3TQIA

Structure of the gmp synthase (guaa) from coxiella burnetii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
519
structure length
464
Chain Sequence
IHQHRILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPEAPAFIFEIGCPVLGICYGMQTMAYQLGGKVNEFGHAQLRVLNPAFLFDGIEDQVSPQGEPLLDVWMSHGDIVSELPPGFEATACTDNSPLAAMADFKRRFFGLQFHPEVTHTPQGHRILAHFVIHICQCIPNWTTKHIIEDSIRDIQEKVGKEQVIVGLSGGVDSAVTATLVHKAIGDQLVCVLVDTGLLRLNEVDEVLNVFQKHLGAKVICVDAKDRFMKALKGISDPEEKRKIAGEQFIRVFEEQAKKLNVKWLGQGTIYPDVIESKLIEPLRELFKDEVRKLGLELGLPADLIYRHPFPGPGLAIRILGEVSAEYINILKQADAIFIEELKKSDYYHQVSQAFAVFMPLKSVYGYIIALRAVKQWADLPHEFLSKVSHRIVNEIKEVSRVVYDMTNKPPATIEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Ligase
molecule keywords GMP synthase [glutamine-hydrolyzing]
total genus 131
structure length 464
sequence length 519
chains with identical sequence B, C, D
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
A PF00958 GMP_synt_C GMP synthase C terminal domain
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3tqiA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3tqiA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tqiA01
2A1TR 3EZGA 1TYAE 4RUKA 3P9QA 1B6TA 3L7NA 3MLBA 3F71A 1K92A 3E27A 1JEEA 4K0BA 3L93A 2AG6A 3FI0A 3GMIA 3AIIA 5KWVA 3CVUA 3UC5A 1TYBE 3ZUGA 1KXJA 1QVZA 4XFDA 4J75A 1BS2A 4MW7A 5H7XA 2CV0A 2CSXA 1Y42X 3R75A 4NATA 4P5PA 4F3RA 5K0SA 4LRUA 3ISJA 1R6TA 1EXDA 3WFZA 3PNBA 1H1TA 4ZGGA 2A7XA 2AB0A 1IQ0A 4JXXA 4HJXA 4EF6A 2CT8A 1TEZA 3NOVA 1MJHA 4MUFA 4QYXA 3AG5A 2RK6A 2QJTA 2YWBA 2QTRA 2HMAA 1EFVB 5JBNA 1C30B 2IELA 1G8FA 2GOYA 1QVWA 4HPWA 1P7ZA 4YP7A 4P36A 5LIRA 4AUEA 3CVYA 1GPWB 1YI8A 2CV2A 3CLTD 1A9XB 4MVCA 4A91A 3R74A 4ENVA 4MLPA 2RK3A 1XNJA 1FY2A 2R5WA 4U8HA 4RKWA 1N2GA 1IFXA 3LOQA 1QTQA 3SO4A 3PXUA 1OI4A 1QRUA 1KA9H 1G59A 1LW7A 2E0IA 1KAQA 1N2IA 3EWNA 4ENUA 1WKBA 4ZT2A 4GE0A 2QTNA 1MAUA 1JIJA 3HV0A 1Q19A 3PQ4A 2W7TA 2YWJA 3NVAA 3QTBA 4ENQA 1MXAA 1O93A 2R1VA 4Y1RA 2YY5A 5DASA 4L4QA 4L2IB 4U63A 1IH8A 2V0GA 4P2GA 1XRCA 1PFVA 1O9TA 3Q4GA 2IP1A 1P7LA 2D7JA 2VRNA 2ZUVA 4P2BA 1KH2A 2O5RA 2Z09A 3P9SA 4R0NA 1O90A 4JFAA 4MUJA 3ZJUA 1JVNA 1KR2A 1N2JA 4L7IA 5KHAA 2A4MA 3SOZA 4RPIA 3RJZA 4PBSA 1JIKA 1I2DA 3RK0A 1F7UA 3AG6A 4I6EA 3CVVA 1VL2A 4UOQA 1IVSA 4I4NA 2Z08A 4K0RA 4GUDA 4L2IA 1TYDE 2AKEA 1I1QB 2A86A 3CLRD 4HPVA 2ZUSA 4R7GA 4B7AA 1J1ZA 3TNJA 1WXGA 3IUBA 1VBNA 2A1UB 1N2EA 1D2RA 4DDHA 4ENSA 5JZMA 3IMCA 4H3SA 3N05A 2VTBB 4OJYA 2XRZA 3TZLA 4GU5A 3ZJ4A 4RKYA 3NOOA 2GHRA 2IJGX 3VU3A 4JZYA 1PV2A 2VTBA 4NAUA 1N78A 4L8WB 1I6MA 2TS1A 2O8VA 1U7XA 1U9CA 1GN8A 1O92A 4L8FA 4ZCRA 3KT3A 1GG9A 3RHSA 4QBTA 3INNA 3HL4A 5J59A 4ENPA 2PXHA 3L18A 1O0CA 1DNPA 3BWEA 5HUJA 1OY1A 1UFVA 3P0IA 3QE4A 1N2OA 1V8FA 2NZ2A 2PFSA 1QU2A 3TQOA 4E1AA 4OJMX 5TGTA 3TTSA 2H2AA 2YWDA 3MGKA 2X1MA 2DXIA 1T0BA 4KR9A 1G8HA 1GAXA 3COZA 4NDNA 1KAMA 4EG6A 1MC1A 1PDVA 4KTTA 1T9GS 1OBCA 1XNGA 5BNZA 3ND7A 2ZUFA 4MWBA 3ZIUA 1KQPA 1PFUA 3KT6A 4CDMA 3ZGZA 1IZYA 4S0ZA 3FHJA 2QUIA 1ZH0A 2J07A 1SURA 3L92A 1HYBA 4PXYA 3DLAA 3LE8A 2DPLA 4ARCA 1GTSA 2CUZA 2E18A 1QU3A 2QUJA 4J76A 4OQ4A 4PBTA 1QQTA 3X1MA 3NOQA 2V0CA 3F3MA 2VXOA 4DDMA 5LM3A 3CLUD 3TDEA 3PQ5A 4KPUB 1WQ3A 4Q16A 1CE8B 5H16A 2WQ6A 4MVXA 1KKUA 4ARIA 1L9XA 1J21A 2Z3VA 3ND6A 1VCMA 2VDJA 1M1ZA 1WXFA 3K9WA 1OX6A 3P52A 2OR3A 3NONA 2DETA 1NP7A 2X3FA 1K4KA 1VCNA 2YXNA 3RBAA 4OUDA 5AHWA 5DFAA 1NUSA 1I6KA 4NDAA 3CZ9A 3JXEA 4AULA 3S82A 3TTYA 3UY4A 1EUQA 3KFLA 4YBRA 3A2KA 4MW9A 4EFKA 1YUNA 3TQIA 3FG9A 1JDBC 5SY6A 3CR8A 3ELBA 3MMXA 1NI5A 1N3LA 2QTMA 3TZEA 5HG0A 1OWMA 2AD5A 2EJCA 4HCJA 4ZDJA 3S3TA 4D1YA 3C8ZA 1RQGA 5TEWA 1TYCA 3CLUC 1O97C 4AS1A 4MW1A 2R1VB 1O96A 1CF9A 3FOCA 4BTEA 4BWVA 4ZDIA 1KORA 5A1GA 1IHOA 1MRZA 1MB9A 1WOYA 2H2WA 3CYFA 3PQ6A 4EG7A 2BTEA 3MIIA 4OGFA 2X0KA 1M8KA 5J58A 1PG0A 4DNXA 4XFJA 3D54D 4NZPA 3OT1B 2CV1A 3X1KA 1VBKA 1MB2A 2QUHA 4MW4A 3ZXSA 1SY7A 3ER6A 4WSOA 4NAHA 3VGJA 3FWKA 4I6JA 1H3FA 1PE0A 1KH1A 2ISSD 3VRHA 1YUMA 2NSYA 2WJZB 1JZQA 1GGKA 3IMGA 1O0BA 1GPMA 4KR6A 1K97A 1T6YA 3P9PA 3ZJ5A 5BV2P 3EFEA 1GGJA 1OWLA 2B7LA 1JECA 2A9VA 1XNHA 3PQ8A 1IRXA 1X8XA 1N75A 2CFOA 2FEXA 4R2MA 4MUGA 4EG3A 3LCJA 3TTXA 5FO0A 4UCFA 1BXRB 1J70A 3NBKA 4K03A 4YP6A 1R6XA 4ZT7A 5TS2A 2ZUEA 3P9RA 4XSVA 1EFVA 4ZT3A 1OD6A 5T8TA 2CYCA 2E89A 5DB4A 3TTVA 1S1MA 3MUEA 1MAWA 4JYZA 2GK3A 5TEVA 2NV0A 2DEUA 1JHDA 5LLTA 1M6VB 5IP5A 4ND6A 3X1JA 1KH3A 1OBHA 2GM3A 1JIIA 1N1DA 1WL8A 4UOZA 2R1UA 3ZJVA 2G36A 1NUTA 3CLSD 3CLSC 2JA2A 3DV2A 4TS1A 1WXHA 4MW5A 4MUKA 4R2LA 4MUEA 1IPHA 2DUMA 3N9IA 1XJQA 2PZ8A 4QREA 1YIDA 4WINA 3UJNA 3IMEA 4MUHA 1NZJA 4ODJA 3FDXA 1T9GR 1PDWA 2ABWA 1OX4B 3IDFA 3MXTA 1G2IA 4UZSA 1A8HA 1GTRA 1KQOA 4WS9A 4MQ6A 2R1TA 2CYBA 1X6VA 1P7PA 4ZCSA 1U7DA 3RV2A 1COZA 4MWCA 3SP1A 4ZT6A 1WZ2A 2P02A 3A04A 1J09A 1F9AA 1MOPA 3I05A 2DR2A 1WXIA 2R1TB 4AUMA 3ZJTA 3L4EA 5JZOA 2HZ7A 4AUNA 1C3OB 3PQ2A 3NV7A 4MNTA 4Y1EA 4B2YA 4DE5A 3AKZA 1M8PA 1T6XA 2VPIA 2RK4A 1WQ4A 3IOBA 4U7JA 1J42A 5H9UA 2I1LA 3H97A 1MBZA 1V47A 3BL5A 3G59A 4KR7A 1QDLB 4L95C 3H9CA 4OFWA 4MGHA 4MW6A 1GZUA 3CA8A 1N57A 1R9GA 4E5VA 3ILVA 5A19A 1JMVA 1WJGA 3MLAA 4OIFA 4UZEA 2C5SA 1Q15A 2LXNA 2YWCA 1J1UA 3H9BA 1T6ZA 2ZUTA 2WB2A 4MVYA 3NBAA 3HGMA 4MW2A 1QRTA 1Q11A 1H3EA 3B3AA 2BYTA 1H3NA 1GLNA 1ULHA 2EL7A 1PFYA 4ENWA 1G8GA 3PNYA 4MTCA 4I2NA 1YULA 3GRAA 1IQUA 1ZH6A 1K9VF 1PG2A 2AZXA 1NUPA 5A1IA 3OTWA 1TFUA 2E21A 1QM4A 1JGTA 4OGGA 1XRAA 1U0BB 1VHQA 1QVVA 4MAFA 4AQ7A 3UK7A 4N0MA 4ND7A 3IVGA 3SZGA 1EUYA 3UK2A 1S4MA 1O6BA 5DEOA 2QUKA 4HJRA 2XF2A 3TTWA 2D5BA 1O1YA 3CLTC 4F4HA 4Y1FA 1K4MA 4L78A 2PIDA 3CVXA 1M8GA 4B31A 3VU8A 3D6VA 4ENTA 3PQ7A 4CDNA 4EG4A 4Y1RB 1I7QB 1U3DA 5IHXA 2OV4A 1FFYA 2DERA 3RK1A 4K2HA 1EFPA 3B36A 4GRIA 4LGYA 3UMMA 3B38A 3IUEA 1OWNA 3R76A 3RHTA 1GGHA 3FETA 3G5AA 1CS0B 1XRBA 3SDBA 3BHNA 3F5DA 1CT9A 1RG9A 1YIAA 3UOWA 1I6LA 1M83A 4KKVA 2OQ2A 1VLHA 1Q7RA 5LFAA 1QWSA 4Y1GA 3EN0A 3SF8B 1O95C 4G6ZA 1O94C 1ONSA 1P80A 4I46A 4BIMA 1TQ8A 5SY4A 3CY6A 3RFFA 2QJOA 5FO1A 1GGEA 3SZ3A 3M5WA 1UCFA 1T3TA 4KTVA 5SYAA 4JXZA 4B5KA 1NSYA 2ZUWA 4XLLA 3D6UA 1VBMA 3IMLA 4GE3A 3COVA 3KKLA 3CNEA 3TS1A 2V4UA 1OX5A 3UGJA 3IOEA 3P0JA 3PQ3A 4MUNA 3TTUA 1NYLA 4PY2A 1LI5A 1N77A 4CQNA 4P35A 3U1VA 1GGFA 1O96B 1OX4A 2PZAA 3GUZA 2A1UA 1FYEA 3FY4A 1PFWA 1MXBA 5DK4A 4N12A 3SEZA 3HZRA 3QTTA 2ZUUA 2HGZA 5F23A 4L7QA 1NUUA 3AFHA 2OBVA 1NURA 3DPIA 1WXEA 5E9AA 4X0EA 4ZDKA 3SYTA 3CZAA 3FH0A 3ND5A 5FNZA 3OT1A 4P34A 3GLVA 2A88A 3IVCA 2JANA 4MW0A 1M8FA 4DJAA 4MULA 1KP3A 4ZT5A 1N2HA 4MUIA 1Q2UA 3FNRA 1FUGA 1O5TA 1IQRA 2RD2A 1O94D 2VKTA 1MXCA 1O95D 1EJ2A 3SEQA 4Q93A 1OWPA 1F4LA 3N2YA 4Y0NA 4ADSG 1KWKA 4JQSA 4ZCTA 4EG5A 5J5AA 1ILEA 4YP5A 1SOAA 3A4IA 1ZJWA 3FIJA 5T8SA 2A1TS 4MWEA 1R6UA 1EE1A 3IOCA 3KT0A 1P7YA 2WQ7A 5SY9A 1F7VA 3UMVA 2DLCX 3N8HA 3CVWA 2D54A 4FZJA 1M8JA 4MWDA 1O97D 5EKDA 3A05A 3IH5A 4G5FA 1NUQA 1IZZA 1JILA 4L8YA 3PRHA 4CT0A 1I7SB 1P5FA 4WXYB 4OUDB 2NV2B 3ZXIA 5HUHA 3M3PA 1FYDA 2RE8A 1QRSA 3PNVA 1QF7A 3HFJA 2JAXA 3HMQA 4WNYA 1OWOA 3N7TA 1WY5A 4L2ZA 1N2BA 1KP2A 1QJCA 2PG3A 4KPUA 4QYTA 3FSEA 4ZCPA 2H29A 5IJXA 1ZUNA 1JEDA 4E08A 2J4DA 4HK4A 1Q77A 4EGAA 2IUFA 3IODA 2J5BA 2XRYA 3FIUA 1LI7A 4ZCQA 1VCOA 3COWA 2GKSA 4QRDA 4AJ9A 3K32A 3IVXA 2A84A 4DDKA 5K4AA 1T36B 3KT8A 1KEEB 2PZBA 4EG1A 4I6GA 3ZR4B 3TTTA 4B40A 2J08A 1EFPB 2WSIA 3AL0C 4NX2A 4S1OA 1J20A 3NORA 4BFLA 4MVWA 5KCMA 2QJFA 3EJ6A 4ENRA 4G5YA 3H99A 3COYA 1KQNA 4PBRA 3Q10A 3OP1A 1JZSA 2X1LA 4YMIA 4DLPA 3H05A 5K0TA 2ZP1A 4UNIA 1U3CA 4LE5A 1QNFA 3Q12A 3L3BA 2J09A 3P0HA 4EG8A 4ZT4A 1KWGA 2D13A 3DO8A 3SF8A 2CYAA 3G6KA 1P81A 3CLRC 4UZFA
chains in the Genus database with same CATH superfamily
2IYWA 2NTVA 4H1HA 4HDAA 3IVMA 2C0QA 4RK6A 4YC7A 4A27A 1Q22A 2DUNA 4FN5A 4BFXA 4Q7QA 1K2VN 4EVSA 1C8VB 2R3SA 4CM8B 3F71A 1KIFA 3ETLA 2GPWA 1S3FA 1FDRA 3U09A 3E05A 4WY8A 3I5XA 4BEWA 4B45A 2QRJA 3SM3A 2ZUCA 2GN6A 3PVSA 5JFGA 4PQFA 1Y42X 2IPOA 3NP9A 1GNTA 3T1VA 4LRSB 3ZHCA 1UWLA 2WR8A 1IEWA 2XPCA 3JVUA 2YRXA 1PF7E 3ETNA 3K9CA 4OHPA 3KQTA 4UTPA 4W9MC 3QXGA 5LVAA 2NO5A 2OKGA 3QKUA 4P80A 4GLOA 1V26A 1XZGA 3ACBA 3RC2A 5J2TB 5EKXA 2Y76A 3L43A 4QYXA 4LQDA 5E3HA 4K7JA 3UFBA 1EFVB 4MWGA 3V46A 4K0KB 3I5MA 1FB5A 3N59A 2PX8A 2A0YA 2QB5A 1P7ZA 4LRXA 4G4SP 2HA6A 5LIRA 4IDNA 4UM5A 1YBVA 3NTXA 1GKYA 1A9XB 4D41A 3AVTA 3R74A 1MIOA 4UPVA 3JTMA 1EWTA 2BRUC 3KUCA 3BXHA 2WE7A 2X9NA 1SXGA 2GCNA 2IHBA 1U8YA 1VPTA 3HEBA 4HN2A 4C78A 4EW3A 1G59A 5IHPA 1PTKA 4PPQA 3VV3A 2D7DA 1VHLA 3R3VA 1P8AA 1VA4A 2IVZA 3QU7A 4HNHA 4J1TC 1DDIA 3AI2A 2QGZA 4IS2A 4ZMSA 1JVBA 1K68A 1DDGA 1DPGA 1GNVA 1NLUA 4EHJA 2HMTA 2PRSA 3C3WA 1NJ6A 3H13A 3M82A 4P4TA 1Z6YA 2ZJBA 1JB9A 3LZ6A 3ZU5A 3KB2A 1ZRSA 2BUBA 5AW7A 3SYKA 3W5BA 3RQIA 1HFKA 3A28A 3B6IA 3N39C 1ST3A 5ALUA 1P5JA 3R3YA 1MGOA 5F5XA 4ZI7B 2VZ9A 3ROZA 5EIXA 2LZ0A 1KR2A 2Z4TA 1DQRA 2OT3B 1US8A 3AEUB 3MJVA 3KCNA 4FOPA 1TCBA 1F06A 4IS3A 4MS3B 4RK4A 4TMVA 4EAAA 2IFTA 3LC2O 4I6EA 4XX0A 2XVMA 2ZBRA 2CU6A 4LBVA 3UQZA 3WHKA 5I9MA 4E14A 4E3WA 2NTEA 2PYIA 5FTLA 1UODA 5B1DA 3WJAA 3AY0A 4JUFA 1B2LA 4PNHA 4DT1B 5TQJA 2JDIA 3GVXA 1RQXA 5ADUS 1YQWA 3GRCA 4I55F 4YDQA 1UDBA 2E9SA 4IHAA 5HE9A 2PUHA 4EUKA 3KU1A 4H3SA 3N05A 1NUAA 3NEPX 4LXXA 3HXLA 4FSDA 4EB8A 5BR1A 4DV0B 3EUAA 4NVRA 1AOXA 1JG6A 4JSYA 3D8RA 2GYYA 5AVYA 3H2TA 4Q0MA 4L8FA 3RC3A 4ZGBA 3HKBA 3UZ0A 4TKVA 1FDVA 4JASB 1X3LA 2F3SA 4QBTA 1FTQA 1CR6A 1KYVA 1V8ZA 1DNPA 2GWHA 3FTQA 4KXQA 5L3SB 1KZ1A 1Q95A 3DVSX 5TGDA 3R8CA 1II8A 3LRTA 4HTAA 3RC8A 1G5TA 4FTWA 4WCDA 2LE0A 1XP5A 3B7PA 4MJLA 4B3CA 2Z1DA 4NF2A 3QUQA 1YB5A 3OUUA 3CZQA 3T4XA 3V55A 1GZVA 2OPBA 2RARA 4AJLA 5IG2A 3K4QA 2K5UA 1NAIA 3MTAA 5CYGA 1SKYE 1OBCA 2JHPA 3KPUA 1PEDA 3O90A 1M6EX 1W8IA 1IZYA 2PGDA 4JQZA 4CEJB 1UMCB 3G9XA 1UBRS 3EQ6A 2B20A 1TZKA 3F4KA 3O4VA 4NH4A 1FLNA 4TS9A 4JWTA 3DLAA 3O3OB 3JRXA 3RUHA 5BSRA 2CUZA 2EFYA 5EMKA 1AMNA 4G1UC 1TMGE 2D4AA 3PHLA 4QATA 1KNXA 3A1SA 5TRTA 5K3BA 2XB6A 4MVXA 2J7KA 3ANMA 1J21A 2BONA 3GRAA 3FVTA 3N8DA 1ELOA 4JH0A 4RTQA 3VAZA 5H0IA 4EA8A 5JZSA 2FGKA 1YMUA 4JVOA 1XN4A 1NUSA 3NBFA 4KP7A 3JXEA 3RCBA 1IVYA 2ZU0C 1NBOA 3AGPA 3U3RA 3OM9A 3ZYZA 4AULA 4YV1A 4HLUC 1CY4A 5AE1A 3A27A 2ZULA 4M0MA 2AN3A 3M2PA 5EIAA 3UJPA 3BQMB 4QOHA 2Z43A 3LIIA 4QT4A 4EI9A 5J4HA 4BLRA 5BSWA 2QGFA 3HLTA 3REOA 5T3YA 4R71A 3OJXA 2I2XB 5JAMA 3OIGA 1YZUA 2QVCA 2AD5A 2O0LA 1JG7A 3R0XA 1TUBA 2DY0A 1PU2A 4R3WA 3RNLA 5TEWA 4CL2A 5ECWA 3DA8A 3W7BA 1TCVA 5I5EA 1RWMA 1J2EA 4PG6A 4QDUA 5MN6A 4U0JA 2O8FA 1LX7A 4IUCS 3TMYA 1U2SA 1IHOA 3DT8A 4EO9A 4DCCA 1YDMA 1H1DA 3PKJA 3QE0A 4M6WB 2OECA 4PFKA 1X2EA 2VWHA 4UUAA 4Y6RA 1K3FA 2QL9A 3ZUPA 4NXMB 5D84A 3GFRA 4UHKA 4N7MA 2VPTA 1MQSA 1VBKA 2QUHA 4MW4A 5BR8B 1FNCA 4QBFA 1U5AA 1OFIA 4M49A 2CMKA 2JJYA 1X2BA 3HSYA 5T5QA 3E9QA 1DE0A 2B4AA 2WWHA 1K6EA 2O7QA 1JZQA 3DCJA 3W5AA 3DGFC 4WKCA 2CLKB 5BNWA 4ME6A 2O8FB 3ZH9B 3JASB 1E6MA 1K97A 2FPGB 4IMJB 2G1KA 4REQB 5E1BA 1U0OC 3THRA 4QPDA 2JGEA 4C4XA 4B82A 2B4TO 3PI7A 2B6HA 4MYTA 4RF4A 4P4SB 2JGDA 3G8AA 1N75A 4C0BA 2R6DA 1MR3F 3T9DA 4XXHA 4UCFA 2HSGA 3H8SA 1R6XA 3R6DA 5AVUA 2Y71A 3CCBA 4JLAA 1KEZA 4CN8A 2GLUA 4MVJH 1R9NA 3II6X 3H1GA 1XN1A 3H2JA 5E7QA 4JC5A 5DSZA 3V7WA 1ZXBA 1A88A 3Q6NA 4E3ZA 3DZDA 5IJ9A 4BFWA 1J8YF 2JCGA 2WNHA 2P20A 4YIHA 3CLSD 3HWSA 1EXNA 1PG5A 3FYHA 1IVNA 5ALXA 1GCAA 3C43A 4UVEA 3UHPA 1STOA 4LJ8A 3CH5A 4QYMA 1NI4A 4RFSA 1NR5A 3MMSA 3TLXA 4PCUA 4QREA 3RLIA 2ST1A 1O94A 1U0FA 4ZTBA 4ALNA 3IEUA 4Z3OA 2GKOA 5DNVA 5JVDA 2YHIA 2FAXA 2NLOA 2NW6A 2Q5IA 1M0WA 4DLNA 1V4VA 2X22A 3FGOA 5CYOA 3LRPA 1ZD1A 4WAUA 4CKWA 5AM5A 1J49A 2C9OA 4FKMA 3RFXA 3P5SA 3FMPB 4HMOA 4TKMA 1FVHA 2I03A 1HT1E 4B35A 3RV2A 2R97A 7ABPA 2ODBA 4P7FA 4ZT6A 1MOPA 1VI2A 3CEHA 3L4EA 1KAHA 2WHEA 3ETCA 3N75A 2EFJA 4DG8A 3QEMA 1IUNA 1N6IA 2VPIA 5MHTA 2DQKA 2NO6A 2RK4A 1E0KA 4H15A 1CQPA 2EG9A 3NHSA 4B5LA 5HKBA 4FX5A 2V55B 3W77A 3H97A 4IRXA 4RF3A 4BKUA 3HYCA 4JJ6A 5CU7A 1XMQC 4AMGA 1N57A 3IEMA 4CCYB 1ODKA 4H7DA 4CM8A 4MIOA 3GR0A 2WWRA 1BE0A 1CZRA 3G8YA 4RPLA 4BVEA 1W6UA 3ECCA 2C4VA 3RAEC 5E9WA 3S2GA 5IVDA 4W9NC 4ZVMA 4M1YA 4NZ9A 2OXFA 2V8BA 3ZCTA 4JB0A 1P5RA 2Y9MB 4P81A 1E3WA 1ABEA 2XUAA 3TPZA 2PJZA 2YJZA 4IICA 1XA3A 4I3GA 1TTHA 3LNOA 3F9IA 5HILA 3GGPA 1CK4A 1L4EA 3ZD9A 3H5OA 1TJ5A 1L1RA 4AURA 1XZFA 3OJEA 2VP2A 1DB3A 1N1EA 5JWRA 2FUG6 5IX8A 1EBUA 3KHUA 2XZDA 2BN4A 4G25A 2HA0A 3PTLA 4O8CA 3TSCA 4F9FA 3G5TA 3IBSA 4W5WA 2F59A 2QQGA 4RH3A 5BVHB 1Y5MA 4U2FA 4ZOBA 2H4JA 3U3JA 3OPYA 4HJRA 2RBGA 5E0KB 1WZUA 2FR8A 4YA6A 1C0EA 1AUXA 1YZGA 3HWX1 4ZQBA 1R74A 1AHPA 2CUNA 4FYIA 2B6NA 1UKCA 2BGWA 1A96A 3E9NA 4FFLA 4UAVA 4W5QA 1XYYA 4TVOA 1B1CA 2FSIA 2PU7A 1GAEO 3A9VA 1Q6YA 2WJ4A 3I9V1 3N2ZB 5KTPA 5LQDA 3A1FA 4BMNA 4CF7A 1A1VA 4B3MC 2ALJA 2DQZA 4KFCA 4DR7B 1FFYA 1WABA 3EVNA 4IG4A 1YDFA 3PSHA 4RYLA 2UXCB 2O4CA 4MUAA 1EIZA 2CE7A 3ME5A 3QKIA 4GRIA 1IJEA 2HWUA 4YYEA 4OXNA 4D9IA 1KRWA 3DTNA 3VZDA 4ZEWA 4WCFB 2YV3A 4RXMA 4Y2XA 4B17A 3LXUX 4U6QA 3V7FA 1TGYA 2X1VA 2ZPTX 5JWHA 5KNDA 2F3UA 4CGYA 5ESXA 4R5HA 4FPXA 3GPIA 5ER6A 1D4AA 1WCIA 3OOHA 3ICVA 3D7SA 1MNQA 3SF8B 4M1EA 2HLDD 3UATA 3VZBA 1RXWA 5SY4A 3MBKA 1XC7A 1FTYA 4X97A 2OG2A 1E2IA 5KINB 2JNWA 1SB8A 3HXQA 3PDHA 1GNPA 1DJPA 2QRQA 4O5OA 4OI2A 3TKYA 1I4EB 1NT2A 1O0SA 2PD3A 2ZJAA 3OFND 4LA4A 4GX1A 4R8SA 2P8JA 3AB7A 4LY9A 4MUNA 1RZRD 3E9ZA 3T38A 2WHRA 4FTFA 4Y2GA 4LF8C 1NYLA 3BXPA 3V4SA 1NT4A 4NPCA 2PT5A 2XODA 2R7KA 2GNPA 1UOEA 2WUWE 5EJ2A 2CBZA 4DSTA 1AS0A 1M34E 1PFWA 3DWIA 2BBTA 2VZLA 5K0ZA 2I4IA 3MZ0A 2PFKA 5CIWA 3SSAA 2RJOA 1B6GA 1YVUA 2NO0A 3BZUA 4W6QA 5EGSA 1E2NA 5SYMA 4B9EA 5HYVA 1W48A 2IPNA 3G1UA 2F8LA 1NX9A 4WVFA 3Q1KA 1GADO 3AQ4A 2IVFA 4XCQA 2C7RA 2D06A 1O87A 3O1HB 4X65C 4L07A 2F43A 5CRIA 3IIIA 3F6YA 4D45A 5BSEA 3HYRA 4YMLA 3LNTA 3K6RA 3VTKA 2P5UA 4O4LB 1RP7A 3EMDA 4QHYA 4ZT5A 3FNRA 1SG9A 5AKHA 1O5TA 2RD2A 3HCOA 3EZXA 2I4RA 4MVJE 3BULA 3WLLA 4ACAA 1WMEA 4TRRA 3REFA 2PIAA 2OENG 5ALTA 3LF1A 3FMOB 5A03A 1TO2E 3DOHA 2G88A 4FGKA 2NVWA 3WQHA 5BW8A 3HPQA 5IABA 1JHAA 3FIJA 4TYPA 3OEHD 1R6UA 2QY6A 1U8FO 3KFXA 3KT0A 4YP1A 2WQ7A 4OFBA 1T5HX 3D2AA 3V4RA 4D56A 1CVLA 1YA4A 5CK5A 2DLCX 1ABBA 1N0VC 3Q5GA 5I8PA 4IGKA 5KQSA 1J8FA 2Q4OA 2XB4A 1YRYE 2HEIA 1JILA 1IU9A 4MV6A 4F6RB 4X60A 2E7GA 3URKA 2PDAA 4K3VA 4CT0A 5F5LA 4IWXA 1VE5A 1FTGA 2FB9A 3VH3A 5HUHA 10MHA 5FT9A 3D8HA 3G2QA 4D57A 3LBAA 3O8QB 1QTNA 2W2VA 1MJNA 2UDPA 1SXJB 2MMCA 3KQWA 3KVVA 2JAXA 2XZTA 3OUZA 2X8LA 3OQ1A 3PXCX 1CFJA 4LVOA 1QJCA 2YIDA 5K0NA 3ROQA 2IS2A 2HEGA 2CJXA 4J9UE 1JZTA 3OIYA 4HAZA 4BQFA 4XTCS 3TR3A 1RACA 4G1MB 5HBGA 1CUYA 4E08A 3VSDA 5K3OA 1HE8B 4F4UA 5ICSA 2QN3A 1K0FA 3EWIA 2PXXA 1U99A 2RH8A 2XRYA 4UU7A 3SMVA 4B34A 4DZTA 3UXMA 1WCJA 1W5TA 1MVOA 4J16A 5BPHA 1LS1A 3VUFA 3AUAA 2NXNA 2PNFA 4D3FA 4J1NA 3DXFA 2JFNA 1K8QA 2YZMA 4XUCA 5GV8A 2DWOA 2PR2A 3AR3A 4ITRC 4B40A 4S1OA 1DS6A 1ZBQA 1H0SA 3BERA 2XJ9A 2PT7A 1G41A 4NJMB 3Q7TA 1IC6A 2C3PA 4R4JA 4MYHA 4P7JA 5T67A 5KAMA 3T06B 4JC4A 2XDQA 5DLYA 4FOOA 4EYKA 1QNFA 2D4HA 2H4XA 1XHLA 2ODAA 2ORWA 1KDZA 3VR4H 1ZGBA 1OPXA 3U7HB 2CYAA 1P81A 2QTBA 4UULA 3N9IA 4IWYA 4LK3A 2A1TR 5EZYF 2AF4C 3PR1A 1TLTA 1ZN7A 4FE3A 2BZ0A 4RLQA 4HFJA 3OBIA 2D5IA 4RD3A 1HZZC 3H2HA 3HCFA 5FNVF 3TZQA 1BMFD 2QYSA 3BCSA 1XVAA 4XE5A 3WGNA 4E94A 3CB2A 1OYVA 1OREA 1TYBE 1XL1A 3O8CA 2FI1A 3OCCA 1DDOA 2FPWA 3EH1A 1MB0A 1VHTA 3SE7A 4WBNB 4ARZB 2E1RA 1BFUA 1E9CA 2BMEA 1GO2A 2YJ6A 4XQCA 3G8DA 4Z0PA 3L6BA 2ZE7A 3T3DA 3EAGA 1QPBA 2EZ4A 2QAGC 4LE2A 4PQYA 3ENVA 4ESOA 2OAQ1 5DLPA 3AM3A 3DFMA 1Z6XA 1UDAA 4BAUA 1BTOA 2RGYA 1CXZA 4YJ3B 4IXMA 4KCGA 2WJHA 5AXCA 2YHBA 4A6XA 1M1NA 4G84A 1N0IA 3G0CA 3V1UA 4K5QA 1YACA 1GPWB 2B25A 2EOAA 1L7BA 2C5BA 3GT0A 4JQCA 4NBSA 4DJEC 1DAMA 2UZIR 3B6ZA 5KWSA 1B73A 2P77A 2FV8A 3EIFA 3NTRA 4IEEA 4ANFA 4ZVUA 4QYWA 3UG6A 1CIJA 4TWRA 3CSDA 5JVDB 4AN0A 1NULA 5EHIA 1A2QA 1GPBA 2NYVA 4JA2A 4UHDA 3KPYA 3AHJA 4JLBA 3WSVA 2EDCA 4ENUA 2QBYA 4TTQA 5DHQA 3TVDA 3RSOA 2OY0A 3PC2A 1QMPA 1XAIA 1V5EA 3BSFA 2CCKA 1EAYA 3HV0A 3RS9A 3C1OA 5BQFA 4AJHA 5LMUB 1QUFA 4F3NA 1FFDA 1OZHA 2XY4A 3SC4A 4L2IB 2J3LA 4OAQA 1NVUQ 2JFZA 2P4SA 3BFXA 2IV3A 4MV4A 3OKCA 1GT91 1FDSA 1P0QA 4BU1A 4GL2A 4F0JA 3GK3A 2I76A 4LJ9A 2Z09A 1E66A 1X86B 2KHZA 1O90A 1YFZA 2HQRA 5BYKA 5JSHA 3ZJUA 4BMXA 1X8KA 3WA7A 5ALWA 2QL5A 4EBBA 5DYWA 3SLGA 4RJTA 1DC8A 1U7ZA 1DFGA 1K08A 4FILA 4LCJA 1N2FA 4C7VA 2OXEA 2G5CA 4V38A 2P0YA 5EJIA 4E30A 3OO0A 2PZKA 4MZDA 4HH0A 1C7IA 1RBZA 1TX4B 3I8XA 1E2DA 4FWBA 4BQSA 1DXQA 5AM2A 3G5UA 5AI5A 3RWBA 4BOYA 1K6JA 1YCGA 2VQDA 4XVHA 3BRWD 3FCUB 3NDPA 4HDCA 2YYSA 2ZTUA 1W36B 2YH2A 1NKTA 2OM2A 3DC2A 4FYJA 3T5CA 3TAXA 5I7RA 3NOOA 3GAMA 3AP1A 5ECDA 5I9NA 5KVAA 1T4DA 4HO1X 1WDMA 3CR7A 1NNLA 3RIGA 4G0UA 2O8VA 5ITZB 3W4JA 1QQAA 4YAWA 1M34A 2G4VA 4ZO9A 4IUDS 1HEYA 3KSRA 1G8KA 2K4MA 3B6KA 3IQGX 1PKXA 4N65A 4GDFA 1Y6GA 2CJPA 1QFSA 1Z83A 2PFSA 1M33A 3W34A 4LKRA 1GPLA 3FSGA 4NBUA 2KB0A 1NTOA 4JI0C 2XKJE 4FCCA 3MGKA 1ZLXA 2C8LA 4ZJUA 1H4TA 2DXIA 2DX7A 4YRRA 1IAQA 3VAYA 4J29A 3RUEA 3VR5A 4I50B 2GPYA 4B33A 2V6FA 1M6YA 1MJFA 2I6XA 2V96A 3H0CA 3PGVA 1DFHA 3EVBA 1JQAA 5FPHA 1TMYA 1QFYA 1L5NA 4QUBA 2A94A 2QAJA 3PNKA 3CX7A 4TQGA 1HYBA 1XTIA 3BE8A 2WAXA 4RVDA 2WHXA 3JQ7A 1G3IA 3K1AB 2GDZA 4Q9HA 5BMOA 1B4DA 4X66B 1EA7A 4N5IX 3D1JA 3F3KA 5F7ZA 3CTMA 4EY8A 3C70A 2X5XA 3QOFA 3F3MA 5CA1B 3T54A 4DDMA 1V2HE 3QMVA 4IQ0A 3M2TA 2QP4A 2WWXA 3ABQB 1CVIA 4J49A 5TDHA 2GN2A 4M9SA 4PO3X 5AJXA 2DETA 3ZIDA 1HOTA 5BSUA 5L45A 3BK7A 3S6JA 2BMVA 1QCCA 1UP7A 1GZDA 2LIVA 2PQ0A 4Z4HA 3UY4A 1A2OA 2FQQA 3D6JA 4CFSA 2CF6A 1GCOA 2XVXA 2W2LA 4X7PA 3WO1A 2GKGA 1LC0A 1MO2A 4RCZA 2ODWA 1QGUA 1ZEJA 2JGAA 3WB0A 5JH7F 1MW8X 4Z8XA 3C45A 2QJRA 3EDQA 1P0CA 4KAJA 2IIQA 3VTAA 2PKQP 5F4BA 3OU6A 4CIDA 4J43A 4DBVO 5AESA 2AFIB 5COBA 4E22A 1SCNE 4F5DA 2X23A 5EAIA 4AS2A 4JT2A 4ZIRA 1A9RA 3ADPA 5J4KA 3PI6A 3INYA 4LF4B 3IX7A 1T2DA 1X1CA 1E5TA 5C1OA 3EG9B 2Y1XA 1C4KA 1QYWA 2KDNA 1IK6A 3F67A 4LJSA 3FPJA 4MQUA 2H2WA 2X9VA 4AU1A 1YS2X 3ZDXB 1UBJS 5DYNA 1B8VA 3SR3A 3VKVA 4DLAA 1K06A 5U1PA 5J58A 5LZ5A 2VYVA 2C83A 5L6MB 5ELMA 5AJYA 2UZ1B 1L7EA 4MKGA 1ZSYA 1FP7A 1XB2A 4U1RA 2Z9CA 1USIA 4DR4B 4IH9A 2CY1A 1PQ4A 3HM2A 3ZHVA 3F73A 4WA8A 3GH1A 1EQUA 5K3AA 4CMGA 2R6R1 1M0TA 2WJPA 1AY0A 3FB4A 4NWIA 1SBZA 1WETA 1N8SA 2FMKA 4LZJA 2OHVA 2Q3BA 3UK0A 1A5BB 5KNDH 5F3DA 1P2VA 1RABA 1YQGA 4MJXA 3T3PB 4BFSA 1XMPA 3VU9A 5CVTA 2NV6A 1IONA 4KWHA 3RB8A 4U9HS 1Z36A 2FLWA 2XA2A 3HUFA 1BXRB 4TV8B 2Z6VA 3TIIA 5BW4A 3FLAA 3P2OA 4P4UA 3IBGA 6ABPA 5FTWA 4M7OA 4FT4A 1U0EA 3VNSA 4LECA 4RO0A 3VSBA 2AUNA 4X64B 3L8CA 5CH5A 1CZUA 1O08A 4OHVA 3UOAB 1UC5B 2JGNA 4X7RA 1E59A 1GYRA 3C6QA 3IHLA 3PGA1 2FFJA 3BEDA 1LQLA 2NU6B 3KKQA 4KXWA 4UXHA 5B6IA 3U44A 4Y2YA 3RU3A 5JDIA 4DUPA 2BHNA 3HHPA 2EFGA 4F3YA 1GUBA 4FT2A 1SMKA 1SU6A 3F5QA 3Q2IA 1ECFA 3QGMA 3SZMA 4MHTA 1ZRMA 4CF3A 1Q7GA 2QZJA 3MVEA 3DF7A 3A6GA 4G01B 2GETA 2PO5A 5MDHA 5IM4A 5IU6A 3OM8A 4IBOA 1D6SA 1L7XA 2QX4A 3OA2A 3C97A 1L4UA 3E22B 4OU5A 1ZM3A 2WU8A 2IYYA 4UZSA 4JDUA 5G4KB 3STWA 4CN9A 3S8YA 2G1PA 1A8HA 4PHFA 2AYYA 4KSYA 3GUUA 4M1QA 1KETA 4WZBB 1TJPB 1L8OA 1TLFA 3M9WA 4O4JA 2ZRAA 2Z2JA 4DANA 1XG5A 1SFRA 2H2HA 4BTVA 3DYBA 4ZKEA 5AUNB 2BKAA 5ALZA 2EKBA 3GLGE 2MINB 1CF4A 3C7AA 5GAJA 2BFCB 3VDMA 4AUMA 3JWGA 2ASVA 1QOZA 2PSDA 2X8AA 2A4KA 2KYRA 2DSNA 4FHCA 4ERNA 3L0BA 1Q0PA 1VZ2A 1XD8A 1S7GA 1T6XA 3DAGA 1UIMA 5CURA 3VPAA 2ZM6B 1UL1X 3KSZO 2BD0A 3AVYA 2ZWIA 4E5MA 4MVJF 1F20A 5CLHA 2J4CA 4JBHA 1CRWG 1PJLA 1DJQA 1Z0DA 2M5OA 4GF5A 3M9LA 5A19A 3WV5A 3M4JA 2C9YA 2Y1EA 3MLAA 4ZGWA 3MT9A 4CZ2A 1RKXA 2ZUTA 1OH7A 4ZVLA 3PKZA 4Z1MA 4CM3A 1K75A 2AZ4A 2AMYA 3B3AA 3N3BC 5C4MA 1GKUB 1ULHA 4H0FA 1GDDA 1G8GA 5AJHA 3SF0A 1NPTO 5K6RA 3SVLA 2QKYA 2QPAA 3OQJA 1YRBA 2O4UX 1NUPA 3O9VA 3I01A 4GM4A 4YDRA 1KK2A 2NU8B 2JB9A 3OWOA 4B0OA 5C8YF 3TEJA 4IKOA 4HNAB 4RK1A 3NYWA 3WZMA 1LNQA 2ZBDA 1AKQA 1W25A 4F4JA 1ESZA 3GD5A 5KJCA 5LP6B 1DAPA 4ZO8A 4YR7A 4Z7QB 1EP2B 3H84A 2PKYX 1AKUA 2P90A 3NHUA 5GOZA 3D0RA 1QFXA 1F60A 1KEWA 2QYTA 1AMUA 1T2AA 5F64A 3NT2A 4L02A 4RGQA 4TTSA 2QSJA 2GHTA 2Q2QA 2NUAB 5DP1A 1U04A 3WYBA 4I5IA 1I24A 1DLJA 1VRCA 4KQJA 4K1LA 3FCYA 3S5JA 2D1QA 1JT9A 2QG4A 3A9RA 1LNZA 1RXSA 2Y93A 4HWSA 1P2DA 1LBHA 3UMMA 2XUOA 3SLKA 2IYUA 5HKLA 1KDVA 4EGSA 4RD4A 1W35A 3ANYB 3PQDA 4RIGA 2A2ZA 3EEYA 4CI9A 1L4BA 3M4YA 4D0RA 2XSZD 3ZZNA 1Z5VA 2ZEJA 2JGJA 3M0EA 4JD5A 3KTAA 1TXGA 1I1NA 3A1WA 3EEFA 3M6IA 3M81A 3NIDB 1A69A 3TW0A 1T8WA 3EN0A 4CU5A 2OCBA 2W71A 1QANA 2VJLA 1M6XA 3OU2A 3RKRA 4BBAA 3EY9A 2YVUA 1L7QA 5EEHA 13PKA 2PZMA 3GGDA 2EFEB 3HNRA 3IB6A 2YJ4A 3A1DA 3LWBA 3NW9A 2WYIA 4FC6A 4K9NA 1Q44A 1G9XA 4GW3A 3D6UA 4TMWA 2YVLA 2QM8A 2EW8A 1Y1KE 5FAXA 1KDRA 3DMTA 3FMGA 1NF9A 3ONEA 2RONA 1KO7A 3DE2X 1OC2A 3WRYC 821PA 3A3KA 3JQGA 3GFVA 2XMBA 2JGLA 1N77A 3TR6A 5CA0B 2PK3A 4QYIB 2AJ8A 5DNAA 4YN3A 5JS1A 5DK4A 1H05A 2HFJA 4YQYA 4J2TA 5KYXA 1AKNA 1XL0A 1T4CA 2C54A 2VAVA 3T0IA 1HNXC 3N1UA 5GMOA 2A5GA 3C6MA 2G09A 1SU7A 1JE1A 1RQPA 1UM8A 1U6IA 1VHJA 3KVOA 3PC8C 4KFUA 5TQ2B 3UG7A 1VMAA 5IYZA 1Z7BA 2R68A 5K7SA 5KC9A 1QKJA 2DTXA 3LKDA 4IMPA 4REMA 5EUQB 2OQVA 1DEHA 1TC1A 1UBEA 2V45A 2I7DA 2Z83A 3AL3A 3CZAA 3EOZA 2WD7B 3LWDA 5CLIA 1ZUHA 3DOCA 1EP1B 2IYOA 2WU4A 2JANA 3ZV6A 4B4DA 4Z1OA 4IR7A 1HE2A 3RVJA 4DV3B 1ICIA 1MXFA 1FUGA 1AKWA 1OBFO 2RGNC 1SCAA 3LQKA 1QGAA 3TLCA 3SEQA 2UV8A 5JH7A 1YB1A 1T4CB 2CLIB 3RAJA 2WKPA 2NCLA 3WLJA 1XLTA 2H1HA 3GIWA 1ZOSA 4QT0A 1GRCA 3OTQA 4Q4CA 2CBXA 3LLUA 3MSXA 4G3XA 4ZQGA 5B1HA 4F1KA 1V37A 3GCWA 5A5FA 2W6ID 1ORTA 1UEJA 1VYTA 2B1JA 4LDNA 4QOIA 4TS4A 4ZANA 2CXUA 1G20B 5I7FA 2ZZMA 3R20A 2G0AA 3KEOA 4JB8A 1F7VA 4NNOA 4M9ZA 2BJWA 4GLLA 5ENDA 2WFLA 1NPDA 1Q0UA 2B21A 1GAQA 1U8AA 5L7YA 3NM6B 2CXQA 3VZSA 1NL3A 2GBIA 2W2OA 4DNFA 1YBFA 4JI7C 4DJDC 1SXQA 1XT6A 1H93A 4Y7CA 4A2WA 4CWAA 1KK3A 1OASA 4MGZR 5HTKA 4HGQA 3SBOA 1J9EA 1GQSA 1WUJS 1Y1PA 2HN9A 2G0NA 1CIVA 1RRKA 3EERA 1GTMA 1WY5A 1KP2A 2FP4A 2OYRA 5IVPA 1HR0B 1C9YA 4MCIA 4BP1A 2HV8A 4IINA 2J0SA 2OD2A 2K2WA 3AUKA 3KZKA 3OKAA 2J41A 2X6RA 2PX3A 3QI7A 1Q57A 4LYHA 5EINA 4BNIA 4N8DA 5A06A 3KQKA 2X4IA 1HPLA 4UCQA 3OFKA 3BA1A 1TI7A 4XEHA 4B6EA 2ZDQA 1TQ2A 2WYOA 2R5FA 2X9QA 2I6UA 3O0DA 2YVAA 4F84A 4TLMB 3AFNA 4LTDA 1V6SA 4I6GA 2YJNA 3C8UA 3TH5A 4BLUA 3EBOA 4PRKA 4V02A 3U4QA 3NORA 2GASA 1J20A 3KQSA 5KMGA 5JMTA 1DKPA 3L04A 2ZCVA 3N5CA 1POXA 2OB1A 5I7WA 3CPSA 4DR5C 3OP1A 2X1LA 2G9RA 3WGQA 4NEGA 3LT0A 4S1PA 3DBHA 4A2PA 1UANA 3E70C 1SCIA 3IP3A 3LPDA 3ELUA 5F12A 3TUIC 5LU9A 2VXBA 3DMRA 3KTFA 2XUFA 3L0PA 3QFFA 1XVTA 4US0R 4GXRA 3TL3A 1ZB9A 1RYBA 3JARA 3CLRC 1SIOA 4IVPA 4P8RA 4D74A 1R9JA 3RAGA 3FX2A 3KEFA 1SUAA 5FR1A 3C8DA 3IP9A 1FNMA 2H0QA 1B6TA 3L7NA 3NHKA 3RW9A 2MR6A 3K92A 2OAGA 5KDDA 1L7AA 3KJZA 2D3TA 3L93A 4F3TA 3LWNA 4YMTA 4N7RA 1PZHA 1Y4DE 4LMBA 4MRMB 3ITKA 5JXJA 1BS2A 3Q98A 3C3MA 3DBHB 2Q29A 4BAZA 1EHCA 1E3LA 5JXWA 1L7NA 1OLXA 1Z15A 2JFHA 4LRUA 1GU1A 4LJYA 3B53X 5D7NA 1SQ5A 2XYPA 5DWQA 5FI5A 1Y63A 5AKKA 5KTNA 1H1TA 2CLHB 2A7XA 4QUEA 4KDRA 5LXTB 2WKRA 1LFDB 4NS4A 3JPYA 3SDSA 3TLZA 2UYHA 4BVHA 3CMMA 3NOVA 4PIVA 2O5CA 1XHFA 4LXYA 3CQ3A 2IZ6A 3OJWA 3HJFA 2BHTA 1LK5A 1BGXT 3TVTA 3ZI7A 1FK8A 5T7BA 4TLLB 3DR5A 3FHLA 2HA3A 2D1FA 5FL3A 1WDTA 2F9LA 2VK4A 3DZHA 5CXUA 2FZLA 1HGXA 4QXQA 5DSTA 3OCXA 4AKIA 4KV7A 4ID9A 3STUA 1WXXA 2CCJA 2HCRA 3T3HA 4YJ3F 2C59A 2Z5VA 4DKXA 4P32A 1T5OA 2IGTA 4ZLPA 3IEVA 2VNJA 1WLYA 4AQYC 2W2MA 2QROA 2ERYA 4Y0AA 3JWIA 2JFVA 3QOYA 2B2XA 4Q9AA 1JXOA 4IZ6A 4K1XA 1I5EA 1NW4A 2FSVC 2V7VA 1GR0A 4WKOA 3S2SA 3VR5H 2J3EA 1PJZA 4FGJA 2D6FA 3N3AC 1F5NA 5JJLA 4RSHA 3RTAA 2IY7A 2IXAA 2Q5HA 2YWJA 3QTBA 2XOKD 2CUKA 1RM3A 2IOFK 1OXXK 2YWFA 3EGIA 3HFRA 1U8UA 3I6MA 3KWLA 3LZDA 3LYHA 4RZXA 5DGIA 3ESAA 4U63A 4RACA 2ONJA 2DBQA 3RO7A 1N34B 3I0MA 1O9TA 4I9UA 4NMMA 3VX3A 1DO8A 5EGNA 2D7JA 5NLLA 2WA2A 4II3A 3EDRA 2Q7XA 2OBYA 2PGLA 4FX2A 4NTZA 2FF7A 4NL4H 4DSUA 1T35A 4MOWA 4R0NA 1ZGHA 4JFAA 2DULA 2EKZA 4LF7C 2D74A 2YQZA 4ID3A 2A4MA 1H1LA 2EBUA 3DKIA 2QE7D 3L79A 1G6KA 3CUTA 1W19A 5ES4B 1ML3A 3Q7IA 1Q21A 3LNCA 4KQEA 5HKOA 4M76B 1SRRA 5KSPA 1E2BA 2CMGA 4I5GA 3WLOA 4OQZA 4UOQA 2DRIA 3MRVA 3C3XA 4FMBB 4BNJA 3WRVA 5DU2A 4CKBA 4ZQEA 3T4EA 3PUZA 3H17A 1V6CA 1N92A 3B1VA 4B7AA 2FPRA 2Q0XA 1Y8AA 3CQ9A 4LV8B 3TNJA 3ZVRA 4U2DA 1G2PA 4R68A 4EL5A 5JS8A 3LHDA 2GD2A 1QC5A 4RVSA 4YJFA 2VTBB 5JMOA 1R1DA 3DEYX 2WMDA 4GSKA 3PCTA 5EZYA 3DYIA 3TZLA 1FQOA 3CQ2A 3WJ7A 1IL0A 1YT5A 5ARBA 2J33A 1WD7A 2EJWA 2QTZA 1DJLA 1P31A 3A9WA 1FMLA 3CBQA 1E6EA 2P9BA 1DOHA 4DA8A 3IV7A 1Z7GA 2GK7A 3MMPA 1TF5A 1YJXA 1DJNA 3GDFA 1NW5A 1J25A 1XWWA 1ZN9A 1ZMRA 3ETHA 3UUGA 4KHPB 2E4XA 2ZS7A 4ENPA 1UPAA 1X3SA 1XMXA 2WWFA 2ZSUA 4P1ZA 3WGZA 1OGIA 5BWLA 1FOEB 2Z8YA 3E3OA 4KH1A 4BVGA 4U7HA 3S2UA 1CIPA 5AO9A 4AMUA 5CDGA 5E6RB 1X1RA 2C29D 4G1FA 2IZ1A 2QLJA 3HDHA 3LBFA 4IIHA 4KXVA 5EFZA 5JAOA 1C2TA 1Z2EA 4J8PA 3EGWA 1RKVA 5C4IA 4EG6A 1NBWB 5JHGB 3GR1A 5JTTA 3BE4A 4IV0A 1JPVA 4LS3A 4MQ4A 3K9BA 2CHVA 2AC7A 3QXCA 4DXAA 1FU7A 1QHHA 4S0ZA 1QOQB 1MT0A 3UV3A 4E2WA 5JNRA 5J2UA 3F6BX 3KHSA 3A10A 1TJ4A 2YCLA 2NYRA 3UF0A 4H6PA 4MB0A 1ZZGA 1JU4A 2E18A 2KPOA 1C8BA 4GL4A 4RK0A 4J76A 4OQ4A 3B5EA 2BR5A 2AI3A 3W9YA 8ATCA 2X4LA 3X1MA 1WVGA 1DMRA 2P0EA 1CEXA 4FDAA 1UPCA 4N4AA 2PXAA 2XB2A 5LM3A 2NPFA 3IPYA 3KKZA 4GMKA 3IUYA 4MITA 2RC5A 1UPTA 1XVUA 2W0SA 4GMDA 4L6IA 1E96A 1M1ZA 1PWYE 3UJBA 3WDKA 2Z0MA 1ECGA 3CONA 3NGXA 2CHUA 2FZKA 3P2MA 2XNDA 5BN5A 2PUEA 3RBAA 1PN3A 5DFAA 2PA3A 3K0EA 4TUYB 2PGJA 2G9ZA 3BICA 5I4CA 3RS4A 1S4QA 1EUQA 2XWQA 4C7MA 1XA4A 1R50A 4ER6A 1FVOA 2ZIGA 4LRTB 2YMQA 5BRNA 3VBEA 3WVNA 1EWKA 1SH7A 3JX9A 3BJRA 3QMPA 5ILQA 5HQ3A 4R2JA 3CR8A 3CUKA 4DR3C 4E70A 1O03A 2REOA 3EC2A 4WLNA 4YJHA 5ALLA 2D1SA 1EGHA 4D1YA 4B3MB 3C8ZA 4V0MA 1E0AA 3PRYA 3O8OA 1RJDA 2D5LA 2RMKA 2HWXA 4CM9A 3ACCA 1UXOA 1VLLA 1YWGO 5HDBB 1YB2A 5IKXA 2GHQA 4P58A 4N3BA 3D7RA 4EWLA 1WOYA 3CYFA 1RI5A 2RSLA 3GFGA 4RMGA 3GLGA 1HEIA 1J8MF 1DTSA 3MOGA 2PMDA 1NVFA 4QBIA 3TQQA 4NCJA 3QU2A 5B4TA 5BWMA 1CF2O 4XFJA 1ECPA 4R40A 2MYUA 3HDJA 3DZ8A 5CDFE 2BH1X 1SUSA 3PXDA 4S04A 1R0WA 3FR7A 4NAHA 4UU1A 4GOXA 4BNDB 5BORA 2MYTA 2YIVX 1E7WA 3JZDA 6ADHA 1HQKA 4OKSA 5AW4A 2JASA 4NCHA 1NQAO 3LGAA 2Z3ZA 4K3UA 4TXJA 4DQUA 3K3PA 1YQTA 1FFAA 1I7DA 1AV6A 3QF4A 2C97A 1TPZA 1F0KA 2A9VA 1DAKA 1Y4SA 1E9SA 2FXIA 2VIIA 2WFAA 1EHYA 3NR2A 3ZK7A 5IDVA 1ZA1A 1YJQA 1ORHA 1V7QA 1V39A 2R4TA 3CSSA 3NV9A 1CY0A 4HTFB 5FO0A 4KUEA 3SZUA 4ZYVA 3D3EA 1BOOA 5HZHA 4HX5A 1KO8A 5EXPA 3LHIA 4ZT7A 1AE1A 1U2GA 3PNQA 1GFZA 3KELA 1MJ5A 2CXRA 2V6IA 3WY9A 1QDUA 3BJZA 5LNK6 3IPLA 4ATNA 3ESBA 5GWXA 5LU8A 1HNNA 3F8SA 1DRVA 1EFKA 4MWTA 5G1PA 2WIKA 2H8KA 4V0NA 1GCIA 1O57A 4BGDA 5LBIA 2DEUA 2EGTA 1KPIA 2QV0A 1ZK1A 4I9FA 3FYCA 1CETA 5DN6A 4L5BA 1TAQA 1D2GA 2H7YA 3CZRA 2AYXA 2ZI6A 1Z0AA 2MIIA 3ZZTA 5MN5A 1H5NA 3UANA 1HDIA 1HNWB 1LSOA 1WXHA 5F21A 3IT0A 3KYCA 4R2WA 4YRDA 3CMCO 3NHBA 5FWYB 3TQSA 4H7HA 2PWZA 1NHWA 1PIWA 2BF7A 1KI7A 5LQSA 3SX4A 4K9RA 4N49A 4Y2JA 2VAWA 5C7OO 5JBIA 3I9FA 2FY8A 2O7NA 2ET6A 2QVZX 2V4MA 3H16A 1NFRA 3QLEA 5TX7A 2GO1A 4V0LA 3SC6A 4QDTA 5IN4A 3STXA 2UAGA 3P26A 2D62A 3BMNA 5DHFA 1NJ2A 2XVZA 1LLUA 1FA9A 1ZS9A 1EI9A 1X7XB 3R6LA 1E5LA 1JQKA 3DTVD 1UM9A 1V96A 1A50B 3IVAA 1OH8A 3RSHA 1YE8A 4KX3A 2HZ7A 4NABA 5K3SA 1K7SN 2ZE5A 4BMSA 2R7MA 4LJKA 5EQTA 1T3LA 2O1XA 3O9MA 1EINA 2XTJA 5J2TF 3FYSA 3VNUA 3R5TA 1RHQA 4M0LA 1QDLB 1OYOA 1ES9A 5DKFA 2JJ8A 2AJLI 1XRNA 4H6XA 4GECA 2E2WA 1BW9B 1CW2B 4IDEA 4M87A 4DSAA 4Z4CA 1WF3A 4BNFA 4C2TA 4AZ0A 3MGGA 1PX2A 3G79A 2FNAA 3T5AA 3WLKX 1EVYA 1GNLA 1KAOA 2SKDA 3PYLA 1R88A 4DEXA 3G9UA 2JK0A 4YRMA 4TTTS 2KSQA 3EVEA 2ZUDA 1GGNA 3D8BA 1KI8A 4BYMA 5FUMA 2VDUE 1U9IA 1OLXB 4OF4A 4N6NA 2EKQA 1JKFA 1YULA 3D0OA 3OO1A 2IW1A 4TWAA 4OLBA 1MUUA 4S05A 3DHVA 5A1IA 2XUPA 1FIUA 3IULA 3L8DA 1Q7TA 4JJAA 2FPPA 4UUMA 3TLGA 3CPJB 3T3NA 1GP2A 1JJ7A 4E13A 3WK5A 4F7DA 2FWAA 2AX3A 4RA6B 4PGHA 3RS7A 3K9NA 5JCJA 1EUYA 1A3CA 1FX0A 1LQTA 1EWYA 1YRQA 4H4EA 4LOAA 2NN3C 2B2CA 4BCDA 5B6JA 3IQDB 2PRKA 1TMKA 4EHFA 5AVTA 3HO8A 5ERYA 1P4GA 1EK0A 5CTJA 5JUWA 2AS0A 4OREX 3PUKA 1BU8A 4BEVA 1GDTA 4Q3DA 1DHRA 3GRVA 2BI4A 3JQQA 1TK2A 4C88A 3PJGA 5AVRA 2PUFA 1M74A 1Z6GA 3O3NB 4O2BB 4QUAA 5FV4A 2BM0A 1N6KA 1L8AA 3BB4A 3Q0EA 2OV4A 4MMXB 2DG2A 1C0KA 5KVCA 3U44B 2PLFA 4NFYA 2Q0QA 1TF2A 1EFPA 1UBUS 3LVFO 3OAAD 4GI7A 3HU2A 2C2HA 2CDRA 1W85A 2PL3A 4OYRA 3EDCA 3IUEA 4IXTA 4ZHSA 4NR0A 5KZMB 5A9SB 1ZITA 5B2FA 1CY8A 1DG1G 5KOIA 3KVYA 4FCWA 5BOSB 2ID9A 2NTNA 4GWLA 2KMLA 2QG9A 3QBEA 4DA0A 2J5KA 4MRPA 2N46A 1YIAA 1TZMA 3HBFA 1M83A 3E22A 2L19A 4MVJD 2ONZA 1QWSA 3N76A 3PFHA 1YDGA 2OHFA 3I42A 2VDWA 2ZT6A 1WR8A 3BCRA 3GBSA 4JYBA 2EP5A 3RSCA 2GF0A 1EGAA 3SKXA 3WHLA 1N2CA 3IP7A 1O5IA 4BIMA 4DJFC 3HP7A 3E9MA 1KIAA 4E07A 1QFZA 4EUNA 1GG5A 1GL3A 1ZQ9A 2IHTA 5K8TA 4CMIA 1VC2A 2HYDA 1NSYA 2PL9A 1Y98A 5CIQA 3FKSA 3C14C 3GLFE 3KKLA 5AYVA 4Z3KA 4YCNA 3PIDA 2VXYA 2IXDA 2DFVA 2X40A 3UHFA 3NPAA 1K0UA 4GKBA 4A8JB 4A26A 1ISSA 4GI1A 4JOCA 4QRIA 4Z4IA 1O6CA 3WIVA 3L4KA 3HH8A 4HNTA 2IF2A 3WQSB 1Q92A 4YP0A 3SEZA 5GJVC 3HZRA 3DZCA 3EXIA 5CB4B 4BL5A 3QYFA 3L0CA 3F49S 5J40A 2GJKA 1VLMA 4K0KC 1WUKS 1TQ4A 4L5CA 5JAUA 5BT9A 1QX3A 4QDKA 1GPJA 1RYHA 2WRZA 3TXXA 5BP7A 5GGXA 1P6UA 1EG2A 2J67A 2JRCA 5DGXA 2P62A 2VBIA 4X0EA 2X0NA 3HBNA 4P34A 4D9FA 1CUGA 4POOA 4F91B 4LJLA 5M5BA 5AKZA 5HQJA 3ROKA 4DJAA 1WB9A 4L7VA 5B7PA 4K46A 3LBHA 1NIJA 1A9XA 2F8SA 3MF4A 3VSEA 1DU4A 1P4EA 1TZCA 2Q5CA 4YPFA 5T41A 3WGMA 2ZDHA 9ATCA 4Y0NA 1BKSB 1GY8A 2P2DA 1EGMB 1KWKA 1Z4LA 3BFJA 4HDOB 3K8OE 3C16C 1ZM7A 3AW9A 5AXAA 1HUQA 2QZPA 1Z45A 2BSAA 3RS5A 3HFGA 5HGJA 1M2GA 2EW1A 2IEBA 1GR1A 5IJ0A 3GARA 1XA0A 2VDKB 2WWGA 3GJ8A 4U3JA 4U4AA 1E7YA 4JGBA 4DV0C 3TL6A 1FRQA 3S28A 3DM5A 3VYSB 1GGMA 2EXXA 3DV0A 2DB3A 4Z8YA 4A0GA 1EWQA 1H9BA 4TWIA 3CEPB 4FOSA 2PQMA 4YAEA 1F1BA 2A9FA 3A05A 1RLJA 3GROA 1AKTA 2Z04A 3DONA 3MILA 3REGA 5ALPA 5M04A 3NGMA 4L8YA 4XWWA 2ADMA 5AJWA 4M0EA 2WJYA 4OUDB 4DXHA 4X6XA 2EWMA 3ZXIA 1F0PA 3RQSA 3CJRA 1OZ0A 3GV0A 5G0UA 1OWOA 1XD2A 1XS3A 1VKHA 4CCWA 2PG3A 2IHZA 3OTGA 4JEIA 2QPOA 1K89A 1OGJA 2B2NA 4H1VA 3N8KA 1JNXX 2CXOA 2XF8A 4HK4A 3SHFA 1Z2DA 2X3YA 2VDMB 3T35A 1GIAA 5A4KA 4YO8A 1YJ8A 2CVZA 4BWGA 2G6TA 4KU4A 2EBFX 2WTBA 5IWAB 1E2KA 2H51A 4JI5B 1LLFA 3EVDA 4FFNA 2OBXA 2JFGA 2JZNA 3IURA 4RV4A 3P0RA 4PNPA 1I3MA 2X2PA 2DWCA 2CHFA 3GJ4A 4UHJA 1BHSA 3RU2A 3U4GA 2Q0SA 1J97A 3A6ZA 2VA9A 1E3MA 1BAPA 4BFLA 2R44A 2QJFA 1XTQA 1TW3A 2CJWA 1NPYA 2PNJA 4BO3A 4D9MA 4ZFNA 2R7NA 3COYA 1KQNA 1DKLA 4QTYA 1YHNA 2J4FA 2O14A 4GGPA 2GEUA 1EX9A 4LI3X 2VYNA 4DT1A 2HD4A 5CHEA 1OHHA 1WMBA 1W8DA 1ORWA 3MWDB 1P3JA 4FYXA 4HWGA 4JLKA 2ZATA 2IUSA 1FFBA 2RBKA 3L0DA 1SUWA 3GA5A 2VHVA 3V1YA 3UWPA 1QR6A 2P68A 5ULLA 2VUTA 5HJEA 4JNCA 1Z6QA 1KE1A 1HH2P 4HNSA 4X44A 4V3CA 1AQLA 1RC1A 4IGFA 3WBJA 1EM8B 2VQSA 1IY9A 5JFTA 4I5FA 1GPKA 1G63A 1E77A 2HXSA 1Z06A 5KWVA 1ZY2A 1QVZA 2PS9A 4BP3A 1U6JA 3O1IC 3I53A 4DN6A 4RTOA 1OXTA 1ZX1A 3WR5A 2V7QA 3IIMA 3F0TA 4N0EA 1SBNE 1YBMA 3GJ5A 1F8FA 4B48A 4EPRA 4D0SA 1RJ9A 4A82A 4LYAA 1SVIA 4IOLA 1DADA 1L4MA 1OA0A 3OUTA 3O1JC 4D79A 2Q21A 1BMFA 3LHSA 4LDZA 3OZWA 2H16A 5B5SA 4JXXA 1CRZA 4OQDA 1HYGA 1K5HA 2XMQA 4JKYA 2RK6A 3LZCA 2ZK7A 4JSTA 2FUCA 3AKYA 4QRHA 2XZLA 1XF9A 3I1YA 3KQPA 1I3LA 2VCEA 4CL0A 3CRZA 3ZZ0A 3JV7A 2JI9A 3KRTA 3K71B 2CV2A 2FOLA 3MT0A 3FDJA 2C9CA 2OD9A 1CCWA 2LP4Y 2MTBA 1OC4A 3R44A 2E5WA 2QX8A 2RI1A 2WB4A 3EZYA 4FQ5A 3GNTA 1V9SA 3QX9A 5CH8A 1I4TD 4E7OA 2VH1A 4D0GA 1CQIA 4P98A 1RFLA 1SKBA 2M6SA 2ATCA 5EKSA 4Q12A 3EWNA 1G3RA 5T8KA 3TRDA 4NDZA 3RHFA 4WJZA 5H3HA 3PG5A 1E1RA 1O4WA 4E5NA 2P3LA 1F17A 2C42A 2BR3A 5EVJA 3IRVA 3PT5A 5EMHA 4FXOA 2B78A 4CV1A 2Q3JA 2BW0A 2XEXA 3C41J 1U8EA 1U2PA 2OCGA 3SJBA 2VUSA 3SC3A 2ZM5A 1GD1O 4DS3A 1EGVB 3B1JA 5JYCA 2VRNA 1P7LA 1J2UA 3ASVA 4LV5B 3FPSA 3FBGA 5GTDA 3OC6A 3ADCA 1P6QA 1CDOA 1N2JA 2YWEA 5FR2A 3IEKA 5F7XA 1JPJA 4OYCA 4DV5B 5I7VA 4ROTA 4PFJA 2FSPA 4IGAA 2WJVA 4YCLA 5GPBA 4WACA 1CJSA 1NIPA 1CJTC 1Z8NA 2B5WA 3HZHA 5EWMA 4C76A 1RW4A 1NM5A 1I1QB 4G5GA 5AW3A 3BGOS 3IJEB 3RFTA 3KQMA 5EY5B 2Q07A 1J1ZA 1AUPA 3PR3A 1GSAA 4EB0A 4ESHA 1RWWA 5JZMA 1BCSA 4GHWA 4XH9B 1QAQA 2GAFA 3CX3A 4BLPA 4F11A 1PJAA 5M29A 4E46A 1JLKA 4WJKB 2R00A 3VU3A 3IBTA 1SUCA 1U9CA 1U7XA 1RXVA 5B1IA 3QYAA 1WCYA 4GI5A 2WM2A 2VHZA 4MJ3A 2WSBA 3ON5A 4S1WA 2F64A 1OZAA 1VLJA 4YJGA 4ZHQF 3WFJA 1OFVA 1VG8A 5KX5F 1O0CA 1GG2A 2Z2IA 5B7NA 1P2BA 3SK0A 1N2OA 4B1FA 1A77A 1HM5A 3LK7A 3O4RA 5TC4A 4RGBA 5H3LA 4G36A 3HR8A 4JA0A 2AG0A 4MVJI 4ZU3A 3NTUA 3U7JA 3TO5A 4EHAA 1N7GA 2HAEA 3HRHA 3O0TA 4MWSA 4ZYUA 1JWAB 3IMFA 1G8HA 3I9KA 1QE3A 3DMDA 5L4LA 4BO2A 3EVAA 1MCZA 4QU9A 4E5SA 1L7RA 3HYSA 2DFDA 4IJVA 4MRMA 5CYPA 1FP4B 3VZRA 3X2SA 1GQFA 4YRCA 4EENA 2OO4A 4I8IA 4RS3A 1RLTA 1W5AA 3E9DA 3H1PA 4ML3A 2CZCA 1VM6A 4EB6A 3TRHA 4NMHA 4PC7A 1GL7A 2ENWA 2ISCA 4LX8A 3ZVMA 1OBVA 4AX4A 1F48A 1TM5E 4DWWA 1A7AA 5FIUA 5AI0A 2GBLC 4ARCA 1J2RA 4ND4A 3PDWA 3EDOA 1XHEA 1UFOA 2QUJA 4OGKA 4BO8A 4ZOQI 5BNIA 1SVUA 1XTSA 2ZYUX 1CUXA 2H2IA 4RDCA 4O63O 2ID8A 3S29A 1ZIXA 2LKCA 2W6OA 2IZ0A 5CZXA 3ZY3A 4X66C 2OO3A 3FOWA 3I07A 2UZ3A 2XWBF 4NOZA 1ECBA 1TQDA 2QRVB 3JR3A 3FPHA 1W5EA 1WXFA 5JCOA 4EI2A 1XTPA 3LG2A 4UNRA 2ONKA 4QGBA 1R0YA 1BWRA 3UJ3X 3HGQA 5AXDA 4ZRMA 2WKQA 3Q6MA 1AUOA 1NWHA 1P62B 3EA4A 3KLNA 3C1AA 1YZVA 4E7PA 4X90A 2R2GA 4HS4A 5SYNA 2NUTA 5E3JA 3UPTA 1WBDA 1D3AA 5IT4A 1OXVA 2BCGY 4MICA 2O6HA 1G6OA 2MOKA 1N34C 1R8QA 3RDPA 6CHYA 4BFCA 1P19A 3ESZA 2LIPA 2ODQA 4PZUA 4HGPA 4LEIA 3B7WA 3L82B 5AK0A 4ALMA 3CGGA 4J0IA 4WLFA 3N8NA 5BSGA 5LJIA 2IYAA 3EWSA 3EGOA 5AW2A 4C0HA 1NONA 4PRLA 2HF8A 4V24A 1RRMA 2QTCA 3FVQA 1HE5A 3QVJA 5IH3A 4MRVA 1PRYA 1ZSNA 4N0DA 3RGGA 3MCUA 4BWVA 5KTYA 3EAFA 4KN6A 3D5EA 4ER7A 4J7UA 3DS8A 3NT5A 2GK4A 1FXUA 1U2GC 4FMDF 3PC3A 1U9JA 4OAPA 1V95A 2NZ8A 4JKIA 5EWJA 4DNXA 5IUJC 1ZIOA 1HDGO 2HV9A 1J07A 3D54D 1XTUA 3HMKA 1EH5A 1RI2A 4JX9A 3H4VA 3NEAA 3PF8A 4ITUA 1FTSA 1BCRB 4NU5A 4AVYA 1VJTA 2I9KA 2ECFA 3P9KA 3RSSA 3U7GA 3ER8A 3Q2OA 3ETDA 2XVYA 1GPMA 1XLVA 3H6KA 3HJHA 5FBHA 4C6TA 3G2MA 3NHAA 4DLUA 1TDJA 4LMPA 1YCHA 3L6CA 3D4OA 2OXIA 3U62A 3P2IA 1IUKA 2QG6A 5KX5B 3CX6A 4WXRA 1VJ1A 3SXUA 1MX5A 3OZBA 3VNAA 3QW2A 1RYNA 4RD1A 1UMBA 1KZ9A 4WCFA 1E9AA 2AGVA 5BR4A 1BX1A 3IJRA 1G7CA 1S7CA 1XD2B 1OD6A 3D7LA 4IXDA 3SIRA 2NO1A 2DUWA 3Q8MA 1Y1TA 3QZUA 1ITZA 2GVZC 4R41A 4RWZA 2ZBPA 3L95X 5LLTA 3T1NA 3VDQA 5JNWA 4GNRA 1KH3A 1MJGM 2ON6A 1WLSA 1FMJA 2WZDA 5D01A 1N1DA 1LPPA 1IUOA 4XSGA 4CLOA 4I3HA 4FMDB 2XB8A 4H0CA 1VI5A 1HC7A 1C7RA 1A5AB 2PAAA 2P4HX 2HSZA 2FP3A 4Z4FA 3ABZA 2PZGA 2PUJA 1ISMA 1C3OA 1FQWA 1PG4A 1Z4IA 2BFMA 2IHKA 2QL7A 2RHWA 2NWQA 4BV3A 4I55B 4COKA 5HKKA 1L2TA 2AQIA 2EGHA 2D7VA 3GQBA 5IFIA 4L0CA 1UPBA 4D6YA 2QVYX 3IOMA 4YV0A 4DPMA 1IN7A 4YRBA 4RIFA 2X5KO 3M6XA 3FTCA 3ONNA 2CYBA 1EG7A 4R8MA 3GT4A 4BQOA 2IY9A 2XI4A 2ZYGA 1BDIA 4JT8A 1J1IA 2IPXA 1SXJE 2XW6A 1PR9A 3ZNNA 2C2KA 4B0PA 1ZHHA 1Z26A 2A9JA 1KEKA 2PS1A 1ZHFA 4QFMA 3X44A 5L51A 4H16A 4DJ5X 2CD7A 2IYNA 2JAHA 3UKDA 4DM4A 1QS0A 4OHKA 1N8KA 1U8ZA 3FTDA 5BN5B 1OE0A 4GLBA 5T4HA 2LTAA 5AJUA 5JJCA 2GN4A 2OK7A 1YB4A 3RVMA 4BMPB 2QOEA 3X1YA 1G18A 5JRZA 3ZBQA 3K6KA 3MRXA 1G2QA 4IHQA 4OFWA 5H80A 4D80A 4EZBA 3GFQA 3G7SA 4UOEA 3AJ8A 2AI2A 4HY3A 3A9CA 5AW1A 2OHJA 4GX0A 5EE5B 4G23A 3S7TA 3CGWA 1JDVA 1PWEA 3KXKA 4BVBA 3WLSA 1JHRA 2CFCA 3OPYI 4OJKA 5CLJA 2Q5FA 3KCQA 4TLAA 3AHGA 5A4DA 1RCUA 1GLNA 4QUGA 4ZJPA 4CKCB 2B30A 1X9HA 4OHRA 4BKMA 3WL4A 4MVJA 4ZVKA 5B1YA 1M1YB 2PX0A 2ZITA 5GVSA 1S1CA 1KMHB 1XZKA 5E0OA 5KYYB 4D02A 2C5FA 1ZH6A 2O2CA 3AU9A 1JAIA 4J03A 4PAMA 1XWIA 1OGYA 1GYQA 4G5OA 1Y82A 3JQ8A 3C3KA 4BGVA 3AHIA 3VU0A 5KJFA 5EYPA 5LXTA 1KQFA 3RJ5A 2AH5A 1SZDA 3B1XA 1G17A 2BY4A 4MAFA 2C84A 1QYDA 2X7JA 3GJ0A 1NYEA 3CN9A 4I9HA 2L42A 4AB1A 4DV7C 4YHHC 3NH9A 2HK7A 4N39A 2ZI3A 3NIWA 4ZOLB 1JR3A 3OHSX 2J0UB 3QU5A 3RARA 2C4KA 4BNDA 2FFHA 2P9QA 4ZMRA 2UUBB 2JD2A 1CEYA 2KW5A 4CFZA 1W4BA 4D82A 2WD7A 4M8LA 4B31A 4C4OA 1U1IA 1GZ6A 2IHUA 1UZUA 1LX6A 3RRBA 4J0EA 3UBMA 1RXEA 3PBKA 3OESA 3QVGB 4HLQB 4L5AA 2V6BA 3KR9A 1Y7PA 3N7UA 4XB1A 5GVRA 5JCJD 4PGMA 5DYGA 2AX4A 3KDAA 4M0FA 3JAKB 1JTEA 4RVUA 4Y0VA 2CNDA 2PE5A 1OVMA 2PLNA 2R11A 4NESA 4BO4A 4UUNA 1GU7A 1YNOA 3TM4A 4PZDA 2H54A 4BATA 4CT4B 1G1MA 1TU4A 1VIDA 2CHGA 2R8BA 3F5DA 1Q3HA 3KXWA 3IAAA 3R5XA 4IOJA 4OUKX 1C3JA 2E8CA 4PF1A 4WECA 2IPLA 1L1EA 1J99A 2OCPA 4QFDA 4AKTA 3QKSA 5F1YA 3AFMA 3ELYA 1OXKB 3BIWA 1O89A 2J0EA 2CXXA 4RMHA 4KNVA 5D3KA 4F6CA 4ZYLA 4KTVA 1LJLA 1PX0A 2VRWA 3GCDA 3R3ZA 1KDPA 1KZYC 4NJOA 4WOCA 1H8HD 1FP1D 2B4RO 3INTA 4X1IA 2P7HA 1XEAA 3GEEA 5CT5A 2V4UA 3TIVA 4X62B 4D9CA 1BNCA 3UNXA 3USCS 2Q4TA 2VT6A 1KOFA 3G23A 5A5DA 4NECA 1JWBB 2DTDA 1G7TA 1GGFA 2CGEA 2FR8C 3VDNB 3BMCB 2RGEA 3FUCA 1P1FA 3K0CA 3QPCA 4QG3A 1KNQA 3TL2A 3EPKA 4RTNA 4PUHA 1MXBA 2F7SA 1SCKA 3CUUA 2FE4A 3ZNQA 2JFUA 5JQGB 3LY8A 4FK8A 4L7QA 3V8PA 3CZ4A 5LDHA 2A9OA 3L9XA 1WNTA 1R4NB 2OUIA 2JFBA 3BJMA 1OW3B 3DXZA 3OIUA 2GSDA 1V5FA 2H5EA 2VK2A 3KKMA 3T9FA 4F1WA 5LD2C 2JAQA 4PLZA 2RHDA 4UBIA 1IOVA 1M1NB 1U3VA 5AVKA 1EX7A 3N74A 3IVCA 4D4HA 3UWMA 3WDSA 5JSFA 4IG9A 5I3ZA 3IKJA 5BUQA 1GQOA 2FW1A 3AXTA 3KKEA 4I9NA 2WE8A 1MXCA 2YX1A 1C4OA 4L9SA 3AETA 1F4LA 2WUFA 3IAHA 4X64C 2YNMC 5E6RA 4BCCA 4HV4A 3AUFA 5JSUA 3H2BA 4ZCTA 2H31A 1TA0A 1KU0A 4M22A 2B82A 2WKSA 3MOSA 3D7KA 3I52A 3U16A 2HBQA 1E5VA 4HWTA 4B83A 2UUCB 2XCRB 1XVIA 1LW6E 4RJKA 3SIWA 2VJNA 3SJCA 2O1SA 3EGEA 1P6XA 1R0CA 2X7HA 2YJ5A 5KWEA 3GRUA 4OQQA 4TTIA 4DJTA 3SBDA 3PEVA 1CZLA 1UKBA 3IH5A 5LKAA 1IZZA 2H18A 1Z82A 3I32A 2RC6A 5K8UA 1P5FA 1P3Y1 5F5NA 5EPEA 4HZGA 4NI5A 1JSXA 3TI7A 4DLKA 1QO0A 3GLIA 2WTUA 3H2SA 5A9TA 3HKCA 2EWVA 2VF5X 3LKVA 4K6OA 3T9CA 1XDUA 3L8GA 5AMXA 3JRNA 3QNUA 2WU3A 2R6HA 4GRAA 2XB9A 4RX1A 4TSKA 1H2YA 4ZK6A 1SO8A 2EKLA 2O0KA 1CUBA 2FPSA 1U1DA 2Z2ZA 4BX3A 2AWOA 4EJ2A 5BWOA 1RKBA 1ZGZA 5DX8A 2I4LA 4QRDA 3E9CA 1KP9A 3LPCA 4YUYA 3GF4A 1WB6A 3TYXA 5JYBA 5MGBA 4B81A 2JFFA 3QKWA 5AOCA 4FEYA 3H8JA 1L5WA 3KR0A 4KZKA 5A0TA 4EYQA 5IBRA 3AVPA 3E61A 5ALHA 1NI4B 5JJ5A 4CMIB 3RANA 5FL7D 1MG5A 2HBZA 4G5YA 3H99A 1ZA2A 3E5RA 3IMKA 5L3QA 4FWTA 1U94A 1AO0A 4RTMA 4V3BA 5KVQA 4AP5A 1QHFA 1ZJJA 4ISBA 4IQGA 1UFKA 2EX1A 5AJTA 2FWIA 4S1NA 5AQEA 2H3EA 2C0CA 3GELA 3PUWA 3SBXA 1KI3A 3PNSA 3TD9A 4EG8A 2D13A 3LXMA 1AQJA 1KWGA 5BRAA 1SHJA 3O4FA 5DM0A 4ND5A 1E3TA 5IFKA 3IUMA 1RNLA 4G85A 3O82A 1R6DA 4KTVE 3NBUA 3DMGA 4RCYA 3UX2A 1MQAA 2NVUA 1U28A 3ZDDA 3FOBA 4C0QC 2JBAB 3FI0A 3AY6A 3LUBA 3WGUA 3O1LA 4AZWA 7AT1A 2OBLA 2P2NA 2W6MA 2YXPX 1Z6PA 1N6HA 3O91A 2YWGA 4J75A 4O0LA 3H0KA 4MW7A 5F9HA 3VJKA 3PX2A 2XNDD 3Q7PA 1IB8A 5K0SA 4DMUB 1PZXA 1LSJA 4D92A 1Q1AA 4AG3A 2H1VA 3AR9A 3WBKA 2REXB 5D6OA 1FP6A 2Q4DA 1TEZA 2WABA 3R7AA 1AGYA 3SX2A 2XGOA 4GP7A 4MUFA 1RBMA 2NVUB 2OCDA 2A5YB 5IDWA 1PGQA 2FEOA 2HMAA 2J30A 3NLLA 4GQIA 4LNUA 4D42A 4TZTA 3CF0A 3QF7A 1QVWA 9LDTA 3FXAA 1E79A 4JUAA 3CF6R 4U3JB 3D5TA 4HOYA 3GXOA 3T95A 2GEBA 2XD4A 1PK8A 3R5FA 4EHBA 1FXWF 4KPEC 2P2QA 5AUOB 1QZTA 2RK3A 3P97A 4L0MA 5AJZA 4DV5C 7ADHA 1GRNA 2XRMA 1T9CA 3L7IA 4U8HA 4UQLA 3M5PA 3PNLA 3AM5A 1D07A 1CC1S 3GQBB 4RK7A 1R6AA 2AG5A 3H8WA 4OHCA 4U7TB 3UMGA 4IEFB 2P40A 2QP9X 4LHXA 3UJDA 3D3WA 1WKBA 4LSMA 1WP9A 2ETVA 4LJ5A 2J9GA 1S9DA 4G5QA 1QX4A 4A6EA 3C6KA 4NEHB 1OTHA 4LN1A 1ONNA 1RDFA 5C5CA 4LYGA 1MO6A 3V32A 1KBOA 3HEAA 4XJVA 1RXIA 1H6DA 4Y1RA 1MDBA 1Y8RB 4ZQIA 5EESA 5EUBA 4NIMA 4ZK2A 2IYRA 2JAUA 2BM8A 4HGOA 4JLDA 4P2GA 4QSHA 3SIXA 4PLCA 1DP4A 3P2YA 3UCEA 4MA4A 3VR4A 5JD3A 1PVOA 1XVVA 2IU6A 5B37A 2I87A 2O5RA 4GKKC 5EE9A 5IULC 3E3LA 3MTEA 3NALA 3DE5X 2W4QA 2R47A 1X7XA 3EIEA 4G1CA 1G9SA 3EZ9A 5F1OA 2WMOB 1JIKA 5TSDA 2QQ5A 3TMKA 2ZJYA 1H6CA 1NGSA 1E1YA 2CFTA 1XCPA 1KK1A 4OBBA 1U3TA 5HS4A 2EF0A 1ADJA 2JDID 3DHWC 1YJBA 2PGOA 4RA9B 3EBPA 3VR6H 3ZGOA 5K8IA 2IH2A 4IKPA 1FEZA 4QUIA 5DNCA 3ZV5A 3KB6A 1M1YA 1WXGA 1IMJA 2F17A 5E9JA 4BLOA 4AY5A 2O19A 3FM9A 3BXGA 3GMTA 3O6VA 3PWKA 3I6IA 3QELA 3RBZA 2B4QA 1ZUD1 3BK2A 3H7IA 5I7OA 4M8IA 2XBUA 1UT8A 1EFCA 3K0BA 3LP5A 4QECA 5EYPB 5HWSA 5EJ8A 2ZXUA 1PJ3A 4ERXA 4G4GA 4YP9A 3ZLTA 1J6UA 5KYYA 1N3BA 2DT8A 4MPTA 4XUGB 5J59A 5K8LA 1THTA 3ENWA 1CUJA 3PA8A 1L5FA 2Q1WA 1KPGA 3Q0IA 1WPGA 4A92A 1K8ZB 1JG1A 4K6CA 2XMGA 4AY4A 2ATIA 3UJ8A 5K03A 2G7ZA 2HLPA 1T0BA 4PPYA 4B4WA 2X14A 3TZKA 1W87A 1KAMA 1QV7A 1QGDA 3NWEA 3PF9A 1C7JA 1EA5A 4I5EA 1X1DA 1IBMC 2D59A 5BNZA 2GZMA 4RKQA 5CFZA 3RHZA 1E32A 4YDHB 2QTVB 1EXMA 1M2VB 1HNXB 2FPXA 1WSWA 3ZGZA 2C3UA 3GCGA 4PE5B 1VL6A 1AKRA 1QG2A 3ABOB 4XB2A 5I8WA 3A2LA 2QQFA 2IZOA 2QMZA 4LYFA 4OTZA 2WKWA 3IT2A 3DQPA 4MV8A 4O4JB 1SCJA 4G09A 4QPPA 2OCKA 3CQ1A 4V0SA 1JU9A 3C1UA 3HCBA 1RJFA 2UVQA 1D03A 3KWJA 3O8QA 1FDTA 3TDEA 3L1IA 3B7GA 5ILOA 2LCFA 2WQZA 1YR2A 4NZYA 1KOJA 1PYOA 4A73A 1JJBA 1DKRA 1ECCA 1EKXA 1L5YA 3D31A 4BECA 3BD8A 4TKUB 4F6RA 5KNCH 4HFRA 1UJ6A 3HSKA 2KJQA 2A9KA 3GBPA 1RHRA 4P7KA 3LCUA 1WXWA 3ZQJA 3S82A 5IASA 3TTYA 4IFBA 5L7WA 1KL7A 1SXJA 4I4TA 3QVWA 5K01A 1Y3IA 4EVQA 3C3CA 1QRDA 2H2FA 3TI9A 5AKJA 5LWHA 3I5YA 3TZEA 5GINE 5HG0A 3EULA 2QL6A 1ZD9A 1G9TA 3C15C 2BRUA 4RF2A 5TIIA 4OSEA 2G9NA 1LBEA 2ZANA 1QGUB 3KKOA 2H7CA 1DAOA 4YCDA 1WP4A 4I1UA 1X8JA 4WK4B 1VKJA 2GZ3A 3KKNA 4KIGA 1UBFA 2YHSA 4ZDIA 4P9NA 1PVVA 2DWUA 3ASUA 1NMZA 1U7TA 3N5KA 5AM4A 6Q21A 2J6HA 2OP1A 1O8CA 1FRZA 2P3SA 3E53A 3MIIA 3OOWA 4PLYA 1BCRA 1M8KA 4TSFD 4TYQA 2M98A 3Q8KA 2O8BA 1F8XA 5FTKA 2XCOA 3HP4A 4G1EB 3IO3A 4LOHA 5I51A 2P9CA 2VBCA 5LMNB 2V58A 2VOJA 2AQKA 2ZRNA 3WFIA 2YZ2A 5JJIA 1W6RA 1U5BB 3U4AA 4CHGA 1YUMA 3GPBA 1Y6JA 3DE1