3TQIA

Structure of the gmp synthase (guaa) from coxiella burnetii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
519
structure length
464
Chain Sequence
b'IHQHRILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPEAPAFIFEIGCPVLGICYGMQTMAYQLGGKVNEFGHAQLRVLNPAFLFDGIEDQVSPQGEPLLDVWMSHGDIVSELPPGFEATACTDNSPLAAMADFKRRFFGLQFHPEVTHTPQGHRILAHFVIHICQCIPNWTTKHIIEDSIRDIQEKVGKEQVIVGLSGGVDSAVTATLVHKAIGDQLVCVLVDTGLLRLNEVDEVLNVFQKHLGAKVICVDAKDRFMKALKGISDPEEKRKIAGEQFIRVFEEQAKKLNVKWLGQGTIYPDVIESKLIEPLRELFKDEVRKLGLELGLPADLIYRHPFPGPGLAIRILGEVSAEYINILKQADAIFIEELKKSDYYHQVSQAFAVFMPLKSVYGYIIALRAVKQWADLPHEFLSKVSHRIVNEIKEVSRVVYDMTNKPPATIEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP synthase [glutamine-hydrolyzing]
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Ligase
total genus 131
structure length 464
sequence length 519
chains with identical sequence B, C, D
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
A PF00958 GMP_synt_C GMP synthase C terminal domain
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3tqiA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3tqiA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tqiA01
1FYEA 5JZOA 1WXHA 1NSYA 4MUGA 1F7UA 3FIJA 4UZFA 4KTTA 1O97D 3UC5A 4OJMX 5J5AA 1P7YA 5HUJA 4AUEA 1OWLA 1WJGA 4Q16A 1M6VB 1VCNA 4ZCRA 1KP3A 1Q19A 3OT1A 4ARIA 3S3TA 3TQOA 4UOQA 1J1ZA 4ZT6A 4YBRA 2BTEA 1OI4A 4MNTA 2OQ2A 4B5KA 2D54A 2QJFA 1GPWB 4OUDA 1U0BB 4ZDJA 3BL5A 1VBNA 1NUQA 3VU3A 4ZT5A 1VBMA 4DDMA 3R74A 3IOCA 3D6VA 1LI7A 3IVGA 1QVVA 2HMAA 3UK7A 4MQ6A 4F4HA 2CV0A 2GK3A 1OY1A 1OWMA 2ZUWA 4JFAA 4K03A 2A1TR 2WQ6A 2RK4A 4MUNA 3CVVA 1RQGA 1OWNA 2YXNA 4XFJA 1WQ3A 4MAFA 4U63A 5SY9A 3WFZA 3SEZA 3ELBA 3FETA 3IOEA 4AQ7A 4L95C 4XSVA 2DR2A 4K2HA 1XNGA 1OX5A 3P9SA 3SOZA 4OJYA 4FZJA 2ABWA 4RKYA 3P9PA 4MTCA 5TEVA 3COVA 4ZCTA 1HYBA 1O5TA 1MXCA 1G8HA 5IJXA 5IP5A 1J20A 3UJNA 2ZUUA 2B7LA 1QDLB 1O94C 3FWKA 3QTTA 1H3NA 2X0KA 4MVXA 4X0EA 1N2BA 1T0BA 3FSEA 3NVAA 1G59A 2CSXA 2CV1A 1V47A 4I6GA 4WNYA 2VKTA 4ENTA 3SZGA 2IUFA 2DXIA 4L4QA 5KHAA 1U9CA 3IVXA 3Q12A 4YP5A 1BS2A 2YWCA 4L2IA 3NONA 4OGFA 1B6TA 3PQ4A 3EZGA 2C5SA 4DLPA 1KKUA 1WXEA 1PFVA 1N2GA 4P2BA 2EJCA 1KEEB 1I6KA 1M8KA 4ND7A 1T9GR 3H97A 5H16A 5LM3A 3L3BA 4I46A 4BTEA 2ZUFA 3TTWA 3IMLA 1MOPA 3KKLA 4DDHA 4LE5A 4EG5A 3VGJA 1IZZA 3HV0A 2A84A 4DDKA 2JA2A 3IMCA 1KORA 1IQUA 3HMQA 3ZJ4A 4ADSG 4MW6A 4KPUB 3H9BA 4NX2A 1VCMA 3OP1A 2CFOA 4N12A 1N2HA 1JDBC 2YWJA 3GUZA 2QTRA 1K97A 4L2ZA 3SP1A 1IPHA 3A4IA 1JZQA 1T6ZA 2OR3A 5A1IA 3K9WA 1KAMA 2ZUSA 1VLHA 4LGYA 3VU8A 3A2KA 1I1QB 1NP7A 1KH1A 2ZUEA 4JXZA 1NI5A 4EG8A 1PDVA 2RK6A 1NUSA 1MB2A 4MUJA 4JQSA 1GGEA 1GLNA 3KT0A 1CS0B 4U7JA 1O0CA 1KA9H 1G8GA 3L18A 1T3TA 1ULHA 2PG3A 3NV7A 4WXYB 2PIDA 2CYCA 3R76A 4PXYA 3KT8A 1A8HA 1KR2A 3AFHA 3OT1B 2IP1A 3F5DA 1PFYA 4UOZA 3FNRA 3N2YA 4EG4A 2Z09A 4OUDB 2ZUVA 1EJ2A 4MVCA 2QUHA 4MW5A 3RK0A 3B36A 1JIIA 4EF6A 1IHOA 3HZRA 1TYAE 1NYLA 1QTQA 1P7LA 4A91A 3CVUA 1J09A 1P81A 1SY7A 1VCOA 1MXBA 2A4MA 1O9TA 4ZCPA 3KT3A 4ZGGA 4EFKA 3CLUC 1H1TA 3FG9A 1MB9A 1CF9A 2VRNA 4AUNA 2JANA 4MGHA 1XNHA 3NORA 3SZ3A 4L78A 3CLRD 2HZ7A 1J21A 1O94D 3COWA 1CE8B 3PNBA 3ZR4B 1JEDA 5T8TA 1JILA 3TS1A 1FUGA 3RV2A 1O92A 4NDNA 1MAUA 3ND6A 4Q93A 5AHWA 4OFWA 4YP6A 4MW2A 1N2JA 1O0BA 3TTTA 3AKZA 3Q10A 4BWVA 3OTWA 2HGZA 1RG9A 4Y1EA 3RK1A 3TTSA 5HUHA 2QTMA 3CLTC 3U1VA 4H3SA 4GE0A 3FY4A 4RPIA 4WINA 3ZGZA 1IRXA 1EFVB 4L2IB 3X1MA 1P7ZA 1GG9A 2CYBA 1M83A 1GTSA 1WXFA 3PQ6A 4QYXA 4L8WB 1IQRA 3G6KA 1WOYA 2A88A 1N78A 1S1MA 5EKDA 3N7TA 1KH3A 2X1MA 1JZSA 2BYTA 2A1UB 4G5FA 4UNIA 1QWSA 4E5VA 1XRCA 3L92A 3TTUA 4EGAA 4MVWA 4E08A 2XRYA 3ND5A 1S4MA 3SDBA 5K0SA 1V8FA 4JZYA 1XRAA 4J75A 4ZCQA 1N57A 3SF8A 1O90A 4B2YA 3NBKA 4PBTA 4AJ9A 2QJOA 1XRBA 1MAWA 2AB0A 4MWDA 4NZPA 4ODJA 2VDJA 1QM4A 2R1UA 1Q77A 3CLRC 3S82A 2DLCX 2WJZB 1H3FA 1K92A 1KXJA 2E89A 1PDWA 4GE3A 1GGFA 4CDMA 3PNVA 4CT0A 1IFXA 5SYAA 4I4NA 1G8FA 2PZ8A 1WXIA 2PZAA 1OX4A 1EFVA 3UGJA 2JAXA 2D13A 2VPIA 3CLSD 4P5PA 1YIDA 4PY2A 1ILEA 2J09A 4ND6A 4XLLA 1D2RA 1N2IA 2X3FA 1K9VF 1DNPA 1NUPA 2YY5A 3CYFA 3IDFA 3M3PA 5DFAA 3DV2A 3ILVA 2AKEA 3PNYA 3AL0C 2XF2A 2O5RA 4I2NA 4GRIA 3UK2A 2A1UA 1I2DA 3CLUD 4UZEA 1Q2UA 3FOCA 2R1TA 3GLVA 1JHDA 2A9VA 5BNZA 3LOQA 2GOYA 2RD2A 2NV0A 1QVWA 3RHTA 4Y0NA 1WY5A 4F3RA 3KT6A 1LI5A 5KCMA 2CV2A 3H9CA 3FH0A 1LW7A 4S0ZA 3PQ7A 3VRHA 4NATA 2TS1A 3ISJA 2AG6A 3TZLA 4ARCA 4AUMA 3UMMA 2RE8A 1I7QB 3INNA 4HK4A 3HGMA 3SEQA 3SYTA 1XJQA 1QRUA 2AZXA 2D7JA 2Z3VA 3G5AA 4RKWA 3TTXA 4WSOA 2NV2B 4NAHA 3IODA 2A7XA 2VXOA 2PZBA 1R6UA 1T6XA 4ZCSA 3ZJUA 3CLTD 1TYBE 4WS9A 1U3CA 2G36A 2QTNA 4ENUA 1JVNA 3QTBA 1JECA 1ONSA 2FEXA 1N1DA 2GHRA 4JXXA 4ENSA 1EE1A 1EFPA 1R6TA 2Z08A 3E27A 1TEZA 3P9QA 3P0JA 4J76A 3CLSC 1GN8A 3ZXIA 3N8HA 4HPWA 3TZEA 1IQ0A 4DNXA 1QRSA 2O8VA 1O95C 4TS1A 4MVYA 3IOBA 1IVSA 2OBVA 3PRHA 3HL4A 4L8FA 3NBAA 3HFJA 5DEOA 3EFEA 2J5BA 5LFAA 3G59A 3GMIA 3DO8A 4ENRA 4MUHA 3CR8A 3SO4A 4KKVA 4R2LA 5DASA 3H05A 3CNEA 1PG0A 1MJHA 3PQ2A 1X6VA 5A1GA 1YIAA 3LCJA 1IZYA 2ZUTA 3SF8B 4L8YA 3I05A 3ZXSA 1GGHA 3ND7A 1I7SB 1P5FA 4P36A 4HPVA 4MUFA 3CVYA 4BFLA 2QJTA 3TTVA 2V0CA 2V4UA 2E0IA 3P0IA 5F23A 4L7IA 1NUUA 2NZ2A 5KWVA 4ZDIA 2RK3A 1CT9A 3MXTA 4GU5A 1ZUNA 3FIUA 4K0RA 3ZJ5A 1K4KA 3IMGA 1R6XA 3TQIA 3IH5A 4YP7A 3UMVA 3CVXA 1QRTA 2CYAA 5H7XA 1G2IA 3AIIA 1QU3A 4S1OA 5A19A 3ZJTA 5TEWA 4ZT3A 1OX4B 1QNFA 2R1VB 4NDAA 4G6ZA 2YWBA 1FYDA 1H3EA 1L9XA 4OQ4A 2W7TA 3GRAA 2V0GA 3MMXA 1NURA 1UFVA 2ZP1A 3X1KA 3BWEA 3IVCA 5J59A 4EG1A 1O1YA 3L93A 1U7XA 1GTRA 1C3OB 3P0HA 1GPMA 1GZUA 1OBCA 2D5BA 1TFUA 4MW0A 3CA8A 3IUBA 4MWEA 1YUMA 1KAQA 1KP2A 4QRDA 1C30B 4KR9A 5TGTA 5K4AA 5LIRA 3L4EA 4DJAA 1YI8A 5LLTA 1N2OA 5E9AA 1MXAA 2R1TB 3L7NA 1Q11A 3ER6A 3EN0A 3RBAA 3CZAA 3F3MA 1J1UA 3A05A 2DPLA 1M8PA 3DLAA 3N9IA 1KH2A 4PBSA 1KQOA 4XFDA 3FI0A 3K32A 5BV2P 2WB2A 1F4LA 3JXEA 4KR6A 3N05A 1VHQA 2CUZA 1YUNA 3P9RA 4ENQA 4MWCA 1T9GS 1VBKA 2VTBA 1J70A 1N2EA 1OWOA 1QJCA 3FDXA 1KQPA 2GM3A 1SOAA 2LXNA 1P7PA 3EJ6A 3R75A 1T36B 4ZT7A 5SY4A 5DK4A 4P35A 2R5WA 1TQ8A 5H9UA 2A86A 2OV4A 4QBTA 5JBNA 3IUEA 4P34A 1I6LA 1QU2A 1EUQA 1A9XB 2J4DA 1JIKA 5K0TA 4CQNA 1M1ZA 1COZA 2R1VA 5SY6A 2AD5A 1QF7A 4MW4A 4QREA 4AULA 4Y1RA 1U3DA 3CY6A 4EG7A 3COZA 1MRZA 4OGGA 2IELA 1EFPB 3H99A 3P52A 1O95D 4MW1A 4KR7A 2PXHA 1ZJWA 5J58A 4MUKA 1EXDA 1PV2A 3MLBA 5DB4A 1GGKA 4KTVA 3ZUGA 4YMIA 3COYA 1JGTA 1JIJA 2DEUA 1BXRB 3MGKA 3LE8A 1PFUA 1WKBA 1O97C 1TYDE 1N3LA 1R9GA 4ZDKA 5FO0A 4RUKA 1OD6A 3RFFA 1P80A 4D1YA 2EL7A 2WSIA 3C8ZA 4NAUA 1KQNA 3RHSA 1EUYA 1FFYA 1O6BA 4E1AA 4MUIA 1MC1A 2GKSA 4ENPA 3TDEA 1F9AA 1XNJA 1ZH6A 2DETA 2P02A 2J07A 2J08A 2QUIA 5IHXA 1N77A 4AS1A 1GAXA 4R0NA 4B40A 1GGJA 3EWNA 3M5WA 4Y1GA 1SURA 4G5YA 3IMEA 3NOOA 1I6MA 4QYTA 4MULA 1X8XA 4K0BA 2DERA 3NOQA 3PQ8A 1Q7RA 1KWGA 1KWKA 2QUKA 3X1JA 5HG0A 1WQ4A 1F7VA 2WQ7A 4MW9A 1UCFA 1VL2A 3F71A 2CT8A 1O96B 1NUTA 4HJRA 4GUDA 4ENWA 1T6YA 4Y1FA 4R2MA 4U8HA 3KFLA 3MUEA 4EG6A 1N75A 4MWBA 1FY2A 1WL8A 2ISSD 1OX6A 3RJZA 1J42A 4I6EA 1U7DA 4R7GA 4DE5A 3A04A 4ENVA 1PG2A 3NOVA 4ZT2A 3CVWA 1TYCA 2I1LA 4UCFA 3PQ5A 4BIMA 4PBRA 4ZT4A 3PQ3A 1OWPA 4HJXA 2QUJA 3FHJA 5FO1A 1PE0A 5JZMA 1NZJA 2X1LA 3D6UA 3QE4A 4MW7A 3TTYA 1M8JA 1WXGA 3ZJVA 4HCJA 3UY4A 3DPIA 1JEEA 3TNJA 2H2WA 3AG5A 3ZIUA 3B3AA 4L7QA 2E18A 1QVZA 2H29A 4MLPA 4CDNA 1JMVA 3Q4GA 2VTBB 3UOWA 1M8GA 1K4MA 1PFWA 4KPUA 4OIFA 2IJGX 4UZSA 3AG6A 4N0MA 2A1TS 2PFSA 2XRZA 4P2GA 1IH8A 4MUEA 1Y42X 2DUMA 3MIIA 5T8SA 1M8FA 1MBZA 1WZ2A 4B31A 4EG3A 1O96A 2YWDA 1YULA 1O93A 5FNZA 3PXUA 2E21A 5TS2A 4B7AA 4Y1RB 3BHNA 3MLAA 4LRUA 4I6JA 1Q15A 1QQTA 1OBHA 2H2AA 2NSYA 3B38A 3CZ9A 1ZH0A 4JYZA 3D54D
chains in the Genus database with same CATH superfamily
1SMKA 3NHUA 4BVEA 4BV2A 4IDBA 1Y1PA 3HKDA 4MUGA 5EAIA 4N82A 1O97D 4M53A 4A0FA 1P7YA 2ADOA 2A3RA 2AZMA 4FE7A 1VLAA 2CFRA 2O05A 2WAMA 1HE3A 4Q03A 4DFDA 3H83A 4IOMA 2P8JA 4LY3A 1SCIA 3CQ1A 3I5YA 4HQ0A 1DINA 2NT4A 1ZQ1A 2CCKA 1I4EB 3H9GA 5HWSA 3R7NA 3I34X 4PQYA 3BH7A 3KTFA 4F9EA 2E82A 1ZC3A 3N8GA 4J91A 5ENVA 2V7WA 5ICMA 1EDDA 3Q98A 1VBMA 4XYBA 4MINA 2WJYA 1P5RA 2IIQA 5A6SB 5CFMA 3ADBA 3RFVA 1PQYA 2JVKA 3FTEA 1QGYA 2O8EB 1C0PA 2E37A 2CV0A 4ISBA 1TC1A 4J03A 2X77A 1GFWA 3N3BC 2O8CB 2BFAA 2OD7A 4IF4A 5A4JA 3DDHA 3PC7A 5HIIA 3RR2A 2XODA 4B83A 4D3XA 2BHNA 1IAVA 2DR2A 4IOKA 1ETUA 1QFJA 1ZY2A 4H0CA 4A6EA 1Y48E 4DR6C 3F2IA 1G21A 2ABWA 2JHFA 3LQQA 4FZJA 4C6RA 2AKAB 2AJBA 3TO5A 4C4RA 2Q6IA 1S9HA 2BT4A 1QQ5A 1J00A 5DWVA 4IGKA 2GJSA 1UOPA 1QANA 3E3MA 1CQZA 3I64A 1V47A 2QS9A 1P4EA 5FQNA 5TIIA 5F2EA 1C9KA 4LVUA 3TMYA 5JAZA 1VLLA 2F55A 2Q6LA 1YA8A 5DSZA 3EODA 4GI7A 5EC8A 1KDRA 1Y5MA 1JKFA 2VUIB 5AR1A 4AF6A 1DXQA 2B7BA 3GFSA 1KPHA 1SVIA 2C5SA 3O2NA 3EVAA 3OA0A 2W42A 4F1KA 4O4IF 3SNHA 5A6SA 2NAFA 4GPAA 5CRIA 1KEEB 3H11B 1M8KA 3DZKA 5FTKA 4YRCA 2O8EA 1QPGA 3LC7O 4ZRDA 5AMXA 3GJQA 1XT6A 4DJEC 5F76A 4UQLA 1JI0A 1MQSA 3KR2A 1A8IA 3B48A 3Q5GA 3COJA 3H9BA 1VCMA 4LVNA 1OZ0A 5E2IA 3ZH2A 4I4CA 1M2HA 4KN8A 1S2OA 5DNVA 3V2GA 2VIIA 1P2UA 3K09A 3UW3A 3OFKA 2XYHA 1DZIA 1N6RA 2P7IA 4HDKB 4W1QA 5A1IA 2DJIA 4XGNA 1VHWA 1ZQ9A 3DCIA 4IIUA 2ZRHA 1PRYA 5CPBA 4UTRA 4XFKA 3QIVA 2IXGA 3GZ4A 4UVGA 3RT1A 2YW2A 1PDVA 3DXXA 1TQDA 3WL6A 1ZRMA 4LS3A 4C5AA 4DMKA 3R2JA 4MUJA 5EJ2A 2FSGA 4URUR 3T1TA 5DN9A 2WWXA 2ATWA 1ZJ6A 3FBTA 4E32A 1AM4D 4GVPA 3TNDA 5FUMA 1H9BA 1ISGA 2FPLA 2H0AA 4V1CI 2JCSA 3QX9A 2VJLA 1RRGA 3RRJA 2QTWB 3K5HA 3PPXA 4L07A 3S2IA 1EVYA 1P5ZB 5I5EA 1YCDA 3PXXA 3ZNNA 1JFRA 4KSBA 1ZDMA 5C37A 3RG2A 5JNTA 2R6R1 3I9V1 4C0AC 4DBVO 3AF3A 2ZBFA 3BJZA 4HMOA 4PR3A 1KEEA 1ICIA 1NOKA 4ZIRA 1FFCA 1ARZA 4EF6A 1O3YA 2F1KA 3IOMA 4NESA 3ND8A 4U2GA 1HMYA 5JDIA 5DVZA 4GMFA 1QTQA 1FBTA 3E58A 4GRDA 4RIGA 3CVUA 1VCOA 1QCZA 4ZOCA 1HT1E 3G2JA 1DJMA 5IYZA 3KT3A 1O9BA 2IYZA 3QPUA 4GWKA 3C6ZA 3B2EA 3EFOB 3H17A 3LO5A 4IQ0A 1JTFA 1C9NA 2X8JB 3OLVA 3Q7SA 5AW9A 1P77A 5A4MS 5ITVA 5FI1B 3WTBA 3IDZA 3T1VA 5GY7A 4P53A 1TDJA 3B78A 4DA0A 3L1VA 2B3TA 2HAEA 4I3FA 1O94D 2PUJA 1A50B 1ZNYA 3X1WA 5KOHB 2OFWA 1JWBB 5ICGA 2R97A 3E48A 1A97A 4IGFA 4X92A 4BMXA 2WYIA 2PRZA 4JVNA 4PHFA 3M7IA 3B3GA 4M36A 5EKSA 2VRWA 4JODA 4MW2A 4RK4A 3WY9A 4B48A 2IUSA 1YOVB 2FDRA 3NCHA 5DM1A 4DJJA 2GBCA 3OUUA 1GR0A 1U2EA 1L8XA 1UBRS 1SZJG 3OZWA 2C7BA 2OE2A 3O4HA 5HUHA 5LL6P 2AK3A 3T8YA 4H3SA 5K3FB 3PHIA 1Q7TA 2JH9A 1KKMA 1SHLA 2CYBA 1EP9A 1XC7A 4Q3NA 4LF9C 4R1PA 5ALOA 4BV9A 1QIJA 3IE0A 1XHEA 1WXFA 1AKUA 2IIPA 4MYCA 5K3FA 3B7PA 1HDZA 4NNOA 3H5AA 5ALKA 1EEXB 2VWHA 5K6RA 1U8FO 1UJNA 2GNAA 4ZQBA 4D46A 4GMDA 4DV7C 3UAXA 3EIEA 4A4DA 3VPDA 5LU9A 4A8HA 1ATIA 1KH3A 2BFFA 3EFOA 2PA0A 3FNGA 5BW8A 3BF8A 4CIBA 1U5AA 5T7BA 4KFTA 4DNOA 2JG3A 1JDPA 3V48A 3QWIA 4BQEA 2QW0X 2MR6A 1CY7A 2PZEA 1JPNA 4CTOA 1BA3A 5I01A 5K0SA 4J75A 1LSSA 4P3YA 4PGAA 3SF8A 5F52A 4CM8B 2JFNA 2IV7A 1T0IA 2XNCA 1AGRA 3TW6A 1XDDA 3LVBA 2VDJA 2VDWB 3WGMA 3L8YA 4K40A 1T2VA 4X54A 5DYIA 3DBLB 3E0XA 5ALXA 1MX3A 1WDWB 3UMGA 2WU4A 5JIBA 2JHGA 3A4MA 4M8LA 1RP1A 4F4IA 3VZDA 4CIXA 3QHPA 3GLGA 2QW1A 4QXRA 2C3UA 1X9GA 4UDXX 3L04A 4DRXA 4OXIA 3KTDA 3WJ7A 3DBHA 3FOAA 3FUXA 1V60A 4P93A 2AX4A 1TZJA 4HH4A 2ZJBA 3ZV4A 4LBWA 3GGDA 4OUKX 5AJYA 1UINA 3B1XA 1EH5A 4ARUA 5CX4A 5ED4A 3AVTA 1BJTA 1P7WA 1Z28A 3NG1A 4URZR 1BKSB 1TTHA 2C4MA 3HP7A 3KXPA 3O3MB 3S1AB 4BL5A 4HX5A 4J0FA 2YVUA 5B58C 4S05A 2D5CA 1N2ZA 5B1HA 1G6HA 1SVLA 4LF8B 1K9VF 1YB2A 4IFIA 2QY9A 3E1KA 4QUDA 1PKXA 4I14A 4YJ2A 4QXMA 3U39A 2XF2A 4H7HA 1VA4A 1C30A 3WNZA 3AM3A 4A03A 3ZDBA 1FZTA 2FRDC 4Y2UA 3U3KA 1Q2XA 1LWOA 3M6AA 1LLQA 2IXFA 2V1XA 4UZEA 5INTA 5KTPA 1TIKA 3U17A 2I33A 1SXJC 5AO9A 4B34A 1NQVA 3ZBUA 1EQAA 2B30A 2I4RA 3W1WA 3RVMA 1TF5A 3EOZA 3KHTA 1GT6A 1HURA 5KCMA 3VAYA 3UK6A 2QP4A 4CM8A 4WJLA 1SQSA 2X7JA 5G4KB 1E63A 2IL1A 2VDWA 2V98A 3IP3A 4ZYZA 4TWAA 8ADHA 2QYTA 3K8YA 3KFVA 5JAPA 2JZOA 4RKWA 5EJGA 1JE0A 3P94A 3WIEA 3RYIA 4X7BA 1U8UA 3JRNA 2PO5A 1FP6A 1NAHA 3I73A 3K0EA 3QVMA 4I9NA 1T1EA 3WV4A 1ZCJA 3ROPA 4ER0A 1FJGC 2QTNA 3T06B 3DAGA 1JVNA 3A25A 1OHHD 4W7HA 1IN4A 4LDQA 3RC9A 2PRJA 1JLLB 5DTMA 1DDGA 4UXHA 2O9JA 4Z7QB 2FW8A 1BFKA 5CYFA 3PEEA 2ZIEA 1RPZA 3OZEA 3EEIA 1QH8B 2ZGVA 2H07A 5ENDA 5ICCA 3PXGA 4MQEB 4D3SA 2ZFUA 3U3JA 2OT3B 4R83A 3UMBA 1WBJB 4KVGA 4M8KA 4UUBA 2DTDA 1C2YA 1DQZA 1G3RA 1O95C 2PLRA 3BAZA 4FQ7A 4LVCA 4YA6A 5IUKC 5FA6A 4DCNA 4CMIB 4BB9A 1HK7A 2C4NA 4DWWA 4RVOA 1LTQA 3FBWA 4LXTA 1B1AA 2ZT6A 3GJ5A 4QOFA 1Q0PA 1VSUA 4X65B 4DM3A 3TLXA 2UZ4A 3U26A 1TLFA 4RA6B 1HFEL 3BH0A 2OOSA 1Z5UA 4LN1A 2EC5A 2ZUTA 5LZ2A 4GM1A 4LMRA 2WKPA 3VQTA 1N4AA 4P5EA 3CIOA 4HPVA 2QV7A 2Y0EA 2VR1A 1QC5A 1PZHA 3HB9A 3UG6A 1VIAA 2V0CA 5E4TA 2VTKA 2J48A 3CG0A 3OF3A 4L4UA 2E0IA 4MRMA 5EWJA 3SFZA 2ZUDA 4HNVA 5CFZA 5F23A 1RRMA 1JEYA 1NJ6A 2V65A 2I6FA 3QWBA 3DONA 3UMVA 1JLLA 1WPXA 4Q15A 3HNOA 1W2HA 4M1SA 4F5WA 5A19A 3MT7A 4JOSA 3EGWA 3V4FA 3RC2A 4ZVLA 2IOQA 3W3AD 3H4MA 2JGJA 2I3GA 4DLRA 1DPGA 1QHHA 2DFVA 3ICPA 2LD4A 1G1AA 4CDGA 3H0EA 5EWLB 1UOEA 4XA8A 3LQ4A 3EX7C 1GITA 4JI4C 4F1JA 2GEDA 3KQLA 4QVIA 5CZVA 3A1DA 3UT6A 4FCTA 3RPEA 4JK3A 4CFYA 1G98A 1LF0A 4D3YA 2R00A 3K6SA 3CA8A 1E77A 4FP9A 1CHNA 2VJQA 5EJIA 1RYDA 2HQBA 5BN3B 1KJNA 5JFOA 5F2NA 2IKSA 2I4MA 4ZI3A 4PN3A 2FEWB 1QG4A 1QX4A 1OXXK 2Z2KA 4Q3KA 3LC1O 1BKDR 3QE0A 3TB4A 3LNVA 1KMCA 4JI7B 2EHJA 4XCXA 4B3IA 4TYWA 4U2CA 3HXMA 3DCNA 1R50A 5BSFA 1QGZA 3R0VA 4PF1A 5FOSA 3GY0A 5LYYA 1ML4A 3Q9LA 5B5SA 4U7FA 3AUAA 5HZGA 1YTUA 3E9ZA 3L6RA 1ZGGA 4DUGA 1C4WA 3HJNA 3T7CA 4QG7A 5DW0A 2A9RA 2IYVA 4BNHA 1L4GA 1TQ8A 5BQPA 1JYEA 4C3UA 1P3JA 1P4AA 5HHTA 1Z12A 4IX9A 4UAUA 2J4DA 3ZG6A 2W2NA 3PGXA 1OLOA 1H5NA 2QM7A 1P5JA 1MOSA 2XD4A 3Q6IA 3ZW9A 5MHTA 1U0GA 4QWWA 5JROA 2FHPA 2BZ0A 3NVDA 2GEUA 5D87A 2ZBUA 3ORSA 1P6UA 2VJBA 4KXWA 2QPTA 2FK7A 2A33A 3BXOA 4PFJA 1S01A 3ZUGA 3H1GA 2GM5A 3CEPB 3HUUA 1CUCA 2C61A 2HU7A 2Z9CA 1K7SN 3V42A 3GK3A 3WYNA 5DN6D 4DV0B 5JTUA 3FDFA 1HETA 1RQRA 2Q9AA 1XDWA 1T2EA 3C5HA 4AMBA 3AIOA 5CLJA 1SIBE 2WIDA 4YMGA 4RTJA 4HVCA 3X1ZA 1P80A 1RAAA 4PCLA 5JH7B 2W93A 1AS2A 2OAP1 1H9AA 2YY6A 1AKVA 1WUKS 1V0JA 3PWSA 1HT0A 2FMIA 3X2FA 3VNUA 2ZAMA 3VPXA 4H1WA 2BEUA 2IXDA 3DTVB 3OAAA 3PKJA 1QO7A 2CJPA 4ETWA 2BI7A 2FFRA 3LFHA 2G0NA 1A8UA 3JSXA 4G5YA 1UUFA 1RVV1 2HF2A 3NOOA 1Q20A 1JG7A 4K0BA 1QGUA 5BR7A 2ZJFA 3OOJA 2EKLA 1P2DA 2YQ4A 4NYMR 3HKCB 4OYYA 2C99A 3M6FA 4UD2A 2ASEA 2O3UA 3EXFB 1HLGA 3DZHA 1O96B 4ND8A 3WYGA 4D4HA 2X9LA 5HRUA 4KPYA 3DO5A 1CYEA 2XNKA 2CSUA 3CUEF 4MR9B 2WHEA 1QQBA 2VNIA 3ED5A 1LA2A 3PNOA 4WZBE 1WHSA 3HPQA 3ZDEA 4E7PA 2EBHX 3HJAA 1OA1A 4RV4A 2R7NA 5LPNA 4BAUA 5E1OA 3QEKA 4MQ4A 3HXKA 3UZUA 3ZHUA 1ODFA 3P71T 3G49A 3NTXA 1E64A 4GPD1 5FO1A 2QUJA 2WYUA 2FSHA 9MHTA 4MKIA 3OQVA 1KAHA 2HK9A 5FJJA 5JH7A 1TCUA 1CB7A 5J5CA 2VZLA 4GWLA 5K2OA 2F9LA 2G83A 1G4UR 1UEJA 2ZIZA 2FWAA 4NEQA 3VM6A 1L7XA 3DPIA 3DTVA 2I2BA 4CEIB 3WSWA 1NXOA 2Q2WA 1RZUA 1L5KA 2Y1KA 3HUDA 4JI6C 1HRKA 2E85A 5KWIA 5K20A 3OQMA 1SBYA 1EVKA 2HMVA 2VTBB 1DAEA 3S2EA 3WIOA 2MSEB 4YYZA 2OO5C 1VJ1A 3K8ZA 3AHHA 4GLJA 2QWXA 1HDOA 2XRZA 1NI4A 2JFZA 3BQ9A 3UMYA 2B78A 3OTGA 3TBKA 4PYRA 2DQSA 1NC1A 3RU2A 4EG3A 1HYGA 1O96A 2FZWA 2P68A 3L7DA 3CF4A 2RHWA 2VDNB 3BCRA 4TKUA 1T1GA 2WFAA 5ECGC 1PGPA 2EDAA 1DADA 3PU6A 5FV4A 5GTDA 4LTDA 2FFHA 2MOKA 4KAAA 5AXBA 5LUBA 2FGKA 4HLUA 3RV3A 1W76A 3PFNA 1NVXQ 3WI7A 4DLNA 4EB0A 2D1FA 3H5WA 7GPBA 4LMAA 4MIYA 3PFCA 2R6GA 1HR0B 1GGVA 3N2ZB 2VDUE 5MF6A 1Z06A 5E38A 5G1NA 3U3MA 3R5KA 3OZUA 5AVYA 4FR5A 3RO7A 3CU5A 4ZC8A 2ZPTX 1KP3A 1P7VA 1WWKA 4F9GA 1VJGA 1DEHA 4J4TA 4U0JA 3U7QA 3G5MA 1OAKA 5A5DA 3TQOA 4BNIA 4NF2A 2VOJA 1FBNA 1YKGA 2OQ2A 4DRYA 2D54A 5P21A 1RLMA 2Q6OA 4LNUB 4EGFA 5CLQA 2R2GA 4DEXA 3D7LA 1M66A 4WEQA 1BAPA 4ZQFA 1RYFA 3VU3A 3UQYS 1VSQA 4C7JA 3HFRA 3C5EA 1J2RA 5HF5A 4ARZB 2XZTA 4G63A 3QE9Y 1Y3IA 3FKSD 1Y9DA 3UK7A 4YDSA 2NVUA 4EGCB 4URHA 2JGDA 1UODA 2PK3A 5BN5B 5BWOA 5CA0F 3Q6NA 4LRQA 3E2MA 1JDTA 1H2FA 1P9OA 2HCRA 4U63A 3WFZA 1NX9A 1J90A 1RYHA 4DV4B 4L95C 3FETA 4AQ7A 2G5PA 2XXAB 1F1JA 3AONB 3TCKA 4TWRA 3NHPA 3D8RA 4ZAFA 1FU7A 3FR7A 3OCWA 1CE8A 2OAGA 3G2PA 1Q6YA 2JFOA 2PMWB 2Q45A 4HFRA 3SJAA 2XNJA 1S0UA 1G8JA 3A2LA 1HYBA 3RV4A 1MXCA 3W4IA 2YHAA 3K30A 3VBEA 3VR2D 1KBOA 2ZUUA 4OTZA 1PEYA 2Y6VA 5FR1A 3FYUA 3C3KA 1LPNA 3OPYA 4V39A 4MVXA 4DR7C 4FN5A 1PS0A 1RRVA 4F04A 1U3UA 4WW0A 3SS9X 3OX4A 4RHYA 1PJRA 4CZ2A 3ZWNA 1UT5A 4Z9AA 3QNWA 2XYQA 1RC0A 3GBSA 2IUFA 4D42A 4WLNA 5HKAA 4COKA 1U2GA 4JKIA 2BHSA 1GSAA 4XM2A 1KSHA 1X80B 4IHJB 4PZUA 4JI1C 3RVPA 3D0QA 4D97A 1YUBA 1TU0A 3ORHA 5KZMB 1KKUA 4JYAB 5KNCH 1TD1A 4G01B 1W8IA 3V1MA 1NBOA 2DPXA 2ERYA 1JSCA 1OYWA 2QTGA 2X7HA 1OV4A 2YHBA 3H97A 1KDOA 1R0ZA 1HTBA 2QG9A 2V58A 3MRSA 3VJKA 5IM4A 2BFPA 5JVDB 3F5FA 2FFJA 3G23A 4XE5A 3HV0A 2XZPA 3UFBA 3C3CA 3B9PA 5ARDA 4P0PB 1R37A 1SCAA 4G1VA 4PGHA 5DP2A 5HOQA 1ZJ4A 2ZYAA 4JJKA 4P7BA 3RSOA 3WAKA 4A16A 2X4GA 4EO7A 1INLA 1RBMA 1HDRA 3LVFO 3VYRB 1ECJA 1BXGA 1KAOA 1HNZC 1HLPA 1W5EA 3NNNA 4QEZA 3LUAA 3LHIA 4WOKA 3U7EB 4B7UA 1J39A 2DU8A 2WJ4A 1H2WA 3GVCA 2P6NA 3JQ8A 3O7MA 2RGNC 3R77A 4H0NA 3RQIA 2VK4A 4EFMA 5J47A 3TG2A 3R5TA 2ZUEA 5IAKA 4E5DA 4ZCIA 1ZITA 3EQ2A 1UM9A 1Y3AA 2ZEJA 2X0RA 3OU7A 4YO7A 5E4JA 5J2TF 1LBHA 4MDEA 2GEKA 3O8NA 1I4OA 2RAUA 1FS5A 2OO4A 1E9EA 3B1YA 4OHOA 4R69A 4Q9AA 4V0LA 3PD1A 1V1MB 1XOIA 1E2NA 2PZLA 2PNJA 4EI7A 4CMGA 2JKVA 3G79A 2JFVA 2O6LA 3LUKA 4FHCA 2WDZA 5JHHB 3PCXA 3I9LA 1XZBA 2B20A 1C9YA 5EP4A 5T4BA 1Z2CA 2BZ1A 2HYDA 3LY7A 4GI1A 2E6KA 4I4TB 2Y0BA 4RELA 1KDZA 3SHWA 1E9BA 1F51E 1ESCA 1XL1A 1DXOA 3EBLA 1JQ3A 2H6EA 1TUBB 2G06A 2QX6A 3HCBA 3HJGA 1WNTA 2XT0A 3GEBA 1RLUA 3PUHA 3OFSA 1EGAA 5JQGF 2RAPA 4UQPA 3IESA 2AXPA 2ZJOA 2WP0A 4QXQA 2FSVA 1ZJZA 4HLNA 4ZHQF 5JCXA 1THTA 5FUWA 1P1KA 4QU0A 4AXBA 4E5NA 1H6AA 2PGIA 1DC5A 1U9JA 2QD5A 3C7TA 4JUDX 1VJDA 1RIIA 5IULC 3KCNA 1T6BY 1E66A 1KZ6A 1U0HC 5AK3A 2IHUA 4HGPA 3OWHA 2ZTVA 3F96A 4PHCA 4KHZA 1UPTA 4QBKA 1G16A 5AHKA 5DHRA 1AN0A 4OHVA 3NS7A 3SZ3A 1C4XA 2GD0A 2DWPA 1H4VB 3CLRD 3NAGA 4A0HA 4DV3B 1BVHA 2Q8QA 4TN1A 1QG0A 3THWB 4BO6A 2B83A 2CVQA 3I2GA 3MOGA 4MYSA 4DYVA 1C9JA 2Q5EA 2BH1X 2R6ZA 4YMWA 4DIEA 2JHAA 2WWRA 2DYKA 3BJRA 4G4SO 2F43B 1URPA 2IGTA 2VF8A 2WVHA 1N2JA 2UUOA 3EXHB 2HHCA 5ERGB 1X9HA 3I07A 5P8WA 4JQCA 1Z25A 5AQ1A 1PG5A 2CUTA 2QQEA 1Z4KA 2BGKA 5GMOA 2BR3A 2EX1A 4WINA 3B2QA 1JMYA 2F59A 1Z0ZA 5FNVB 1JALA 2II6A 4I4TA 1TZCA 2YJ3A 4Y2GA 3QENA 5HFJA 3ZGLA 1DAKA 4RTSA 2R7MA 1PJ4A 3LNOA 5KYUA 2GBPA 2O07A 4F11A 2OSVA 4FIDA 2C29D 4WNIA 5CBPB 2DOKA 4DANA 1XNQC 2PBRA 4Q01A 3J81k 2JAHA 1Q0UA 3HBMA 2HIMA 1UBEA 4XYMA 3ELUA 5I9BA 4WD3A 2D28C 2J46A 1K66A 2OWDA 3CEMA 2F8SA 4H08A 2C7RA 2Y1FA 3AVUA 5JJCA 4FYYA 2FA9A 5EHZA 2ETXA 4L5IA 4ROTA 3O8CA 1H22A 2O8BA 3OMXA 1F8GA 4XWTA 2B9EA 4MVJD 4B73A 4NJEB 1L5HA 1KOJA 4E08A 4EG0A 4R2KA 1WB5A 2C2YA 1ECGA 3KBBA 2PXCA 3LLCA 1M2GA 1SK8A 3C97A 3P8ZA 3ANNA 4RACA 2OKGA 3QUBA 2PJZA 3UT5B 5L95A 1MB4A 5DIZA 1CCWA 3EZFA 2W2MA 4LFBC 1Q1EA 2P9JA 1CJCA 3FSJX 4NBNA 3HYRA 5G3ZA 2P2YA 4JC8A 4B6FA 5JXHA 3GAMA 2X41A 2P9TA 5KHOC 4DWVA 1PGOA 1FTGA 2YFKA 3QBJA 4DR4B 2ICAA 2HJSA 3L82B 1GCUA 1JQKA 2G70A 4MB2A 2GO7A 4J3NA 2I91A 1A4XA 1FJ2A 1A4IA 4PYIA 3CJQA 3QE3A 4I4NA 3ZWAA 3D64A 3OY7A 4F45A 4TQAA 1V45E 2P2BA 3IQWA 5IS2A 4EOGA 4BY9E 1NASA 4GEGA 3LP8A 1O94A 2GUWA 2ZQZA 1RJ9B 5IASA 2PVSA 1RPJA 3SQOA 1ILEA 2VHJA 4UEJA 4KC0A 4RH3A 5I4BA 3AF4A 1WSWA 2ZWAA 1DNPA 2BONA 3RLFA 4G5GA 4IIGA 1J9EA 1RTTA 3I9V6 2V9PA 1PEAA 3EAFA 2IQIA 1SOMA 2AF4C 1KDTA 3ZU2A 3ZE6A 4G81A 4DCPA 1XQ6A 2AWOA 2PYIA 3QHQA 5G4LA 1Q0QA 1LLCA 3LI2A 4F46A 2RD2A 1DCKA 2NV0A 2OK7A 1WCIA 2DGDA 3IA2A 4HAZA 1U6IA 2NYRA 3UUFA 1G0OA 2BL4A 4NMMA 2K6GA 4MLDA 3BCHA 5REQB 1P4RA 3OICA 4PO9A 1TM3E 4HAIA 2TS1A 3DOFA 4NL4H 5F3DA 3WB1A 2CLKB 4QA9A 4D0SA 1I7QB 2V7TA 4PVDA 1R5OA 5AJUA 3OX1A 1OFVA 3BICA 2OXEA 4DV2B 4NAHA 4CMKA 4C6HA 3GEMA 3OURA 2DHQA 2J0SA 1L5WA 2N3ZA 2QLFA 3D4OA 2NCLA 5AESA 2JAPA 4OQQA 4G1UC 1L8LA 4XYGA 4EB8A 2PQ2A 3B13B 4RMJA 1JG1A 3JQAB 1PX2A 2DTXA 3EPRA 3BGDA 1TVEA 4K3UA 1R0LA 1KU6A 1YQ9A 4ZXFA 1IOWA 4L27A 1LDEA 2NXEA 1IUKA 4JVOA 3VV2A 3L9XA 2QRVA 3M6MD 4PPYA 4BKPA 3THXA 1XO1A 4BNMA 5CT6A 4AZSA 1CC1S 3PF9A 3GL9A 2O19A 2VJYA 5K2MA 4TTAA 5EJ4A 4QHYA 1QONA 2OPLB 4PG8A 3BD7A 4L02A 2XUKA 5EJ9A 1ZXLA 3BIFA 1PSDA 3QMMA 2CHGA 1MA3A 3BN3A 3D81A 4G89A 5NLLA 3HL4A 4QRIA 4XWAA 3U48A 3DTTA 5IH7A 2NUTB 4G1MB 2CXTA 2Z58A 1SC9A 4FKZA 2JZCA 4QIHA 2QUAA 3GHHA 3ROKA 1V8DA 4UM9B 5HOEA 2WKQA 1QFXA 3OEYA 3B8EA 3H5TA 2IDJA 3MOIA 4YMSA 5EQJB 2DBVO 3W6UA 4ABYA 3ND7A 2Q07A 5H3HA 4QUGA 3CVYA 1O03A 3VR4H 4E5SA 1ABBA 5JNSA 3EXAA 4M1OA 5CEFA 3GP8A 2EX0A 1U99A 4FSHA 1KY3A 1H4TA 3C2QA 4H7KA 4XX0B 3D4BA 3T4XA 1D0VA 1M33A 3RRZA 2YS6A 2WHPB 3DLHA 2DECA 3FGOA 2W2LD 2QZZA 2W37A 3IMGA 3LDUA 4LRYA 4K6OA 3O2SB 4XUGB 5C46F 2GLUA 5C7YA 5HYVA 1QNFA 4F06A 4XIFA 5BWNA 3SQXA 4NH0A 4E6EA 2HLHA 3P1JA 3MJDA 3KR0A 4RVGA 4YCBA 3BWEA 5G40A 5J2UB 3WRVA 3X1KA 2ODPA 5J59A 1QIHA 4CWAA 1C3VA 1LK7A 5BUQA 4G5SA 1EE9A 1VCHA 2BEVA 3HZOA 1X42A 1PUIA 3MJRA 5LQAA 1EI9A 1N3YA 2BFDA 1OHHA 3T3HA 2IUUA 4DMCA 5M34A 2ZI7A 4I8IA 1CUWA 2R6FA 2NUTA 3ECCA 1B8NA 1X7WB 4X1KA 3UPUA 1Z7EA 4PR0A 4UBMA 1YMUA 1SKBA 4JCOA 3ZHCA 3G8DA 2D0PB 3GJ7A 5DM4A 2CLDX 2NPFA 3MJ4A 2V6FA 2H18A 2VUSA 3DD5A 4UMFA 4B5LA 1J8VA 4ZHSA 5C8YF 5L45A 1HTTA 3GG9A 4ONEA 5FORA 1V7ZA 2CJWB 3NJ8A 4BGEA 1T9GS 4Q9DA 2R84A 4HX9A 1WLSA 1AMOA 1MO5A 2WHPA 4WXHA 4YP1A 3PGLA 5EZYF 3ZV6A 2XB8A 1SC4A 1GCGA 4QBTA 7REQB 2H5IA 1FS6A 1NY8A 4FUQA 3KKMA 4TXMA 4I1YA 2P2JA 4EJSC 2CL0X 2AOTA 2PR7A 4J0EA 5DHTA 3A9RA 3VR1A 1NDHA 1JPVA 2ZTUA 3A4YA 3HJHA 3LLUA 3RYCA 1YS6A 3CY6A 1ST3A 2YIDA 3Q9NA 4OHCA 3KSBC 4MVJG 2JFPA 4HF7A 4NZNA 3ROMA 1AIPA 2C58A 3HO8A 1T1IA 5AW3A 1DIHA 3HR8A 3WLTA 1MIOB 1KK3A 5JR3A 3RKRA 2GRJA 5CCDA 3X3HA 5CT5A 3S1SA 3MLBA 3HJCA 1YOBA 2HBYA 3FVWA 2CDAA 5EEGA 3UOGA 2EP8A 4L16A 3H2KA 4DV1B 1BXRB 1G7RA 4Y2JA 2OWEA 2GXAA 3ZZ1A 5JW6A 1N3LA 1GQ2A 4JEUA 1W5BA 3W3AA 1ONOA 1YS9A 4DLAA 1SKAA 2BPOA 2GDJA 4NQRA 5TF4A 3DEKA 3BD8A 1JPJA 1JT9A 1P0FA 3GNSA 3OQHA 4LF6B 2HADA 1DKLA 1PN3A 4KB5A 1QUEA 2Z2ZA 5EG5A 3RHSA 5I3CA 3VA7A 1XZMA 1DS6A 2CJWA 1FK8A 2N0SA 4RIFA 1DEAA 5EPEA 3PGKA 1F9AA 2FWIA 3SLRA 4BNVA 4C0QC 4NEGA 2I22A 3MWKA 2VCHA 3R7LA 4MJLA 1WDLA 1M7GA 3HUTA 2W4QA 4R0NA 1ISHA 3G2QA 2UXDB 3WXBA 1KYIA 3AKYA 1OT3A 2RHLA 3E2IA 2TSYB 2P91A 4KXXA 1Q95A 2I03A 2WWGA 4MKGA 3UUEA 4RFVA 1SO8A 2WHXA 3PC6A 1PJAA 4HNGA 5KYGA 2W43A 1LUAA 2HNKA 2W4MA 5FLEX 1XHLA 3UB4A 3U56A 4O2AB 1DKQA 4B71A 2TMGA 3LCCA 1TIPA 4YALA 4EUEA 2HCTA 4U7WA 3KD3A 4W63A 4NCXA 2HMUA 1NF3A 1D1QA 2DT5A 1UJMA 2IRWA 1WV0A 3ETLA 3PXEA 2RHBA 3MNFA 3OPXA 1KZ9A 1R1DA 4WK4B 3BMXA 4G09A 4ZDWA 3WHLA 4KG7A 4F2WA 1J42A 1AK2A 3KAKA 5CVJA 5AYVA 1OGYA 3VI4B 5JAOA 1WCV1 2IEAA 4RZHA 3CVWA 3EGVA 4OFBA 2YFQA 2YKGA 1HL7A 4MUXA 2NO9A 1N6NA 2O54A 4KIJA 2NU7A 4BLQA 1XTBA 1PR3A 3KHSA 2WBLC 1U02A 3CUWA 3U4IA 4Q3LA 1QS0B 4AS2A 4MQBA 1F14A 2SNIE 4UEKA 4Q9HA 3NC4A 2ZR0A 4QNRA 3T7KA 2GN0A 3NATA 1DAFA 2GFIA 1FIUA 3V00A 5JUWA 1Z5VA 1Z13A 2FU5C 4CFSA 5GIOE 1NR7A 4HCJA 5IUJC 1RTKA 2K87A 4WL0A 2GZRA 4PNHA 2PUEA 2EKBA 3GHYA 1W49A 3IQIX 5GAJA 4NS4A 1DEXA 1IXRC 1OQAA 2VSQA 5DN6A 1W9MA 1MA0A 1XP5A 2POQX 3RIHA 2Z5VA 1U3WA 2I62A 2E1PA 3WIDA 4G36A 2YTZA 3IIEA 4YRNA 5CM9C 3UJPA 2C7PA 2IEIA 2OORC 3OTQA 3CNNA 5T8SA 4Q3BA 4W8GA 3ZH9B 3SYRA 4X8MA 1UBGA 2UVQA 4FONA 2UU9C 1DDOA 3OSUA 4KNWA 5E9WA 5I9IA 4QJBA 2DSNA 4OYLA 2F00A 4P83A 5E6UA 5LC1A 5CA1B 3HRIA 5IWAB 4U9IS 1E0DA 5EUBA 5G0VA 2H11A 4KDFA 3PGMA 4RQBA 5JZSA 4BU0A 2YFHA 2V6IA 3I6IA 3NWEA 4OQEA 1TJ5A 3MYRA 2B21A 4MKHA 4JLBA 3ONFA 1MLDA 1XTIA 2OHXA 3GGJA 3GX1A 4GOND 1LBTA 4JQYA 4C4SA 2VK2A 2C88A 1M2WA 1UMCA 4LUCA 3IB6A 5BYBA 2GLTA 3T5GA 4LGMA 4CN9A 1NU8A 3MTDA 3U16A 1XXHA 5I9MA 1ZL0A 5FTJA 3SQMA 1IN1A 3TZ6A 1RI3A 3EVNA 1UBJS 3ACCA 3QFCA 3A4VA 5MGBA 1UKYA 3IOCA 2F48A 5I7EA 3QVXA 2PD3A 3MQ4A 1V9SA 3T38A 3N2EA 2EBWA 4JC5A 3SJ7A 2PT9A 5A2QD 3WSTA 3UN1A 1GU7A 2RK4A 3PWKA 1U7PA 2IHZA 3IXMA 1Z17A 4HDSA 4JC0A 3WGLA 3ELWA 3W77A 1VIDA 3JR7A 2FRVA 2C7GA 1W9HA 3AJEA 5JPCA 4KLCA 1IDN1 4PX2A 1XVUA 3QU7A 3D8HA 4IP0A 3KPUA 2C7OA 2P1DA 1RYZA 1JJFA 1TUGA 2K7ZA 3BEOA 3ER9A 4CEHA 5BVGA 3DOUA 2JLAA 1U63A 4L50A 4Z4QA 2PUCA 2F4VB 1Y5IA 2PZGA 3M5DA 2ECFA 1S3IA 3PITA 4X1YA 1YDEA 4MV5A 4TSFD 3NYWA 3PFKA 4UOEA 3KLBA 4AM8A 2EAUA 2O1EA 2QMUA 4FFVA 4KVZA 4ASUD 4AX4A 4KMRA 4S35A 3NHWA 1T0BA 3CNQS 4NIMA 5FUBA 1SA0B 4KJZA 2MJLA 3B6IA 3IOYA 5TSDA 4D41A 3P9CA 3L8HA 4HYYA 2XADA 4RD1A 2WZBA 2ZE7A 3V9PA 1QO0D 3JYNA 3J7AC 1CVRA 2YWCA 1XEAA 5ALLA 2OM2A 3F9CA 1F2UB 5DBFA 3C43A 2Z1MA 3D7RA 2P3SA 4QUEA 4B74A 1SBHA 4RQTA 4WBSA 4ZI5A 4B33A 2QAJA 5E0OA 1AGNA 1JLRA 4NMLA 1Z3IX 4JNCA 2FP4B 4R9RA 5KVAA 2GVDC 3KKLA 3QKIA 4NV1A 5C7LO 1G8SA 3CBQA 3IMCA 4MYDA 2QTVB 3SQDA 3LXRA 3V1TC 3BSWA 2HJVA 4RNDB 3P0RA 3O2EA 4NX2A 4ZAXA 5LOVA 2QMQA 4OHFA 3WQSB 2YMPA 1N2HA 3CJTA 2BEJA 1SCQA 3SP1A 4HGOA 4DAEA 1K4YA 4RTKA 3FRJA 16PKA 3I6QA 2GZHA 2HPAA 3AUFA 4L08A 3OLQA 3WL7A 4B3XA 2P6RA 3L06A 3D8SA 4B76A 3RFTA 3D0OA 1D4ZA 3FKSA 3JVUA 4H4CA 3UATA 1Q21A 2J5RA 1F1BA 5AVZA 4LK3A 4XWYA 5LDGA 4NHEA 2L18A 3WWDA 4Q4HB 1LLDA 4FD2A 3TRFA 4E94A 4TYYA 3L6OO 1SA0A 4EGQA 1CQIA 1WDTA 1K7CA 2DWCA 2JI9A 5FEUA 4YJHB 3L49A 5ENZA 2ODEA 3N2NA 4LISA 3SMQA 3V8MA 5JS8A 5LQSA 3PYXA 3W5CA 4XQGA 4AMZA 1KR2A 4FTWA 5GADl 4QM6A 3FUWA 3BE8A 3T7DA 3MQFA 2BE9A 2W8BA 1TVCA 2ZUVA 1YVRA 4GM4A 4O29A 4WA7A 3VR2A 3RABA 1MRNA 4FDAA 1L7QA 1NXSA 3ICWA 2BSAA 3OPYI 1PQ4A 1N5MA 2FP4A 2IDZA 4KO4S 4X3CA 1NFFA 4FEYA 4M0LA 3SR3A 3ZCXA 5E4YA 5BURA 2AL7A 3PUVA 3HWRA 5FWAA 5C81A 1OFHA 4DJDC 2QTVA 2Q1TA 4JROA 4B4UA 3A1SA 2HI0A 4A91A 3E9YA 3OHMA 5JT1A 2O8NA 1XZDA 4RO0A 4ECEA 1D6SA 5CDSA 2EFGA 5DULA 4EFKA 4ZGGA 2OXRA 4GX0A 2JA1A 4CUZA 3QOYA 4JI8C 2J30A 5HRAA 2VPQA 3K6RA 2VRNA 5FUXA 1WXDA 4YBZA 1IEVA 1E1YA 3A1WA 3CKLA 1QIFA 3IXQA 3Q7PA 4FPXA 4L5JA 1H9CA 2A9FA 3ZR4B 1K0UA 1XMQB 1BZYA 3FPKA 1DX4A 4IH4A 1MAUA 1ENPA 2OAQ1 2VP9A 3PNKA 1KHTA 4R3WA 1MQAA 3KOZA 5CFLA 3SBDA 1POXA 2ZDHA 3AWIA 3F6CA 4LWPA 3ZDYB 1FP4A 3Q7RA 1DTWB 1H93A 4FSXA 1N8SA 3P32A 1SVMA 2G7MC 1Z39A 4D9KA 2YICA 4YAUA 1QP0A 2QTMA 1W2WB 5ALPA 5CGZA 2Z6AA 2N46A 3GLIB 2A0FA 4DJFC 2YWFA 5HCNA 2Q2OA 5JECA 1KI4A 1YL5A 4L2IB 1KSGA 1AX9A 3TZKA 3VR5D 1KEPA 1I8TA 2APJA 3DV0B 1I5RA 1T4CA 2QDXA 2FXVA 2OCGA 2EFEB 3PJGA 3CLKA 3PQ6A 4PQRA 3QEOA 1RHQA 4QGSA 3WSVA 5C8DA 4PGGA 1G8YA 3KQHA 3DJYA 1GSHA 2HHAA 4MKXA 4AP6A 1MPTA 5JWOA 3FZNA 1XQ1A 1LRKA 1E1KA 5MFPA 1U80A 1CP3A 2VL7A 1XZ8A 2XTNA 4I1IA 1I14A 3KQOA 2MIIA 3DAHA 3CX3A 1VI6A 4DSNA 3N1UA 4B79A 2XVMA 2REXB 3LWNA 5TQ0B 1PGJA 3ND5A 3D8BA 4Q1CA 1AV7A 3SDBA 4H9GA 3SX2A 1XRAA 1DUSA 1A9ZA 2VN8A 4FEAA 4KLZA 3TINA 5IT4A 2AN3A 5TRTA 2WFLA 4IKOA 5EFZA 5LSAA 3KOOA 2AB0A 5DYNA 4AX8A 2WRZA 1A72A 4I9GA 1J8YF 4NKRA 4H1UA 4C4OA 1IBKC 1XV5A 3WLAA 4CG1A 1L8AA 5B1DA 4H3HB 3U31A 1EK0A 1HPLA 4GYWA 1IIRA 1RKUA 1Q3KA 1X8KA 3I0ZA 3DE6X 3PNVA 1IFXA 4RCVA 2JJYA 2GD2A 4TX1A 4F8YA 3OQIA 4IIJB 3GPCA 2H1VA 1QDUA 1IBMC 1D6NA 4GZ3A 1NW5A 4MS3B 4NMXB 4LJ8A 4K0KC 2UVPA 3SWWA 2VQSA 3AF2A 3OZDA 2J09A 3TOZA 3IPCA 3EXEB 2CVHA 2C3PA 3JRWA 4LSZA 2Y71A 4MRNA 1C3OA 3QW4B 5TS3A 3BS4A 4DA9A 2FEAA 1L1FA 1JFFA 4BX8A 4FYJA 4BO7A 2B92A 4DREA 5JI3E 3GLFA 2AKEA 1P1RA 3FFXA 3KOXA 4J6FA 3UK2A 1C7FA 1FMLA 4B3RB 3VNBA 1I2DA 1IB6A 3F74A 1S8OA 3NTOA 4EGJA 8AT1A 3RWMB 1JHDA 3A9SA 3DOOA 5EIHA 4UXIA 1AF4A 5TQ0A 5J3JA 3JYPA 2AGVA 2WIAA 2RHTA 3CVJA 5T4FA 4A92A 3RJ9A 3INGA 2DFLA 1PJ3A 3G88A 3T9FA 4DV5C 3UM9A 4AZ0A 1A1SA 3C6BA 4UU7A 3ZZUA 4UFNA 5J5VA 5JD3A 3BRSA 2Q3CA 3FPHA 3NPMA 4YJ3F 3ZE1B 2I65A 2NO0A 1A7JA 1S96A 1N34B 4B3GA 2ZYIA 1W88A 3F3SA 3QG1A 1ML3A 2PZBA 1U2DA 1U8XX 1EVJA 2EIXA 3ZE8A 1RHMA 2CBGA 3A6KA 2VJPA 3R9IA 3VTAA 4MVJA 1KQGA 1B8UA 1JIUA 2XUZA 4R2JA 1NW7A 2VDPB 1R6VA 3CO5A 3FB1A 4MS3A 1C50A 3IKLA 3HYNA 4N5LA 4YDRA 1QFSA 1U8TA 3O8BA 3USCS 3REFA 3FZGA 1B8VA 4M6WA 1FQWA 1KFKB 1PFKA 3U4CA 2AZTA 5TPZA 3T0GA 4WZAE 1YBHA 1U5BA 4KQXA 2VHZA 4MITA 2I2AA 2IOYA 1B8OA 1NMQA 2IZ7A 4QPDA 4XDHA 2AN5A 4N0EA 5A9SA 2GH1A 3ESBA 3VHLB 1YE5A 4DZTA 2MINB 1NU6A 2HF8A 2F9MA 4EY7A 3HU1A 3O47A 4X97A 2EEZA 1OUMA 3BMNA 1WUHS 4B75A 2WSBA 1SBZA 5JCJD 2CUKA 5DT9A 1XRQA 4YCJA 4BNXA 4EX7A 1ZOPA 1RPTA 3LCJA 2WA1A 3U62A 1Y9EA 5L3SB 3WZ2A 5BSVA 2HHHB 1AKWA 1FRNA 1GGHA 3TQFA 1W85B 1VKNA 3NWJA 2JLXA 2OV2A 3QM1A 4DIOA 1X15A 2JD0A 3A06A 2R6HA 1YGYA 2VYND 3JAKA 2M5HA 3FMOB 4ER6A 4YACA 2RK3A 3TL6A 3R8XA 3ZU4A 1YQEA 1B0AA 3DEYX 2ZRCA 3T15A 3PEUA 3HO1A 2XKBA 3AVQA 2QG4A 3SIPA 4GGMX 4QG3A 1M73E 1QE3A 3E9EA 2Z0MA 4HFJA 1W59A 3AIIA 3ETJA 1JXOA 2VG8A 1JHZA 3KEGA 1NRJB 5TEWA 1Z37A 3PYLA 1S1CA 5FBLB 2Q5OA 1FRQA 1QHEA 3DOJA 3WXMA 1UBLS 1UPAA 5TGZA 2H4JA 1N6PA 2V0GA 3FVTA 4JJ6A 4HNAB 4DIFA 1IY0A 1DHRA 1ESZA 1NVAA 2MDTA 3SC2A 1PGQA 2ZRLA 3W5IA 4QFBA 3DLCA 3IIKA 3L93A 1NR5A 4JT9A 3GPIA 5DWDA 1AUVA 1OFTA 4MWTA 4MWEA 1FDSA 5D3MA 2R8RA 1SBNE 2GJ8A 3IBFA 4KR9A 2G28A 3L4EA 4DLKA 4G9GA 4EYOA 2H2FA 2LRHA 2YHIB 4F4UA 5TQ2A 2R1TB 4ETNA 3GWGA 3STYA 5HKOA 2J6IA 1FJHA 1Z6XA 1JV2B 3OE7D 4AF8A 3Q6MA 4EHBA 5DH9A 4C08A 4OJQA 2PT7A 4DR5C 4MJ3A 2CFTA 3SHFA 1V7PC 4YJ3A 1W85A 1KRXA 1ZMXA 1PW5A 4M4SA 2MYTA 3P9RA 4NZMA 1PGNA 4KIUA 4M38A 2AG5A 3SSMA 2ONFA 1OWOA 2LXNA 2BTOA 3UXYA 1RHUA 4PXSA 5AW1A 5IF3A 1Q7BA 2LUOA 2W8ZA 1WHTB 4D8TA 3Q8MA 3SLKA 1YB5A 3BWXA 4WFJA 3ICCA 3KJNA 4GDFA 3RC1A 5H9UA 4AZTA 1LS6A 4CQLB 5JBNA 1VG1A 2D8MA 3NKFA 4J1QA 4GL2A 1GV0A 4PZAA 3GWZA 1KOGA 4AROA 1JAXA 5ERYA 1EIZA 4NTZA 4MH4A 4K2AA 2QGZA 4HL6A 4Y30A 5IK2D 2UZ0A 2VNHA 3HVUA 3ROGA 3AK4A 1AZLA 3VUFA 4MWZA 3DE5X 1T8TA 3ENWA 2I55A 4BTLA 3V33A 1DRKA 3REOA 5K4GA 1U28A 1YJQA 1M0SA 1C7JA 1WLYA 3V46A 1AQIA 3KQQA 2W2LA 3COYA 3UIEA 2G04A 3QP9A 1RXIA 2DEUA 1MZVA 5FHQA 3DZ8A 4ND3A 3HU3A 1PFUA 1L8OA 4OHZA 2ANBA 4C04A 2QTFA 1I3KA 3IPYA 3OLXA 1PJTA 1PSWA 2IF2A 3TVDA 2C57A 4EKGA 1NM5A 1NNI1 1A5ZA 3TYXA 1FFYA 4R0VA 1BIFA 1QOQB 1ZVVA 3SXJA 2A2ZA 3CW9A 4RM3A 4TMKA 2SCUA 2X3UA 3DUWA 4OHKA 5CNKA 3EA0A 3TIFA 5C4GB 1KK2A 2FH5B 2WG0A 5HSGA 2B99A 3F8WA 4QYTA 4CQLA 1KWGA 1RQLA 5ALQA 1L5ZA 5T8KA 1D0IA 4NEHB 2BBSA 3F90A 1FLAA 4ZV4A 1LXCA 1UZUA 2YXPX 3RUEA 5JD5A 3DZGA 4FGZA 1L5MA 3F71A 4PPFA 2CT8A 4IO0A 5E9QA 1CJSA 3ENZA 3FPSA 4GEKA 1L8QA 2FN9A 1K88A 2PROA 2HHLA 4U7HA 2EQAA 2ZAIA 5HX7A 5IZ4A 5FLXD 3ZVNA 3E8MA 1E6WA 2OB2A 2EGHA 1XZHA 1J0DA 3FX2A 3MA0A 4JJIA 4TYPA 4D92A 5EHNA 4YUXA 5MN6A 1ZJJA 3Q41A 4RY9A 3ZKAA 2O0HA 3A04A 3AVOA 4Y6GB 5U4XA 1GSIA 1P8AA 1J22A 3GRUA 1JSRA 3KLNA 1VKHA 4HJXA 2J5KA 4WPGA 2QRZA 1KAEA 5JD6A 4D81A 2YNMC 2W6NA 1G6KA 1U3GA 1U8ZA 1HE2A 2X0NA 1I2CA 3C1UA 4YCSA 2YIJA 2F90A 3MMPA 3OM1A 2PMDA 4KR0A 4CQMB 1UOOA 3QE4A 4RSRA 4PRKA 2HA2A 1LPSA 1S2GA 5AVOA 3Q2IA 4ZQHA 2MWMA 3TMKA 1T35A 2Z04A 3PKIA 3UWKA 3WMEA 2H29A 4CDNA 2PL1A 1P4JA 1E9RA 1IZ0A 1M8GA 2GBFA 3BIXA 3T9CA 5A4IS 1NMZA 5BNTA 1Z4QA 4FZRA 4WN3A 2VA9A 1X1QA 1ODIA 3N8DA 5A1TA 3GGGA 3HRKA 4YYEA 1Q22A 5AKLA 4BKOA 3ZHQA 4CMBA 2OBMA 4TMYA 4DVGA 1WY7A 3BJEA 4BU1A 3O4JA 3GAFA 4O25A 5H68A 1Y3CE 5JMWA 4HZUA 1Z0SA 1FYEA 1Z34A 3U7IA 1CS0A 2PAAA 4US2R 4YCLA 5JZOA 1ABFA 2FUG6 1ENYA 1AHPA 2UYOA 4D79A 2WSSD 4RZXA 1QYXA 4MMXB 4BVBA 1XWFA 1RAFA 3U0VA 2FG6C 5BQ5A 1Z68A 3S3TA 5F1YA 4ALIA 3LPCA 4Z2AA 1J1ZA 3QEBZ 1ZI6A 2IS6A 1UIRA 1Q1ZA 3VUEA 3CC8A 1D7AA 2VLBA 1EZ4A 1YNOA 3M70A 3VNAA 1LTHR 3A28A 3WS7A 3OTOB 1FLOA 4X1IB 3PR1A 1ZOLA 1E96A 1PL6A 1UXOA 4B4WA 2C4KA 3MZ0A 3GLKA 1MO4A 1JDZA 1EGMB 4ZALA 1AK9A 1ULTA 5M29A 3WP1B 1XTPA 3FVVA 4K03A 2HA4A 4YPFA 1JEQB 4A10A 2WQ6A 3HZHA 2M5OA 2Q50A 3ASUA 4KQGA 1KFBB 3P9XA 3DM9B 1GA6A 1V8BA 3GFOA 2LIVA 4C14A 1E58A 1FW8A 1WQ3A 4LHXA 1YCFA 3PXDA 4RD6A 2AI3A 4X62C 3IOEA 4D5GA 1IBLC 1ACJA 5IBCA 2DX7A 5BWCA 1M2KA 4OQFA 1X1SA 4RX1A 5AVWA 5DNCA 2AMJA 4D8UA 1W7AA 1JQJC 4ZZ3A 3IP6A 4YJKA 2VSYA 3U6KA 1WH9A 1XEXB 4LHYA 1ML8A 1ACLA 2CZGA 4ECAA 3LWBA 4I1VA 1IL0A 4J0JA 4M1QA 3R5JA 2OXTA 1BG6A 3FSEA 1QV7A 1MDBA 3U4MA 4IQ4A 1Y98A 4RIHA 3FOFC 5J1SB 4FYHA 4KE6A 3QF7A 1G59A 4DMRA 2OHHA 2AW5A 3IDSA 4BB0A 5FD8A 3A3PA 4B7CA 1E6LA 3F8SA 3JAMD 2IY7A 4PS1A 3IVXA 5K03A 4YP5A 1N1MA 5AXCA 2YYSA 2WZCA 2Q41A 5C5IA 2WG2A 3JQFC 1L4MA 4L3WA 4TTVA 1CUIA 2G0AA 3H65A 2BBWA 2C03A 5J43A 2RHDA 5H16A 4NZOA 4GD3Q 3A3KA 1MENA 2YVQA 3NTRA 3T3PB 4P31A 4C0XA 1CQPA 5LA6F 2LP4Y 3EDMA 1BO6A 2Z3ZA 1GRCA 1UBCA 3AETB 4M9ZA 3ZJ4A 4DLLA 1D9ZA 4H35A 3HXPA 1X94A 3JYHA 1Q1AA 1H2AS 1ECCA 1K63A 2JJ1D 3DE4X 3TOVA 3DDOA 4GOMD 1M34B 2CFOA 5JJIA 3OU6A 1I94B 1VLJA 2P4SA 1GCAA 3TE6A 3CPJB 1XZFA 1N7HA 1L5VA 4E30A 1TAUA 4IEFB 5KC8A 5AFSA 2HUPA 2XNSA 5DYWA 4CLRA 2QZSA 4HNRA 1KI3A 1R6DA 4N6GA 4UEQA 1RWQA 4KK3A 3PFIA 5H83A 1G21E 1NI5A 1SCNE 3FFWA 1RKQA 4WGFA 5CW1A 5A2QA 1JN0A 1RWNA 1II8B 1MO2A 3LHSA 3OOSA 4O63O 3DHNA 2JD1A 5GZ6A 1E9VA 1GZ3A 1ZOSA 3KT0A 2C59A 3M89A 4IDGA 5MN4A 2XCLA 4BFWA 1O0CA 3FAKA 3ORQA 4YCDA 5FA8A 1JYSA 5D5PA 2PCLA 4HEQA 2JJMA 2X5OA 4I50A 4WXYB 1FXWA 1LBIA 5FLYA 4BKRA 4BNFA 4BBJA 4UBJA 3JARA 4GKKC 5AJZA 4I9FA 3F5DA 1KO5A 4RK0A 4TSFA 4DIBA 1KYVA 2GS9A 3R6GA 4N3BA 5KREA 4OYCA 2QUHA 3N28A 2QXYA 5K5EA 2J3LA 1K6XA 1P1CA 4NXMC 1HWYA 1VL5A 4H27A 4ML3A 3ELDA 1H69A 3AETA 1QH9A 3CNBA 3RE1A 4P7JA 4F5ZA 1MXBA 2OBBA 4CV2A 4I1SA 3VNSA 5FOTA 1M34A 3OM8A 1UWLA 4UFPA 4EHHA 1QO0A 5ALUA 4OHXA 4TZ6A 3TM4A 2W48A 4FMCB 4UMEA 5HNKA 4TLBA 1RWKA 1R8SA 1E1QD 3G1WA 2NTEA 4RAQA 1XNHA 3S8MA 1QFYA 1YDHA 3MWGA 3M3HA 3DVQX 3WWYA 1XTKA 3W04A 1NR1A 1J21A 1I9GA 1U8YA 3COWA 5THQA 5KCZA 1II8A 4Y2XA 3RV2A 1W1WA 1IJEA 1QKKA 3T4UA 2QBYA 2QD2A 2W5UA 1RYNA 3DMRA 4UE6A 3LAXA 4LBZA 4V0SA 3ICOA 4M7WA 4LFAC 1V7CA 2FNAA 4QULA 3SE0A 1ZSVA 2E3JA 3OFND 4Y1EA 2AN1A 1F17A 2OCYC 2CXNA 2X58A 3A7DA 2HN9A 2TMDA 4RV9A 1W5SA 1EFVB 4GYYA 5A1JA 3HB5X 1QZZA 5JD4A 1P7ZA 1ANKA 1GG9A 2AVNA 2FMXA 3SSAA 2YBEA 3TG8A 4WCFB 1PWHA 5IBQA 3EG9B 1ORIA 3VOSA 1JBKA 4HHEA 5KTMA 5BSEA 2ZRFA 3EUAA 2XMPA 5K8CA 1PR2A 3KRTA 3PHHA 5ED0A 3UW1A 2X9GA 1B0UA 1RKVA 2X1MA 2H4HA 3RYFA 4HI0E 1NVGA 3ADOA 5LMUB 1EFTA 1T1RA 3BMOB 4RVUA 4E5VA 3B53X 3ETHA 1UFOA 3TL2A 4K6HA 1HYEA 4POAA 1TIBA 2QHXA 3TK1A 3LBNA 4L5BA 4O1IA 2ET6A 2P4HX 2QMHA 3VYVA 1LSUA 5K3EA 1NKVA 3UTCA 5JLJA 3T1HB 5E7QA 3GOHA 1RI5A 3V3TA 3UCXA 5U1PA 5UKDA 5FTMA 2R1UA 4J2OA 1W36C 3D8TA 5PNTA 5DHPA 3QSGA 1FFXB 4GH5A 2VO1A 4OMFG 3WOHA 1JJVA 2LKCA 3R9WA 4C29A 1V6CA 3AEQA 3VO9A 4NV0A 1PUXA 1OYVA 2NZYA 2Q4EA 2XGSA 2KM1A 3JSAA 4B4KA 2WT8A 4RFSA 4BFTA 1PTKA 1EFVA 3FCSB 4FGWA 3UFXA 1RI4A 3ZW7A 5KJCA 4KRFA 5DXFA 2CJYA 1NVWQ 3CLSD 4FB4A 2IPMA 1QHXA 1CJBA 1B0PA 2H1CA 2HA5A 2OECA 3A8TA 3GFTA 3L7LA 3OIDA 4COOA 5JNLA 2UXCC 2BZSA 2J9ZB 4KMSA 4REQA 4NYJQ 1XD9A 4JI5B 4PYKA 2CJXA 3I9OA 1E3WB 3O9VA 2FOXA 1G5TA 5AXAA 4X64B 4EZBA 5KC9A 5CX1B 1JEJA 4OI1A 4G0PA 5KUTA 1AGPA 3HCAA 2L69A 5T6MA 1SB9A 1UBFA 1ZD2P 4L4RA 3WNVA 2WVJA 5KNBD 2ZSIA 5EP1A 2GGSA 3VR5A 4BJ5A 3EXIB 1FX0B 4YV0A 3ISJA 5BWLA 3LYAA 3EIOA 1O4WA 3CMCO 3A6JA 3IAXA 3ND9A 1R6UA 2DHEA 2OXCA 2O2HA 3MGCA 4JLMA 3UOAB 3WRYA 1XU9A 2Z8YA 1IJKA 1TYBE 1H0HA 4ZKEA 1OLXA 5ALDA 3GLGE 1R4MA 1VXOA 4L85A 3IPAA 4BAGA 1ULUA 3LL7A 3T35A 2OCLA 1Q0ZA 3K7EA 2G40A 1XFDA 4G5XA 4GOLD 4O4LF 4G8DA 3BVPA 4E2XA 1VHLA 1KDVA 1D9XA 1E1LA 1MMFB 3P9QA 2PANA 4RTRA 1HE1C 4ZARA 5BV8A 4MS4B 1CRPA 3RAPR 3C5CA 1L4UA 2O8DB 3KJIA 2FX5A 2VH1A 3SC3A 4LRWA 2O8VA 3GDOA 3WFJA 2I67A 4ICIA 4JGIA 1CTQA 3IP1A 3TE7A 2XUFA 4OHMA 5AVQA 2BGMA 1CHDA 4XPZA 4L0MA 1U1DA 4E33A 5KTYA 13PKA 3R6DA 1BX3A 3LLVA 5DEOA 3ZDQA 9ABPA 1KETA 4GECA 4F21A 2QRPA 1JVBA 4Q1EA 1BCSB 1Z33A 3G59A 2C8JA 1SEVA 2FB9A 4MGIR 4CG3A 2IYYA 4OX9Y 1T5DX 3GGSA 5D5HA 2HLDD 1HQCA 2NZUG 3H05A 2F3QA 1BU8A 1T8UA 5A1GA 1X6VA 4H7PA 4P81A 3UPDA 3CKKA 1H1LA 1FFBA 1NW3A 5IYZF 2CC2A 2GAJA 2VP2A 3S2GA 4E12A 3PJRA 1WMAA 1NMSA 4YVFA 1X0XA 1MEJA 3M4XA 2JEYA 3L4BA 1VMDA 2VJAA 2WKSA 4FMDF 3LRTA 5JY6A 4ZTUB 5HJ7A 3WYBA 1IQPA 3TVTA 1KVUA 3BIWA 4ZEWA 4Q7JB 1OGJA 4AQYB 2VNSA 3WLHA 1FYFA 2RHGB 4KQKA 1YZNA 1OJ7A 5FPPA 3OH8A 2H2IA 4N6NA 2FDXA 2A9JA 4Q9JA 2IWRA 5HDQA 1H6BA 3H2SA 1ZSYA 1N8TA 3BB4A 3VV3A 3ZI4A 2O2EA 4C0HA 1S6YA 2G67A 5A0FA 3W3ZB 2C04A 3ON5A 5BQ3A 2BAGA 2R2AA 2O1XA 4M1EA 4HAUA 1UBHS 4KLRA 1J7KA 2HZBA 1MGOA 3A26A 2DUWA 2PFGA 4M9UA 1MZPA 3G9UA 1TI7A 4ZYVA 1G63A 5LD2B 1JDJA 2CNBA 4LX8A 5FL7D 3V8RA 5CLGA 1B6GA 4MVJI 1MU0A 1T5SA 1KP2A 1KSJA 3LY8A 4JDUA 3DNFA 3LCUA 1BE6A 3BKXA 1N6KA 2MTBA 4KRYA 2PGOA 2O6HA 2CCJA 1QR6A 5EKTA 3U4HA 1AY0A 5F21A 1UKCA 4KDCA 4P08A 4R8MA 5HKLA 3TLGB 5JS7A 2J6CA 2PL9A 5IAGA 5KBYA 2PS9A 4R16A 4KN6A 3PHLA 2H8KA 1E32A 3X0DA 4G2NA 1NFRA 2VEDA 1HOTA 2IPOA 3J80D 3FYTA 4GKBA 4OH1A 4OHWA 4YT2A 1ONBA 3FOWA 4J7AA 4PGMA 3H5OA 3RSGA 3VYWA 4PYJA 2IYWA 4ZQCB 5EMJA 2P2DA 5DM70 1J70A 1QG2A 1P73A 4G84A 2RH8A 3R75A 3C16C 4LSGA 5E1BA 2Z4SA 1HNNA 4D6YA 1BN6A 1HDYA 2OHFA 1II9A 2K7FA 3BCUA 2DPYA 3LOUA 4HPJB 1IM8A 3K2EA 4P34A 5JCJA 4K81B 1OIWA 3VH1A 3H8JA 1GXSB 4AD8A 3PX2A 3JQRA 4AG3A 2ILTA 3S6JA 2PZJA 4EPYA 4QREA 1ZHFA 4X90A 4B3DA 4B1FA 4EEKA 4Q7QA 1CJKC 5DV9A 4HS9A 2WYOA 1C41A 1OASA 4N39A 1IUOA 1KZHA 2R4QA 3H99A 3K35A 3D7KA 3KVYA 4M1WA 2OD9A 2ZI4A 1LNQA 4FOTA 4OSOA 5AKZA 4U9HS 3W2IA 3HJUA 1UOQA 5EMKA 1SCJA 2Y4NA 2AT1A 3MPUA 4NV3A 2ERXA 2CE7A 4KTVA 2MSCB 1BEEA 2WM2A 3MS7A 3QXHA 5E2BA 3I9NA 4HWGA 1MG0A 1Y34E 2G5GX 4JD5A 3J81A 3I9KA 3MGKA 2G88A 2HR1A 3W0LB 4BZZA 1O5OA 2SBTA 3CEJA 2BSXA 2WAOA 3OZIA 5FO0A 4RUKA 3KSDO 1TGYA 4IV0A 4YJ2F 4V24A 4OG2A 1FL9A 5JMPA 1S3SA 3SX0A 5AHRA 1TM1E 4E03A 2DFDA 2D1RA 1Q50A 3A31A 1E3MA 1GQRA 3HRHA 1J99A 2EGTA 2XX3A 4U8GA 1Z5PA 2LNDA 1X77A 3QLVC 4AJ1A 4LHEA 2HNBA 5AVXA 1C8KA 1DLJA 3T94A 4KITB 5KI6A 1SVNA 4P3XA 3N2KB 4HC4A 4WK0B 3RARA 4B3HA 2EWMA 4ZEMA 3OE7A 2RHMA 4BC7A 3INTA 1GXSA 1WQ4A 1QHIA 2PGJA 3CH6A 1E3TA 1F7VA 4Y18A 2YC2C 1NZFA 4QUKA 4JBGA 5DBHX 1EK6A 1O6FA 2XA9A 2JFYA 3TSAA 2R65A 4DR1C 4N03A 1YR6A 1PTJA 1ZD4A 2FFQA 4YCNA 1N5JA 2GESA 1J8FA 2VHEA 3F7TA 7ADHA 4YRDA 1K0RA 3ZCTA 1GPAA 2WPDD 1BH2A 3A1VA 2OCAA 2NNWB 4IRMA 1DQNA 4R7GA 3B1KA 1ULAA 3ONEA 3PDCA 4GVLA 5JASA 5D85A 2HCBA 4BIMA 5I8PA 1W0KD 1KJIA 3D6MA 1OBFO 4IILA 4HX2A 5IVKA 3H16A 3GCGA 3WBBA 4PLTA 4JVMA 1KHHA 5IK2A 1L5RA 2X1LA 1D03A 2CXCA 1HY3A 1SCKA 1I3LA 2ZSFA 2ZITA 2QXUA 1BE0A 2PH5A 1VG9B 3QBEA 5JCOA 1ZU4A 4J0CA 2R68A 4P32A 1EJ6A 2IHVA 2XE6A 2Z98A 3SYNA 4PCAA 1I30A 2GWRA 2KHZA 4QC2A 5H80A 3Q85A 2F64A 1IBCA 4NCNA 4S3MA 1NDUA 1R0CA 1JKXA 5EA2A 1GNPA 1ZMOA 2IJGX 3N2KA 1KIAA 3RSLA 5K0JA 3EH2A 4TLLB 3IERA 1N9KA 1EKXA 2KQUA 4HNSA 4YT8A 1GRRA 1Z9BA 3W8EA 1MJ5A 3V4OA 1XVTA 3K70C 1SZDA 1DZ3A 3MAAC 3ZIAD 4A1OA 1WZ2A 4A7PA 3HACA 5GWXA 4LFCC 2Q46A 4QEDA 2X9VA 3YASA 3U9SA 2CF5A 3WK7A 4DR7B 1XNRC 2RC6A 4LRUA 1N36B 3WK6A 4LZZA 4REOA 5AM5A 1ISPA 5H59A 2GAOA 3ADPA 2HRQA 3NBYC 4C05A 3U3XA 1WXHA 3P97A 3G85A 1F7UA 4UZFA 2OMKA 3QXXA 3ZEIA 4CKWB 3Q8LA 2JARA 5ILOA 1YFJA 5CB0A 1M6VB 5JJLA 4CNBA 2QQGA 1Q19A 3GARA 3NRCA 3USES 1NN0A 3N75A 3NIGB 4LF7C 5AKIA 4EMBA 5HZKA 3P9KA 1OLUA 4ZT6A 5LXTA 3AOGA 4MNTA 1OI4A 2WTEA 4M8SA 3R6WA 4BBAA 5FLXA 1SHUX 2O5VA 4NCKA 3EIQA 2JCYA 5BVHB 2QL5A 5D2CA 4JP1A 2I7CA 1K9SA 3BMCB 5EIFA 4J7XA 2X0IA 1YB6A 4N8EA 5HJ5A 1A9RA 1QVVA 2F9FA 2HMAA 4U3JA 1DMSA 5JE8A 2IWHA 3UJ9A 1UMBB 4D9NA 4WNCA 3G8CA 3HI6A 4XLTA 3T6KA 4OU5A 1BFDA 5IC5A 1JIQA 1X7HA 3Q0EA 5A9TA 2AI2A 2VDKB 3VU0A 4AKTA 3NM4A 1QYDA 5K7SA 3RSHA 3LHKA 4MHTA 3NEPX 3MBOA 3PEYA 5M04A 3DOHA 3BHIA 1DBRA 3S2UA 4HTAA 1P4EC 1CW2B 4UUQA 1D2AA 1N2CB 4QATA 3SR0A 4P3NA 2WILA 2XTMA 3K6JA 3HEBA 2O52A 3IKTA 2OFOA 2Y05A 3MTQA 4MTNA 4BZWA 3WKEA 2WWIA 3C14C 4XZ3A 2C9CA 3NTQA 4XQEA 3FWNA 2NACA 1M6VA 3HP4A 1XZPA 3ZBQA 1A96A 5ALGA 5DF1A 1QPZA 4X20B 2IZ0A 4XB2A 5DGDA 5FX2A 2CE2X 4ZVMA 1DKPA 5KPJA 5TLSA 3E22A 1BCRA 2G77B 2ZU6A 5BVHA 3BMCA 3BC1A 3C6MA 2YRXA 4YJGB 1LBQA 5A62A 2IBTA 1SVKA 2QVGA 3K09C 1ZK3A 1PT6A 2ZVJA 4XI9A 4KX3A 1CRQA 3TW8A 4EY3A 5L3QA 1E2BA 1SAYA 3FNBA 1B41A 2WSSA 3QYJA 1J8MF 1XRRA 4HTFA 1NY6A 4G0NA 4AQDA 4KPUB 4GS5A 3KL2A 3SPXA 2YMQA 3KZXA 3SKVA 4DQKA 3DR5A 1W35A 4ARVA 3V2HA 4Q5IA 2ETVA 2GYUA 1K97A 4IINA 5CYPA 1YCHA 4DCSA 1ODTC 2QTHA 1UP7A 4EYSA 3T34A 1K3FA 4Q4AB 4MQMA 3ZDAA 2ESRA 1P17A 1W29A 4GNRA 1N0UA 3G13A 1ABEA 2RK6A 4KODA 4FLMA 2C20A 4XIYA 3JQQA 2BJHA 2C3MA 3B9QA 4MQUA 4O33A 4ZK6A 2VP6A 3GLQA 5KINB 2H5LA 3JQ9A 5HFNA 4I4IA 1FYVA 3Q3GE 1XLVA 3CUKA 3GYBA 1K8YB 3K5PA 3AEUB 1CUZA 2OBNA 3GRZA 3A6EA 4PXYA 5IXYA 1WG8A 2J9GA 3NI2A 4C0JA 3OT1B 2J9XB 2XBLA 4UEWA 3H8WA 1FVHA 4EHAA 3Q87B 1X86B 1Z6ZA 4XCVA 3CRZA 3DB2A 4YJGA 1Y81A 4X8HA 4C2BA 5FWNA 3SI7A 3ZXYA 5EUCA 4FYXA 3WGJA 1SKYB 1NJ1A 1B4DA 1NE7A 1L4YA 1ZN9A 1U5CA 2SICE 1O0SA 3O9ZA 3OPQA 3QKSB 5JH7F 1Y8ZA 1REQA 2XI4A 4B46A 1J09A 2G7ZA 4PWZA 2A4MA 3R7WB 1EG7A 3JAMA 1V3TA 2IOFA 4G41A 1R6BX 1NBMD 1IHUA 2ZJ8A 4OHPA 1WP4A 5ESWA 1GKYA 2B1QA 3GYGA 3QXCA 4MB0A 1EWYA 2CDBA 2HCJB 2R48A 2V59A 3HN2A 3KKNA 4L6AA 4P58A 2JANA 1EU1A 4AUNA 2V7PA 2CXUA 5KHLB 2BMFA 3I6BA 3I4FA 2HIGA 2H92A 1E2EA 4UAGA 3U4AA 3VR6H 2XUQA 4MYTA 4R0MA 4M0CA 2FW0A 4XDYA 5IMBA 4RTPA 5CT9A 1UFKA 2BDEA 1CFZA 4B3CA 4TS3A 3NM5A 5BXQC 4EUSA 4N48A 2NPOA 2HRBA 3C4QA 4M76B 5HM8A 2JJ1A 4P4SB 4YP6A 9ATCA 4B3MB 1M6WA 5K3DA 2FJ0A 2W2KB 4EW6A 4TM7A 4P22A 1TQ4A 2ARKA 3UAGA 5L4SA 3PEWA 1QQAA 2PL5A 1XDBA 4LWOA 2QSJA 3BGVA 4UHDA 4WEOA 3KAQA 1XCMA 3FY4A 3AINA 5ES3A 4P7FA 4E5UA 5KDOA 4CGZA 5I7RA 1K8RA 3TSYA 5JRDS 4Y6LA 5C35A 1A88A 1Q5PA 2JCXA 4XOUA 4A2PA 3AQIA 3M4JA 3VZBA 2PSHA 1EHIA 2BN4A 1UBUS 1NT4A 3D7NA 5LUAA 2CNDA 4DLTA 2EU8A 3PNQA 5F9MA 2CMFA 3R7WA 3A37A 1U3VA 1II0A 5DK6A 3IR5A 5F77A 3TUZC 1PA4A 4LQCA 1L4FA 1QWSA 1YZ3A 3TBHA 1EP2B 4ETMA 4MIEA 4DHWA 2GT1A 2GTPA 2Q0QA 2XDWA 1Z7BA 3DFZA 4IV5A 1YH3A 1SBQA 4EI2A 1T8RA 4TMFA 1Q1GA 5LIPA 3VKFA 1EHCA 2XTZA