3TQIA

Structure of the gmp synthase (guaa) from coxiella burnetii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
519
structure length
464
Chain Sequence
IHQHRILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPEAPAFIFEIGCPVLGICYGMQTMAYQLGGKVNEFGHAQLRVLNPAFLFDGIEDQVSPQGEPLLDVWMSHGDIVSELPPGFEATACTDNSPLAAMADFKRRFFGLQFHPEVTHTPQGHRILAHFVIHICQCIPNWTTKHIIEDSIRDIQEKVGKEQVIVGLSGGVDSAVTATLVHKAIGDQLVCVLVDTGLLRLNEVDEVLNVFQKHLGAKVICVDAKDRFMKALKGISDPEEKRKIAGEQFIRVFEEQAKKLNVKWLGQGTIYPDVIESKLIEPLRELFKDEVRKLGLELGLPADLIYRHPFPGPGLAIRILGEVSAEYINILKQADAIFIEELKKSDYYHQVSQAFAVFMPLKSVYGYIIALRAVKQWADLPHEFLSKVSHRIVNEIKEVSRVVYDMTNKPPATIEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Ligase
molecule keywords GMP synthase [glutamine-hydrolyzing]
total genus 131
structure length 464
sequence length 519
chains with identical sequence B, C, D
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
A PF00958 GMP_synt_C GMP synthase C terminal domain
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3tqiA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3tqiA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tqiA01
1KWKA 2CV2A 4J76A 1N2BA 2JA2A 3G5AA 3AL0C 3OP1A 2EL7A 5TEWA 3A04A 3ZR4B 3X1JA 1R6TA 4L7IA 1PFUA 4OFWA 4UOQA 2WB2A 1EFVA 4ZCPA 1N2EA 1LI7A 4FZJA 3TZEA 2YWDA 1ILEA 4F4HA 1Q11A 2Z09A 3L7NA 3FOCA 3DV2A 4RPIA 5SYAA 3ZUGA 1J1UA 2QUKA 3SZ3A 1O95D 1T36B 3IMGA 1J1ZA 2QJOA 3SF8A 4Y1RA 4GRIA 2A86A 5A19A 1T6ZA 3F3MA 3FIUA 3HL4A 2GK3A 3P9QA 2ZUSA 3JXEA 1J09A 4ZCRA 3P0HA 4MVCA 1N2HA 3INNA 1O97D 1OWPA 1KAMA 1X6VA 1ULHA 2VXOA 3IMCA 3QE4A 5TGTA 4JFAA 4JYZA 2WSIA 3COWA 4E08A 3FG9A 1WJGA 4EG3A 3DPIA 1QTQA 3I05A 4MUKA 4GE3A 5KHAA 5A1IA 2A84A 3DLAA 2AB0A 1L9XA 4DNXA 4AUMA 2QTNA 5SY9A 1U3DA 1LI5A 4MWDA 3TZLA 4ZCTA 1EFPA 1LW7A 3AFHA 4G5YA 1YI8A 1KXJA 1KH2A 5H9UA 1U3CA 1JEEA 3N8HA 4WINA 1J21A 1WXGA 4NAHA 2AZXA 1NUUA 1P81A 4PY2A 1NURA 3RJZA 1QVWA 3Q10A 1MB9A 4OGFA 4RKYA 1MBZA 1JILA 3L18A 3IOCA 3GUZA 1N2IA 1Q19A 4OIFA 2A1UB 1WXEA 4ZCSA 1KEEB 5H16A 2RK6A 4UZEA 4G6ZA 1T6YA 3SP1A 1U9CA 4AULA 3SOZA 1XNHA 2X1LA 3UY4A 1M6VB 3IMEA 1TYBE 4BWVA 4PXYA 1JIIA 1KA9H 4DE5A 1VLHA 2TS1A 2I1LA 4EFKA 4QYXA 4Y1GA 4ENRA 4QREA 4MULA 1VCMA 3BL5A 5FNZA 1VCOA 1JECA 1WOYA 4HPWA 1MOPA 4HCJA 1NUTA 3IODA 4OJYA 3TTUA 4EG8A 1QRUA 2ZP1A 1CF9A 4L8YA 2PZ8A 1U7XA 3UMMA 4ZDKA 1O96B 4MW9A 4ND6A 4MVYA 3CLRC 3IMLA 3G6KA 2VTBA 4RKWA 4AJ9A 4D1YA 5K0TA 1KAQA 2OBVA 3CLRD 3CVUA 1GG9A 3ZJ5A 4L2IA 2GHRA 1I7QB 4X0EA 4ODJA 4KR9A 4AQ7A 3CVXA 3FETA 4U8HA 1M8JA 3H99A 1EXDA 4B7AA 4P36A 4MQ6A 1GZUA 4ENVA 4ND7A 1FY2A 3UMVA 5DASA 2R1VB 1SURA 1MXBA 1X8XA 1PDVA 4B31A 3VRHA 2XF2A 3EZGA 1R6XA 1WQ4A 3A05A 1BXRB 3VU3A 3LE8A 3M5WA 4L78A 2RD2A 4MUGA 4Q93A 1QRSA 1WXFA 3IUEA 1S4MA 2VPIA 3M3PA 4N0MA 3RHTA 4AUNA 1T9GR 1P5FA 4L2ZA 2PZAA 1GGHA 2BTEA 4OUDB 2A1TS 4R7GA 2ZUWA 1KP3A 1OI4A 5DFAA 3L92A 2YXNA 1V8FA 1P7ZA 3MGKA 2YWCA 1NZJA 3MXTA 4UZSA 3C8ZA 4EGAA 1I6MA 2RK4A 4EF6A 1N2OA 1ZH0A 3KT8A 3X1MA 2J4DA 3PNYA 2A4MA 4YMIA 3ZIUA 4EG5A 3ZJUA 2NZ2A 1H3EA 1P7LA 1JVNA 3D6VA 1IPHA 2DXIA 1QVZA 1IFXA 2NV2B 2E89A 5LLTA 1GN8A 1QNFA 3P9SA 3WFZA 1N2JA 1G8GA 3CLUD 1GTRA 1N57A 2X0KA 1MJHA 3PQ4A 1U0BB 3DO8A 3P9RA 3FHJA 4ENQA 4ENPA 4QRDA 5DK4A 1MAUA 1C30B 3ELBA 1T0BA 5FO1A 1SY7A 1FYDA 1N75A 4MWEA 4DDKA 1D2RA 3SEQA 2A7XA 3A2KA 1I6LA 1O5TA 2JANA 4F3RA 1VBNA 2DETA 1JDBC 2QUHA 1O1YA 4P5PA 4HJRA 2JAXA 3PQ8A 2J08A 4XFDA 1QVVA 3COVA 3F5DA 3CVVA 1JGTA 4YP6A 1EUQA 1T9GS 3RV2A 3K32A 4WSOA 3ILVA 1I2DA 4EG1A 1OX4A 1F4LA 4G5FA 1XNJA 4P2GA 1JIKA 2BYTA 2QTMA 1GGEA 4MVWA 1KP2A 3P9PA 1K92A 2H2WA 1P7PA 3PQ6A 4S0ZA 3IUBA 3IH5A 4Y1EA 4TS1A 1QWSA 1MAWA 1T3TA 3GLVA 5J5AA 4ENTA 3PNBA 4MWCA 1EUYA 1K97A 4ZT2A 1RG9A 4ZDJA 1H3NA 4I46A 1N3LA 3TTTA 2D7JA 1GGFA 4KPUB 4R2LA 4XSVA 4AUEA 4PBTA 4YP5A 1O95C 1N78A 2CT8A 2CSXA 1ZUNA 1N77A 1XJQA 3NONA 3FIJA 4ARIA 1O9TA 1OBCA 3K9WA 3CLTD 3Q4GA 1GAXA 4B2YA 4CDMA 5DB4A 2WQ7A 4OQ4A 2O5RA 4JZYA 4MW1A 2R1TB 1IQUA 4KR6A 4A91A 2ABWA 4HPVA 2VKTA 2GKSA 4MW4A 1NYLA 3UJNA 1R6UA 2G36A 3SF8B 5EKDA 4UNIA 1BS2A 1K4KA 1O96A 3MMXA 3E27A 1A9XB 1TFUA 2H2AA 4U63A 3BHNA 1EFVB 1Q7RA 2R1TA 4L8WB 3GMIA 1M8GA 2X3FA 4ZCQA 2E18A 3RK1A 2QUIA 3U1VA 4ZT4A 2ZUEA 1GTSA 1O0BA 2ZUUA 1UCFA 1COZA 4CT0A 3R76A 3TTWA 4K0BA 1PG0A 1SOAA 1WXHA 4ZDIA 3SO4A 4MTCA 1UFVA 2D5BA 5F23A 4LRUA 2V0GA 1HYBA 1OX4B 1TQ8A 2XRZA 3N9IA 1FFYA 3PQ3A 5LIRA 1Q77A 1IQRA 1R9GA 3H05A 3N2YA 3FSEA 2Z08A 4ENSA 3ZXSA 1JEDA 1KR2A 4ZGGA 3G59A 2AKEA 3ND5A 3BWEA 4MGHA 3RBAA 2QJFA 3CLTC 1KQNA 5J58A 2YWJA 1A8HA 5HUHA 1WL8A 1O94C 1EFPB 3B38A 2IELA 1EJ2A 4XLLA 3KT6A 2GM3A 4PBSA 3L3BA 4Y1FA 1YUNA 4HK4A 4QBTA 3ND7A 4EG4A 1DNPA 5J59A 2D54A 3IVXA 5AHWA 2DERA 4MVXA 3TDEA 3SYTA 1F7UA 3EJ6A 3S3TA 4Y0NA 2ZUTA 2QJTA 3A4IA 4YP7A 1ZJWA 1O92A 2DUMA 3TS1A 2ZUVA 3KFLA 5IHXA 1KQPA 1QJCA 1CT9A 2OV4A 5TEVA 5T8SA 2CYCA 4MUFA 5BNZA 1ONSA 4ARCA 3HV0A 3ND6A 2DR2A 1PV2A 4MNTA 2RK3A 4P34A 3ZJ4A 3HMQA 4ADSG 1KWGA 2NV0A 3AKZA 3N7TA 1ZH6A 4R2MA 1NI5A 3L93A 2NSYA 1H1TA 3KKLA 4GUDA 1MXAA 1VL2A 4NDAA 1F7VA 1G8HA 3N05A 4MUJA 1KKUA 2YY5A 4N12A 3PQ5A 4NATA 3S82A 3H9BA 5FO0A 4DDHA 1GGKA 2XRYA 3MLAA 3FY4A 3EFEA 3PQ2A 3P0JA 3CLSD 2HMAA 4H3SA 1IH8A 4MW2A 4K03A 1MB2A 1C3OB 5H7XA 1GPMA 1T6XA 3CZ9A 1WY5A 2HZ7A 3FWKA 2FEXA 1YIDA 4NZPA 5T8TA 4Q16A 1H3FA 3TTSA 1B6TA 4YBRA 3FI0A 1P80A 4EG6A 1O93A 5LFAA 2DPLA 2WJZB 4E5VA 1IHOA 2ISSD 1G59A 1PG2A 2AG6A 4MLPA 2QTRA 3H97A 3LCJA 4K0RA 1WQ3A 4NAUA 3X1KA 4DJAA 3OT1A 4Y1RB 1N2GA 3TTVA 3AG5A 4MUHA 4MW7A 3AG6A 1I1QB 1VBKA 1QU3A 3L4EA 1O90A 1QQTA 1V47A 4XFJA 2D13A 1U7DA 3IDFA 4AS1A 3ZXIA 2CYBA 1XRAA 1JIJA 1OWLA 4ZT7A 5TS2A 4UZFA 2B7LA 4JQSA 4JXXA 3ZJVA 3SEZA 3CY6A 4EG7A 1EE1A 3KT3A 4BFLA 4MW6A 3TQIA 1J42A 2GOYA 1VHQA 4GE0A 3P0IA 5E9AA 3CVYA 3IVCA 1QRTA 1IZYA 2QUJA 4ZT6A 1J70A 1IVSA 3PNVA 3FH0A 4CDNA 3ISJA 2J09A 3CVWA 1J20A 3B3AA 4NX2A 3Q12A 3LOQA 3UGJA 4GU5A 1S1MA 4I6JA 3RFFA 2PG3A 1O94D 4DLPA 4UCFA 3HFJA 1G2IA 3KT0A 5SY4A 3MIIA 2LXNA 3IOEA 3SZGA 4MW0A 3RK0A 3IOBA 1JZQA 2ZUFA 2V4UA 1TEZA 1OD6A 1Y42X 4E1AA 4MUEA 4MWBA 1PE0A 5SY6A 3OTWA 4WNYA 1CS0B 4OJMX 4JXZA 2CV0A 1PDWA 3SDBA 3TTYA 2P02A 2IP1A 3UK2A 5JZOA 1NUPA 1Q15A 1M8FA 1RQGA 3UK7A 3FNRA 5K4AA 3B36A 1K4MA 1JZSA 1PFWA 1YULA 3HGMA 3UC5A 2VDJA 4LGYA 3CLSC 3H9CA 4J75A 2A9VA 2VRNA 3D54D 4I4NA 2WQ6A 2W7TA 3NORA 2CV1A 1NUQA 1XRCA 3ER6A 2C5SA 5HUJA 3NOQA 4R0NA 2O8VA 1GGJA 1K9VF 1QM4A 3P52A 4BTEA 4L95C 3PQ7A 3CNEA 2H29A 1O97C 2PXHA 1MRZA 4KTVA 3OT1B 4ZT5A 1KH1A 4KKVA 1CE8B 2CYAA 4OUDA 1OY1A 1M83A 4HJXA 3CZAA 2CUZA 3GRAA 5K0SA 3EN0A 2RE8A 4P2BA 1TYAE 1TYDE 3NBKA 5LM3A 2OQ2A 3RHSA 1MC1A 1OWNA 4DDMA 4I2NA 2E21A 2R1VA 2R5WA 1QDLB 1KQOA 4K2HA 1KORA 2Z3VA 3AIIA 1GPWB 1P7YA 1Q2UA 4KPUA 1O0CA 5JBNA 3CYFA 4ZT3A 3NOVA 1MXCA 3CLUC 1VBMA 5KWVA 3R74A 1GLNA 2A1UA 4NDNA 1XRBA 1M8KA 3TTXA 4PBRA 2CFOA 1VCNA 3UOWA 1OWMA 4QYTA 1YIAA 1WXIA 1PFVA 4CQNA 4P35A 5BV2P 1OX6A 1I6KA 3FDXA 4MUNA 3COYA 2VTBB 1I7SB 2IJGX 4L2IB 4S1OA 2DLCX 1OWOA 4MUIA 2R1UA 3NV7A 3EWNA 1NUSA 4I6GA 2HGZA 1M8PA 4U7JA 2AD5A 2IUFA 2E0IA 1N1DA 1YUMA 4ENWA 3MLBA 5KCMA 3TQOA 1WZ2A 4KTTA 3MUEA 1IZZA 3D6UA 4BIMA 1F9AA 5IP5A 4LE5A 2PFSA 5IJXA 1NSYA 3CA8A 4KR7A 1FYEA 3VU8A 2A88A 1FUGA 4RUKA 4L4QA 1O6BA 3F71A 4B5KA 5JZMA 3NBAA 1IQ0A 2J07A 4MAFA 3QTBA 3TNJA 2V0CA 2PZBA 2YWBA 4MW5A 4L8FA 3PXUA 1JMVA 1NP7A 1JHDA 1QF7A 2OR3A 3HZRA 1IRXA 4B40A 3R75A 3QTTA 4OGGA 3IVGA 2PIDA 2DEUA 4ENUA 1PFYA 4L7QA 4UOZA 1TYCA 5DEOA 3NOOA 2A1TR 3PRHA 5HG0A 1KH3A 1M1ZA 2J5BA 3ZGZA 1XNGA 4WXYB 4I6EA 1WKBA 5A1GA 2EJCA 3ZJTA 3COZA 3NVAA 1QU2A 2X1MA 1OBHA 1G8FA 3VGJA 1OX5A 3CR8A 4WS9A
chains in the Genus database with same CATH superfamily
4CQLA 3TUFA 1YBVA 2GA9A 4J1NA 4W5JA 3O95A 2ZI4A 5TEWA 1KY2A 4LF6B 4BNXA 1E3WB 2ATEA 3QLJA 4IIBA 3MJVA 4ZCPA 4HGNA 3L6BA 3B5JA 1EEHA 5IN4A 2BR4A 3H0KA 4F4HA 1Z0AA 2PH3A 3DDSA 5DBEX 1LSSA 2DH5A 2EEZA 1YBMA 3DOCA 1H5NA 2H4HA 1FXWA 2G9RA 1F3LA 2QTHA 4K3UA 5JCZA 3RSFA 3ABZA 4QYMA 3RVBA 1AS3A 3V3KA 3WRYA 1SBYA 2Q9CA 2WPDA 3RS5A 3SJUA 4LFBB 4KUEA 2CXOA 2Q46A 2GK3A 1RSZA 2PD4A 1UWVA 4B85A 5ALDA 5CG2A 2FV8A 4LE1A 4IJWA 3MMSA 1N2HA 1SH7A 3R6LA 4XE5A 3HCPA 4IO0A 1RW4A 3FDIA 4XB2A 4E08A 5FKJA 1WU8A 1WJGA 4F4JA 5HTOA 3EGIA 3FMGA 3AP2A 4FKMA 1YTUA 4NXMC 1E8MA 1G21E 2BH9A 3LXMA 1Q14A 4QYIA 5FUQA 4I3FA 4GECA 3IKVA 1WO8A 3ZWCA 2MR6A 4FCTA 2WABA 4PPYA 1ZUWA 1HEYA 2BFPA 3JZDA 1EFPA 1AG9A 4U9HS 4DUYC 5KMGA 5K2OA 3SSNA 3IAAA 4D4GA 4HEQA 3OWOA 4UTVA 1FP4A 4ZYWA 1JPUA 3K0FB 4NMWA 1E9BA 2A1IA 3TZHA 4MEAA 4TKZA 4X1KA 4QJ5A 4BNYA 1S3SA 2GHIA 2PMCA 1LZKA 1OT5A 3ABRB 1UWDA 1YR2A 3GUZA 4RBNA 4OHYA 4UJ5A 1MLDA 2C0PA 1HE8B 4D57A 3KZ1E 4DV5B 1A5ZA 2Z9BA 5IT5A 2HKIA 1O9HA 2QIPA 4Z9YA 1EAMA 3PUVA 4CR8A 5K03A 2ZJZA 4M6WA 1T43A 4KGZA 1B2LA 1OGIA 1MKYA 2ZYVX 1XVAA 4RF3A 4RCZA 2DHMA 1OCEA 1NZDA 1ZOSA 1NONA 1ZJYA 3DWEX 3EH1A 3G2HA 4EB8A 4QYXA 3HJBA 2YJ4A 3RASA 4DC0A 4Y2YA 3OQOA 3HDYA 1P39A 1KEPA 3OF5A 1SUPA 4KDRA 2H1FA 4HPWA 1QAOA 1PAUA 4A73A 1AQJA 2ONFA 2AN9A 3ETNA 3OX2A 1H9BA 1U94A 3FROA 2QZ9A 3LCMA 1GFWA 2BBOA 2ILTA 3DMGA 2WWVD 3HV2A 1NV9A 3MXOA 4CDRA 2OCGA 2OXTA 3D6MA 3DULA 1BA2A 4FB4A 1A8QA 2ROQA 2VYVD 3MD9A 4YJ3F 5E38A 3QQ5A 4B3DA 4Z6KA 4H59A 3CTMA 5HQ3A 2QV0A 4QLOA 4B34A 5KJ6A 3QH4A 1QBGA 1Z0ZA 1GWNA 1KVUA 3RS9A 2REQB 3PFFA 1R4MB 1JJIA 4YGYA 2VNJA 4LQCA 4GPEA 2XLBA 1IIRA 3PPVA 1P1RA 3QMPA 4TX1A 3RD5A 3UG7A 4S3MA 2VA9A 3DDNA 1KYIA 1SCAA 4MQ6A 2XE4A 3HZHA 3S1AB 3GAMA 4ENVA 4MLDA 1FY2A 3AHHA 5C8YA 1CUIA 1EM8A 3RTCA 8ATCA 1MG0A 4IFTA 3QVVA 2XF2A 5DSZA 1J49A 5LCIA 5DGDA 4OK3A 3TDMA 5HIKA 4HUJA 5EUCA 2VZEA 2BM0A 4YMGA 1QRSA 2IL1A 1U3FA 4RE6A 1EP1B 2IH4A 1MA3A 4B9AA 1P44A 1S01A 3R9KA 1JBQA 2UZ4A 3H0CA 4W7IA 5DM0A 2A1TS 3DVQX 4OHPA 4BC0A 1TAQA 5LQDA 3WYDA 3L92A 2FMXA 5DWDA 2GVZC 1R74A 3N59A 4BLRA 1JHVA 2PSDA 4AJOA 1XMJA 1ISPA 5KIAA 4BNDA 1W88B 3IHTA 2EX1A 4AP6A 1TUEA 2L2QA 2QUZA 2ZKLA 2GNAA 1UKKA 1VJ5A 3ESYA 3K09C 3QPVA 4M0KA 1CULC 1EESA 1Z0KA 3ORSA 1DIGA 3H1TA 2EKDA 3EEYA 3G2QA 3RSHA 4OX9C 3GXOA 2EL9A 3KJFA 3M33A 5AK5A 3N2GB 3GI1A 1VGRA 4IHAA 3D9QX 2VQSA 1MW8X 3NBMA 3JQAD 4XA8A 4FNOA 5JASA 1VYVA 2BJHA 1UWKA 2UUCC 2JGLA 3RK4A 4PG8A 2J0UA 3L8EA 2BFAA 4FDUA 4HNHA 4QGGA 5FUVA 4QTYA 1VGVA 2GN9A 1IY8A 2IHZA 2V6GA 2WINI 1BWSA 2YHUA 4H4CA 2XD4A 3DD1A 1TF5A 1QK5A 1RLJA 1PR1A 2OZKA 3WRXA 4C29A 2MHCA 1IXYA 2IYPA 2ZTLA 1P31A 3TMAA 1QVVA 3ZBUA 2AN5A 1GXSA 3WJ1A 4IDOA 2NU7A 4FYMA 2X1HA 3U7FB 3LGXA 1FC0A 1ARZA 1DBWA 1QK4A 4FSDA 1WMFA 4TYMA 2SKCA 1KVTA 3E9QA 521PA 1O9BA 3ZBPA 5CFPA 3HYSA 5BRAA 2PGJA 2BCEA 4INAA 4C87A 4RYDA 1G1MA 4XARA 3LPAA 4S0ZA 3ZWKA 3KSDO 1M2OB 4OJQA 5ALZA 1QCCA 2YRWA 3GEGA 3C39A 3KZXA 1P5HA 5FNVB 4MARA 4EX6A 2RAUA 3EEBA 2AL7A 3ZX5A 1Y8QA 2NSDA 5K8VA 4NFHA 3L2OB 2FDRA 2XMBA 3ANSA 3OQMA 2IS2A 2CLLB 2GJKA 4UUPA 2I03A 1DEXA 2O2DA 1A4IA 4N7JA 5CVDA 1RQLA 4CV0A 5IULC 5L95A 3HTXA 1IMJA 3DA8A 5HTKA 1BX1A 3IEPA 1OC4A 1RP1A 1ATZA 1X1DA 2PVSA 1ENZA 3GEBA 4XB1A 5ECDA 4P3OA 4BZQA 5A4IS 3E7WA 3GPIA 2IY9A 4JZYA 3A9CA 4MW1A 4M0FA 4XOIA 5CP8A 1T1JA 4HDAA 4HHEA 4LC0A 4A91A 4C5AA 5J4VA 2GKSA 1XK7A 3DVSX 1N6LA 4MYCA 2V8BA 1KFKB 1GQQA 1MV5A 2JJ8A 4Y67A 3CW8X 1O96A 4XB6B 5CGZA 3S1SA 3LUAA 4MGKR 1YL6A 2FW0A 1QCDA 3PGLA 3TR6A 1TYEB 4DJFC 5ITZA 1H69A 1LX6A 2YXPX 2COKA 1LEHA 1R0ZA 1W35A 1XP8A 4HLNA 1OHHD 2HLDA 3BHJA 3O94A 1BO6A 1JDSA 1V43A 4DR2C 1L8OA 1E9RA 2BCGY 3B1WA 5TE9A 2MSNA 1PBTA 1PG0A 2AJLI 3FRIA 4M86A 3SWWA 4GM0A 4QFMA 5F23A 4NBSA 4G4JA 2XD9A 3LAXA 1I13A 3K6RA 2D2EA 2QRVA 4PSCA 5HF5A 2IX9A 4QUEA 2OOKA 1JP7A 1VG9B 1XTZA 2BFEB 4KN6A 4WZBE 4FJ0A 3HE3A 4XYMA 8ADHA 4DV6B 1TUGA 2P0EA 2PUJA 3OZWA 4IXNA 1ODCA 1NQXA 5AXCA 2G72A 5TX7A 3VFDA 4YB8A 5JI3E 5KUTA 3O38A 4C89A 3BF8A 4O4JA 2J1LA 1DMSA 4PHFA 3RIHA 2I6TA 4EY8A 2I87A 3FDJA 2EWWA 3M9WA 4JP5A 4FQ5A 5EIWA 2OMKA 4FEGA 3DDCA 1ZYUA 3OM0A 2HA3A 2I8LA 1AHIA 4HFMA 4UNPA 1DBVO 2PDAA 3I3OA 2ZS8A 3LSTA 4BVKA 3ZE9A 4KNYA 3VVBA 4LZWA 3GEMA 5E6UB 2XB4A 4PVCA 5JNSA 1A5BB 3MQ2A 4K81B 1BRTA 3BGVA 3FCSB 4AL4A 3FTDA 1V7PC 1X7ZA 2FKAA 3DEYX 3NHUA 1I51A 4MVXA 3EFOB 4EI7A 2QR3A 5IBRA 1H8HD 2E5LB 2D28C 3HHEA 4MXDA 4NMMA 3JQFA 2ZSAA 1U0FA 4WKBA 3QMWA 3OI7A 3OOSA 4OD0A 5K0CA 2IIBA 1QJCA 1T15A 2H65A 3L02A 5DMXA 2CYCA 5K6RA 4DR1B 1YONA 2ZJ1A 4ARCA 1XG5A 3HV0A 2RARA 3Q8WA 2ZBRA 4MQFB 1BS1A 3U3RA 3ZWWA 5BWMA 5A04A 1RPJA 2RBKA 3U26A 5FWXB 2ONJA 1KDRA 4G0WA 2LKCA 4RF4A 3JD2A 1JG3A 3DFMA 2E4YA 1RYBA 3N7TA 5G4KA 2AXPA 4WY5A 3GLHA 1H1TA 3IEKA 4Y6QA 4OHZA 2ETVA 2WMYA 2Q2NA 3D6HA 1GQYA 4AUEA 4BQIA 2QQGA 4E4RA 1UBGA 3LOPA 4UBKA 3S82A 4P83A 1ZJ4A 2W6JD 2WB4A 4F4IA 3PT9A 2OZEA 3W2IA 1ID1A 1FBTA 3QUAA 4HWGA 1U5BA 3BN3A 3P0JA 1CFJA 3JYHA 4MW2A 4AZWA 4X9XA 1H1LA 2HZ7A 1JR4A 3K1YA 5INTA 2OENG 2V3VA 4U4AA 2MSWA 2RHTA 3SNHA 3RVDA 1P80A 4EG6A 2FPPA 4FFWA 1CR6A 1T4CB 1W2GA 2V45A 1R5JA 4Y30A 1FDIA 4A03A 1G66A 4ERNA 1GG8A 1M2VA 3AG5A 4IJMA 3UX3A 2ZB8A 3CE6A 4LSMA 4BFUA 4J0DA 3B5IA 3M70A 3QK7A 7AT1A 5DISB 2NXNA 1E18A 4IH4A 4RO0A 4UM7A 1JAYA 4IO1A 3RYFA 3KQMA 1T1IA 3WLAA 1N0WA 2AR9A 4RGYA 1RM5A 3EGEA 4JC8A 5JOQA 1HE4A 2V59A 3KT3A 3G82C 2BI7A 4GAEA 3GUUA 4BFLA 4EG7A 1FSGA 2H0AA 4I50F 1AZSC 3UJAA 3DH0A 5EJAA 1QRTA 1IZYA 1U04A 4YRGA 4DUZB 1U02A 2EQAA 5DF1A 4A5SA 5EKUA 2RG7A 2VBCA 3FCYA 1NQWA 1OASA 3PIRA 2DLDA 4DWWA 3Q8KA 3FE2A 4CKWA 2ONZA 1YB2A 4FU0A 3PGJA 4GQIA 1NJ6A 2Q4DA 1I4LD 3RFFA 1XMOC 1O94D 2VAVA 4C30A 1W8IA 3B13B 4XVRA 1P3DA 3ZI0A 4RMIA 2NVWA 1GAEO 4L28A 4KACA 3CZRA 2WHPB 3FTPA 5BPHA 2LV8A 2IPLA 2O1XA 3OIVA 3KNZA 5FWAA 5TRTA 3LK6A 3LUFA 4DF3A 3DBLB 3NAGA 2BC9A 2AVNA 1S6YA 1FW6A 1RPAA 4YASA 2NYUA 1AUPA 2F7SA 1PDWA 4FHFA 3RYIA 3E9NA 1O94A 1E8DA 3JALB 5A0VA 2G77B 5B58C 1OAKA 1TO6A 5TF4A 3RYHA 4BC9A 3DLPX 3NALA 1KMHB 1PFWA 1YASA 2H4XA 1EH5A 2R8ZA 1IJEA 1AS2A 2FQYA 2ZRCA 3FPEA 5CDTA 3NCHA 2H9IA 3FPAA 4AG6A 1FFHA 4B3TC 3W1VA 5CTAA 5KCZA 3SSMA 1ZGBA 1Z5NA 1G20B 4HLQB 2XQVA 1XRCA 4GHWA 4RFVA 3QXGA 3W9UA 1A9XA 3ODGA 3ABSB 4MB0A 4S04A 4YRCA 2UZ3A 1HTTA 2HY7A 2WU4A 1JWLA 4HUQB 2CFIA 1K9VF 4JYCA 2GM9A 1XSEA 4YBZA 1M7GA 4YRPA 2ZYUX 1KE2A 3CX6A 3T5BA 1IXZA 4ZRNA 1BDHA 1GHTA 5CM9C 4EJ6A 3QNWA 2H4FA 4HLUC 4CMKA 5I9NA 4HWPA 4XVUA 3AVQA 1POWA 1XD2A 3KUCA 3OC6A 3OHMA 4L5YA 4LW8A 4CE6A 1M83A 4D0NA 5KTMA 3UFXA 1F06A 1I9CA 2FUEA 3HPQA 3TIFA 1USIA 3K8ZA 5CB4A 1KI6B 3GUCA 3C16C 2BDTA 1X74A 4OQFA 1JEJA 3FJYA 1CY2A 4CF7A 5IVKA 4DYVA 3QA9A 4I2NA 3TLAA 1MT3A 1OSNA 4OA5A 5AIBA 4LF9C 5GWXA 2PL9A 3PITA 1Q1ZA 3ZY6A 4AU1A 2BUBA 2WTEA 4DWVA 4FYHA 3R8FA 1KDPA 4GT1A 3GLHE 1K0FA 5CB4B 4CKYA 4RNDB 3UYLA 2DR3A 1QTNA 1MX9A 1GU1A 4OJNA 1ZIPA 3TTXA 1YRBA 2CFOA 2HPAA 2KDNA 3IV9A 5CT4A 3MGAA 4B46A 1HNWB 3RVLA 3G9ZA 1YS2X 3DVAA 3GRZA 4LFBC 1B93A 5JNRA 1I6KA 3STTA 4KMMA 3EVFA 4QNNA 1GVHA 2WSBA 4LOAA 1IWOA 4LZZA 2YUIA 3C0KA 5TJHA 3B51X 4DIOA 2AD5A 5EHZA 1B15A 1W0CA 4FR0A 3HVHA 3V6MA 3ZV5A 3EISA 3UMRA 4CQMA 5AVUA 3EFBA 4BXOA 2NTJA 3ENZA 3M6VA 1W4BA 3IAHA 4AK9A 5EE5B 3KXPA 4RK7A 2QV7A 4WN3A 1XAGA 2AJBA 4L4QA 1TTHA 2VZ0A 3ROGA 3TMKA 3NBAA 1IQ0A 1N5OX 2GBPA 3O8RA 1TA4A 4KU4A 4MRRA 3DP7A 1Q50A 1J9GA 4BU1A 1EB8A 1XYGA 2V0CA 3IRVA 5C8XA 3FCEA 1VKZA 3D6TB 4L8FA 4LFCB 4WD3A 4EY5A 1JHDA 1TUBB 2E8FA 5IT4A 1VHLA 3NJRA 5FUXA 1Z12A 3EW9A 3LCUA 1FS5A 1NXPA 3EPLA 1T10A 1X1CA 1XJ0A 4PFQA 1JFTA 1MVNA 1YS1X 3Q9SA 2FW8A 3M4ZA 4FFMA 5HG0A 2J5BA 3R8XA 1EBUA 1XT6A 4MWGA 4FIZA 4Q03A 2VCEA 5J1SB 2PX5A 1E0SA 4Y6SA 4MI6A 5T6BA 3KBOA 4NCNA 4WESA 3DVAB 3DWFA 2WMNB 5B7GA 4IKPA 4A8HA 1XRJA 4IV8A 3RM3A 3UV3A 4GGMX 1O6ZA 2D00A 1E6EA 2X4LA 1T8RA 1H5UA 4RHFA 4CUZA 3E3LA 1N6PA 3ZY2A 4H18A 4QPCA 2QYHA 1SUWA 1ZO8A 3PNPA 1KYWA 1FEZA 4OLBA 3RG8A 5EZYA 1XVLA 1K7SN 4LECA 1Z8DA 1Z36A 5FV7A 3ZN2A 3CGWA 4BP1A 1DQYA 1R4AA 1GN9A 1QYIA 5IAGA 1T5DX 3WIEA 4CIDA 1QGAA 3FOCA 2IXEA 3O4IA 1M6EX 1Z2AA 1T3GA 4LNUA 4D8VA 2XI4A 2QUKA 1NF3A 4Y2VA 2X23A 3WYNA 1J1ZA 5JHGB 3FGPA 1JSLA 2EYQA 3GEHA 3M4NA 5FOXA 5I7AA 1FFAA 1UBOS 1JUDA 3MOSA 4YUVA 1RR6A 2RJOA 4I4IA 1JDJA 1GRVA 3HCAA 1OA0A 1GADO 2BJWA 1C1YA 2F1JA 3IC5A 4R54A 4DVJA 1SIWA 1E2QA 2QMQA 5IABA 4GPIB 1SA0B 3NT4A 4PX5A 1CK4A 4QULA 1PZHA 4BGEA 4LY3A 4D7AA 5CDYA 1F8YA 1KZGB 3IYLW 4FEEA 1LDMA 4O29A 3FKSD 1HBJA 4PSUA 1AURA 5KHAA 4ZEVA 4PU0A 2A84A 2W2MA 6REQB 1Q3TA 3CLKA 5K8IA 2W6OA 2C9YA 1Z0DA 3O93A 5FPYA 1H2WA 4DJTA 4W5RA 2BGKA 3AJDA 2HUNA 3ZXYA 1ZGGA 4UU7A 3MQFA 5M7EA 3NEAA 3TZBA 3PLAE 1JIQA 3AFHA 2HO4A 2G1UA 3AFGA 1KH2A 2O7RA 3AC0A 3FB1A 4QTXA 2D59A 1JEEA 1ZMTA 2DQ4A 2YCLA 2YZ2A 2VZ8A 2YQ4A 3OCVA 4FDTA 2PS9A 4OAQA 4O4LA 4XJTA 2I6XA 2X2FA 3WNVA 5JYCA 1UC9A 1GYQA 1PZFA 1E5QA 3RJZA 4HFRA 3WGLA 2PYZA 3ZXXA 4UQLA 2GMWA 4B3SC 2MDTA 4TT8A 3WAJA 3KZOA 1NXSA 3WMFA 3ZCPA 1YZFA 4AO6A 4CF3A 5BMVB 2OFPA 1NBAA 2AE2A 1WX1A 3KOWA 5AHKA 3D8BA 4BNGA 5JTTA 2RAPA 3AR3A 3A6GA 1P91A 4MS1B 1T1RA 4KC0A 2C95A 2YQZA 3A1WA 5ADHA 1L7MA 1T0IA 2VC2B 1M6VB 4I2VA 4QATA 5FTMA 4KR3A 2Y27A 4WX2B 4DCTA 4M1MA 2F1KA 3HBLA 2IHTA 1X77A 3VHXB 1EWRA 4JI2C 1TTQB 4WFJA 5E9WA 1JMYA 2W4MA 5H80A 4ZDJA 3GAFA 5F76A 1T2NA 4X6LA 5EQJB 4N9WA 2FPRA 1MO3A 3IX7A 1Y63A 1LGYA 1HKUA 3DTVA 1PR4A 1OMOA 1YQTA 3ZU4A 3HB9A 4MVYA 2ZRLA 4RJLA 5FLEX 1NNEA 4QJ4A 4M0PA 2F8MA 4ZAWA 4MIEA 3U3MA 4D1YA 1QZTA 3ZJ5A 1A0OA 1ZFNA 1KEEA 4J6FA 4TLBA 4UMFA 3R5FA 5IVHA 3PZRA 3SC2A 3PU6A 2ZVQX 4K6HA 2XDAA 4L27A 5TDHA 5BN4A 5ELMA 1Z0FA 1GRNA 2IHUA 2HBYA 4EKGA 4J16C 5HP4A 1EI9A 1ODFA 1AKTA 2EP7A 1RXUA 2QR2A 1C3OA 3TOXA 4FYXA 3CR3C 3WIBA 3PUXA 1GZUA 5E2IA 4E88A 1UAAA 1EVYA 4NOZA 1DELA 3UMVA 2ESRA 1CWUA 2R1VB 5KOJB 1US8B 1Y6QA 1PDVA 2FZVA 3A6DA 5J5CA 3S8YA 4Z49A 4HXFB 1QKKA 3DT9A 3EMKA 3GLIB 3FLMA 5AK6A 1Y34E 2WTAA 1TCVA 4G1FA 4OUDB 2JHCA 1RVV1 1VRWA 4TQ9A 3RIGA 3R7AA 1ZD8A 1KP3A 3BSFA 5JSZB 1AH2A 2COEA 2A5YB 5J43A 5EQDA 2R8BA 2V9ZA 3C8ZA 3LCCA 2B4YA 2AFRA 4RA9A 3V1NA 4G0VA 3MT8A 3HGTA 1DJLA 3A1VA 4KV7A 4CCSA 2A4MA 5BW6B 1WULS 4QPZA 1EFRA 4UVDA 4UAGA 3FKJA 3MOIA 4BWYA 4EF4A 1QVZA 1U3TA 4TM8A 3VI3B 4F60A 5B7NA 2VRCD 5A1TA 3TBFA 2HA5A 3VZPA 1WDTA 1N7HA 1WSAA 3P9SA 3AVYA 1AT1A 3LV8A 4MEJA 1GTRA 4JI8C 4OSPA 3AOEA 2DYJA 1U0TA 3KFVA 5BVHB 1NMSA 3DO8A 2EG5A 2PS3A 1SY7A 4W9NA 2OUKA 3M6MD 4CI9A 1P2TA 1D2RA 3SEQA 5JNUA 2HNBA 1N32C 4YO8A 1Q16A 5DYYA 3VR4H 4A16A 2EW8A 2I62A 4IWNA 3Q2IA 4CMJA 4AJ1A 3PQ8A 3ZWQA 3C87A 1O57A 3IPAA 3HKEB 2WHPA 4L22A 4WK4B 5LQKA 4YQYA 4QUIA 1H0HA 2Q1WA 3TRDA 4EPTA 5C7LO 2WJ4A 2OBYA 1DXOA 2WTMA 4XJXA 3PESA 3RGGA 3WL3A 4I8XA 3QOFA 5CJJA 2AYXA 2Z1MA 3IVRA 4X95A 3P8ZA 5HKBA 1BWRA 3ZHQA 1TCUA 3CIOA 3AUFA 1DB3A 5HQTA 2FX3A 3UH1A 1OU4A 4WXHA 4B8WA 2CD7A 3CF4G 4IRMA 1DRKA 4H7PA 1MQ9A 4RY2A 1VLVA 5B1SA 2Y1XA 3HRIA 3P71T 1W0KD 1G8PA 3EPHA 1CIVA 3WWOA 3NONA 3EMVA 3NYQA 1ZJZA 3GFQA 4JU9A 4QOFA 4U9IS 5AWFC 4JH0A 4AN0A 3PGKA 1PWXA 2X7XA 4MVJG 1EWKA 1GTVA 3OZBA 5KB3A 3CUKA 2C4UA 3ITNA 3Q7TA 2ZIEA 4K6FA 2WQ7A 1R18A 1JFFA 2N46A 1SD5A 4PSVA 2O3UA 3OKFA 1T2FA 3KQOA 4U6NA 2C3UA 4DLXA 1EIWA 3K9NA 4HPVA 4MQUA 4ZTUB 9LDBA 5BN5A 4GXRA 2VKTA 1KFJB 4MW4A 2ZK7A 1YZVA 4J0IA 4N5LA 4BV3A 3V8MA 3EOZA 1XWWA 5A4DA 2UXBB 4OMFG 5AK4A 1TFRA 3LHSA 5DGTA 1I2BA 1UFOA 5JEEA 2GAOA 3N0WA 1I0LA 1F17A 2OWDA 4PCVA 3HJUA 3NWBA 1YQ9A 1U0RA 2NIPA 4M9XA 4Q9IA 2X3FA 2G5PA 4EY4A 3F6RA 4KXLA 4CIXA 3KXWA 2QUIA 3ONWA 3FPKA 1HNZC 3D6AA 4U2KA 2I0FA 4YEDA 2WZQA 3NLLA 1ZGHA 2ZUUA 3FF1A 1AZWA 1L3IA 4AC9A 2O3JA 1GTL1 4BO2A 1P6UA 4MTCA 2GRJA 5CGQB 1W73A 5MFPA 2D5BA 3DWIA 3DVLA 1V39A 3MB5A 3H2BA 4RIHA 3K5HA 4D99A 3G0GA 3NEPX 1L6IA 2ZIUB 1L1FA 4DBLC 3MJ4A 1TJ5A 1VFPA 1ZICA 2ZOSA 1KBOA 3GFGA 3SD7A 2HMWA 3PXDA 2VWPA 1VE9A 2HQBA 3FR8A 3G59A 3MTEA 1V8DA 3ND5A 4BBPA 1ZSYA 5FJJA 2BFFB 4X64B 2GCGA 5C1OA 1ZK3A 4F3NA 3K9CA 3HCFA 3T1VA 2JF0A 1B74A 5DYWA 3WMRA 4AZ0A 3G1UA 3B38A 4F2HA 3CKLA 4B4UA 2Q5HA 5FBHA 1QUEA 2VHYA 2ZM5A 1FP7A 3K6JA 1ZRMA 1P7CA 3TZKA 1Z0UA 2IUEA 1QG6A 4R31A 3I1JA 1AM4D 3DTYA 5CEJA 5CFLA 4KRXA 3BXPA 5JJLA 1ISJA 4WK0B 1QIEA 3S3TA 2ZUTA 4F5EA 2O2IA 4YCCA 1VA5A 4QPJC 1LQLA 2Q3LA 1THGA 2DUMA 2VH1A 2ZUVA 3PV0A 2V6MA 3QW4B 4BDTA 2FKNA 3CW2A 4JQZA 1L7PA 5CITA 2GPSA 1U5AA 1T8TA 2OILA 3K8QA 2P91A 4R1PA 1DE0A 2EF1A 2IKQA 3R40A 4KB5A 5D51S 3WLSA 5IZ4A 2DR2A 2REXB 1SHJA 1WV0A 2FFRA 2OLKA 1WE2A 3UK1A 5CLFA 5IKMA 3JZAA 5JY1A 4R2MA 5LQUA 1NI5A 4ZPXA 2BRUC 3NHMA 2R2AA 2Y71A 1IN1A 1KU6A 3OO1A 2WWIA 4MUJA 2FQ1A 4IG9A 4HYQA 2HK9A 2GCOA 1UDBA 2DFNA 3G17A 3HEMA 4S2UA 1RYFA 5AVZA 1DI0A 4N01A 3O8CA 4H3SA 3QFSA 4DG5A 4ER5A 3L1HA 4QRIA 1ZM7A 3FZYA 4IGEA 1T6XA 5BR1A 2QYTA 3FWKA 1JFVA 2JGRA 2R97A 5KOHA 5JYDA 1E6LA 3LL7A 2HQRA 2P2ZA 5KNBD 4PV7A 4ZPJA 3FYTA 5DNUA 1TRKA 4EHJA 3UJ8A 1LW6E 4HYYA 1DAOA 2PX0A 3BFPA 2IV2X 2WWGA 2VNKA 1PT6A 4NE7A 3R9WA 4R3UC 4W6ZA 1VHWA 4UD2A 1WHSA 1KKGA 5EIBC 2DBQA 2WF8A 4HXEB 1U8ZA 1ULAA 4LI0A 4IOMA 2AEMA 3AF1A 3LT0A 2FPIB 3H97A 3OQIB 4CT4B 3OT1A 4QXAA 1RRFA 3EEIA 4BO7A 1CQXA 5EIHA 4MW7A 4MUHA 4UNQA 1FYXA 4RWEA 1Z17A 3WB1A 3ZDEA 1EUCB 1HLFA 3W6UA 3DV0B 4FJ2A 4V39A 2HDHA 2P2SA 3ZHXA 1WUYA 1ZMXA 5JAPA 2AFHA 5FULA 1G19A 2JL1A 3ZI7A 4UHBA 3AJAA 2GOYA 2AHOA 2FZKA 7ADHA 2W6IA 4HAZA 1LNZA 3MWDA 4NXNC 3MTBA 4TSFD 4K05A 1PYOA 1V1MA 1UBFA 2WE7A 3ZE0B 2KBEA 3K7EA 3OOJA 3GKUA 3B3AA 4TRRA 4W5QA 2QRMA 3E9EA 2O2EA 1UM9B 3GVCA 2QQ5A 4C4TA 3K1AA 2CXNA 1B3RA 4DMCA 5CFQA 2H1VA 1KVRA 2YZGA 4A8JB 1I3NA 2QVCA 3L7MA 3E70C 1ZKDA 2X2EA 4XWGA 3WRWA 3UCFA 4AF7A 4UDNA 3T5GA 3OZEA 3OETA 2W6ID 3GWZA 3NAQA 2NO0A 4K0KB 4X84A 2GCEA 4KAJA 1HDCA 2IV7A 1JDUA 1QOQB 4RVOA 1Y8RB 2B35A 3CUEF 3NNDA 3TW4A 4PO1A 3B1KA 3BKXA 3NXSA 1NP3A 2Q4BA 3D4OA 4ZTBA 3TTYA 4E13A 2NZXA 1RWNA 1VMAA 4Q3KA 5F64A 3C3XA 1VG8A 3ZK7A 4OYYA 1NUPA 2W71A 3WKBA 1R15A 1XR3A 3GD5A 3H11A 5D3MB 2W11A 3B36A 1SUDA 3H8WA 1WDKA 1FMJA 4REQA 3KKQA 4DLZA 1VCHA 4B5LA 2B36A 1GUDA 3KE9A 4FPXA 3VX3A 3LBIA 3TKYA 3D3JA 2ZJFA 4D4HA 5HKAA 4I4NA 2OO5C 3K3PA 3NORA 4BNKA 4E22A 4INZA 2B1QA 4K9KA 3E48A 1SD1A 5HUQA 3RUHA 1LBEA 2MJLA 3CZCA 4TL7A 3ENVA 1GNTA 4DMMA 4Z2AA 1MB3A 4Z9BA 3D8HA 3EIOA 1GGJA 1GV1A 4IH1A 5EWMB 1YZHA 1CB7A 1NJ1A 1QGOA 2C0QA 4LF4B 4XFKA 2LUOA 3VO9A 1IBLB 4B7CA 2TECE 3TRJA 1PX0A 2RHHA 4KKVA 3VH2A 4RF2A 4B7ZA 3INRA 3Q72A 3PTZA 1H0KA 1XL0A 2YHIB 1E59A 1BQEA 2OO7A 2IYOA 4QWWA 2QD1A 2I2FA 1PJSA 3KPYA 3A2LA 2EFJA 2IDJA 2GILA 3HWRA 1V7QA 2C9ZA 3IERA 3NBKA 4MQBA 4QYWA 2WHRA 3VC1A 1CUCA 5E6SB 4H1WA 3WGHA 4UTRA 1B1AA 4PC7A 1ULTA 2A5DA 4PLHA 4ZYXA 2H9YA 3HSSA 4HH0A 3T4EA 1DHRA 3CIFA 3REGA 3I52A 3CYFA 1WV1A 3ETOA 1NW5A 3FBGA 5GZ3A 3MWEA 3LY8A 5CRIA 1H6CA 4WNAB 1WXDA 2Q0XA 2FRVA 2IY7A 3DT8A 4PBRA 4XDYA 3STWA 4Z0HO 3TZCA 4ME6A 4JLKA 1O95A 1PDOA 2VJKA 4RIGA 2W2PA 5A4MS 5A0TA 3C1AA 2CLSA 5BV2P 3RWBA 5L45A 2WUVA 3QX8A 4X8HA 5D6NA 2PWPA 3BX1A 3HUDA 5CW2A 4L2IB 4BNUA 1HT3A 3IKLA 3IQFA 4M0MA 1FDWA 4CV1A 4XM1A 3GT7A 3PFBA 2QIOA 1W2WB 4IQFA 4OH1A 5LMNC 1RTTA 1LKZA 3B60A 3EBLA 3KKMA 4FZ3A 3UKOA 3G02A 4FB5A 3D6UA 2R66A 2R4QA 4EQ6B 4BIMA 1F9AA 1KO8A 4FD2A 1VSTA 1ZNXA 3ZLTA 2HHHC 3HKDB 4ZK2A 1WG8A 3DG9A 2GBLC 5TNXA 2VK1A 4JUFA 3CA8A 1MUUA 1XDUA 5BYKA 1ZUIA 4L16A 4J0CA 4DKXA 1MPTA 5IYZA 3EGXB 2VF5X 3GJXC 3SXUB 2NT3A 3U4QA 1ZCAA 3GJRA 1YNSA 3TNJA 4LAFA 1E7MA 1C9DB 1CR4A 2FSHA 2BMFA 1UEXC 2PZBA 2ZIVB 3R20A 1TD9A 1XVIA 2BKVA 4JLPA 3HYRA 4HQFA 5DP1A 2Z5FA 2J3KA 3SI7A 1UF9A 1DC3A 1IRXA 4GKBA 3BDIA 3VR3A 4BKRA 4UUAA 3MFYA 1E4YA 1FVOA 5KVSA 3VU9A 2PIDA 2DSNA 1I30A 3F3YA 1QZ3A 2PXAA 1YDMA 3QX7A 4CR6A 2HF9A 2FZWA 2WVAA 1KH3A 5FP0A 2C7PA 2KYRA 5DLDA 3UB4A 1UJ5A 1HC7A 4OUKX 2X5KO 2YS6A 3HDTA 3JPWA 4O25A 3HRKA 4P5DA 2O0KA 4DV6C 5IAJA 3LYAA 1DADA 1YF3A 2F43B 1VIDA 1Z4PX 2ZTVA 1BN6A 2J4CA 1LF0A 1W4RA 3A6PC 4D8TA 2ADOA 4B7UA 1WKCA 5C1BA 2ODNA 1Q1BA 2R85A 4DV2B 2HJ9A 3U17A 1NN5A 1R6TA 1SEPA 3OC0A 3VSDA 4RTLA 1SCUB 4QASA 3ZVMA 4DOMA 4EYKA 4Z7OB 2PA0A 1I3OA 2V4ZA 3PE6A 5KNLA 4NCKA 4A0FA 1VJRA 3OO0A 3JVVA 5AOBA 1CY0A 1PR0A 1ZC4A 5EZQA 2GN6A 3NBFA 5I9SA 2YHAA 3VNUA 1IEXA 2OPLA 2I66A 2PNFA 4KL8S 3VPAA 3I0NA 3CZMA 3GEIA 1VLZA 3N2IA 1MU0A 2C4MA 5HF6A 3KSBC 2A86A 3QWIA 3D5EA 4YV2A 5LXTF 4HUQA 1KRHA 3HXMA 1G3IA 3JXEA 4UUOA 4X3PA 3LUKA 5F5LA 1V25A 3K0CC 2BBSA 5J4KA 1FLDA 1S8NA 2D4AA 1AC5A 3OZFA 5FADA 2VJOA 2JCVA 3OLXA 3HKDA 3WNCA 3I05A 5F7XA 3FSGD 4DA9A 4DB4A 1G8SA 2VXBA 4KX3A 5EXDA 3OFJA 3TLKA 2CLKB 5I48A 2ZQYA 2PS0A 2GSWA 4LDNA 3D1LA 2J41A 3EWSA 1I3CA 3GBVA 4PF1A 1KZ1A 1LW7A 4D3ZA 4NY1A 1V35A 1J8DA 3KPVA 4N3NA 4YRZA 3RC9A 2DT5A 3KZCA 3QUSA 3RKSA 5ESRA 4B74A 1Q0HA 3LZ6A 3L0SA 3Q10A 2P30A 2P27A 5LZ8A 1UQTA 2ARKA 2JIPA 2LE0A 1Z2CA 2LKDA 2QZ4A 3H1FA 1RHQA 1E2NA 2C9OA 1QLHA 2ENUA 3M6WA 1Z38A 1WBJB 1ODLA 3NHZA 1R66A 3O8NA 3R5KA 1TGVA 2TMDA 4WPGA 5H16A 3SSOA 3ITEA 1DUSA 4RD4A 4CMHA 4K6MA 1DL5A 1JSXA 2XITA 1EJBA 1JDBB 3AJEA 1JFRA 2PGXA 3KB8A 4F96A 1TO2E 3WZ2A 1SHKA 4L6IA 3N5CA 3ESCA 5GAJA 2C3PA 1Z6AA 4NC9A 3DZCA 4YDHB 2WWHA 3MWDB 1ZI9A 3QPWA 4QREA 4C7VA 3OE7A 4DMLA 1TU0A 1WOYA 3PDIB 1RWPA 2Y05A 1ABFA 1J2RA 1ZNQO 5G0TA 2JAHA 3BXZA 4ZYLA 3ZK9A 3LDAA 5LWQA 4RDHA 5KYWA 3KKNA 3OLQA 4H1VA 4UTPA 4Z9AA 4F6RB 1B42A 1K5GA 2V7PA 2VWHA 1ABBA 2JASA 4KO8A 2YOFA 2QY9A 3AX6A 2C2WA 2Y1DA 3LWZA 3IJEB 5A3RA 1EDOA 2FRDC 4O2LA 3X2SA 4CF5A 3FPHA 4MJ3A 2QD5A 4ODJA 5CA1F 1UMDB 3KU1A 5L7TA 1WUJS 2ZSBA 1GUYA 3I07A 1GQFA 1ZK1A 3AEUB 5LXTA 2EX0A 4J1QA 2RGNC 5M34A 1XEXA 1PS0A 1EXDA 1BU8A 4PPGA 5BSWA 3K9QO 2CXUA 2PO7A 1V2HE 1SURA 1GSHA 1SCIA 4QUAA 1UZLA 5BSMA 1L5ZA 1R6XA 4F4UA 1GPNA 2JD0A 3HU2A 3L7BA 1BROA 2AD1A 2P9GA 1EGHA 3K8YA 4FEAA 4IDCA 4EW2A 1NW3A 5L3SB 3GPLA 3WNBA 4H1TA 1XMIA 2Q4RA 2XMQA 4D9JA 4G86A 5ECGC 3AGQA 2ZPUA 2ON6A 4A92A 5P8WA 5KNCH 2QPAA 4I1VA 1F2TA 1H42A 2PUEA 4P38A 3SQLA 1BDIA 2PUBA 1H05A 4YWJA 1V8FA 4CNQA 1QP4A 4NZYA 2VPTA 3UBTA 2QPLA 4DR1C 2YBDA 3L8FA 3SC2B 1FDSA 2QROA 3SMVA 2PUCA 2ZWVA 4WN9A 1L5YA 4XUGB 4BKPA 4EF6A 2HQSA 2C8LA 4B4OA 1TQ6A 5FLXA 3R5SA 4LK2A 2EZ9A 3AEQB 3BMXA 4G5XA 4LWQA 3WQBA 2C4KA 1QSGA 1X1SA 2Q5IA 3GJYA 4AKHA 5I4IA 4O33A 4BQFA 1O03A 2LCFA 3WSWA 1KJ9A 3HYNA 4N48A 2A5LA 3PQ4A 1E64A 2Y1LA 1QOPB 3PWZA 3Q1LA 4LJ5A 4JI2B 1FFWA 1KDTA 1KMCA 3HNOA 4PX9A 5FO1A 2VRCA 2PUWA 3PHGA 1RBYA 2P2LA 4MWEA 4U2EA 1ZW1A 1WUIS 4EA8A 5KWSA 3F5SA 4OYRA 3WYCA 4AG5A 4ZTZB 4DBZA 3QRWA 1YDWA 5HYVA 1GRQA 3Q6MA 4JGIA 3CINA 1A27A 4E11A 4HVCA 3DJYA 1JIUA 3E9YA 1MTZA 4Y9DA 3Q7EA 3TR3A 2O3RA 3P9NA 4MO9A 3H65A 4N3GA 4DMUB 2BI4A 2ZM6B 1A4RA 5CK5A 4TQUS 4DC1A 2V7BA 3KKEA 1TM2A 4OQQA 1B76A 5FA5A 1AUOA 1M67A 1KS9A 3OMLA 2FEAA 2PZGA 4FINA 3K53A 1IOZA 1SIBE 4G5HA 1R88A 1PFQA 3D7NA 4ZT2A 4RAOA 5IXYA 3CRVA 2VHZA 3TZQA 1GGFA 2R6HA 3GN1A 4GPAA 2J59A 1O95C 2FUNB 1TAHA 1E0DA 1F5SA 1V7CA 4JUAA 3G3EA 5FORA 3KYDA 3IAM6 2BLNA 2ZWPA 1M34A 2PEYA 1C3XA 1CP2A 2HRDA 4YA6A 3KOZA 4NE9A 4S35A 4LVNA 1GU0A 1USGA 3I1YA 5D2CA 4ARIA 4GOOD 2LWIA 3EQ2A 2R8YA 2I99A 2P68A 3W6NA 5H3HA 3GFTA 1HT1E 2AN3A 4JUCA 1RWMA 5K6AA 2QYSA 1GY8A 1QGZA 4L7VA 4OYHA 4PW0A 1RC8A 1VGQA 1Z45A 5H81A 1NLYA 2I6FA 1JHUA 3EZLA 3G7NA 1RIIA 3LNCA 4NJEA 4ARAA 2HYIC 3G8BA 5AW5A 1F6WA 1GNQA 2FEWB 1CUEA 2ZAIA 4OH7A 3KUUA 3QU2A 3L41A 2IW3A 3REQA 4U7DA 1U8AA 3M81A 2HMVA 3L0YA 5TIIA 1EFVB 5BRJA 5HZHA 1QQAA 3K70C 1QIMA 3EIHA 3RFXA 3N0RA 4M7WA 1UBUS 4O2BB 2QM7A 4DA8A 5IC5A 3RQSA 2WPNA 2P5SA 3MJRA 3RREA 2B4AA 1FBNA 1VJTA 4Q9LA 4GF5A 3DGEC 5E0KB 5IJ0A 3H8JA 1Z07A 2XB9A 1LPOA 5KDDA 2OCKA 3U9TA 3A2MA 1KAHA 2BE9A 4XD2A 3U31A 4BFVA 4IIDA 4GRDA 3TJRA 1W52X 2GPAA 2PJUA 2CLMB 4EDFA 1C3JA 2FU5C 4YAJA 2QVZX 2QL6A 4B4DA 5A71A 5JS8A 3IAUA 1QH0A 1TPYA 2X4DA 1EDDA 5K0NA 1NM5A 3U7EB 4C0LA 4EB6A 1LBSA 4J0JA 2P4HX 1HFJA 3UMCA 2PUFA 3ND9A 5CCBA 3GGDA 4MS4A 1R12A 2ZUCA 3P94A 1KBZA 1YDGA 3C41J 1Z16A 5EE3A 3IA7A 5C1PA 3FAKA 3GEEA 4FGJA 3WB2A 2OL4A 3EXHB 4MWSA 1G291 3QOYA 1Y80A 1NA5A 5KKCA 4BY9E 3JQCA 1HLDA 4IKOA 2OBBA 3DOUA 3M5DA 2F59A 4WLVA 2VSQA 3U49A 4DMRA 2HBRA 3WGYA 2QMZA 2H5JA 3C14C 1YCHA 4D6YA 1CDDA 1E9EA 3FCUB 4IV5A 3VBEA 5K8UA 3DLHA 3FI9A 3H42B 4NE2A 5A6SB 4LJKA 5I4KA 5EJFA 2DHEA 5CCXA 1V5EA 4HTFB 5JMOA 1CT9A 2RI6A 3K4HA 1TJYA 3LOUA 5JSYA 2H0QA 1MP0A 4IJ6A 3WGUA 3Q7QA 2I55A 5DVZA 1IBLC 3D4IA 3BK1A 1KZYC 2WU1A 2O2HA 3R4VA 4OI1A 2HSWA 3FHCB 4G5RA 1P2SA 2F1IA 3KKLA 3TLEA 3MGGA 3ONEA 1PNQA 4OQLA 4HSEA 4QEDA 4RYLA 5K01A 1QE5A 1E99A 1GSOA 1M0SA 1QDEA 2WA2A 4K9MA 1KYYA 3H9BA 4UD6A 4RABA 4NNJA 3C7KA 3MLAA 2L69A 1QF9A 3PNSA 4R01A 9ABPA 2W43A 4KMOA 1RWQA 2A5FA 3A58B 4NOMA 3UB3A 3KEGA 4MTLA 4F04A 2R3SA 5HFNA 3WLRA 1GPMA 2JAOA 1J2YA 1YJAA 2PFGA 2AW3A 1T6BY 1WZEA 1X7YB 1C50A 3FVTA 3LA8A 1XZAA 4IH9A 1ZBDA 1OW3B 2GAJA 1NVKA 2OK7A 3QEJA 2E4UA 1K89A 4Y2HA 2Y1CA 2PKRA 3F6EX 3W7AA 1QHSA 2W48A 3LYLA 2R6FA 3QJGA 4IOKA 1JU9A 3SZMA 3GJQA 4G1VA 4RD3A 2O7VA 2WPDD 1PG2A 3A4NA 2AG6A 2SNIE 2VDRB 3F98A 4DM7A 4F86A 4YMHA 5HZMA 3LCJA 1SUAA 3QLVC 4QU5A 3MAGA 4NCIA 1IL0A 5C18A 5HIAA 3NIBA 1DC7A 4KWTA 4TRNA 5B57C 1TZ2A 2AOTB 3C3AA 5EMJA 4UE2A 1L5LA 4AS1A 4H6VA 3GZ4A 4HMPA 1M34E 5TS2A 3D64A 4JQSA 3DNMA 1SHUX 4EA7A 1RWVA 2L82A 3V9AA 3QEMA 5E9AA 2HWKA 1YRQA 1VJ1A 2DSTA 3VPSA 4E31A 4P8RA 4XVCA 5I6DA 3LUHA 4EGQA 1M10A 4YJ3A 5A06A 1Q1QA 1J25A 1HRDA 4QJBA 1D7OA 3LP5A 2IW1A 1L4KA 3SX2A 4HN4B 3NGMA 3PROC 3E9MA 2P35A 1L5GB 1OBFO 2VUSA 5L4NA 5AT1A 3OOWA 2DTDA 3F9CA 3I9V6 2GARA 1Q7TA 4JJFA 3NHKA 1ZRNA 4F45A 4JJZA 4BRSA 4QODA 3TXYA 2JLWA 2VF4X 1QJ4A 3LCVB 1MNQA 3NH6A 4FYWA 2XY4A 3UYKA 2NTVA 2XVMA 3HYLA 4J4TA 5I9MA 2W4QA 1P4RA 4HDSA 1VIAA 5FNVF 1NTRA 4R16A 2LD4A 3RVQA 3RU9A 3RV3A 4JHXA 1M0TA 3OUTA 3UNXA 3TL2A 2XX3A 4O3MA 1POXA 2RGGA 1G98A 1X94A 2O50A 2VF2A 3DR3A 3G8YA 3IJRA 5IKOA 3TAUA 3WMGA 4LGVA 5FI1B 1IVNA 2FZEA 2WAOA 1N9ZA 2J67A 4Q00A 1HTBA 1NJFA 1KC3A 1N6KA 3CLSC 2HXYA 3BGIA 3Q7IA 5LU9A 4Y9TA 3VGPA 4XPIB 3F2IA 1EK5A 1DKPA 2G7ZA 1GGNA 5CBKA 1XZKA 1H9AA 4PGAA 5JD3A 5SYMA 4MX8A 2AMFA 3NTLA 2KI5A 2J6IA 4KN8A 4O3FA 4BNIA 1DP4A 2KW5A 5FX2A 1G0NA 1JEQB 3CE9A 3PHIA 1EVKA 4R2KA 5EUMA 2EX4A 2VWQA 2JIBA 3U7GA 4R3NA 2EIHA 2NO9A 5BW5A 3UFBA 1Z9BA 2PM8A 4FFLA 3X3HA 3ER9A 2CMGA 4FHGA 1VJDA 2JCBA 1MOQA 4NZZA 5FXMA 3A9VA 5I7OA 3FMOB 1TYAE 2N42A 1OZFA 1DDOA 1BQ4A 2WYWA 3L04A 1C9YA 2Q49A 1K27A 4JP3A 3LWBA 3DAHA 4TXNA 4A0QA 5EI5A 4H2DA 6Q21A 2D4HA 4JVNA 2GBLA 4IMIB 3GDOA 3KKOA 3D02A 4DV4B 3K9HA 5GONA 3ZY5A 1YJ5A 4X7BA 4DSZA 2VHUA 1DQNA 1TJNA 3A2NA 4B6OA 4Z51A 2OPHA 1SQFA 1CR0A 1E4OA 2HJRA 2Q27A 5ULLA 4LCBA 4ALMA 2ZAYA 4K26A 5BXYA 2MOKA 4KPEC 4JD5A 1YS9A 4D26A 1JEYA 1S7CA 1I7SB 4YI5A 1MHTA 2VPXA 4WUVA 2CFSA 3C3BA 2QG6A 2XMCA 1HMPA 3OZRA 3WYGA 1NNUA 1JXQA 4A4DA 4DDTA 2ZIXB 3ANLA 4KTTA 1YVPA 1OFHA 1QE3A 1EGMB 1UZMA 2EBHX 4KWEA 4PZ9A 3RVNA 2VYCA 4BX2A 1SXGA 3RDPA 5IP5A 3CF0A 4MRMB 4RKFA 3SJ7A 4U2DA 1B2RA 3GGGA 4G1UC 4HEJA 4MINA 1K3TA 4HDMB 3BM5A 4KR7A 1CNEA 3MCTA 4HQOA 5D3ZA 4B5KA 3RVRA 4R71A 5FTNA 4I14A 2W9XA 5K6AC 1WA5A 3MPOA 4L08A 4ZANA 4X20B 2YWBA 4KQMA 1ZMRA 1N1EA 3GGSA 4BB5A 2VFAA 4DRYA 5SZJA 3TL6A 1VSQA 4LOJA 4IIVA 4GZ3A 4NICA 4K9PA 4PLGA 3U2QA 5K0FA 3R24A 5G2OA 1EMDA 1FQKA 3IQIX 2C5EA 2ZYAA 2ODEA 2VPQA 1FFXA 3KQKA 4QT0A 4FW9A 3USCS 2P8SA 3KWJA 3M1YA 1PSWA 1J9ZA 3EIXA 1O77A 2EJCA 3OFKA 3BFKA 3VR3D 2IWHA 2HBZA 1M9NA 3WR5A 2G63A 4ZMRA 4JI7B 3ZQKA 4EB3A 3E1KA 4LDPA 4JKYA 3SK0A 3CSUA 4B81A 2JLVA 2XXAA 2IHBA 2Q9BA 4M4SA 4P34A 1Q2XA 2VBGA 1LC0A 2QD2A 3L7CA 3MHTA 2GUWA 1T35A 4WAUA 5B30A 4RLQA 3UJ7A 3X1JA 3IGFA 1TIPA 5I7VA 2WFAA 2YTZA 3GXBA 1CC1S 4NZMA 2IYWA 2OCLA 4TV9F 3AESA 5KO2A 2QOEA 4M8NE 2CW5A 1E2PA 2PX3A 3JATA 1ILEA 2OVFA 4JJEA 3B1XA 4GNKA 5IKEA 4JI4B 2X9NA 1XNQC 2BHRA 5AICA 2ODTX 3UFXB 4JIMA 3DV2A 2FB9A 4FMDB 4L4YA 5AVXA 3IMGA 4LZJA 1VE5A 1EUCA 4L0MA 3W3AA 1PG5A 4IJ5A 4LJSA 1QWIA 4Q1DA 5F5XA 2Q5OA 3T15A 2FN9A 1TM4E 3PQDA 4ISCA 2XODA 2KWIA 1KK2A 1V96A 4IDEA 1Q83A 4CLDA 4DCNA 4YACA 5JAUA 5DCUA 1R3UA 4K6OA 3P0FA 1KAMA 1RQPA 4ZU1X 4ZVTA 4JFAA 3T3HA 1UPBA 4Q5IA 3FG9A 2FH5B 1FU8A 1QCZA 4KYVA 4M0DA 2AUMA 1JVBA 4B3MC 4BRUA 3LW7A 2CVZA 2AB0A 1KTIA 4AUMA 3DF7A 2IYSA 3FHLA 4ABYA 1PUXA 3H5WA 1WNTA 3R9IA 3MILA 3NATA 2AHRA 4KK4A 4II2A 4N7MA 4OK6A 4WMLA 1V16B 2XT6A 1J21A 3N8HA 2XUZA 1N5MA 4O08A 1ZH4A 2PQ2A 1GFIA 3VHRA 4ALJA 3QX3A 2ZBVA 2H5EA 4XX0B 1L4BA 4PSKA 1K5HA 3T7JA 1VPTA 4J29A 3PPIA 3THOA 2JCGA 2NO1A 2BHSA 1QV7A 4KYIB 4QRHA 2WZBA 1S2LA 3AW8A 5CLQA 1MQSA 1YCDA 3CG0A 1K6XA 2QT9A 5AUQA 5G3ZA 1HUQA 1X2EA 3VC3A 2TYSB 2OORC 4LF7C 5EMMA 1NBOA 1YHNA 2CNBA 1RXYA 1V9CA 2P2MA 2CUNA 2NXJA 3AUUA 3INYA 2CXSA 4KXQA 2FY8A 4Q1FA 3RFUA 4HGRA 3P2JA 3W2GA 1F38A 4BGIA 5B2ZA 4DCCA 2NU9B 2WD8A 2C7BA 4BWVA 4RANA 1OYYA 1QH8A 1KA9H 3M82A 5ALIA 4CLXA 4FQ7A 4EFKA 4EGFA 4F0JA 4ZGWA 2ZROA 4H27A 2J3DA 3HDGA 5GIOE 4TUYF 2UVPA 2RC5A 4LZOA 3EDCA 3TTUA 1APBA 2YNMC 1MAVA 1R16A 3FUXA 3S2FA 1GUFA 4L74A 1CDZA 2CWWA 4YHBA 2JVIA 1ZB8A 2PN2A 6ABPA 4ABTA 1FUEA 1N5RA 5JCOA 4P81A 4AKEA 4BEWA 1PJZA 2B78A 4R41A 1P62B 1IVYA 1IAVA 3FMFA 3I9V1 2PZEA 3E9ZA 3HBJA 4O5OA 3EGWA 4KR9A 5AQEA 3U39A 1X9IA 3HA2A 2VPPA 2JIDA 4BN0A 4YT4A 3CVXA 1G64A 1LDYA 1Z2PX 2WDZA 3HWSA 4C3ZA 3A10A 4HDKA 1IRIA 2QRLA 1C7ZA 4CTJA 5JC8A 5B2EA 3EEQA 1LB1B 3TQRA 2QORA 5DASA 1TYZA 2B4TO 2PKWA 2NUTA 4U5QA 3AO0B 5F3RA 5KPJA 1K3UB 2O5VA 1YB7A 5E7MA 5EMKA 1DSSG 2QL9A 4EHNA 4Z4CA 1WQ4A 4EYSA 2B20A 3VNQA 3OZSA 4NCJA 5LLTA 3GLGA 4PICA 5EGSA 2QZZA 5CFMA 4P0PB 1GGHA 3EXEB 1RLIA 4WLEA 4JP2A 2EBFX 4TTSA 2PUVA 2OCPA 1PW5A 3RQIA 5T5QA 3GRFA 3QNMA 4D56A 2ZRHA 2REQA 4K40A 1E5LA 4AN1A 2CGEA 4ZOLA 1LH0A 3WK4A 2C9BA 4KTVE 3BSWA 1ONBA 1N2OA 3AUSA 2O2ZA 3G2KA 1X86B 1HORA 2Y93A 3V2GA 4CETA 2WD7A 4YMIA 4PG5A 4CNBA 5IK2D 2X9QA 1ZZEA 1QGUA 2C29D 3E81A 1IPHA 3R5JA 4E3ZA 1G38A 3Q0EA 3TDKA 1NVDA 3ROXA 1E2IA 3P20A 1JHOA 4BLVA 5CHYA 4CHGA 1U8XX 1NDUA 1JKJB 2SKEA 2ATVA 2I67A 1CG6A 2ZJ7A 5GOZA 3KPJA 5FLXD 1MJHA 2AFIA 3BTVA 5JFOA 3N6RA 1WVMA 2RCNA 2XLCA 4JBLA 5CU7A 5F35A 4C3VA 1H2EA 4P80A 3UWSA 5DK4A 2FJUA 1BE1A 3T7SA 4Z1MD 2DUJA 4YALA 2QVYX 1Z6TA 2I4IA 4TV8A 4MICA 1N34B 1KK3A 4Q19A 5KWJA 2F43A 2OD2A 1U9JA 1HT2E 2N1BA 3QKSA 4KLAA 3COVA 2NVOA 5IX8A 3GU3A 4ASUD 1IWBB 1YZLA 3WNQA 3ZDXB 1Y33E 3K32A 3HY6A 1OX4A 4EA9A 4ZJUA 3BJIC 3LHFA 5DPMA 5JQWA 1MH9A 4ZQFA 4D80A 4IL5A 4R1LA 1K92A 2W6ZA 5TF0A 3QKTA 1P7PA 3WJ7A 3HFSA 2OAQ1 4YUWA 1QIFA 2D1FA 3WLJA 3WSTA 2GUGA 5TJ9A 4DLNA 4PWZA 2VHVA 4J03A 3FUTA 5LUAA 4O2BA 3VYSB 3E53A 4D4JA 2D7DA 5HGXA 3M3HA 3ICOA 1P18A 5GINE 1X3SA 3K2IA 2I7TA 3OTIA 2P11A 4FCVA 4E5SA 4M99A 1S3FA 2FEOA 2YRXA 2Q8QA 4BP8A 2XTZA 3G9UA 4U6SA 3FVWA 3FIJA 5DIZA 4C9BA 5JLAA 1RI2A 1ZX1A 4HDMA 4RIFA 1L0BA 1SAYA 1CRQA 3Q4GA 4P3XA 1KJWA 1GAXA 1Y5LA 3NHAA 1OXTA 3DOOA 3N1UA 1YDHA 2O5RA 2R1TB 2WAAA 4HGZA 1KJQA 3GPBA 4KR6A 4KWIA 5M3BA 4MA4A 1T2UA 1X1EA 2ATIA 4WQMA 2FJ0A 2G36A 1EFAA 2RBEA 3D4BA 4I4CA 3MMXA 4O4HA 4P4NA 3RHZA 4YUYA 3VISA 4G9GA 2R7AA 1TFUA 4U63A 1EJ0A 1EJ6A 4MI9A 3E3NA 2YN0A 2AJ8A 3FYUA 1BHJA 3FPBA 5KYVA 1U2DC 2P9TA 5EEGA 1YGPA 5E6UA 5TT1A 1KPHA 4LXIA 3PHCA 1R3DA 3ZTTA 1O0BA 1DIBA 3RPEA 2MSLA 5KJEA 3IRUA 4K0BA 1FX1A 2BJVA 5HIIA 2GPYA 3LT4A 1MO5A 3AYXB 4Z0TA 4BATA 5EVJA 3LPDA 5FPQA 4CT5A 1Z7BA 4KSYA 1MMFB 2VJCA 2FWMX 4OHRA 5E8RA 2UYHA 3MJSA 1FA9A 2UYOA 2H2GA 4EEZA 3CQ2A 4O4IF 5IRCD 4RORA 1UINA 2KMLA 3BE8A 2XWQA 3LAWA 1Q6YA 4JYMA 1EFTA 3BWDD 3IDZA 4MOWA 3A28A 2FPMA 4MVJD 2NSHA 2VUIB 2WFLA 2KLBA 1HDYA 3H5VA 1W5SA 1YACA 3CCBA 4M1YA 4QUGA 3ZWNA 4BQRA 1KEVA 3GA5A 1XZLA 2NW6A 3AT1A 1ZIXA 4B33A 3B12A 2GM3A 1F0YA 3KBBA 1KY3A 3M7IA 4PBSA 1LQ2A 4Y1FA 2ZJ6A 1RRMA 5JARA 1CZUA 3ZU3A 4EG4A 3CZPA 5T6MA 3RSZA 3HKBB 4LPSA 1T3SA 1VHTA 3AY6A 2AFVA 3OIUA 1SG0A 2AQIA 3LG2A 1C5KA 1OC2A 4IGKA 3RUCA 1XGKA 4XWKA 4GX0A 5KTTA 2VF7A 1VB3A 2IVFA 1L4LA 1NNSA 4DVGA 2A67A 2CLHB 1XHJA 4LF8C 1CQJB 2E82A 2VYND 4C4PA 2R9VA 3K0AA 1YZGA 3DEKA 3PP8A 2IOHA 4P22A 4YYZA 4D2IA 3DQPA 5T3YA 1XZEA 3O3MB 1P4EA 2E5FA 2W00A 4XIYA 4ZO4A 1GCOA 3RT7A 3T3MB 1KWGA 5ALWA 3IL2A 2QW1A 1OZ0A 4MGYR 5D00A 2B92A 2FFQA 1S8FA 1SWWA 2ZATA 3JV7A 1IZ8A 4BTLA 4NPAA 3N05A 1TZJA 3C1OA 4HNAA 1RDFA 3I4CA 3U3XA 1CZNA 3TQSA 1IHUA 4Q9AA 4JI5B 5H9WA 4AKSA 4GZLA 3TCXB 3ZGXA 1R9NA 4BFTA 3Q87B 3BT7A 1VL6A 3AEKA 5BV7A 3I01M 4HAWA 4Y3UA 2YINC 3V55A 2HMAA 1RE1A 2QPOA 1SULA 2Y67A 2NXEA 3NV9A 3O8OB 3MOGA 4DWJA 3EEFA 4M7RA 5CUQA 1P9OA 4YIKA 4JI8B 1RM0A 4C43A 3SZRA 5JD6A 5DBIA 3N7AA 5LDDC 4NOJA 4NZPA 2JS7A 3MJDA 4RENA 1H3FA 1NF9A 2YDYA 4ZO8A 3SYKA 3U3ZA 4GW3A 4HVLA 1DRVA 2QLNA 4Q66C 1RKUA 1NVVR 1YRHA 2ZCJA 1SKMA 3L7YA 1QG0A 2E85A 1IM2A 1U81A 1YB6A 3W2EA 2AFHB 3FNIA 4Q1CA 4UUMA 3O5AA 1KNQA 3ZDFA 3RADC 5CXXA 1VPEA 3OQPA 1ISMA 3OEYA 4FS8A 3WGVA 2ZR0A 1TAUA 2XT0A 1V47A 2P1ZA 4X1IA 2BBTA 2PKEA 3GVHA 3GY0A 4UKDA 2P9BA 4M7OA 4YJFB 4F6CA 3U09A 2CYBA 2GN4A 3ADBA 2B7LA 4CUJA 2Z51A 4QM6A 5FOUA 1IY2A 3V8NA 4XH9B 4NARA 4DIMA 5B55A 1B0ZA 3U48A 2GWRA 4V02A 2QP4A 4MS3A 1GTMA 1E3MA 5JZSA 1C0EA 4UXJA 4KQ1A 4ZEXA 3ISJA 2HJHA 2X22A 3IO5A 1PEKE 2J09A 4YCJA 1WUHS 3F8SA 1YQDA 5IJWA 4Q9KA 4KXYA 1XN1A 2Y4OA 1MW9X 3KT0A 2FE4A 4HATA 1WVGA 3KUKA 4NS4A 5IBQA 1JR3D 4ZVVA 1AK1A 2PGAA 1U7HA 3MAJA 3W5VA 5JPCA 2ZUFA 3D4PA 2P6MA 4JDUA 4RJTA 4CODB 3N2EA 3TIXB 1RAIA 4E1AA 1XNRB 1L7QA 1Z29A 2P2FA 3WLQA 3S55A 4DLTA 1BCRA 3UUFA 1E96A 5REQB 4KO2S 3N58A 5DHUA 1ZSNA 3K0FA 4IMRA 3UZ0A 5K0GA 2O8BA 4RSRA 3T0GA 4N0QA 4OL0A 3C6KA 2YW2A 2IYTA 1M8FA 1RQGA 1Z5OA 3IOYA 1XZQA 3SXUA 3IR7A 1X8KA 1Z25A 1H22A 3VKVA 3QPDA 2Z2YA 2I8CA 3CC8A 2FPGA 3F7TA 5EJ2A 5GPBA 3VYWA 1KBQA 2F3QA 1L7RA 3D7MA 2ANCA 3I9LA 4KBGA 5BUZA 1CUAA 2C5SA 3GJ3A 1HE1C 3U3OA 3UCXA 1OLXB 4RNCA 1XMSA 2CLCX 1W4LA 2O19A 1S02A 2YWFA 1J2TA 2KZ0A 2EWMA 3O4JA 3PVSA 1FK8A 4N6OA 1FFSA 3NTVA 4B6SA 1NYEA 3OQ1A 4U5XA 4HJXA 5CFNA 4JJ6A 4JCCA 2GBFA 2JLXA 4JV5B 1M1YE 3VR6H 2GS9A 2F8LA 3F74A 4R3WA 2L17A 2OQ2A 4KXWA 3R0JA 2IS6A 5EKXA 2AI2A 2HCRA 1GYPA 2WWWA 3DZGA 5SYNA 2PJRA 4FFBA 5BOVA 3D7LA 3DKRA 2I7VA 3USES 4JEMA 1U8TA 3GJ4A 2PMBA 4DNQA 5ITSA 1T25A 3GEPA 1Q2UA 3G8CA 4ALLA 2BMVA 2JFBA 2B2NA 2Q2QA 2WKRA 2WT9A 3DBHB 2WTBA 5EUQB 1A9PA 1KHHA 3JYOA 3MCUA 1I32A 5B1IA 3SHFA 2NU6B 4Q1BA 3KE8A 3LXUX 1JSZA 3RYTC 2QJWA 3JQ8B 4FYPA 4QBFA 2IPXA 3GCZA 4OG2A 5A4JA 4CQNA 1DG3A 4MB6A 4A3SA 1ZWKA 2C94A 3C5EA 3S0JA 3DHNA 1H93A 5B64A 5MGBA 1QR6A 1BHSA 1GL3A 2QMUA 2WYIA 1GVNB 5HE8A 5BQ5A 3NV7A 1TK9A 1WY7A 1T0UA 5HS6A 1QRRA 3WLNA 5LYJA 4EFLA 5ALMA 4DLLA 1ZUHA 4B6QA 2CJYA 1NWCA 1CNFA 2PZKA 2WW8A 3JZFA 2FVYA 3OZUA 4HQKA 2ZB4A 4OF4A 5DNEA 5AVOA 1LPBB 3PJGA 5CX1B 1LV8A 4LE5A 4BHTA 2PLFA 4D5EA 5A5VA 5K3OA 1B8UA 5CDFE 4XDHA 1E2DA 4JA0A 1OFVA 4AJIA 1NBEA 3NC1C 1NMZA 1E1DA 3OX1A 5FYQA 1ZU4A 1J07A 2BLLA 4A36A 3S27A 2I4NA 1SBQA 4RM3A 2G07A 2JHPA 4KQ2A 1P5RA 1XTPA 5IANA 4GKJC 2ENWA 5L3VA 1F8GA 1W36C 1JAIA 3VXKA 2ZB2A 4GXTA 4EYEA 2PQMA 2A1TR 4BS9A 1AA9A 2NX2A 2Z43A 1XAHA 1YIOA 3TD6A 4BV2A 3ZGZA 1SZJG 4EEKA 4QVGA 4BLPA 3KZKA 1U3UA 1J2EA 5EXPA 1LWOA 4WOKA 1P60A 3FNEA 1JTVA 2XUAA 3N8IA 1V3UA 3OUZA 3ACCA 1MR3F 4PANA 3VUEA 4YV7A 3PFNA 2VNAA 2ADFA 3I6ZA 5B6PA 3STVA 2QTVB 5LB4A 1HDZA 2HWYA 2WP8J 3EXFB 3F2VA 5LNK1 4Q4DA 1L5WA 3K70D 4ARZA 4M0LA 1E3DA 4BB0A 2C9CA 4ZQGA 2FFBA 3I4FA 4IYJA 5EXSA 5HCIA 2A9QA 1L5KA 4XWAA 1C8KA 1BEZA 1FFGA 5CA0B 4M1TA 1NVVQ 2V5VA 2NZ8A 3QF4B 3GNLA 3EGCA 2PUAA 2XCUA 4BU0A 5I3ZA 4KCGA 4NEGA 3ZUGA 2OCBA 4ER6A 1BCSB 4WVFA 2PCLA 3EXIB 1T9CA 2A0KA 4DS3A 4L4SA 1K8XB 4XLTA 2X76A 4ZYVA 1E3SA 2IIPA 5DTMA 3HACA 5DNDA 1M2VB 4GI7A 4Z54A 5JADA 1SXJA 3CFYA 2K2WA 1ZOPA 1K6MA 2Z98A 5ES4B 2VPZA 2V6IA 4OXIA 3DDWA 1LDGA 3BULA 3NBXX 4RTJA 3D3QA 1EGAA 3MS7A 3M34A 3EOBI 3ZNQA 3SYRA 3JAMA 4UVHA 1XIVA 3ZE1B 5FTWA 2BI8A 1R1DA 2OO3A 3CB4A 3HB5X 3NHWA 3OJWA 4G1BA 2WU3A 1XMPA 1LI5A 4WXPA 1V6AA 3T8YA 3R5HA 5D86A 3MSXA 4BLSA 2R0QC 3JVEA 4POAA 4WBXC 4I55B 4C21A 4IV0A 1IOVA 2RKWA 3QPCA 1FPQA 1JBEA 3TM4A 1SKAA 2XNDD 5SZHB 5BVGA 2AZXA 3WL6A 4CM7A 3KM0A 5B4UA 3EA4A 3ZV6A 3GLQA 4JLOA 4MV4A 5F3DA 3G7SA 2WE8A 1DAGA 2HEIA 4BMVA 3OF2A 4V0RA 3DBVO 1C1DA 3RE1A 2FN8A 3QNUA 2CZCA 2R00A 2NNWB 2PSSA 1E8NA 3I0ZA 1GARA 4YQEA 3A7DA 4DBVO 3IXQA 4YCLA 3HO1A 4PNPA 1EWVA 4BMZA 5FT9A 2J9ZB 2BGRA 4FFBB 2JI8A 3OZGA 1L1RA 1JQ3A 3L4BA 1NUHA 4OU4A 1F6DA 2ZR9A 3H2YA 5KS2A 4WA7A 4Z3DA 2P77A 4Y1GA 1WZCA 3RJMA 4ENRA 2QL7A 1XTKA 4HPJB 1JECA 1KIMA 4TSRA 2XMRA 1V2GA 5FJIA 2O54A 3RUAA 1UOPA 3BB4A 5EWJA 2PZ8A 1U7XA 2XMDA 1NVEA 5GONF 3BPSA 1C8VB 4ZHQB 2K5UA 1AU9A 2V7UA 3R3XA 1QGUB 3AVXA 1RBMA 1XTQA 4RKWA 1NQOA 1Q0TA 3AEQA 2XYPA 3R0ZA 2HSDA 4JB2A 2IYUA 1FMTA 4QQKA 1A69A 2UXBC 1T1EA 4W5WA 2B98A 2YICA 5BUSA 3B1FA 4PZ0A 2QGFA 1PLLA 3K9LA 1VSBA 4YP0A 1EU1A 4Q9DA 3N2KA 5K8TA 3NKFA 1TCCA 4A8JC 5L51A 5AHOA 1GR1A 2C84A 5CLIA 2FSVA 1M74A 2G17A 3EDYA 3QVSA 4ND7A 4B2IA 3F6SA 1EK2A 1JLMA 3EZYA 4BUJA 3PRJA 2HMYB 5BT9A 4LF7B 3G1TA 3DB1A 1O0SA 2FGJA 2XZTA 3DHYA 3O90A 4FYKA 2Z83A 3PK0A 2IOYA 2O2CA 3IUEA 3BDAA 3M3PA 4IXDA 4M22A 3A3KA 3LZDA 2HHJA 2JHFA 2RB4A 5DIFA 1MX1A 5F1YA 5C4IA 5JSFA 3TFWA 2R62A 2DHRA 3GZNB 3N0XA 1SA0A 1T5TA 2VI5A 1T4BA 3QUTA 1ZN9A 3DOHA 4TV9A 5ALNA 1RU3A 2BKXA 1JMKC 3AUYA 3DZBA 2JI9A 2PSEA 3ESQA 3PEUA 2MTBA 4W5TA 3E7PA 4OPMA 1A9QA 3KO8A 2CN1A 3ZTYA 1NBME 4OHCA 3M1LA 2RK4A 3SR0A 5J5VA 3UJDA 2EFYA 4ZC8A 4GXNA 1BVUA 2J0VA 1QOZA 3LF1A 1IZ9A 1WCIA 3IIMA 4WBNB 2YJ6A 5LP1A 3IUPA 3PC3A 3KQQA 3VPGA 4D9MA 1KTVA 1M7BA 3KLBA 2RGUA 4HWSA 1JAZA 4RY8A 1BOOA 3F78A 1XCOA 1QONA 1T4DA 3IO3A 3BQ9A 3IKTA 4G37A 1EXMA 5E8JA 1DKUA 4RTQA 2COUA 4DA4A 1RYDA 1WCV1 3GG2A 5BSEA 2P9FA 1LD3A 4FGZA 4GYWA 4QRDA 1JHPA 4TV8F 2PJDA 2QAIA 1ECCA 1IE3A 1PJTA 2PRSA 2IHKA 1IB6A 3H4MA 4CKBB 2MINA 3DKKA 2C57A 4HN2A 4NJMB 4QGAA 3ZCXA 1TT5A 4EB6B 1WPGA 2D0OB 1V3QE 1Z5ZA 1GZ3A 1U28A 1Z0IA 1E9AA 4LG1A 4AWAA 2P7HA 3HJAA 2HCTA 1EP3B 1EUDA 1S5PA 2GI4A 2AOUB 1J24A 1FLNA 4FHDA 5AW9A 1TIBA 3ILVA 3R6DA 4Q4AB 4D43A 2DPHA 4BMPB 4EG1A 2ZYGA 2BSAA 3HA5A 4YRMA 3IT0A 5CZVA 1YB5A 1KP2A 1EK0A 2J3EA 5D87A 5J2TB 1R64A 5JVDA 3CRW