3TQLA

Structure of the amino acid abc transporter, periplasmic amino acid-binding protein from coxiella burnetii.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
225
Chain Sequence
TDTIKFATEATYPPYVYMGGQVEGFGADIVKAVCKQMQAVCTISNQPWDSLIPSLKLGKFDALFGGMNITTARQKEVDFTDPYYTNSVSFIADKNTPLTLSKQGLKGKIIGVQGGTTFDSYLQDSFGNSITIQRYPSEEDALMDLTSGRVDAVVGDTPLIKQWLKQNGRREYVLIGKPVNDPNYFGKGVGIAVKKGNQALLLKLNKALAAIKANGVYAAIVQKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine-binding protein
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transport protein
total genus 71
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tqlA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tqlA02
1FTKA 1LAXA 1TFDA 4EXLA 4QFOA 4U1ZA 4KFQA 1F9BA 5L9OA 1B3FA 3R26A 3S9EA 4XKRA 2GHBA 1BIYA 4KCCA 4JWOA 3VVEA 4U4XA 2XD2A 2ZYKA 1JEUA 1H43A 2VHAA 3KFMA 4ZEBA 1ZU0A 1FCKA 4ZS9A 5TP9B 2REJA 2DXRA 4O3BA 3CG1A 3P7IA 2HZKA 1AH5A 4QFKA 2ZNUA 3N26A 2PVUA 4OESA 2O7IA 3UIFA 1B2HA 3JV9A 2ZYMA 1WDNA 1Y4CA 1LAHE 1FTLA 4ZE9A 4PFWA 1PBQA 2HEUA 1B58A 2Y7WA 4IO2A 3PUVE 2B3BA 4NWCA 1XC1A 1UIUA 4QSCA 5TPAA 1USYH 1A99A 3SKPA 4H0WA 3LSLA 5DYHA 2VD2A 4EQ9A 4R75A 1N84A 5B7DA 4GD5A 1LGBC 4ZEIA 4MLVA 3C34A 3RNNA 3OMBA 2DOJA 3D4CA 2ESNA 2CZLA 2H25A 3G3HA 3KOSA 2UVJA 3QUFA 4LONB 3JZJA 1SW1A 3SEWA 1NH7A 3MBPA 3TCGA 1MY4A 4OTEA 3UN6A 5HPQA 3G7WA 4BLAA 1R1NA 2OZZA 3U8QA 3MZ1A 3O9PA 1TFAA 1N76A 2H99A 1SYIA 1H45A 4F3GA 1MQHA 3CFZA 3QYTA 2DS9A 4HW8A 3DP6A 1N7XA 3CFXA 1N0TA 3T9VA 4KD5A 4RK2A 2IA4A 2AIXA 4TOZA 2GH9A 1ATGA 3TYHA 5TU0A 3IO6A 3KJ7A 4OZ9A 3OEMA 3QK6A 3KN7A 3N5LA 2H5YA 3KSJA 4POXA 3LR1A 4EF2A 1URSA 4O3CA 4Q0CA 3IX1A 4F22A 4BDOA 3VXCA 1JQFA 4NTLA 3FXUA 3OEKA 3DM0A 4TQUQ 4WEPA 1JNFA 2Z8FA 2D5WA 4EQ7A 4OETA 3FJMA 4FIMA 2UVIA 5JTYB 4PP0A 4OWDA 5AA2B 2D21A 2XXWA 2F35A 4DZ1A 1BKAA 3O2AA 1B3EA 3WAEA 4U21A 3TELA 4DXUA 2OJTA 2RC7A 4ZEDA 1B1HA 2ZYNA 3TTLA 2ONRA 4IO7A 3PUWE 4R6KA 4QFNA 5ISUA 4X1BA 3ZS6A 4JB7A 1MY1A 2DVZA 1FTOA 4ZECA 4X1DA 4IO3A 4RPNA 3MQ9A 3S2VA 5I58B 4Q30B 3TDJA 4UA8A 2V84A 1DTZA 4RPOA 3CIJA 2FNCA 3Q28A 5H8SA 3S9NC 4ELQA 3LBSA 1OVTA 2DXYA 4POWA 4LP2B 3MP6A 3OO6A 2V3TA 3MP1A 2G93A 3PPRA 2DYXA 3CFLA 4G8NA 2O68A 4F2OA 2AL4A 3ZKKA 4K3FA 4XKNA 2OCUA 4OVJA 4ESXA 3PUZE 1JW4A 1P1UA 4XTCQ 1IZ1A 2OWTA 1QUIA 5KZTA 3ILTB 4X9TA 4U4SA 2F6GA 4ELRA 1BTJA 1UTHB 2A5TB 1MPBA 1RYXA 4GIZA 4UACA 1FQFA 1CE2A 4KYEA 1TWYA 3BBRA 4I8CA 1MY0A 1H3DA 5H8HB 4MBPA 4ZE8A 4JSOA 4G68C 2VGQA 4MF3A 5M2VA 4YU0A 3A09A 4H1XA 4Z7EA 1B9JA 1NH8A 4JWYA 3E9XA 2HCAA 4OFJA 3PMXA 3TQWA 3OXNA 3FVGA 4IGTA 3KBRA 1MQIA 1MXYA 1HSJA 4NF8A 1SW2A 4MFIA 4M4GA 1FQDA 4MLQA 4TLLB 4G68B 1B3GA 1SVXB 1JW5A 1P1WA 1VFDA 1D9VA 3IJOB 1Y1MA 4GWOA 2Y7PA 5L9SA 2XD3A 5H8NA 2F36A 3EQ1A 3PD9A 3MP8A 2Y84A 5CRYA 3LUYA 4XKQA 1Y20A 3TPAA 4F29A 3F11A 4P0IA 3T22A 3FJGA 3VDFA 1XT8A 5KDTA 3DLNA 2P2AA 5HM4B 1RYOA 4LZ8A 1ZBMA 1MH3A 1QKAA 5I56A 4LUBA 2DWAA 5KCJB 2Y7IA 1B0LA 1KWHA 1P1NA 4H8IA 1IUDA 1J1NA 4Q8RA 3TMGA 2ABHA 3IORA 1LFHA 4ELOA 4DCYA 2PMSA 2PT2A 3HCQA 2UVGA 1O63A 3K0VA 2Z8DA 4U22A 2IEEA 1Y3NA 3PPNA 1MPDA 3FXQA 1QUJA 2Z23A 2WKYA 1M5BA 3MZBA 5DVJA 2V93A 4R9FA 2I3VA 1LAFE 4R6YA 5A5XA 5ICTA 1SYHA 3W15C 3O6HA 1GTKA 1Y9UA 5BUUA 1A40A 3LSXA 1TT1A 3QIMA 1QULA 2PYYA 3O28A 2DE3A 1IITA 3LC8A 3Q27A 2DE2A 1Y4TA 3GXAA 2HAVA 3H7MA 1PB7A 3IK6B 1MS7A 5H8QA 5ELVA 3LSWA 1ZIUA 2RINA 3PPOA 2I4CA 4C1TA 5DEXA 1OVBA 2QL3A 1I6QA 1QUKA 1LFGA 2V25A 4XIGQ 1EZOA 1EZ9A 3HHFA 1B52A 4LA9A 2HQ0A 2RF1A 3VV5A 1DPPA 3KEIA 1FQCA 3RTFB 4KYDA 4OQOA 3TTKA 3W9WA 5FTIA 2F34A 2Q2CA 3EN3A 2Q89A 1B40A 1B3HA 4F1VA 3R6UA 1M5FA 5AA4A 1NNKA 5DVFA 3IO4A 1XVXA 4ZDMA 2Y7KA 4EQBA 4OYVA 3OSRA 3UGWA 1JVYA 3K1MA 4OENA 2H9BA 3KOTA 2B3FA 1VSOA 2XXPA 4R74A 3MW0A 4RK9A 2DSFA 1MQDA 2XX9A 5CBSA 2ZNTA 1YCJA 4IO4A 3IR1A 2O84X 3M3FA 2YJPA 1AOVA 1VR5A 2V3UA 1XS5A 3K6XA 3M3KA 4ZZEA 3OD7A 4OXVA 1DMBA 4YB6A 2HZLA 1B51A 1FQBA 5J1DA 3MVWA 1DPEA 4JSDA 3V89B 2THIA 3DP8A 1UTBA 4OFOA 1B5IA 1MXVA 3KJTA 2F7AA 3PUXE 2F8DA 5ITPA 2XXUA 2YLNA 1P1OA 1B1XA 2F97A 1MQJA 1M5CA 3DP4A 3I5OA 3MPLA 3U94A 1GVCA 1FTMA 4FECA 1II5A 2ONSA 3VE1B 3TTNA 5AE4A 1PC3A 3IOWA 4BDNA 1QVSA 4JXIA 4NEDA 5TPAB 5I59A 3FJ7A 3GZGA 2NVUB 3CVGA 2XXIA 5HBCA 1D4NA 4QRZA 3N6TA 3FVOA 2A5SA 2DWJA 4I62A 3TQLA 3ZSFA 5EHMA 1MXZA 4H65A 4QFPA 1OQGA 2XXTA 4KQPA 1IIWA 1LBBA 1Q35A 4N13A 3S4UA 2FYIA 1NKXA 4THIA 1A8EA 4F3PA 1XOCA 5CMMA 1MY2A 2VP1A 4LVQA 1IXHA 4R73A 2HFBA 3O6GA 3T96B 4GQOA 1PB8A 3BFUA 3E13X 3MVZA 4GRKA 1EU8A 3KN3A 1EH3A 4IO6A 1QW0A 1LAGE 3Q26A 4NF4A 3PD8A 1MRPA 3OENA 1LFIA 1Z7NE 3FASA 5CBRA 4H67A 2ONKE 1B6HA 4E0XA 3L6GA 5I2KA 5F1QA 3R7XA 1NMUA 1VE4A 3ZKLA 2R71A 1ELJA 3FXRA 4FJPA 1MPCA 3USDA 4JBZA 1OQHA 1A7LA 4IY5A 3BFTA 1D3KA 3SEYA 5I2NA 1YTVA 3RUMA 1AL3A 3KG2A 4F3SA 3RQTA 5IKBA 3FVKA 4IB2A 1HSLA 1JEVA 1NNTA 3OO8A 2B65A 1OLCA 1YPNA 3GBBA 3HV1A 3IL1B 2I0CA 3EHTA 3V83A 2X7PA 1CB6A 1S50A 3IOTA 1OMPA 3CG3A 1M5DA 3C9HA 4F31B 4NF6A 4RNSA 1Y1ZA 3RGYA 1I6AA 3SERA 4NE4A 4WXJA 5L8DA 4HS7A 2XHDA 4LQ2A 5JK4A 2AL5A 2M8CA 4FATA 1GR2A 1VFEA 5ITOA 1FQEA 3KSXA 3H3GA 3HN0A 4DXCA 3UK4A 3EHSA 1AIVA 5B70A 1A8FA 1A54A 1URDA 2DP8A 5I57A 5CC2A 3TEPA 2F7BA 2OWSA 4YKPA 2RKMA 3MVXA 4H5GA 4HCYA 4ECFA 4QF9A 2UXAA 4U23A 4PE5B 4O3AA 4F3BA 4HCWA 1ZTYA 2O6AA 3IOVA 2QMXA 2F6PA 4F2QA 5CMBA 1O64A 1URGA 3C36A 2ZMBA 3VVDA 2NXOA 4P11A 4Q5TA 4R6HA 1B46A 1MQGA 1IQ7A 4DCXA 1ZMGA 2Q8JA 1MXUA 4NF5A 2V3QA 3FV1A 3B6QA 2NWJA 2P1SA 3K6WA 4YKJA 3ECRA 3K1PA 4NF8B 3U93A 1BP5A 3FZVA 5ICQA 3RPWA 5FHOA 4LZ7A 4AB6A 4ZEKA 1B0HA 4G4PA 3O29A 4JWXA 3AXFA 3HO7A 3S9MC 4OERA 1N04A 5CMKA 5H8NB 3OO9A 2HAUA 4MH5A 1L5TA 3O66A 3VLUA 3TAJA 3SEUA 2O1MA 2O7UA 1S7YA 2Q2AA 3A3UA 4BDLA 3OO7A 2DWHA 4NWDA 5TP9A 5KDTB 2BJJX 4H6DA 4OMBA 3EF7A 4G77A 3H6VA 5I56B 1GGGA 3M8UA 3CI8A 3H6TA 3GLBA 4OFLA 3IAZA 3L6HA 1OIBA 1LBCA 2I49A 3HSTA 3MJNA 3SDFA 2XXXA 3TTRA 2G29A 2UVHA 5AA3A 3MVYA 1FQAA 1HSEA 2QRYA 2KLFA 3TFLA 1MDP1 4WEDA 3KZGA 4AB5A 4H5FA 2Q88A 2XX7A 4U2RA 5IAIA 1LCTA 1WVJA 4DDDA 1DTGA 2F78A 5L9MA 3WAFA 3TODA 5A5XB 1D9YA 3U92A 4F1UA 2XXQA 4GLIA 4BDRA 1H76A 4GFRA 4U1OA 1I69A 2OLBA 3PGFA 4I9DA 4BDQA 2QS3A 4XKPA 1LB9A 4ELPA 5DT6A 1MG1A 3C4MA 5H8QB 4RXLA 4YB5A 3ILUB 2VD3A 3VLWA 4EDPA 3DELB 4R2BA 5DEXB 1JW1A 1DSNA 1POY1 3M3LA 5DVIA 3E4RA 4GXAA 2HXWA 4PQJA 3VFJA 1TXFA 2QJEA 2I6EA 3KGCA 4RYAA 3FD3A 3RTWB 1SW4A 4C0RA 4FORA 2W7YA 1DOTA 2QMWA 3TTMA 4ISUA 1SD3A 3RY3A 4QSEA 5DTBA 3HPIA 4ESWA 4ZEFA 1OLAA 2RCBA 4GOTA 1R6ZA 2O69A 1QKBA 4AQ4A 2RC8A 4FEBA 5AA4B 1PBPA 4GXSB 5JTYA 2H98A 4FEDA 2XXVA 5AA2A 4N6PA 5K2YA 4YAHX 4IGRA 4G8MA 3TCFA 2PBWA 1B4ZA 3GBAA 3S9LC 3IB2A 1H44A 3Q25A 4DXBA 3OOAA 3TCHA 5CI5A 3FUZA 2I48A 4P0GA 2O51A 3RT6B 3H6UA 3VVFA 3IOUA 2I3WA 3PV0E 3B6TA 5AA2D 1B3LA 1Y3QA 1M5EA 2ZXTA 4HTGA 3C32A 1FW0A 1S9TA 3VXBA 4YZZA 5I58A 4QHQA 2ALUA 4LATA 1B05A 2DE4A 1US5A 3H4ZA 2Q9TA 3RN8A 1IXIA 1LSTA 3C31A 4KHZE 3T9HB 4X48A 2YPNA 4PFYA 3SESA 3HHGA 4R2FA 1FTJA 1MXWA 3K00A 2AYSA 4IY6A 3T93B 3IB1A 1NNPA 1B32A 3C35A 1UTBB 4EXKA 1AMFA 3A3CA 1R9LA 3TUSA 1P99A 1LLSA 3I3VA 2QSXA 3D4GA 3UORA 3T9XB 3MPKA 2X26A 2P0SA 1UTHA 2A5TA 3IB0A 4EF1A 3G3FA 4L17A 1SI1A 4GL8A 1Q1KA 3FATA 3IJXB 1B7ZA 3OSQA 3SEVA 4EUOA 2D3IA 3B6WA 3UA8A 2R6GE 5CM6A 2XX8A 3PMWA 5H8HA 4YMAA 2XXYA 4R72A 1Y3PA 2OK2A 2QPQA 3CRBA 3QSLA 2ANJA 1MM7A 3I6VA 5I59B 3CSBA 1ZJLA 3G3IA 3H03A 4DLDA 4GL0A 1PB9A 2NOOA 2Z8EA 1EZPA 2Y7RA 3E3KA 2ZNSA 3UP9A 2QS4A 1SBPA 4FE8A 3H06B 4H8JA 4F1YA 3V8XB 3ODBA 3T9UA 1N3WA 1JVXA 1R9QA 2UYEA 3BKIB 4QFLA 3K01A 4LZ5A 1N3XA 1PDAA 2I58A 4G68A 4ND9A 3U72A 4OHNA 4OEVA 2O1LA 4QSDA 4G8HA 5I84A 1ZKBA 3MAMA 2GRVA 5JEIA 2GHAA 4PFUA 3JYRA 4YKIA 2PX1A 3MC2A 2QS2A 3PUYE 1MM6A 4JDFA 3PU5A 4NF4B 1NNFA 1PEBA 1B5JA 1MH4A 1MDQA 3EHUA 3MZ9A 4GVOA 1JETA 3T66A 5H8FA 3ONMA 3FVNA 3RT8A 4OEUA 1YAEA 1RKMA 5KCJA 5I2KB 1NL5A 4Z0IA 4C1UA 1USYE 3VLVA 3PPPA 3RLFE 3C33A 2RC9A 5FHMA 2DVCA 3TZAA 4NMYA 2DWIA 1MY3A 2REGA 4FAJA 3QUJA 4TLMB 3OELA 1LCFA 5I2NB 5LOMA 1SDXA 5FTHA 3FIRA 1SW5A 3CSGA 1T0KA 5AA1A 1IEJA 1B5HA 3LSFB 3B7DA 3TKDA 1US4A 2XXHA 3N6UA 4RA1A 1XHYA 4RJZA 5F7VA 1SQYA 3K1NA 1NFTA 1LB8A 3U1OA 3SETA 2E1SA 3QXMA 1A55A 4KI0E 5K2XA 3K02A 4I1DA 5EYFA 3O97A 4LQ5A 3K6VA 2GFEA 2DQVA 3W9VA 1UIVA 2VOZA 4F18A 2LAOA 5CMCA 4NF6B 2H4IA 3FV2A 4DIGA 1P1QA 1UQWA 3G3JA 2OBGA 5H8FB 3MWBA 1IXCA 1GV8A 4ONYA 4RY1A 3K4UA 1POTA 4GF8A 4N07A 2CMOA 4G2ZA 1I6BA 2NUVA 2Z22A 3K2DA 4R9GA 5I57B 4XXUA 3Q29A 4M1VA 3O6IA 3PPQA 1B4HA 5BWJA 3H6WA 4KCDA 4YICA 1Z7ME 4F19A 1QJMA 3V5AA 3SEXA 2R9JA 3EPEA 4BDMA 2RCAA 1B7HA 1IXGA 2I4BA 1B7UA 1BLFA 2F5XA 4KR5A 4F39A 4PFTA 4YB7A 3THIA 1WODA 4KPTA 3PMVA 1ANFA 1N7WA 3G3KA 1SI0A 2QS1A 3QAXA 3FGSA 4E0WA 1XVYA 2E0SA 4WKMA 1ZLQA 4DE8A 4PETA 4NF5B 3MUQA 5FHNA 2PT1A 4YKKA 2ZYOA 5EHSA 2I0BA 2X7QA 3CR9A 1MXXA 3N94A 3K6UA 2UYFA 4ZZAA 3KN8A 3G3GA 4YMBA 2XXRA 1O7TA 2FA7A 4KYSA 4IO5A 2F7CA
chains in the Genus database with same CATH superfamily
1FTKA 1LAXA 1TFDA 4EXLA 4GWZA 4PC9A 4QFOA 4U1ZA 3ROJA 4KFQA 1F9BA 5L9OA 1B3FA 3R26A 3S9EA 4XKRA 2GHBA 1BIYA 4KCCA 4JWOA 4MMPA 3VVEA 4U4XA 2XD2A 2ZYKA 4MHFA 1JEUA 1H43A 2VHAA 3KFMA 1FPEA 4ZEBA 1ZU0A 1FCKA 2GQ1A 4ZS9A 3B50A 5TP9B 2REJA 2DXRA 4O3BA 3CG1A 3P7IA 2HZKA 1AH5A 4QFKA 1FPLA 2ZNUA 2PVUA 3N26A 2O7IA 4OESA 3UIFA 1B2HA 3JV9A 2ZYMA 3SZPA 1WDNA 3BIGA 1Y4CA 1LAHE 1FTLA 4ZE9A 4AS5A 4PFWA 4X8RA 1PBQA 2HEUA 1B58A 5IZ3A 2Y7WA 4IO2A 3PUVE 4HXVA 2B3BA 4NWCA 1XC1A 1UIUA 5ET7A 4QSCA 5TPAA 1USYH 1A99A 3SKPA 4H0WA 3LSLA 4MNPA 5DYHA 2VD2A 4GWYA 2B4LA 4EQ9A 4R75A 1N84A 5B7DA 4GD5A 1LGBC 4ZEIA 4MLVA 4PAFA 1QGXA 2CEXA 3C34A 4JVCA 3RNNA 3OMBA 2DOJA 3D4CA 2ESNA 2CZLA 2H25A 3G3HA 3KOSA 2UVJA 3QUFA 4LONB 3JZJA 1SW1A 3SEWA 1NH7A 3MBPA 3TCGA 1MY4A 4OTEA 3UN6A 5HPQA 3G7WA 4BLAA 1R1NA 2OZZA 2B4MA 3U8QA 3MZ1A 3LUZA 3O9PA 1TFAA 1N76A 2H99A 1SYIA 1H45A 4F3GA 1MQHA 4JVIA 3CFZA 3QYTA 2DS9A 4HW8A 3DP6A 1N7XA 3CFXA 1N0TA 4MCOA 3T9VA 4KD5A 4RK2A 2IA4A 2AIXA 4TOZA 5T3JA 2GH9A 1ATGA 2HPGA 3TYHA 5TU0A 3IO6A 5FBPA 3KJ7A 4OZ9A 3OEMA 3QK6A 3KN7A 3N5LA 2H5YA 3KSJA 4POXA 3LR1A 4EF2A 1URSA 1NUYA 4O3CA 4Q0CA 3IX1A 4F22A 4BDOA 3RPLB 3VXCA 1JQFA 4NTLA 3FXUA 3OEKA 3DM0A 1KZ8A 4TQUQ 4WEPA 1JNFA 2Z8FA 2D5WA 4EQ7A 4GX3A 4OETA 3FJMA 4FIMA 2UVIA 5JTYB 4PP0A 4OWDA 4PBQA 5AA2B 2D21A 2XXWA 2F35A 3KBZA 4DZ1A 3LV0A 1BKAA 3O2AA 1B3EA 1FPKA 5LTCA 3WAEA 4U21A 3TELA 1FPBA 1XI6A 4DXUA 2OJTA 2RC7A 4ZEDA 2MKZA 1B1HA 2ZYNA 3TTLA 2ONRA 4IO7A 3PUWE 4R6KA 4QFNA 5ISUA 4X1BA 3ZS6A 4JB7A 1MY1A 2DVZA 1FTOA 4ZECA 4X1DA 4IO3A 3MSTA 4RPNA 3MQ9A 5EYGA 3S2VA 5I58B 4Q30B 3TDJA 3KC0A 4UA8A 2V84A 1DTZA 4RPOA 3CIJA 2FNCA 3Q28A 5H8SA 2FHYA 3S9NC 4ELQA 3LBSA 1OVTA 2DXYA 4POWA 4LP2B 3MP6A 3OO6A 2V3TA 3MP1A 2G93A 3PPRA 3U65A 2DYXA 3CHGA 4I40A 3CFLA 4G8NA 2O68A 4F2OA 2AL4A 3ZKKA 4K3FA 4XKNA 2OCUA 4OVJA 4ESXA 1EYIA 3PUZE 2KQZA 1JW4A 1P1UA 4XTCQ 1IZ1A 2OWTA 1QUIA 5KZTA 3ILTB 4X9TA 4U4SA 1FBEA 2F6GA 4ELRA 1BTJA 1UTHB 2A5TB 1MPBA 1RYXA 4GIZA 4UACA 1FQFA 1CE2A 4KYEA 1TWYA 3BBRA 4I8CA 1MY0A 1H3DA 5H8HB 2DDKA 4MBPA 4ZE8A 4JSOA 2XWKA 4G68C 2VGQA 4MF3A 5M2VA 4YU0A 4N4UA 3A09A 4HE2A 4H1XA 1FBCA 2CZHA 3HFUA 1DBZA 4Z7EA 1B9JA 1NH8A 1FPDA 4JWYA 3E9XA 2HCAA 4OFJA 3PMXA 3TQWA 3OXNA 3FVGA 4IGTA 3KBRA 1MQIA 1MXYA 1HSJA 4N8GA 4NF8A 1SW2A 4MFIA 4M4GA 1FQDA 4MLQA 4TLLB 4G68B 1B3GA 1SVXB 2CZIA 1JW5A 2XWOA 1P1WA 1VFDA 4GX6A 1D9VA 3IJOB 1Y1MA 4GWOA 1IMBA 2Y7PA 5L9SA 2XD3A 5H8NA 2F36A 3EQ1A 3PD9A 3MP8A 2Y84A 5CRYA 3LUYA 4XKQA 1Y20A 3TPAA 4F29A 3F11A 4P0IA 4GWSA 3T22A 2FIEA 3FJGA 3VDFA 1XT8A 5IM2A 5KDTA 3DLNA 2ZZXA 2P2AA 5HM4B 1RYOA 4LZ8A 4MX6A 1ZBMA 1MH3A 1QKAA 5I56A 4LUBA 2DWAA 5KCJB 2Y7IA 2Y5KA 1B0LA 1KWHA 1P1NA 4H8IA 1IUDA 1J1NA 4Q8RA 3TMGA 2ABHA 3IORA 1LFHA 2L5VA 4ELOA 4DCYA 2PMSA 2PT2A 3HCQA 2UVGA 1O63A 3K0VA 2Z8DA 4U22A 2IEEA 5IZ1A 1Y3NA 3PPNA 5IZZA 1MPDA 3GYYA 5EQ9A 3FXQA 1QUJA 2Z23A 2WKYA 2VT5A 2V4CA 1M5BA 3MZBA 5DVJA 2V93A 4R9FA 2I3VA 1LAFE 4R6YA 5A5XA 5ICTA 1SYHA 3W15C 3O6HA 1GTKA 1Q9DA 1Y9UA 5BUUA 1A40A 3LSXA 1TT1A 3QIMA 1QULA 2PYYA 3O28A 2DE3A 2P3VA 1IITA 3LC8A 3Q27A 2DE2A 2PFZA 1Y4TA 3GXAA 1FPJA 2R8TA 2HAVA 3H7MA 1PB7A 3IK6B 1MS7A 5H8QA 5ELVA 3LSWA 1ZIUA 2RINA 3PPOA 2I4CA 4PCDA 4C1TA 4O8MA 5DEXA 1OVBA 4JVDA 2QL3A 1I6QA 1KA1A 1QUKA 1LFGA 2V25A 4XIGQ 1EZOA 1EZ9A 3HHFA 1B52A 4LA9A 2HQ0A 2RF1A 3VV5A 1DPPA 4OVSA 3KEIA 1FQCA 4DI3D 1IMEA 3RTFB 4KYDA 4OQOA 3TTKA 2P3NA 3W9WA 5FTIA 2F34A 2Q2CA 4O7MA 3EN3A 2Q89A 1B40A 1B3HA 3D1RA 4F1VA 3R6UA 1NV6A 1M5FA 5AA4A 1NNKA 5DVFA 3IO4A 5I7IA 1XVXA 4ZDMA 1IMAA 2Y7KA 4N6DA 4EQBA 4OYVA 3OSRA 3UGWA 1JVYA 3K1MA 4OENA 2H9BA 4P47A 3T0JA 3KOTA 2XXKA 2B3FA 1VSOA 2XXPA 4R74A 4XF5A 3MW0A 4RK9A 2DSFA 3RYDA 1MQDA 5EQAA 2XX9A 5CBSA 2ZNTA 1YCJA 4IO4A 3IR1A 2O84X 3M3FA 2YJPA 3BIHA 1AOVA 1VR5A 2V3UA 1XS5A 1YXIA 3K6XA 3M3KA 4ZZEA 3OD7A 4OXVA 3KC1A 1DMBA 4YB6A 1LBWA 2HZLA 1B51A 1FQBA 5J1DA 3MVWA 1DPEA 4JSDA 3V89B 5ET8A 2THIA 3DP8A 1UTBA 4OFOA 1B5IA 1MXVA 3KJTA 1FRPA 2F7AA 3PUXE 2F8DA 1YZ0A 5ITPA 2XXUA 1NUXA 2YLNA 1P1OA 1B1XA 4N8YA 2F97A 1MQJA 5A5LA 1M5CA 3DP4A 3I5OA 3MPLA 3U94A 1GVCA 1FTMA 4FECA 4PGPA 5IZ3B 1II5A 2ONSA 3VE1B 3TTNA 5EQ7A 5AE4A 1PC3A 3IOWA 4BDNA 4N81A 1QVSA 1FBFA 4JXIA 4NEDA 5TPAB 5I59A 3FJ7A 4GBVA 3GZGA 2NVUB 3CVGA 2XXIA 5HBCA 4I3YA 1D4NA 4QRZA 3N6TA 3FVOA 2A5SA 2DWJA 2Y5LA 4I62A 3TQLA 1INPA 3ZSFA 5EHMA 1MXZA 1NUWA 4PE3A 4QFPA 2F3DA 4H65A 1OQGA 4N15A 2XXTA 4KQPA 1IIWA 3E78A 1LBBA 1Q35A 4N13A 3S4UA 4PAIA 2FYIA 1NKXA 4THIA 1A8EA 4F3PA 1XOCA 5CMMA 4GBWA 1MY2A 4X04A 2VP1A 4LVQA 4N17A 1LBVA 1IXHA 4R73A 2HFBA 3O6GA 3T96B 4GQOA 1PB8A 3BFUA 3E13X 3MVZA 4GRKA 1EU8A 3KN3A 1EH3A 1YYZA 4IO6A 1QW0A 1LAGE 3Q26A 4NF4A 3PD8A 1MRPA 3OENA 1LFIA 2CZKA 3B8BA 1Z7NE 3FASA 5CBRA 4H67A 2ONKE 1B6HA 4E0XA 3L6GA 5I2KA 5F1QA 4PGNA 3R7XA 1NMUA 1VE4A 3ZKLA 2R71A 1ELJA 3FXRA 4FJPA 4PFIA 1MPCA 3USDA 4JBZA 1OQHA 1A7LA 4IY5A 3BFTA 1D3KA 4OVTA 3SEYA 2WYPA 5I2NA 1YTVA 3RUMA 4MNCA 1AL3A 3KG2A 2ZZWA 1FPIA 4NHBA 1IMCA 4F3SA 3RQTA 5IKBA 3FVKA 4IB2A 1HSLA 1JEVA 1FBPA 4AS4A 1NNTA 3OO8A 3E79A 2B65A 1OLCA 1YPNA 3GBBA 3HV1A 3IL1B 2I0CA 4P56A 4PDHA 3EHTA 3V83A 2X7PA 1CB6A 1CNQA 4O7IA 1S50A 3IOTA 1OMPA 4OA4A 3PTYA 3CG3A 1M5DA 3C9HA 4F31B 2KR0A 4NF6A 4RNSA 1Y1ZA 3RGYA 1NI9A 2VPNA 1I6AA 3SERA 1LBZA 4NE4A 4WXJA 1DK4A 5L8DA 4HS7A 2XHDA 4LQ2A 5JK4A 2AL5A 2M8CA 4FATA 1GR2A 1JP4A 1VFEA 5ITOA 1FQEA 1NV0A 3KSXA 3H3GA 2QFLA 4G61A 3HN0A 4DXCA 3UK4A 3EHSA 1AIVA 5B70A 4O94A 1A8FA 1A54A 1URDA 2DP8A 5I57A 5CC2A 3TEPA 2F7BA 2OWSA 4I3EA 4YKPA 2RKMA 3MVXA 4H5GA 4HCYA 4ECFA 4UABA 4QF9A 2XWVA 2UXAA 4U23A 4PE5B 4O3AA 2QVUA 4F3BA 4HCWA 1ZTYA 1FPGA 2O6AA 5LDZA 3IOVA 2QMXA 2F6PA 4F2QA 5CMBA 4N91A 4LN5A 1O64A 1URGA 4XEQA 3C36A 2ZMBA 3VVDA 2NXOA 4P11A 4Q5TA 4QBAA 4R6HA 1B46A 1MQGA 4GX4A 1IQ7A 4DCXA 1ZMGA 4GWWA 2Q8JA 1MXUA 4MAGA 4NF5A 2V3QA 3A29A 3FV1A 3B6QA 4NGUA 2NWJA 2P1SA 3K6WA 4YKJA 1NV2A 3ECRA 3K1PA 4NF8B 3U93A 1BP5A 3FZVA 5ICQA 3RPWA 4OVRA 5FHOA 4LZ7A 4AB6A 4ZEKA 1B0HA 3FBPA 4G4PA 3O29A 4N6KA 4JWXA 3AXFA 3HO7A 3S9MC 4OERA 1N04A 4OVQA 5CMKA 5H8NB 3OO9A 2HAUA 4MH5A 1L5TA 2BJIA 3O66A 3VLUA 2QVVA 4PF6A 3TAJA 3SEUA 4MIJA 2O1MA 2O7UA 2VPOA 2WX9A 4OANA 1S7YA 2Q2AA 3A3UA 4OVPA 4BDLA 3OO7A 2DWHA 4NWDA 5TP9A 5KDTB 2BJJX 4H6DA 5I3SA 4OMBA 3EF7A 4G77A 3H6VA 5I56B 1GGGA 3M8UA 3FXBA 3CI8A 3H6TA 3GLBA 4OFLA 3IAZA 3L6HA 1NV5A 1OIBA 1LBCA 2I49A 3HSTA 3MJNA 3SDFA 2XXXA 1NV4A 4QXDA 3TTRA 2G29A 2UVHA 5AA3A 3MVYA 1FQAA 1HSEA 2QRYA 2KLFA 3TFLA 1FJ9A 1MDP1 4WEDA 3KZGA 4AB5A 4H5FA 2Q88A 2XX7A 2Q74A 4U2RA 5IAIA 1LCTA 1WVJA 3QMFA 5EQ8A 4DDDA 1DTGA 2F78A 5L9MA 3WAFA 2WBDA 3TODA 5A5XB 1D9YA 4PDDA 3U92A 4F1UA 2XXQA 4GLIA 4BDRA 1LBXA 1H76A 4GFRA 1G0HA 4DI4B 4U1OA 1I69A 2WYKA 1NUZA 2OLBA 3PGFA 1FBDA 3ISPA 4I9DA 4BDQA 2QS3A 4XKPA 1LB9A 5F24A 4ELPA 5DT6A 1MG1A 3C4MA 5H8QB 3EKIA 4RXLA 4KXPA 4NQ8A 4YB5A 3ILUB 2VD3A 3VLWA 4EDPA 3DELB 4R2BA 1FPFA 5DEXB 1JW1A 1DSNA 1POY1 3M3LA 5DVIA 3E4RA 4GXAA 2HXWA 4PQJA 3VFJA 1TXFA 2QJEA 4HE1A 2I6EA 3KGCA 4RYAA 3FD3A 3RTWB 1SW4A 4C0RA 4FORA 2W7YA 3RPLA 1DOTA 1FSAA 2QMWA 3TTMA 4ISUA 1SD3A 3RY3A 4QSEA 5DTBA 3HPIA 4ESWA 2FBPA 4ZEFA 1OLAA 2RCBA 4GOTA 2XA5A 1R6ZA 2O69A 1QKBA 4AQ4A 2RC8A 4FEBA 5AA4B 1PBPA 5ET6A 2FVZA 4GXSB 5JTYA 2H98A 4FEDA 2XXVA 2PFYA 5AA2A 4N6PA 5K2YA 4YAHX 4IGRA 4G8MA 3TCFA 2PBWA 1B4ZA 3GBAA 3S9LC 3IB2A 1H44A 2WBBA 3Q25A 4DXBA 3OOAA 3TCHA 5CI5A 3FUZA 2I48A 4H46A 4P0GA 2O51A 3RT6B 1FJ6A 1G0IA 2F3BA 3H6UA 3VVFA 3IOUA 2I3WA 3PV0E 3B6TA 5AA2D 1B3LA 1Y3QA 1M5EA 2ZXTA 4HTGA 3C32A 1FW0A 1S9TA 3VXBA 1D9QA 4YZZA 5I58A 1RDZA 4QHQA 5J16A 2ALUA 4LATA 1B05A 2DE4A 1US5A 3H4ZA 4IR8A 2Q9TA 1NV7A 1K9YA 4MNIA 3RN8A 1IXIA 1LSTA 3C31A 4FBPA 4KHZE 3T9HB 4X48A 2YPNA 1LBYA 3IFCA 4PFYA 3SESA 3HHGA 4R2FA 2CEYA 2JJKA 1FTJA 1MXWA 3K00A 2AYSA 4IY6A 3T93B 4NAPA 3IB1A 2HXRA 1NNPA 1B32A 3C35A 1UTBB 4EXKA 1AMFA 3A3CA 1R9LA 2WEFA 3TUSA 1P99A 1LLSA 3I3VA 2QSXA 3D4GA 3UORA 3T9XB 3MPKA 2X26A 2P0SA 1UTHA 2A5TA 3IB0A 4L17A 3G3FA 4EF1A 1SI1A 4GL8A 1Q1KA 3FATA 3IJXB 2OWZA 1B7ZA 3OSQA 3SEVA 4EUOA 2D3IA 3B6WA 3UA8A 2XWIA 2R6GE 5CM6A 2XX8A 3PMWA 4PBHA 1IMFA 5H8HA 4YMAA 2XXYA 4R72A 1Y3PA 2OK2A 2QPQA 3CRBA 3QSLA 2ANJA 1MM7A 3I6VA 5I59B 3CSBA 1ZJLA 3G3IA 3H03A 4DLDA 4GL0A 4HE0A 1PB9A 2NOOA 2Z8EA 1EZPA 2Y7RA 3E3KA 2ZNSA 3UP9A 5I5PA 2QS4A 1SBPA 4P3LA 4FE8A 3H06B 1RDYA 4H8JA 5EYHA 4F1YA 1IMDA 3V8XB 3ODBA 3T9UA 1N3WA 1JVXA 1R9QA 2UYEA 3BKIB 4QFLA 3K01A 4LZ5A 1N3XA 1PDAA 2I58A 4G68A 4ND9A 1AWBA 3U72A 4OHNA 4OEVA 4XFEA 2QVRA 1SPIA 2O1LA 4QSDA 4G8HA 5I84A 1ZKBA 3MAMA 2GRVA 1EYJA 5ET5A 4GWUA 5JEIA 2GHAA 4PFUA 3JYRA 4YKIA 2PX1A 3MC2A 2QS2A 3PUYE 4PFBA 4P1EA 1MM6A 4JDFA 3PU5A 4NF4B 1NNFA 1PEBA 4NG7A 1B5JA 1MH4A 1MDQA 5IGAA 3EHUA 3MZ9A 4GVOA 1JETA 3T66A 5H8FA 3ONMA 3FVNA 3RT8A 4OEUA 1YAEA 1RKMA 5KCJA 5I2KB 1NL5A 4Z0IA 4C1UA 1USYE 3VLVA 3PPPA 3RLFE 3C33A 2RC9A 5FHMA 2ZZVA 2DVCA 4MJOA 3TZAA 4NMYA 1EYKA 2DWIA 4PFRA 1MY3A 2REGA 4H45A 4FAJA 4GWXA 3QUJA 4TLMB 3OELA 1LCFA 5I2NB 5LOMA 1SDXA 4P8BA 5FTHA 3FIRA 1SW5A 3CSGA 1T0KA 5AA1A 1IEJA 1B5HA 2Q8MA 3LSFB 3B7DA 1DCUA 3TKDA 1US4A 2XXHA 3N6UA 4P1LA 4RA1A 1XHYA 3NOHA 4RJZA 5F7VA 1FTAA 1SQYA 3K1NA 1FBHA 1NFTA 1LB8A 3U1OA 3SETA 4NF0A 2E1SA 3QXMA 2OX3A 1A55A 5ESYA 4KI0E 4P9KA 5K2XA 3K02A 4I1DA 5EYFA 4PF8A 1NV3A 3O97A 4LQ5A 3K6VA 1K9ZA 2GFEA 2DQVA 3W9VA 1UIVA 2VOZA 4F18A 2LAOA 5CMCA 4NF6B 2H4IA 3FV2A 4DIGA 1P1QA 1UQWA 3G3JA 1FBGA 2OBGA 5H8FB 3MWBA 2FIXA 1IXCA 1GV8A 4ONYA 4RY1A 1LEVA 3K4UA 1POTA 4GF8A 4N07A 3MYUA 2CMOA 4G2ZA 1I6BA 2NUVA 2HHMA 4PTKA 2Z22A 3K2DA 1KA0A 4R9GA 5I57B 4XXUA 3T1BA 3Q29A 4M1VA 3O6IA 4PAKA 3PPQA 1B4HA 5BWJA 3H6WA 4KCDA 4YICA 1Z7ME 4F19A 1RDXA 1QJMA 3V5AA 3SEXA 2R9JA 3EPEA 4BDMA 2RCAA 1B7HA 1IXGA 2I4BA 1B7UA 1BLFA 2F5XA 4KR5A 1NV1A 4F39A 4PFTA 4YB7A 3THIA 1WODA 4KPTA 3PMVA 1BK4A 4NX1A 1ANFA 1N7WA 1VDWA 3G3KA 1SI0A 3IFAA 2QS1A 3QAXA 3FGSA 4E0WA 1XVYA 2E0SA 4WKMA 5DW8A 1ZLQA 4MEVA 4DE8A 4PETA 4NF5B 3MUQA 2PCRA 5FHNA 2PT1A 4YKKA 2ZYOA 4NN3A 5EHSA 2I0BA 2X7QA 3CR9A 1MXXA 3N94A 3K6UA 2UYFA 4ZZAA 3KN8A 3G3GA 4YMBA 2XXRA 1O7TA 2FA7A 4KYSA 4IO5A 2F7CA
chains in the Genus database with same CATH topology
1FTKA 1LAXA 1TFDA 4EXLA 4QFOA 4U1ZA 4KFQA 1F9BA 5L9OA 1B3FA 3R26A 3S9EA 4XKRA 2GHBA 1BIYA 4KCCA 4JWOA 3VVEA 4U4XA 2XD2A 2ZYKA 1JEUA 1H43A 2VHAA 3KFMA 4ZEBA 1ZU0A 1FCKA 4ZS9A 5TP9B 2REJA 2DXRA 4O3BA 3CG1A 3P7IA 2HZKA 1AH5A 4QFKA 2ZNUA 3N26A 2PVUA 4OESA 2O7IA 3UIFA 1B2HA 3JV9A 2ZYMA 1WDNA 1Y4CA 1LAHE 1FTLA 4ZE9A 4PFWA 1PBQA 2HEUA 1B58A 2Y7WA 4IO2A 3PUVE 2B3BA 4NWCA 1XC1A 1UIUA 4QSCA 5TPAA 1USYH 1A99A 3SKPA 4H0WA 3LSLA 5DYHA 2VD2A 4EQ9A 4R75A 1N84A 5B7DA 4GD5A 1LGBC 4ZEIA 4MLVA 3C34A 3RNNA 3OMBA 2DOJA 3D4CA 2ESNA 2CZLA 2H25A 3G3HA 3KOSA 2UVJA 3QUFA 4LONB 3JZJA 1SW1A 3SEWA 1NH7A 3MBPA 3TCGA 1MY4A 4OTEA 3UN6A 5HPQA 3G7WA 4BLAA 1R1NA 2OZZA 3U8QA 3MZ1A 3O9PA 1TFAA 1N76A 2H99A 1SYIA 1H45A 4F3GA 1MQHA 3CFZA 3QYTA 2DS9A 4HW8A 3DP6A 1N7XA 3CFXA 1N0TA 3T9VA 4KD5A 4RK2A 2IA4A 2AIXA 4TOZA 2GH9A 1ATGA 3TYHA 5TU0A 3IO6A 3KJ7A 4OZ9A 3OEMA 3QK6A 3KN7A 3N5LA 2H5YA 3KSJA 4POXA 3LR1A 4EF2A 1URSA 4O3CA 4Q0CA 3IX1A 4F22A 4BDOA 3VXCA 1JQFA 4NTLA 3FXUA 3OEKA 3DM0A 4TQUQ 4WEPA 1JNFA 2Z8FA 2D5WA 4EQ7A 4OETA 3FJMA 4FIMA 2UVIA 5JTYB 4PP0A 4OWDA 5AA2B 2D21A 2XXWA 2F35A 4DZ1A 1BKAA 3O2AA 1B3EA 3WAEA 4U21A 3TELA 4DXUA 2OJTA 2RC7A 4ZEDA 1B1HA 2ZYNA 3TTLA 2ONRA 4IO7A 3PUWE 4R6KA 4QFNA 5ISUA 4X1BA 3ZS6A 4JB7A 1MY1A 2DVZA 1FTOA 4ZECA 4X1DA 4IO3A 4RPNA 3MQ9A 3S2VA 5I58B 4Q30B 3TDJA 4UA8A 2V84A 1DTZA 4RPOA 3CIJA 2FNCA 3Q28A 5H8SA 3S9NC 4ELQA 3LBSA 1OVTA 2DXYA 4POWA 4LP2B 3MP6A 3OO6A 2V3TA 3MP1A 2G93A 3PPRA 2DYXA 3CFLA 4G8NA 2O68A 4F2OA 2AL4A 3ZKKA 4K3FA 4XKNA 2OCUA 4OVJA 4ESXA 3PUZE 1JW4A 1P1UA 4XTCQ 1IZ1A 2OWTA 1QUIA 5KZTA 3ILTB 4X9TA 4U4SA 2F6GA 4ELRA 1BTJA 1UTHB 2A5TB 1MPBA 1RYXA 4GIZA 4UACA 1FQFA 1CE2A 4KYEA 1TWYA 3BBRA 4I8CA 1MY0A 1H3DA 5H8HB 4MBPA 4ZE8A 4JSOA 4G68C 2VGQA 4MF3A 5M2VA 4YU0A 3A09A 4H1XA 4Z7EA 1B9JA 1NH8A 4JWYA 3E9XA 2HCAA 4OFJA 3PMXA 3TQWA 3OXNA 3FVGA 4IGTA 3KBRA 1MQIA 1MXYA 1HSJA 4NF8A 1SW2A 4MFIA 4M4GA 1FQDA 4MLQA 4TLLB 4G68B 1B3GA 1SVXB 1JW5A 1P1WA 1VFDA 1D9VA 3IJOB 1Y1MA 4GWOA 2Y7PA 5L9SA 2XD3A 5H8NA 2F36A 3EQ1A 3PD9A 3MP8A 2Y84A 5CRYA 3LUYA 4XKQA 1Y20A 3TPAA 4F29A 3F11A 4P0IA 3T22A 3FJGA 3VDFA 1XT8A 5KDTA 3DLNA 2P2AA 5HM4B 1RYOA 4LZ8A 1ZBMA 1MH3A 1QKAA 5I56A 4LUBA 2DWAA 5KCJB 2Y7IA 1B0LA 1KWHA 1P1NA 4H8IA 1IUDA 1J1NA 4Q8RA 3TMGA 2ABHA 3IORA 1LFHA 4ELOA 4DCYA 2PMSA 2PT2A 3HCQA 2UVGA 1O63A 3K0VA 2Z8DA 4U22A 2IEEA 1Y3NA 3PPNA 1MPDA 3FXQA 1QUJA 2Z23A 2WKYA 1M5BA 3MZBA 5DVJA 2V93A 4R9FA 2I3VA 1LAFE 4R6YA 5A5XA 5ICTA 1SYHA 3W15C 3O6HA 1GTKA 1Y9UA 5BUUA 1A40A 3LSXA 1TT1A 3QIMA 1QULA 2PYYA 3O28A 2DE3A 1IITA 3LC8A 3Q27A 2DE2A 1Y4TA 3GXAA 2HAVA 3H7MA 1PB7A 3IK6B 1MS7A 5H8QA 5ELVA 3LSWA 1ZIUA 2RINA 3PPOA 2I4CA 4C1TA 5DEXA 1OVBA 2QL3A 1I6QA 1QUKA 1LFGA 2V25A 4XIGQ 1EZOA 1EZ9A 3HHFA 1B52A 4LA9A 2HQ0A 2RF1A 3VV5A 1DPPA 3KEIA 1FQCA 3RTFB 4KYDA 4OQOA 3TTKA 3W9WA 5FTIA 2F34A 2Q2CA 3EN3A 2Q89A 1B40A 1B3HA 4F1VA 3R6UA 1M5FA 5AA4A 1NNKA 5DVFA 3IO4A 1XVXA 4ZDMA 2Y7KA 4EQBA 4OYVA 3OSRA 3UGWA 1JVYA 3K1MA 4OENA 2H9BA 3KOTA 2B3FA 1VSOA 2XXPA 4R74A 3MW0A 4RK9A 2DSFA 1MQDA 2XX9A 5CBSA 2ZNTA 1YCJA 4IO4A 3IR1A 2O84X 3M3FA 2YJPA 1AOVA 1VR5A 2V3UA 1XS5A 3K6XA 3M3KA 4ZZEA 3OD7A 4OXVA 1DMBA 4YB6A 2HZLA 1B51A 1FQBA 5J1DA 3MVWA 1DPEA 4JSDA 3V89B 2THIA 3DP8A 1UTBA 4OFOA 1B5IA 1MXVA 3KJTA 2F7AA 3PUXE 2F8DA 5ITPA 2XXUA 2YLNA 1P1OA 1B1XA 2F97A 1MQJA 1M5CA 3DP4A 3I5OA 3MPLA 3U94A 1GVCA 1FTMA 4FECA 1II5A 2ONSA 3VE1B 3TTNA 5AE4A 1PC3A 3IOWA 4BDNA 1QVSA 4JXIA 4NEDA 5TPAB 5I59A 3FJ7A 3GZGA 2NVUB 3CVGA 2XXIA 5HBCA 1D4NA 4QRZA 3N6TA 3FVOA 2A5SA 2DWJA 4I62A 3TQLA 3ZSFA 5EHMA 1MXZA 4H65A 4QFPA 1OQGA 2XXTA 4KQPA 1IIWA 1LBBA 1Q35A 4N13A 3S4UA 2FYIA 1NKXA 4THIA 1A8EA 4F3PA 1XOCA 5CMMA 1MY2A 2VP1A 4LVQA 1IXHA 4R73A 2HFBA 3O6GA 3T96B 4GQOA 1PB8A 3BFUA 3E13X 3MVZA 4GRKA 1EU8A 3KN3A 1EH3A 4IO6A 1QW0A 1LAGE 3Q26A 4NF4A 3PD8A 1MRPA 3OENA 1LFIA 1Z7NE 3FASA 5CBRA 4H67A 2ONKE 1B6HA 4E0XA 3L6GA 5I2KA 5F1QA 3R7XA 1NMUA 1VE4A 3ZKLA 2R71A 1ELJA 3FXRA 4FJPA 1MPCA 3USDA 4JBZA 1OQHA 1A7LA 4IY5A 3BFTA 1D3KA 3SEYA 5I2NA 1YTVA 3RUMA 1AL3A 3KG2A 4F3SA 3RQTA 5IKBA 3FVKA 4IB2A 1HSLA 1JEVA 1NNTA 3OO8A 2B65A 1OLCA 1YPNA 3GBBA 3HV1A 3IL1B 2I0CA 3EHTA 3V83A 2X7PA 1CB6A 1S50A 3IOTA 1OMPA 3CG3A 1M5DA 3C9HA 4F31B 4NF6A 4RNSA 1Y1ZA 3RGYA 1I6AA 3SERA 4NE4A 4WXJA 5L8DA 4HS7A 2XHDA 4LQ2A 5JK4A 2AL5A 2M8CA 4FATA 1GR2A 1VFEA 5ITOA 1FQEA 3KSXA 3H3GA 3HN0A 4DXCA 3UK4A 3EHSA 1AIVA 5B70A 1A8FA 1A54A 1URDA 2DP8A 5I57A 5CC2A 3TEPA 2F7BA 2OWSA 4YKPA 2RKMA 3MVXA 4H5GA 4HCYA 4ECFA 4QF9A 2UXAA 4U23A 4PE5B 4O3AA 4F3BA 4HCWA 1ZTYA 2O6AA 3IOVA 2QMXA 2F6PA 4F2QA 5CMBA 1O64A 1URGA 3C36A 2ZMBA 3VVDA 2NXOA 4P11A 4Q5TA 4R6HA 1B46A 1MQGA 1IQ7A 4DCXA 1ZMGA 2Q8JA 1MXUA 4NF5A 2V3QA 3FV1A 3B6QA 2NWJA 2P1SA 3K6WA 4YKJA 3ECRA 3K1PA 4NF8B 3U93A 1BP5A 3FZVA 5ICQA 3RPWA 5FHOA 4LZ7A 4AB6A 4ZEKA 1B0HA 4G4PA 3O29A 4JWXA 3AXFA 3HO7A 3S9MC 4OERA 1N04A 5CMKA 5H8NB 3OO9A 2HAUA 4MH5A 1L5TA 3O66A 3VLUA 3TAJA 3SEUA 2O1MA 2O7UA 1S7YA 2Q2AA 3A3UA 4BDLA 3OO7A 2DWHA 4NWDA 5TP9A 5KDTB 2BJJX 4H6DA 4OMBA 3EF7A 4G77A 3H6VA 5I56B 1GGGA 3M8UA 3CI8A 3H6TA 3GLBA 4OFLA 3IAZA 3L6HA 1OIBA 1LBCA 2I49A 3HSTA 3MJNA 3SDFA 2XXXA 3TTRA 2G29A 2UVHA 5AA3A 3MVYA 1FQAA 1HSEA 2QRYA 2KLFA 3TFLA 1MDP1 4WEDA 3KZGA 4AB5A 4H5FA 2Q88A 2XX7A 4U2RA 5IAIA 1LCTA 1WVJA 4DDDA 1DTGA 2F78A 5L9MA 3WAFA 3TODA 5A5XB 1D9YA 3U92A 4F1UA 2XXQA 4GLIA 4BDRA 1H76A 4GFRA 4U1OA 1I69A 2OLBA 3PGFA 4I9DA 4BDQA 2QS3A 4XKPA 1LB9A 4ELPA 5DT6A 1MG1A 3C4MA 5H8QB 4RXLA 4YB5A 3ILUB 2VD3A 3VLWA 4EDPA 3DELB 4R2BA 5DEXB 1JW1A 1DSNA 1POY1 3M3LA 5DVIA 3E4RA 4GXAA 2HXWA 4PQJA 3VFJA 1TXFA 2QJEA 2I6EA 3KGCA 4RYAA 3FD3A 3RTWB 1SW4A 4C0RA 4FORA 2W7YA 1DOTA 2QMWA 3TTMA 4ISUA 1SD3A 3RY3A 4QSEA 5DTBA 3HPIA 4ESWA 4ZEFA 1OLAA 2RCBA 4GOTA 1R6ZA 2O69A 1QKBA 4AQ4A 2RC8A 4FEBA 5AA4B 1PBPA 4GXSB 5JTYA 2H98A 4FEDA 2XXVA 5AA2A 4N6PA 5K2YA 4YAHX 4IGRA 4G8MA 3TCFA 2PBWA 1B4ZA 3GBAA 3S9LC 3IB2A 1H44A 3Q25A 4DXBA 3OOAA 3TCHA 5CI5A 3FUZA 2I48A 4P0GA 2O51A 3RT6B 3H6UA 3VVFA 3IOUA 2I3WA 3PV0E 3B6TA 5AA2D 1B3LA 1Y3QA 1M5EA 2ZXTA 4HTGA 3C32A 1FW0A 1S9TA 3VXBA 4YZZA 5I58A 4QHQA 2ALUA 4LATA 1B05A 2DE4A 1US5A 3H4ZA 2Q9TA 3RN8A 1IXIA 1LSTA 3C31A 4KHZE 3T9HB 4X48A 2YPNA 4PFYA 3SESA 3HHGA 4R2FA 1FTJA 1MXWA 3K00A 2AYSA 4IY6A 3T93B 3IB1A 1NNPA 1B32A 3C35A 1UTBB 4EXKA 1AMFA 3A3CA 1R9LA 3TUSA 1P99A 1LLSA 3I3VA 2QSXA 3D4GA 3UORA 3T9XB 3MPKA 2X26A 2P0SA 1UTHA 2A5TA 3IB0A 4EF1A 3G3FA 4L17A 1SI1A 4GL8A 1Q1KA 3FATA 3IJXB 1B7ZA 3OSQA 3SEVA 4EUOA 2D3IA 3B6WA 3UA8A 2R6GE 5CM6A 2XX8A 3PMWA 5H8HA 4YMAA 2XXYA 4R72A 1Y3PA 2OK2A 2QPQA 3CRBA 3QSLA 2ANJA 1MM7A 3I6VA 5I59B 3CSBA 1ZJLA 3G3IA 3H03A 4DLDA 4GL0A 1PB9A 2NOOA 2Z8EA 1EZPA 2Y7RA 3E3KA 2ZNSA 3UP9A 2QS4A 1SBPA 4FE8A 3H06B 4H8JA 4F1YA 3V8XB 3ODBA 3T9UA 1N3WA 1JVXA 1R9QA 2UYEA 3BKIB 4QFLA 3K01A 4LZ5A 1N3XA 1PDAA 2I58A 4G68A 4ND9A 3U72A 4OHNA 4OEVA 2O1LA 4QSDA 4G8HA 5I84A 1ZKBA 3MAMA 2GRVA 5JEIA 2GHAA 4PFUA 3JYRA 4YKIA 2PX1A 3MC2A 2QS2A 3PUYE 1MM6A 4JDFA 3PU5A 4NF4B 1NNFA 1PEBA 1B5JA 1MH4A 1MDQA 3EHUA 3MZ9A 4GVOA 1JETA 3T66A 5H8FA 3ONMA 3FVNA 3RT8A 4OEUA 1YAEA 1RKMA 5KCJA 5I2KB 1NL5A 4Z0IA 4C1UA 1USYE 3VLVA 3PPPA 3RLFE 3C33A 2RC9A 5FHMA 2DVCA 3TZAA 4NMYA 2DWIA 1MY3A 2REGA 4FAJA 3QUJA 4TLMB 3OELA 1LCFA 5I2NB 5LOMA 1SDXA 5FTHA 3FIRA 1SW5A 3CSGA 1T0KA 5AA1A 1IEJA 1B5HA 3LSFB 3B7DA 3TKDA 1US4A 2XXHA 3N6UA 4RA1A 1XHYA 4RJZA 5F7VA 1SQYA 3K1NA 1NFTA 1LB8A 3U1OA 3SETA 2E1SA 3QXMA 1A55A 4KI0E 5K2XA 3K02A 4I1DA 5EYFA 3O97A 4LQ5A 3K6VA 2GFEA 2DQVA 3W9VA 1UIVA 2VOZA 4F18A 2LAOA 5CMCA 4NF6B 2H4IA 3FV2A 4DIGA 1P1QA 1UQWA 3G3JA 2OBGA 5H8FB 3MWBA 1IXCA 1GV8A 4ONYA 4RY1A 3K4UA 1POTA 4GF8A 4N07A 2CMOA 4G2ZA 1I6BA 2NUVA 2Z22A 3K2DA 4R9GA 5I57B 4XXUA 3Q29A 4M1VA 3O6IA 3PPQA 1B4HA 5BWJA 3H6WA 4KCDA 4YICA 1Z7ME 4F19A 1QJMA 3V5AA 3SEXA 2R9JA 3EPEA 4BDMA 2RCAA 1B7HA 1IXGA 2I4BA 1B7UA 1BLFA 2F5XA 4KR5A 4F39A 4PFTA 4YB7A 3THIA 1WODA 4KPTA 3PMVA 1ANFA 1N7WA 3G3KA 1SI0A 2QS1A 3QAXA 3FGSA 4E0WA 1XVYA 2E0SA 4WKMA 1ZLQA 4DE8A 4PETA 4NF5B 3MUQA 5FHNA 2PT1A 4YKKA 2ZYOA 5EHSA 2I0BA 2X7QA 3CR9A 1MXXA 3N94A 3K6UA 2UYFA 4ZZAA 3KN8A 3G3GA 4YMBA 2XXRA 1O7TA 2FA7A 4KYSA 4IO5A 2F7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FTK A;  1LAX A;  1TFD A;  4EXL A;  4QFO A;  4U1Z A;  4KFQ A;  1F9B A;  5L9O A;  1B3F A;  3R26 A;  3S9E A;  4XKR A;  2GHB A;  1BIY A;  4KCC A;  4JWO A;  3VVE A;  4U4X A;  2XD2 A;  2ZYK A;  1JEU A;  1H43 A;  2VHA A;  3KFM A;  4ZEB A;  1ZU0 A;  1FCK A;  4ZS9 A;  5TP9 B;  2REJ A;  2DXR A;  4O3B A;  3CG1 A;  3P7I A;  2HZK A;  1AH5 A;  4QFK A;  2ZNU A;  3N26 A;  2PVU A;  4OES A;  2O7I A;  3UIF A;  1B2H A;  3JV9 A;  2ZYM A;  1WDN A;  1Y4C A;  1LAH E;  1FTL A;  4ZE9 A;  4PFW A;  1PBQ A;  2HEU A;  1B58 A;  2Y7W A;  4IO2 A;  3PUV E;  2B3B A;  4NWC A;  1XC1 A;  1UIU A;  4QSC A;  5TPA A;  1USY H;  1A99 A;  3SKP A;  4H0W A;  3LSL A;  5DYH A;  2VD2 A;  4EQ9 A;  4R75 A;  1N84 A;  5B7D A;  4GD5 A;  1LGB C;  4ZEI A;  4MLV A;  3C34 A;  3RNN A;  3OMB A;  2DOJ A;  3D4C A;  2ESN A;  2CZL A;  2H25 A;  3G3H A;  3KOS A;  2UVJ A;  3QUF A;  4LON B;  3JZJ A;  1SW1 A;  3SEW A;  1NH7 A;  3MBP A;  3TCG A;  1MY4 A;  4OTE A;  3UN6 A;  5HPQ A;  3G7W A;  4BLA A;  1R1N A;  2OZZ A;  3U8Q A;  3MZ1 A;  3O9P A;  1TFA A;  1N76 A;  2H99 A;  1SYI A;  1H45 A;  4F3G A;  1MQH A;  3CFZ A;  3QYT A;  2DS9 A;  4HW8 A;  3DP6 A;  1N7X A;  3CFX A;  1N0T A;  3T9V A;  4KD5 A;  4RK2 A;  2IA4 A;  2AIX A;  4TOZ A;  2GH9 A;  1ATG A;  3TYH A;  5TU0 A;  3IO6 A;  3KJ7 A;  4OZ9 A;  3OEM A;  3QK6 A;  3KN7 A;  3N5L A;  2H5Y A;  3KSJ A;  4POX A;  3LR1 A;  4EF2 A;  1URS A;  4O3C A;  4Q0C A;  3IX1 A;  4F22 A;  4BDO A;  3VXC A;  1JQF A;  4NTL A;  3FXU A;  3OEK A;  3DM0 A;  4TQU Q;  4WEP A;  1JNF A;  2Z8F A;  2D5W A;  4EQ7 A;  4OET A;  3FJM A;  4FIM A;  2UVI A;  5JTY B;  4PP0 A;  4OWD A;  5AA2 B;  2D21 A;  2XXW A;  2F35 A;  4DZ1 A;  1BKA A;  3O2A A;  1B3E A;  3WAE A;  4U21 A;  3TEL A;  4DXU A;  2OJT A;  2RC7 A;  4ZED A;  1B1H A;  2ZYN A;  3TTL A;  2ONR A;  4IO7 A;  3PUW E;  4R6K A;  4QFN A;  5ISU A;  4X1B A;  3ZS6 A;  4JB7 A;  1MY1 A;  2DVZ A;  1FTO A;  4ZEC A;  4X1D A;  4IO3 A;  4RPN A;  3MQ9 A;  3S2V A;  5I58 B;  4Q30 B;  3TDJ A;  4UA8 A;  2V84 A;  1DTZ A;  4RPO A;  3CIJ A;  2FNC A;  3Q28 A;  5H8S A;  3S9N C;  4ELQ A;  3LBS A;  1OVT A;  2DXY A;  4POW A;  4LP2 B;  3MP6 A;  3OO6 A;  2V3T A;  3MP1 A;  2G93 A;  3PPR A;  2DYX A;  3CFL A;  4G8N A;  2O68 A;  4F2O A;  2AL4 A;  3ZKK A;  4K3F A;  4XKN A;  2OCU A;  4OVJ A;  4ESX A;  3PUZ E;  1JW4 A;  1P1U A;  4XTC Q;  1IZ1 A;  2OWT A;  1QUI A;  5KZT A;  3ILT B;  4X9T A;  4U4S A;  2F6G A;  4ELR A;  1BTJ A;  1UTH B;  2A5T B;  1MPB A;  1RYX A;  4GIZ A;  4UAC A;  1FQF A;  1CE2 A;  4KYE A;  1TWY A;  3BBR A;  4I8C A;  1MY0 A;  1H3D A;  5H8H B;  4MBP A;  4ZE8 A;  4JSO A;  4G68 C;  2VGQ A;  4MF3 A;  5M2V A;  4YU0 A;  3A09 A;  4H1X A;  4Z7E A;  1B9J A;  1NH8 A;  4JWY A;  3E9X A;  2HCA A;  4OFJ A;  3PMX A;  3TQW A;  3OXN A;  3FVG A;  4IGT A;  3KBR A;  1MQI A;  1MXY A;  1HSJ A;  4NF8 A;  1SW2 A;  4MFI A;  4M4G A;  1FQD A;  4MLQ A;  4TLL B;  4G68 B;  1B3G A;  1SVX B;  1JW5 A;  1P1W A;  1VFD A;  1D9V A;  3IJO B;  1Y1M A;  4GWO A;  2Y7P A;  5L9S A;  2XD3 A;  5H8N A;  2F36 A;  3EQ1 A;  3PD9 A;  3MP8 A;  2Y84 A;  5CRY A;  3LUY A;  4XKQ A;  1Y20 A;  3TPA A;  4F29 A;  3F11 A;  4P0I A;  3T22 A;  3FJG A;  3VDF A;  1XT8 A;  5KDT A;  3DLN A;  2P2A A;  5HM4 B;  1RYO A;  4LZ8 A;  1ZBM A;  1MH3 A;  1QKA A;  5I56 A;  4LUB A;  2DWA A;  5KCJ B;  2Y7I A;  1B0L A;  1KWH A;  1P1N A;  4H8I A;  1IUD A;  1J1N A;  4Q8R A;  3TMG A;  2ABH A;  3IOR A;  1LFH A;  4ELO A;  4DCY A;  2PMS A;  2PT2 A;  3HCQ A;  2UVG A;  1O63 A;  3K0V A;  2Z8D A;  4U22 A;  2IEE A;  1Y3N A;  3PPN A;  1MPD A;  3FXQ A;  1QUJ A;  2Z23 A;  2WKY A;  1M5B A;  3MZB A;  5DVJ A;  2V93 A;  4R9F A;  2I3V A;  1LAF E;  4R6Y A;  5A5X A;  5ICT A;  1SYH A;  3W15 C;  3O6H A;  1GTK A;  1Y9U A;  5BUU A;  1A40 A;  3LSX A;  1TT1 A;  3QIM A;  1QUL A;  2PYY A;  3O28 A;  2DE3 A;  1IIT A;  3LC8 A;  3Q27 A;  2DE2 A;  1Y4T A;  3GXA A;  2HAV A;  3H7M A;  1PB7 A;  3IK6 B;  1MS7 A;  5H8Q A;  5ELV A;  3LSW A;  1ZIU A;  2RIN A;  3PPO A;  2I4C A;  4C1T A;  5DEX A;  1OVB A;  2QL3 A;  1I6Q A;  1QUK A;  1LFG A;  2V25 A;  4XIG Q;  1EZO A;  1EZ9 A;  3HHF A;  1B52 A;  4LA9 A;  2HQ0 A;  2RF1 A;  3VV5 A;  1DPP A;  3KEI A;  1FQC A;  3RTF B;  4KYD A;  4OQO A;  3TTK A;  3W9W A;  5FTI A;  2F34 A;  2Q2C A;  3EN3 A;  2Q89 A;  1B40 A;  1B3H A;  4F1V A;  3R6U A;  1M5F A;  5AA4 A;  1NNK A;  5DVF A;  3IO4 A;  1XVX A;  4ZDM A;  2Y7K A;  4EQB A;  4OYV A;  3OSR A;  3UGW A;  1JVY A;  3K1M A;  4OEN A;  2H9B A;  3KOT A;  2B3F A;  1VSO A;  2XXP A;  4R74 A;  3MW0 A;  4RK9 A;  2DSF A;  1MQD A;  2XX9 A;  5CBS A;  2ZNT A;  1YCJ A;  4IO4 A;  3IR1 A;  2O84 X;  3M3F A;  2YJP A;  1AOV A;  1VR5 A;  2V3U A;  1XS5 A;  3K6X A;  3M3K A;  4ZZE A;  3OD7 A;  4OXV A;  1DMB A;  4YB6 A;  2HZL A;  1B51 A;  1FQB A;  5J1D A;  3MVW A;  1DPE A;  4JSD A;  3V89 B;  2THI A;  3DP8 A;  1UTB A;  4OFO A;  1B5I A;  1MXV A;  3KJT A;  2F7A A;  3PUX E;  2F8D A;  5ITP A;  2XXU A;  2YLN A;  1P1O A;  1B1X A;  2F97 A;  1MQJ A;  1M5C A;  3DP4 A;  3I5O A;  3MPL A;  3U94 A;  1GVC A;  1FTM A;  4FEC A;  1II5 A;  2ONS A;  3VE1 B;  3TTN A;  5AE4 A;  1PC3 A;  3IOW A;  4BDN A;  1QVS A;  4JXI A;  4NED A;  5TPA B;  5I59 A;  3FJ7 A;  3GZG A;  2NVU B;  3CVG A;  2XXI A;  5HBC A;  1D4N A;  4QRZ A;  3N6T A;  3FVO A;  2A5S A;  2DWJ A;  4I62 A;  3TQL A;  3ZSF A;  5EHM A;  1MXZ A;  4H65 A;  4QFP A;  1OQG A;  2XXT A;  4KQP A;  1IIW A;  1LBB A;  1Q35 A;  4N13 A;  3S4U A;  2FYI A;  1NKX A;  4THI A;  1A8E A;  4F3P A;  1XOC A;  5CMM A;  1MY2 A;  2VP1 A;  4LVQ A;  1IXH A;  4R73 A;  2HFB A;  3O6G A;  3T96 B;  4GQO A;  1PB8 A;  3BFU A;  3E13 X;  3MVZ A;  4GRK A;  1EU8 A;  3KN3 A;  1EH3 A;  4IO6 A;  1QW0 A;  1LAG E;  3Q26 A;  4NF4 A;  3PD8 A;  1MRP A;  3OEN A;  1LFI A;  1Z7N E;  3FAS A;  5CBR A;  4H67 A;  2ONK E;  1B6H A;  4E0X A;  3L6G A;  5I2K A;  5F1Q A;  3R7X A;  1NMU A;  1VE4 A;  3ZKL A;  2R71 A;  1ELJ A;  3FXR A;  4FJP A;  1MPC A;  3USD A;  4JBZ A;  1OQH A;  1A7L A;  4IY5 A;  3BFT A;  1D3K A;  3SEY A;  5I2N A;  1YTV A;  3RUM A;  1AL3 A;  3KG2 A;  4F3S A;  3RQT A;  5IKB A;  3FVK A;  4IB2 A;  1HSL A;  1JEV A;  1NNT A;  3OO8 A;  2B65 A;  1OLC A;  1YPN A;  3GBB A;  3HV1 A;  3IL1 B;  2I0C A;  3EHT A;  3V83 A;  2X7P A;  1CB6 A;  1S50 A;  3IOT A;  1OMP A;  3CG3 A;  1M5D A;  3C9H A;  4F31 B;  4NF6 A;  4RNS A;  1Y1Z A;  3RGY A;  1I6A A;  3SER A;  4NE4 A;  4WXJ A;  5L8D A;  4HS7 A;  2XHD A;  4LQ2 A;  5JK4 A;  2AL5 A;  2M8C A;  4FAT A;  1GR2 A;  1VFE A;  5ITO A;  1FQE A;  3KSX A;  3H3G A;  3HN0 A;  4DXC A;  3UK4 A;  3EHS A;  1AIV A;  5B70 A;  1A8F A;  1A54 A;  1URD A;  2DP8 A;  5I57 A;  5CC2 A;  3TEP A;  2F7B A;  2OWS A;  4YKP A;  2RKM A;  3MVX A;  4H5G A;  4HCY A;  4ECF A;  4QF9 A;  2UXA A;  4U23 A;  4PE5 B;  4O3A A;  4F3B A;  4HCW A;  1ZTY A;  2O6A A;  3IOV A;  2QMX A;  2F6P A;  4F2Q A;  5CMB A;  1O64 A;  1URG A;  3C36 A;  2ZMB A;  3VVD A;  2NXO A;  4P11 A;  4Q5T A;  4R6H A;  1B46 A;  1MQG A;  1IQ7 A;  4DCX A;  1ZMG A;  2Q8J A;  1MXU A;  4NF5 A;  2V3Q A;  3FV1 A;  3B6Q A;  2NWJ A;  2P1S A;  3K6W A;  4YKJ A;  3ECR A;  3K1P A;  4NF8 B;  3U93 A;  1BP5 A;  3FZV A;  5ICQ A;  3RPW A;  5FHO A;  4LZ7 A;  4AB6 A;  4ZEK A;  1B0H A;  4G4P A;  3O29 A;  4JWX A;  3AXF A;  3HO7 A;  3S9M C;  4OER A;  1N04 A;  5CMK A;  5H8N B;  3OO9 A;  2HAU A;  4MH5 A;  1L5T A;  3O66 A;  3VLU A;  3TAJ A;  3SEU A;  2O1M A;  2O7U A;  1S7Y A;  2Q2A A;  3A3U A;  4BDL A;  3OO7 A;  2DWH A;  4NWD A;  5TP9 A;  5KDT B;  2BJJ X;  4H6D A;  4OMB A;  3EF7 A;  4G77 A;  3H6V A;  5I56 B;  1GGG A;  3M8U A;  3CI8 A;  3H6T A;  3GLB A;  4OFL A;  3IAZ A;  3L6H A;  1OIB A;  1LBC A;  2I49 A;  3HST A;  3MJN A;  3SDF A;  2XXX A;  3TTR A;  2G29 A;  2UVH A;  5AA3 A;  3MVY A;  1FQA A;  1HSE A;  2QRY A;  2KLF A;  3TFL A;  1MDP 1;  4WED A;  3KZG A;  4AB5 A;  4H5F A;  2Q88 A;  2XX7 A;  4U2R A;  5IAI A;  1LCT A;  1WVJ A;  4DDD A;  1DTG A;  2F78 A;  5L9M A;  3WAF A;  3TOD A;  5A5X B;  1D9Y A;  3U92 A;  4F1U A;  2XXQ A;  4GLI A;  4BDR A;  1H76 A;  4GFR A;  4U1O A;  1I69 A;  2OLB A;  3PGF A;  4I9D A;  4BDQ A;  2QS3 A;  4XKP A;  1LB9 A;  4ELP A;  5DT6 A;  1MG1 A;  3C4M A;  5H8Q B;  4RXL A;  4YB5 A;  3ILU B;  2VD3 A;  3VLW A;  4EDP A;  3DEL B;  4R2B A;  5DEX B;  1JW1 A;  1DSN A;  1POY 1;  3M3L A;  5DVI A;  3E4R A;  4GXA A;  2HXW A;  4PQJ A;  3VFJ A;  1TXF A;  2QJE A;  2I6E A;  3KGC A;  4RYA A;  3FD3 A;  3RTW B;  1SW4 A;  4C0R A;  4FOR A;  2W7Y A;  1DOT A;  2QMW A;  3TTM A;  4ISU A;  1SD3 A;  3RY3 A;  4QSE A;  5DTB A;  3HPI A;  4ESW A;  4ZEF A;  1OLA A;  2RCB A;  4GOT A;  1R6Z A;  2O69 A;  1QKB A;  4AQ4 A;  2RC8 A;  4FEB A;  5AA4 B;  1PBP A;  4GXS B;  5JTY A;  2H98 A;  4FED A;  2XXV A;  5AA2 A;  4N6P A;  5K2Y A;  4YAH X;  4IGR A;  4G8M A;  3TCF A;  2PBW A;  1B4Z A;  3GBA A;  3S9L C;  3IB2 A;  1H44 A;  3Q25 A;  4DXB A;  3OOA A;  3TCH A;  5CI5 A;  3FUZ A;  2I48 A;  4P0G A;  2O51 A;  3RT6 B;  3H6U A;  3VVF A;  3IOU A;  2I3W A;  3PV0 E;  3B6T A;  5AA2 D;  1B3L A;  1Y3Q A;  1M5E A;  2ZXT A;  4HTG A;  3C32 A;  1FW0 A;  1S9T A;  3VXB A;  4YZZ A;  5I58 A;  4QHQ A;  2ALU A;  4LAT A;  1B05 A;  2DE4 A;  1US5 A;  3H4Z A;  2Q9T A;  3RN8 A;  1IXI A;  1LST A;  3C31 A;  4KHZ E;  3T9H B;  4X48 A;  2YPN A;  4PFY A;  3SES A;  3HHG A;  4R2F A;  1FTJ A;  1MXW A;  3K00 A;  2AYS A;  4IY6 A;  3T93 B;  3IB1 A;  1NNP A;  1B32 A;  3C35 A;  1UTB B;  4EXK A;  1AMF A;  3A3C A;  1R9L A;  3TUS A;  1P99 A;  1LLS A;  3I3V A;  2QSX A;  3D4G A;  3UOR A;  3T9X B;  3MPK A;  2X26 A;  2P0S A;  1UTH A;  2A5T A;  3IB0 A;  4EF1 A;  3G3F A;  4L17 A;  1SI1 A;  4GL8 A;  1Q1K A;  3FAT A;  3IJX B;  1B7Z A;  3OSQ A;  3SEV A;  4EUO A;  2D3I A;  3B6W A;  3UA8 A;  2R6G E;  5CM6 A;  2XX8 A;  3PMW A;  5H8H A;  4YMA A;  2XXY A;  4R72 A;  1Y3P A;  2OK2 A;  2QPQ A;  3CRB A;  3QSL A;  2ANJ A;  1MM7 A;  3I6V A;  5I59 B;  3CSB A;  1ZJL A;  3G3I A;  3H03 A;  4DLD A;  4GL0 A;  1PB9 A;  2NOO A;  2Z8E A;  1EZP A;  2Y7R A;  3E3K A;  2ZNS A;  3UP9 A;  2QS4 A;  1SBP A;  4FE8 A;  3H06 B;  4H8J A;  4F1Y A;  3V8X B;  3ODB A;  3T9U A;  1N3W A;  1JVX A;  1R9Q A;  2UYE A;  3BKI B;  4QFL A;  3K01 A;  4LZ5 A;  1N3X A;  1PDA A;  2I58 A;  4G68 A;  4ND9 A;  3U72 A;  4OHN A;  4OEV A;  2O1L A;  4QSD A;  4G8H A;  5I84 A;  1ZKB A;  3MAM A;  2GRV A;  5JEI A;  2GHA A;  4PFU A;  3JYR A;  4YKI A;  2PX1 A;  3MC2 A;  2QS2 A;  3PUY E;  1MM6 A;  4JDF A;  3PU5 A;  4NF4 B;  1NNF A;  1PEB A;  1B5J A;  1MH4 A;  1MDQ A;  3EHU A;  3MZ9 A;  4GVO A;  1JET A;  3T66 A;  5H8F A;  3ONM A;  3FVN A;  3RT8 A;  4OEU A;  1YAE A;  1RKM A;  5KCJ A;  5I2K B;  1NL5 A;  4Z0I A;  4C1U A;  1USY E;  3VLV A;  3PPP A;  3RLF E;  3C33 A;  2RC9 A;  5FHM A;  2DVC A;  3TZA A;  4NMY A;  2DWI A;  1MY3 A;  2REG A;  4FAJ A;  3QUJ A;  4TLM B;  3OEL A;  1LCF A;  5I2N B;  5LOM A;  1SDX A;  5FTH A;  3FIR A;  1SW5 A;  3CSG A;  1T0K A;  5AA1 A;  1IEJ A;  1B5H A;  3LSF B;  3B7D A;  3TKD A;  1US4 A;  2XXH A;  3N6U A;  4RA1 A;  1XHY A;  4RJZ A;  5F7V A;  1SQY A;  3K1N A;  1NFT A;  1LB8 A;  3U1O A;  3SET A;  2E1S A;  3QXM A;  1A55 A;  4KI0 E;  5K2X A;  3K02 A;  4I1D A;  5EYF A;  3O97 A;  4LQ5 A;  3K6V A;  2GFE A;  2DQV A;  3W9V A;  1UIV A;  2VOZ A;  4F18 A;  2LAO A;  5CMC A;  4NF6 B;  2H4I A;  3FV2 A;  4DIG A;  1P1Q A;  1UQW A;  3G3J A;  2OBG A;  5H8F B;  3MWB A;  1IXC A;  1GV8 A;  4ONY A;  4RY1 A;  3K4U A;  1POT A;  4GF8 A;  4N07 A;  2CMO A;  4G2Z A;  1I6B A;  2NUV A;  2Z22 A;  3K2D A;  4R9G A;  5I57 B;  4XXU A;  3Q29 A;  4M1V A;  3O6I A;  3PPQ A;  1B4H A;  5BWJ A;  3H6W A;  4KCD A;  4YIC A;  1Z7M E;  4F19 A;  1QJM A;  3V5A A;  3SEX A;  2R9J A;  3EPE A;  4BDM A;  2RCA A;  1B7H A;  1IXG A;  2I4B A;  1B7U A;  1BLF A;  2F5X A;  4KR5 A;  4F39 A;  4PFT A;  4YB7 A;  3THI A;  1WOD A;  4KPT A;  3PMV A;  1ANF A;  1N7W A;  3G3K A;  1SI0 A;  2QS1 A;  3QAX A;  3FGS A;  4E0W A;  1XVY A;  2E0S A;  4WKM A;  1ZLQ A;  4DE8 A;  4PET A;  4NF5 B;  3MUQ A;  5FHN A;  2PT1 A;  4YKK A;  2ZYO A;  5EHS A;  2I0B A;  2X7Q A;  3CR9 A;  1MXX A;  3N94 A;  3K6U A;  2UYF A;  4ZZA A;  3KN8 A;  3G3G A;  4YMB A;  2XXR A;  1O7T A;  2FA7 A;  4KYS A;  4IO5 A;  2F7C A; 
#chains in the Genus database with same CATH topology
 1FTK A;  1LAX A;  1TFD A;  4EXL A;  4GWZ A;  4PC9 A;  4QFO A;  4U1Z A;  3ROJ A;  4KFQ A;  1F9B A;  5L9O A;  1B3F A;  3R26 A;  3S9E A;  4XKR A;  2GHB A;  1BIY A;  4KCC A;  4JWO A;  4MMP A;  3VVE A;  4U4X A;  2XD2 A;  2ZYK A;  4MHF A;  1JEU A;  1H43 A;  2VHA A;  3KFM A;  1FPE A;  4ZEB A;  1ZU0 A;  1FCK A;  2GQ1 A;  4ZS9 A;  3B50 A;  5TP9 B;  2REJ A;  2DXR A;  4O3B A;  3CG1 A;  3P7I A;  2HZK A;  1AH5 A;  4QFK A;  1FPL A;  2ZNU A;  2PVU A;  3N26 A;  2O7I A;  4OES A;  3UIF A;  1B2H A;  3JV9 A;  2ZYM A;  3SZP A;  1WDN A;  3BIG A;  1Y4C A;  1LAH E;  1FTL A;  4ZE9 A;  4AS5 A;  4PFW A;  4X8R A;  1PBQ A;  2HEU A;  1B58 A;  5IZ3 A;  2Y7W A;  4IO2 A;  3PUV E;  4HXV A;  2B3B A;  4NWC A;  1XC1 A;  1UIU A;  5ET7 A;  4QSC A;  5TPA A;  1USY H;  1A99 A;  3SKP A;  4H0W A;  3LSL A;  4MNP A;  5DYH A;  2VD2 A;  4GWY A;  2B4L A;  4EQ9 A;  4R75 A;  1N84 A;  5B7D A;  4GD5 A;  1LGB C;  4ZEI A;  4MLV A;  4PAF A;  1QGX A;  2CEX A;  3C34 A;  4JVC A;  3RNN A;  3OMB A;  2DOJ A;  3D4C A;  2ESN A;  2CZL A;  2H25 A;  3G3H A;  3KOS A;  2UVJ A;  3QUF A;  4LON B;  3JZJ A;  1SW1 A;  3SEW A;  1NH7 A;  3MBP A;  3TCG A;  1MY4 A;  4OTE A;  3UN6 A;  5HPQ A;  3G7W A;  4BLA A;  1R1N A;  2OZZ A;  2B4M A;  3U8Q A;  3MZ1 A;  3LUZ A;  3O9P A;  1TFA A;  1N76 A;  2H99 A;  1SYI A;  1H45 A;  4F3G A;  1MQH A;  4JVI A;  3CFZ A;  3QYT A;  2DS9 A;  4HW8 A;  3DP6 A;  1N7X A;  3CFX A;  1N0T A;  4MCO A;  3T9V A;  4KD5 A;  4RK2 A;  2IA4 A;  2AIX A;  4TOZ A;  5T3J A;  2GH9 A;  1ATG A;  2HPG A;  3TYH A;  5TU0 A;  3IO6 A;  5FBP A;  3KJ7 A;  4OZ9 A;  3OEM A;  3QK6 A;  3KN7 A;  3N5L A;  2H5Y A;  3KSJ A;  4POX A;  3LR1 A;  4EF2 A;  1URS A;  1NUY A;  4O3C A;  4Q0C A;  3IX1 A;  4F22 A;  4BDO A;  3RPL B;  3VXC A;  1JQF A;  4NTL A;  3FXU A;  3OEK A;  3DM0 A;  1KZ8 A;  4TQU Q;  4WEP A;  1JNF A;  2Z8F A;  2D5W A;  4EQ7 A;  4GX3 A;  4OET A;  3FJM A;  4FIM A;  2UVI A;  5JTY B;  4PP0 A;  4OWD A;  4PBQ A;  5AA2 B;  2D21 A;  2XXW A;  2F35 A;  3KBZ A;  4DZ1 A;  3LV0 A;  1BKA A;  3O2A A;  1B3E A;  1FPK A;  5LTC A;  3WAE A;  4U21 A;  3TEL A;  1FPB A;  1XI6 A;  4DXU A;  2OJT A;  2RC7 A;  4ZED A;  2MKZ A;  1B1H A;  2ZYN A;  3TTL A;  2ONR A;  4IO7 A;  3PUW E;  4R6K A;  4QFN A;  5ISU A;  4X1B A;  3ZS6 A;  4JB7 A;  1MY1 A;  2DVZ A;  1FTO A;  4ZEC A;  4X1D A;  4IO3 A;  3MST A;  4RPN A;  3MQ9 A;  5EYG A;  3S2V A;  5I58 B;  4Q30 B;  3TDJ A;  3KC0 A;  4UA8 A;  2V84 A;  1DTZ A;  4RPO A;  3CIJ A;  2FNC A;  3Q28 A;  5H8S A;  2FHY A;  3S9N C;  4ELQ A;  3LBS A;  1OVT A;  2DXY A;  4POW A;  4LP2 B;  3MP6 A;  3OO6 A;  2V3T A;  3MP1 A;  2G93 A;  3PPR A;  3U65 A;  2DYX A;  3CHG A;  4I40 A;  3CFL A;  4G8N A;  2O68 A;  4F2O A;  2AL4 A;  3ZKK A;  4K3F A;  4XKN A;  2OCU A;  4OVJ A;  4ESX A;  1EYI A;  3PUZ E;  2KQZ A;  1JW4 A;  1P1U A;  4XTC Q;  1IZ1 A;  2OWT A;  1QUI A;  5KZT A;  3ILT B;  4X9T A;  4U4S A;  1FBE A;  2F6G A;  4ELR A;  1BTJ A;  1UTH B;  2A5T B;  1MPB A;  1RYX A;  4GIZ A;  4UAC A;  1FQF A;  1CE2 A;  4KYE A;  1TWY A;  3BBR A;  4I8C A;  1MY0 A;  1H3D A;  5H8H B;  2DDK A;  4MBP A;  4ZE8 A;  4JSO A;  2XWK A;  4G68 C;  2VGQ A;  4MF3 A;  5M2V A;  4YU0 A;  4N4U A;  3A09 A;  4HE2 A;  4H1X A;  1FBC A;  2CZH A;  3HFU A;  1DBZ A;  4Z7E A;  1B9J A;  1NH8 A;  1FPD A;  4JWY A;  3E9X A;  2HCA A;  4OFJ A;  3PMX A;  3TQW A;  3OXN A;  3FVG A;  4IGT A;  3KBR A;  1MQI A;  1MXY A;  1HSJ A;  4N8G A;  4NF8 A;  1SW2 A;  4MFI A;  4M4G A;  1FQD A;  4MLQ A;  4TLL B;  4G68 B;  1B3G A;  1SVX B;  2CZI A;  1JW5 A;  2XWO A;  1P1W A;  1VFD A;  4GX6 A;  1D9V A;  3IJO B;  1Y1M A;  4GWO A;  1IMB A;  2Y7P A;  5L9S A;  2XD3 A;  5H8N A;  2F36 A;  3EQ1 A;  3PD9 A;  3MP8 A;  2Y84 A;  5CRY A;  3LUY A;  4XKQ A;  1Y20 A;  3TPA A;  4F29 A;  3F11 A;  4P0I A;  4GWS A;  3T22 A;  2FIE A;  3FJG A;  3VDF A;  1XT8 A;  5IM2 A;  5KDT A;  3DLN A;  2ZZX A;  2P2A A;  5HM4 B;  1RYO A;  4LZ8 A;  4MX6 A;  1ZBM A;  1MH3 A;  1QKA A;  5I56 A;  4LUB A;  2DWA A;  5KCJ B;  2Y7I A;  2Y5K A;  1B0L A;  1KWH A;  1P1N A;  4H8I A;  1IUD A;  1J1N A;  4Q8R A;  3TMG A;  2ABH A;  3IOR A;  1LFH A;  2L5V A;  4ELO A;  4DCY A;  2PMS A;  2PT2 A;  3HCQ A;  2UVG A;  1O63 A;  3K0V A;  2Z8D A;  4U22 A;  2IEE A;  5IZ1 A;  1Y3N A;  3PPN A;  5IZZ A;  1MPD A;  3GYY A;  5EQ9 A;  3FXQ A;  1QUJ A;  2Z23 A;  2WKY A;  2VT5 A;  2V4C A;  1M5B A;  3MZB A;  5DVJ A;  2V93 A;  4R9F A;  2I3V A;  1LAF E;  4R6Y A;  5A5X A;  5ICT A;  1SYH A;  3W15 C;  3O6H A;  1GTK A;  1Q9D A;  1Y9U A;  5BUU A;  1A40 A;  3LSX A;  1TT1 A;  3QIM A;  1QUL A;  2PYY A;  3O28 A;  2DE3 A;  2P3V A;  1IIT A;  3LC8 A;  3Q27 A;  2DE2 A;  2PFZ A;  1Y4T A;  3GXA A;  1FPJ A;  2R8T A;  2HAV A;  3H7M A;  1PB7 A;  3IK6 B;  1MS7 A;  5H8Q A;  5ELV A;  3LSW A;  1ZIU A;  2RIN A;  3PPO A;  2I4C A;  4PCD A;  4C1T A;  4O8M A;  5DEX A;  1OVB A;  4JVD A;  2QL3 A;  1I6Q A;  1KA1 A;  1QUK A;  1LFG A;  2V25 A;  4XIG Q;  1EZO A;  1EZ9 A;  3HHF A;  1B52 A;  4LA9 A;  2HQ0 A;  2RF1 A;  3VV5 A;  1DPP A;  4OVS A;  3KEI A;  1FQC A;  4DI3 D;  1IME A;  3RTF B;  4KYD A;  4OQO A;  3TTK A;  2P3N A;  3W9W A;  5FTI A;  2F34 A;  2Q2C A;  4O7M A;  3EN3 A;  2Q89 A;  1B40 A;  1B3H A;  3D1R A;  4F1V A;  3R6U A;  1NV6 A;  1M5F A;  5AA4 A;  1NNK A;  5DVF A;  3IO4 A;  5I7I A;  1XVX A;  4ZDM A;  1IMA A;  2Y7K A;  4N6D A;  4EQB A;  4OYV A;  3OSR A;  3UGW A;  1JVY A;  3K1M A;  4OEN A;  2H9B A;  4P47 A;  3T0J A;  3KOT A;  2XXK A;  2B3F A;  1VSO A;  2XXP A;  4R74 A;  4XF5 A;  3MW0 A;  4RK9 A;  2DSF A;  3RYD A;  1MQD A;  5EQA A;  2XX9 A;  5CBS A;  2ZNT A;  1YCJ A;  4IO4 A;  3IR1 A;  2O84 X;  3M3F A;  2YJP A;  3BIH A;  1AOV A;  1VR5 A;  2V3U A;  1XS5 A;  1YXI A;  3K6X A;  3M3K A;  4ZZE A;  3OD7 A;  4OXV A;  3KC1 A;  1DMB A;  4YB6 A;  1LBW A;  2HZL A;  1B51 A;  1FQB A;  5J1D A;  3MVW A;  1DPE A;  4JSD A;  3V89 B;  5ET8 A;  2THI A;  3DP8 A;  1UTB A;  4OFO A;  1B5I A;  1MXV A;  3KJT A;  1FRP A;  2F7A A;  3PUX E;  2F8D A;  1YZ0 A;  5ITP A;  2XXU A;  1NUX A;  2YLN A;  1P1O A;  1B1X A;  4N8Y A;  2F97 A;  1MQJ A;  5A5L A;  1M5C A;  3DP4 A;  3I5O A;  3MPL A;  3U94 A;  1GVC A;  1FTM A;  4FEC A;  4PGP A;  5IZ3 B;  1II5 A;  2ONS A;  3VE1 B;  3TTN A;  5EQ7 A;  5AE4 A;  1PC3 A;  3IOW A;  4BDN A;  4N81 A;  1QVS A;  1FBF A;  4JXI A;  4NED A;  5TPA B;  5I59 A;  3FJ7 A;  4GBV A;  3GZG A;  2NVU B;  3CVG A;  2XXI A;  5HBC A;  4I3Y A;  1D4N A;  4QRZ A;  3N6T A;  3FVO A;  2A5S A;  2DWJ A;  2Y5L A;  4I62 A;  3TQL A;  1INP A;  3ZSF A;  5EHM A;  1MXZ A;  1NUW A;  4PE3 A;  4QFP A;  2F3D A;  4H65 A;  1OQG A;  4N15 A;  2XXT A;  4KQP A;  1IIW A;  3E78 A;  1LBB A;  1Q35 A;  4N13 A;  3S4U A;  4PAI A;  2FYI A;  1NKX A;  4THI A;  1A8E A;  4F3P A;  1XOC A;  5CMM A;  4GBW A;  1MY2 A;  4X04 A;  2VP1 A;  4LVQ A;  4N17 A;  1LBV A;  1IXH A;  4R73 A;  2HFB A;  3O6G A;  3T96 B;  4GQO A;  1PB8 A;  3BFU A;  3E13 X;  3MVZ A;  4GRK A;  1EU8 A;  3KN3 A;  1EH3 A;  1YYZ A;  4IO6 A;  1QW0 A;  1LAG E;  3Q26 A;  4NF4 A;  3PD8 A;  1MRP A;  3OEN A;  1LFI A;  2CZK A;  3B8B A;  1Z7N E;  3FAS A;  5CBR A;  4H67 A;  2ONK E;  1B6H A;  4E0X A;  3L6G A;  5I2K A;  5F1Q A;  4PGN A;  3R7X A;  1NMU A;  1VE4 A;  3ZKL A;  2R71 A;  1ELJ A;  3FXR A;  4FJP A;  4PFI A;  1MPC A;  3USD A;  4JBZ A;  1OQH A;  1A7L A;  4IY5 A;  3BFT A;  1D3K A;  4OVT A;  3SEY A;  2WYP A;  5I2N A;  1YTV A;  3RUM A;  4MNC A;  1AL3 A;  3KG2 A;  2ZZW A;  1FPI A;  4NHB A;  1IMC A;  4F3S A;  3RQT A;  5IKB A;  3FVK A;  4IB2 A;  1HSL A;  1JEV A;  1FBP A;  4AS4 A;  1NNT A;  3OO8 A;  3E79 A;  2B65 A;  1OLC A;  1YPN A;  3GBB A;  3HV1 A;  3IL1 B;  2I0C A;  4P56 A;  4PDH A;  3EHT A;  3V83 A;  2X7P A;  1CB6 A;  1CNQ A;  4O7I A;  1S50 A;  3IOT A;  1OMP A;  4OA4 A;  3PTY A;  3CG3 A;  1M5D A;  3C9H A;  4F31 B;  2KR0 A;  4NF6 A;  4RNS A;  1Y1Z A;  3RGY A;  1NI9 A;  2VPN A;  1I6A A;  3SER A;  1LBZ A;  4NE4 A;  4WXJ A;  1DK4 A;  5L8D A;  4HS7 A;  2XHD A;  4LQ2 A;  5JK4 A;  2AL5 A;  2M8C A;  4FAT A;  1GR2 A;  1JP4 A;  1VFE A;  5ITO A;  1FQE A;  1NV0 A;  3KSX A;  3H3G A;  2QFL A;  4G61 A;  3HN0 A;  4DXC A;  3UK4 A;  3EHS A;  1AIV A;  5B70 A;  4O94 A;  1A8F A;  1A54 A;  1URD A;  2DP8 A;  5I57 A;  5CC2 A;  3TEP A;  2F7B A;  2OWS A;  4I3E A;  4YKP A;  2RKM A;  3MVX A;  4H5G A;  4HCY A;  4ECF A;  4UAB A;  4QF9 A;  2XWV A;  2UXA A;  4U23 A;  4PE5 B;  4O3A A;  2QVU A;  4F3B A;  4HCW A;  1ZTY A;  1FPG A;  2O6A A;  5LDZ A;  3IOV A;  2QMX A;  2F6P A;  4F2Q A;  5CMB A;  4N91 A;  4LN5 A;  1O64 A;  1URG A;  4XEQ A;  3C36 A;  2ZMB A;  3VVD A;  2NXO A;  4P11 A;  4Q5T A;  4QBA A;  4R6H A;  1B46 A;  1MQG A;  4GX4 A;  1IQ7 A;  4DCX A;  1ZMG A;  4GWW A;  2Q8J A;  1MXU A;  4MAG A;  4NF5 A;  2V3Q A;  3A29 A;  3FV1 A;  3B6Q A;  4NGU A;  2NWJ A;  2P1S A;  3K6W A;  4YKJ A;  1NV2 A;  3ECR A;  3K1P A;  4NF8 B;  3U93 A;  1BP5 A;  3FZV A;  5ICQ A;  3RPW A;  4OVR A;  5FHO A;  4LZ7 A;  4AB6 A;  4ZEK A;  1B0H A;  3FBP A;  4G4P A;  3O29 A;  4N6K A;  4JWX A;  3AXF A;  3HO7 A;  3S9M C;  4OER A;  1N04 A;  4OVQ A;  5CMK A;  5H8N B;  3OO9 A;  2HAU A;  4MH5 A;  1L5T A;  2BJI A;  3O66 A;  3VLU A;  2QVV A;  4PF6 A;  3TAJ A;  3SEU A;  4MIJ A;  2O1M A;  2O7U A;  2VPO A;  2WX9 A;  4OAN A;  1S7Y A;  2Q2A A;  3A3U A;  4OVP A;  4BDL A;  3OO7 A;  2DWH A;  4NWD A;  5TP9 A;  5KDT B;  2BJJ X;  4H6D A;  5I3S A;  4OMB A;  3EF7 A;  4G77 A;  3H6V A;  5I56 B;  1GGG A;  3M8U A;  3FXB A;  3CI8 A;  3H6T A;  3GLB A;  4OFL A;  3IAZ A;  3L6H A;  1NV5 A;  1OIB A;  1LBC A;  2I49 A;  3HST A;  3MJN A;  3SDF A;  2XXX A;  1NV4 A;  4QXD A;  3TTR A;  2G29 A;  2UVH A;  5AA3 A;  3MVY A;  1FQA A;  1HSE A;  2QRY A;  2KLF A;  3TFL A;  1FJ9 A;  1MDP 1;  4WED A;  3KZG A;  4AB5 A;  4H5F A;  2Q88 A;  2XX7 A;  2Q74 A;  4U2R A;  5IAI A;  1LCT A;  1WVJ A;  3QMF A;  5EQ8 A;  4DDD A;  1DTG A;  2F78 A;  5L9M A;  3WAF A;  2WBD A;  3TOD A;  5A5X B;  1D9Y A;  4PDD A;  3U92 A;  4F1U A;  2XXQ A;  4GLI A;  4BDR A;  1LBX A;  1H76 A;  4GFR A;  1G0H A;  4DI4 B;  4U1O A;  1I69 A;  2WYK A;  1NUZ A;  2OLB A;  3PGF A;  1FBD A;  3ISP A;  4I9D A;  4BDQ A;  2QS3 A;  4XKP A;  1LB9 A;  5F24 A;  4ELP A;  5DT6 A;  1MG1 A;  3C4M A;  5H8Q B;  3EKI A;  4RXL A;  4KXP A;  4NQ8 A;  4YB5 A;  3ILU B;  2VD3 A;  3VLW A;  4EDP A;  3DEL B;  4R2B A;  1FPF A;  5DEX B;  1JW1 A;  1DSN A;  1POY 1;  3M3L A;  5DVI A;  3E4R A;  4GXA A;  2HXW A;  4PQJ A;  3VFJ A;  1TXF A;  2QJE A;  4HE1 A;  2I6E A;  3KGC A;  4RYA A;  3FD3 A;  3RTW B;  1SW4 A;  4C0R A;  4FOR A;  2W7Y A;  3RPL A;  1DOT A;  1FSA A;  2QMW A;  3TTM A;  4ISU A;  1SD3 A;  3RY3 A;  4QSE A;  5DTB A;  3HPI A;  4ESW A;  2FBP A;  4ZEF A;  1OLA A;  2RCB A;  4GOT A;  2XA5 A;  1R6Z A;  2O69 A;  1QKB A;  4AQ4 A;  2RC8 A;  4FEB A;  5AA4 B;  1PBP A;  5ET6 A;  2FVZ A;  4GXS B;  5JTY A;  2H98 A;  4FED A;  2XXV A;  2PFY A;  5AA2 A;  4N6P A;  5K2Y A;  4YAH X;  4IGR A;  4G8M A;  3TCF A;  2PBW A;  1B4Z A;  3GBA A;  3S9L C;  3IB2 A;  1H44 A;  2WBB A;  3Q25 A;  4DXB A;  3OOA A;  3TCH A;  5CI5 A;  3FUZ A;  2I48 A;  4H46 A;  4P0G A;  2O51 A;  3RT6 B;  1FJ6 A;  1G0I A;  2F3B A;  3H6U A;  3VVF A;  3IOU A;  2I3W A;  3PV0 E;  3B6T A;  5AA2 D;  1B3L A;  1Y3Q A;  1M5E A;  2ZXT A;  4HTG A;  3C32 A;  1FW0 A;  1S9T A;  3VXB A;  1D9Q A;  4YZZ A;  5I58 A;  1RDZ A;  4QHQ A;  5J16 A;  2ALU A;  4LAT A;  1B05 A;  2DE4 A;  1US5 A;  3H4Z A;  4IR8 A;  2Q9T A;  1NV7 A;  1K9Y A;  4MNI A;  3RN8 A;  1IXI A;  1LST A;  3C31 A;  4FBP A;  4KHZ E;  3T9H B;  4X48 A;  2YPN A;  1LBY A;  3IFC A;  4PFY A;  3SES A;  3HHG A;  4R2F A;  2CEY A;  2JJK A;  1FTJ A;  1MXW A;  3K00 A;  2AYS A;  4IY6 A;  3T93 B;  4NAP A;  3IB1 A;  2HXR A;  1NNP A;  1B32 A;  3C35 A;  1UTB B;  4EXK A;  1AMF A;  3A3C A;  1R9L A;  2WEF A;  3TUS A;  1P99 A;  1LLS A;  3I3V A;  2QSX A;  3D4G A;  3UOR A;  3T9X B;  3MPK A;  2X26 A;  2P0S A;  1UTH A;  2A5T A;  3IB0 A;  4L17 A;  3G3F A;  4EF1 A;  1SI1 A;  4GL8 A;  1Q1K A;  3FAT A;  3IJX B;  2OWZ A;  1B7Z A;  3OSQ A;  3SEV A;  4EUO A;  2D3I A;  3B6W A;  3UA8 A;  2XWI A;  2R6G E;  5CM6 A;  2XX8 A;  3PMW A;  4PBH A;  1IMF A;  5H8H A;  4YMA A;  2XXY A;  4R72 A;  1Y3P A;  2OK2 A;  2QPQ A;  3CRB A;  3QSL A;  2ANJ A;  1MM7 A;  3I6V A;  5I59 B;  3CSB A;  1ZJL A;  3G3I A;  3H03 A;  4DLD A;  4GL0 A;  4HE0 A;  1PB9 A;  2NOO A;  2Z8E A;  1EZP A;  2Y7R A;  3E3K A;  2ZNS A;  3UP9 A;  5I5P A;  2QS4 A;  1SBP A;  4P3L A;  4FE8 A;  3H06 B;  1RDY A;  4H8J A;  5EYH A;  4F1Y A;  1IMD A;  3V8X B;  3ODB A;  3T9U A;  1N3W A;  1JVX A;  1R9Q A;  2UYE A;  3BKI B;  4QFL A;  3K01 A;  4LZ5 A;  1N3X A;  1PDA A;  2I58 A;  4G68 A;  4ND9 A;  1AWB A;  3U72 A;  4OHN A;  4OEV A;  4XFE A;  2QVR A;  1SPI A;  2O1L A;  4QSD A;  4G8H A;  5I84 A;  1ZKB A;  3MAM A;  2GRV A;  1EYJ A;  5ET5 A;  4GWU A;  5JEI A;  2GHA A;  4PFU A;  3JYR A;  4YKI A;  2PX1 A;  3MC2 A;  2QS2 A;  3PUY E;  4PFB A;  4P1E A;  1MM6 A;  4JDF A;  3PU5 A;  4NF4 B;  1NNF A;  1PEB A;  4NG7 A;  1B5J A;  1MH4 A;  1MDQ A;  5IGA A;  3EHU A;  3MZ9 A;  4GVO A;  1JET A;  3T66 A;  5H8F A;  3ONM A;  3FVN A;  3RT8 A;  4OEU A;  1YAE A;  1RKM A;  5KCJ A;  5I2K B;  1NL5 A;  4Z0I A;  4C1U A;  1USY E;  3VLV A;  3PPP A;  3RLF E;  3C33 A;  2RC9 A;  5FHM A;  2ZZV A;  2DVC A;  4MJO A;  3TZA A;  4NMY A;  1EYK A;  2DWI A;  4PFR A;  1MY3 A;  2REG A;  4H45 A;  4FAJ A;  4GWX A;  3QUJ A;  4TLM B;  3OEL A;  1LCF A;  5I2N B;  5LOM A;  1SDX A;  4P8B A;  5FTH A;  3FIR A;  1SW5 A;  3CSG A;  1T0K A;  5AA1 A;  1IEJ A;  1B5H A;  2Q8M A;  3LSF B;  3B7D A;  1DCU A;  3TKD A;  1US4 A;  2XXH A;  3N6U A;  4P1L A;  4RA1 A;  1XHY A;  3NOH A;  4RJZ A;  5F7V A;  1FTA A;  1SQY A;  3K1N A;  1FBH A;  1NFT A;  1LB8 A;  3U1O A;  3SET A;  4NF0 A;  2E1S A;  3QXM A;  2OX3 A;  1A55 A;  5ESY A;  4KI0 E;  4P9K A;  5K2X A;  3K02 A;  4I1D A;  5EYF A;  4PF8 A;  1NV3 A;  3O97 A;  4LQ5 A;  3K6V A;  1K9Z A;  2GFE A;  2DQV A;  3W9V A;  1UIV A;  2VOZ A;  4F18 A;  2LAO A;  5CMC A;  4NF6 B;  2H4I A;  3FV2 A;  4DIG A;  1P1Q A;  1UQW A;  3G3J A;  1FBG A;  2OBG A;  5H8F B;  3MWB A;  2FIX A;  1IXC A;  1GV8 A;  4ONY A;  4RY1 A;  1LEV A;  3K4U A;  1POT A;  4GF8 A;  4N07 A;  3MYU A;  2CMO A;  4G2Z A;  1I6B A;  2NUV A;  2HHM A;  4PTK A;  2Z22 A;  3K2D A;  1KA0 A;  4R9G A;  5I57 B;  4XXU A;  3T1B A;  3Q29 A;  4M1V A;  3O6I A;  4PAK A;  3PPQ A;  1B4H A;  5BWJ A;  3H6W A;  4KCD A;  4YIC A;  1Z7M E;  4F19 A;  1RDX A;  1QJM A;  3V5A A;  3SEX A;  2R9J A;  3EPE A;  4BDM A;  2RCA A;  1B7H A;  1IXG A;  2I4B A;  1B7U A;  1BLF A;  2F5X A;  4KR5 A;  1NV1 A;  4F39 A;  4PFT A;  4YB7 A;  3THI A;  1WOD A;  4KPT A;  3PMV A;  1BK4 A;  4NX1 A;  1ANF A;  1N7W A;  1VDW A;  3G3K A;  1SI0 A;  3IFA A;  2QS1 A;  3QAX A;  3FGS A;  4E0W A;  1XVY A;  2E0S A;  4WKM A;  5DW8 A;  1ZLQ A;  4MEV A;  4DE8 A;  4PET A;  4NF5 B;  3MUQ A;  2PCR A;  5FHN A;  2PT1 A;  4YKK A;  2ZYO A;  4NN3 A;  5EHS A;  2I0B A;  2X7Q A;  3CR9 A;  1MXX A;  3N94 A;  3K6U A;  2UYF A;  4ZZA A;  3KN8 A;  3G3G A;  4YMB A;  2XXR A;  1O7T A;  2FA7 A;  4KYS A;  4IO5 A;  2F7C A; 
#chains in the Genus database with same CATH homology
 1FTK A;  1LAX A;  1TFD A;  4EXL A;  4QFO A;  4U1Z A;  4KFQ A;  1F9B A;  5L9O A;  1B3F A;  3R26 A;  3S9E A;  4XKR A;  2GHB A;  1BIY A;  4KCC A;  4JWO A;  3VVE A;  4U4X A;  2XD2 A;  2ZYK A;  1JEU A;  1H43 A;  2VHA A;  3KFM A;  4ZEB A;  1ZU0 A;  1FCK A;  4ZS9 A;  5TP9 B;  2REJ A;  2DXR A;  4O3B A;  3CG1 A;  3P7I A;  2HZK A;  1AH5 A;  4QFK A;  2ZNU A;  3N26 A;  2PVU A;  4OES A;  2O7I A;  3UIF A;  1B2H A;  3JV9 A;  2ZYM A;  1WDN A;  1Y4C A;  1LAH E;  1FTL A;  4ZE9 A;  4PFW A;  1PBQ A;  2HEU A;  1B58 A;  2Y7W A;  4IO2 A;  3PUV E;  2B3B A;  4NWC A;  1XC1 A;  1UIU A;  4QSC A;  5TPA A;  1USY H;  1A99 A;  3SKP A;  4H0W A;  3LSL A;  5DYH A;  2VD2 A;  4EQ9 A;  4R75 A;  1N84 A;  5B7D A;  4GD5 A;  1LGB C;  4ZEI A;  4MLV A;  3C34 A;  3RNN A;  3OMB A;  2DOJ A;  3D4C A;  2ESN A;  2CZL A;  2H25 A;  3G3H A;  3KOS A;  2UVJ A;  3QUF A;  4LON B;  3JZJ A;  1SW1 A;  3SEW A;  1NH7 A;  3MBP A;  3TCG A;  1MY4 A;  4OTE A;  3UN6 A;  5HPQ A;  3G7W A;  4BLA A;  1R1N A;  2OZZ A;  3U8Q A;  3MZ1 A;  3O9P A;  1TFA A;  1N76 A;  2H99 A;  1SYI A;  1H45 A;  4F3G A;  1MQH A;  3CFZ A;  3QYT A;  2DS9 A;  4HW8 A;  3DP6 A;  1N7X A;  3CFX A;  1N0T A;  3T9V A;  4KD5 A;  4RK2 A;  2IA4 A;  2AIX A;  4TOZ A;  2GH9 A;  1ATG A;  3TYH A;  5TU0 A;  3IO6 A;  3KJ7 A;  4OZ9 A;  3OEM A;  3QK6 A;  3KN7 A;  3N5L A;  2H5Y A;  3KSJ A;  4POX A;  3LR1 A;  4EF2 A;  1URS A;  4O3C A;  4Q0C A;  3IX1 A;  4F22 A;  4BDO A;  3VXC A;  1JQF A;  4NTL A;  3FXU A;  3OEK A;  3DM0 A;  4TQU Q;  4WEP A;  1JNF A;  2Z8F A;  2D5W A;  4EQ7 A;  4OET A;  3FJM A;  4FIM A;  2UVI A;  5JTY B;  4PP0 A;  4OWD A;  5AA2 B;  2D21 A;  2XXW A;  2F35 A;  4DZ1 A;  1BKA A;  3O2A A;  1B3E A;  3WAE A;  4U21 A;  3TEL A;  4DXU A;  2OJT A;  2RC7 A;  4ZED A;  1B1H A;  2ZYN A;  3TTL A;  2ONR A;  4IO7 A;  3PUW E;  4R6K A;  4QFN A;  5ISU A;  4X1B A;  3ZS6 A;  4JB7 A;  1MY1 A;  2DVZ A;  1FTO A;  4ZEC A;  4X1D A;  4IO3 A;  4RPN A;  3MQ9 A;  3S2V A;  5I58 B;  4Q30 B;  3TDJ A;  4UA8 A;  2V84 A;  1DTZ A;  4RPO A;  3CIJ A;  2FNC A;  3Q28 A;  5H8S A;  3S9N C;  4ELQ A;  3LBS A;  1OVT A;  2DXY A;  4POW A;  4LP2 B;  3MP6 A;  3OO6 A;  2V3T A;  3MP1 A;  2G93 A;  3PPR A;  2DYX A;  3CFL A;  4G8N A;  2O68 A;  4F2O A;  2AL4 A;  3ZKK A;  4K3F A;  4XKN A;  2OCU A;  4OVJ A;  4ESX A;  3PUZ E;  1JW4 A;  1P1U A;  4XTC Q;  1IZ1 A;  2OWT A;  1QUI A;  5KZT A;  3ILT B;  4X9T A;  4U4S A;  2F6G A;  4ELR A;  1BTJ A;  1UTH B;  2A5T B;  1MPB A;  1RYX A;  4GIZ A;  4UAC A;  1FQF A;  1CE2 A;  4KYE A;  1TWY A;  3BBR A;  4I8C A;  1MY0 A;  1H3D A;  5H8H B;  4MBP A;  4ZE8 A;  4JSO A;  4G68 C;  2VGQ A;  4MF3 A;  5M2V A;  4YU0 A;  3A09 A;  4H1X A;  4Z7E A;  1B9J A;  1NH8 A;  4JWY A;  3E9X A;  2HCA A;  4OFJ A;  3PMX A;  3TQW A;  3OXN A;  3FVG A;  4IGT A;  3KBR A;  1MQI A;  1MXY A;  1HSJ A;  4NF8 A;  1SW2 A;  4MFI A;  4M4G A;  1FQD A;  4MLQ A;  4TLL B;  4G68 B;  1B3G A;  1SVX B;  1JW5 A;  1P1W A;  1VFD A;  1D9V A;  3IJO B;  1Y1M A;  4GWO A;  2Y7P A;  5L9S A;  2XD3 A;  5H8N A;  2F36 A;  3EQ1 A;  3PD9 A;  3MP8 A;  2Y84 A;  5CRY A;  3LUY A;  4XKQ A;  1Y20 A;  3TPA A;  4F29 A;  3F11 A;  4P0I A;  3T22 A;  3FJG A;  3VDF A;  1XT8 A;  5KDT A;  3DLN A;  2P2A A;  5HM4 B;  1RYO A;  4LZ8 A;  1ZBM A;  1MH3 A;  1QKA A;  5I56 A;  4LUB A;  2DWA A;  5KCJ B;  2Y7I A;  1B0L A;  1KWH A;  1P1N A;  4H8I A;  1IUD A;  1J1N A;  4Q8R A;  3TMG A;  2ABH A;  3IOR A;  1LFH A;  4ELO A;  4DCY A;  2PMS A;  2PT2 A;  3HCQ A;  2UVG A;  1O63 A;  3K0V A;  2Z8D A;  4U22 A;  2IEE A;  1Y3N A;  3PPN A;  1MPD A;  3FXQ A;  1QUJ A;  2Z23 A;  2WKY A;  1M5B A;  3MZB A;  5DVJ A;  2V93 A;  4R9F A;  2I3V A;  1LAF E;  4R6Y A;  5A5X A;  5ICT A;  1SYH A;  3W15 C;  3O6H A;  1GTK A;  1Y9U A;  5BUU A;  1A40 A;  3LSX A;  1TT1 A;  3QIM A;  1QUL A;  2PYY A;  3O28 A;  2DE3 A;  1IIT A;  3LC8 A;  3Q27 A;  2DE2 A;  1Y4T A;  3GXA A;  2HAV A;  3H7M A;  1PB7 A;  3IK6 B;  1MS7 A;  5H8Q A;  5ELV A;  3LSW A;  1ZIU A;  2RIN A;  3PPO A;  2I4C A;  4C1T A;  5DEX A;  1OVB A;  2QL3 A;  1I6Q A;  1QUK A;  1LFG A;  2V25 A;  4XIG Q;  1EZO A;  1EZ9 A;  3HHF A;  1B52 A;  4LA9 A;  2HQ0 A;  2RF1 A;  3VV5 A;  1DPP A;  3KEI A;  1FQC A;  3RTF B;  4KYD A;  4OQO A;  3TTK A;  3W9W A;  5FTI A;  2F34 A;  2Q2C A;  3EN3 A;  2Q89 A;  1B40 A;  1B3H A;  4F1V A;  3R6U A;  1M5F A;  5AA4 A;  1NNK A;  5DVF A;  3IO4 A;  1XVX A;  4ZDM A;  2Y7K A;  4EQB A;  4OYV A;  3OSR A;  3UGW A;  1JVY A;  3K1M A;  4OEN A;  2H9B A;  3KOT A;  2B3F A;  1VSO A;  2XXP A;  4R74 A;  3MW0 A;  4RK9 A;  2DSF A;  1MQD A;  2XX9 A;  5CBS A;  2ZNT A;  1YCJ A;  4IO4 A;  3IR1 A;  2O84 X;  3M3F A;  2YJP A;  1AOV A;  1VR5 A;  2V3U A;  1XS5 A;  3K6X A;  3M3K A;  4ZZE A;  3OD7 A;  4OXV A;  1DMB A;  4YB6 A;  2HZL A;  1B51 A;  1FQB A;  5J1D A;  3MVW A;  1DPE A;  4JSD A;  3V89 B;  2THI A;  3DP8 A;  1UTB A;  4OFO A;  1B5I A;  1MXV A;  3KJT A;  2F7A A;  3PUX E;  2F8D A;  5ITP A;  2XXU A;  2YLN A;  1P1O A;  1B1X A;  2F97 A;  1MQJ A;  1M5C A;  3DP4 A;  3I5O A;  3MPL A;  3U94 A;  1GVC A;  1FTM A;  4FEC A;  1II5 A;  2ONS A;  3VE1 B;  3TTN A;  5AE4 A;  1PC3 A;  3IOW A;  4BDN A;  1QVS A;  4JXI A;  4NED A;  5TPA B;  5I59 A;  3FJ7 A;  3GZG A;  2NVU B;  3CVG A;  2XXI A;  5HBC A;  1D4N A;  4QRZ A;  3N6T A;  3FVO A;  2A5S A;  2DWJ A;  4I62 A;  3TQL A;  3ZSF A;  5EHM A;  1MXZ A;  4H65 A;  4QFP A;  1OQG A;  2XXT A;  4KQP A;  1IIW A;  1LBB A;  1Q35 A;  4N13 A;  3S4U A;  2FYI A;  1NKX A;  4THI A;  1A8E A;  4F3P A;  1XOC A;  5CMM A;  1MY2 A;  2VP1 A;  4LVQ A;  1IXH A;  4R73 A;  2HFB A;  3O6G A;  3T96 B;  4GQO A;  1PB8 A;  3BFU A;  3E13 X;  3MVZ A;  4GRK A;  1EU8 A;  3KN3 A;  1EH3 A;  4IO6 A;  1QW0 A;  1LAG E;  3Q26 A;  4NF4 A;  3PD8 A;  1MRP A;  3OEN A;  1LFI A;  1Z7N E;  3FAS A;  5CBR A;  4H67 A;  2ONK E;  1B6H A;  4E0X A;  3L6G A;  5I2K A;  5F1Q A;  3R7X A;  1NMU A;  1VE4 A;  3ZKL A;  2R71 A;  1ELJ A;  3FXR A;  4FJP A;  1MPC A;  3USD A;  4JBZ A;  1OQH A;  1A7L A;  4IY5 A;  3BFT A;  1D3K A;  3SEY A;  5I2N A;  1YTV A;  3RUM A;  1AL3 A;  3KG2 A;  4F3S A;  3RQT A;  5IKB A;  3FVK A;  4IB2 A;  1HSL A;  1JEV A;  1NNT A;  3OO8 A;  2B65 A;  1OLC A;  1YPN A;  3GBB A;  3HV1 A;  3IL1 B;  2I0C A;  3EHT A;  3V83 A;  2X7P A;  1CB6 A;  1S50 A;  3IOT A;  1OMP A;  3CG3 A;  1M5D A;  3C9H A;  4F31 B;  4NF6 A;  4RNS A;  1Y1Z A;  3RGY A;  1I6A A;  3SER A;  4NE4 A;  4WXJ A;  5L8D A;  4HS7 A;  2XHD A;  4LQ2 A;  5JK4 A;  2AL5 A;  2M8C A;  4FAT A;  1GR2 A;  1VFE A;  5ITO A;  1FQE A;  3KSX A;  3H3G A;  3HN0 A;  4DXC A;  3UK4 A;  3EHS A;  1AIV A;  5B70 A;  1A8F A;  1A54 A;  1URD A;  2DP8 A;  5I57 A;  5CC2 A;  3TEP A;  2F7B A;  2OWS A;  4YKP A;  2RKM A;  3MVX A;  4H5G A;  4HCY A;  4ECF A;  4QF9 A;  2UXA A;  4U23 A;  4PE5 B;  4O3A A;  4F3B A;  4HCW A;  1ZTY A;  2O6A A;  3IOV A;  2QMX A;  2F6P A;  4F2Q A;  5CMB A;  1O64 A;  1URG A;  3C36 A;  2ZMB A;  3VVD A;  2NXO A;  4P11 A;  4Q5T A;  4R6H A;  1B46 A;  1MQG A;  1IQ7 A;  4DCX A;  1ZMG A;  2Q8J A;  1MXU A;  4NF5 A;  2V3Q A;  3FV1 A;  3B6Q A;  2NWJ A;  2P1S A;  3K6W A;  4YKJ A;  3ECR A;  3K1P A;  4NF8 B;  3U93 A;  1BP5 A;  3FZV A;  5ICQ A;  3RPW A;  5FHO A;  4LZ7 A;  4AB6 A;  4ZEK A;  1B0H A;  4G4P A;  3O29 A;  4JWX A;  3AXF A;  3HO7 A;  3S9M C;  4OER A;  1N04 A;  5CMK A;  5H8N B;  3OO9 A;  2HAU A;  4MH5 A;  1L5T A;  3O66 A;  3VLU A;  3TAJ A;  3SEU A;  2O1M A;  2O7U A;  1S7Y A;  2Q2A A;  3A3U A;  4BDL A;  3OO7 A;  2DWH A;  4NWD A;  5TP9 A;  5KDT B;  2BJJ X;  4H6D A;  4OMB A;  3EF7 A;  4G77 A;  3H6V A;  5I56 B;  1GGG A;  3M8U A;  3CI8 A;  3H6T A;  3GLB A;  4OFL A;  3IAZ A;  3L6H A;  1OIB A;  1LBC A;  2I49 A;  3HST A;  3MJN A;  3SDF A;  2XXX A;  3TTR A;  2G29 A;  2UVH A;  5AA3 A;  3MVY A;  1FQA A;  1HSE A;  2QRY A;  2KLF A;  3TFL A;  1MDP 1;  4WED A;  3KZG A;  4AB5 A;  4H5F A;  2Q88 A;  2XX7 A;  4U2R A;  5IAI A;  1LCT A;  1WVJ A;  4DDD A;  1DTG A;  2F78 A;  5L9M A;  3WAF A;  3TOD A;  5A5X B;  1D9Y A;  3U92 A;  4F1U A;  2XXQ A;  4GLI A;  4BDR A;  1H76 A;  4GFR A;  4U1O A;  1I69 A;  2OLB A;  3PGF A;  4I9D A;  4BDQ A;  2QS3 A;  4XKP A;  1LB9 A;  4ELP A;  5DT6 A;  1MG1 A;  3C4M A;  5H8Q B;  4RXL A;  4YB5 A;  3ILU B;  2VD3 A;  3VLW A;  4EDP A;  3DEL B;  4R2B A;  5DEX B;  1JW1 A;  1DSN A;  1POY 1;  3M3L A;  5DVI A;  3E4R A;  4GXA A;  2HXW A;  4PQJ A;  3VFJ A;  1TXF A;  2QJE A;  2I6E A;  3KGC A;  4RYA A;  3FD3 A;  3RTW B;  1SW4 A;  4C0R A;  4FOR A;  2W7Y A;  1DOT A;  2QMW A;  3TTM A;  4ISU A;  1SD3 A;  3RY3 A;  4QSE A;  5DTB A;  3HPI A;  4ESW A;  4ZEF A;  1OLA A;  2RCB A;  4GOT A;  1R6Z A;  2O69 A;  1QKB A;  4AQ4 A;  2RC8 A;  4FEB A;  5AA4 B;  1PBP A;  4GXS B;  5JTY A;  2H98 A;  4FED A;  2XXV A;  5AA2 A;  4N6P A;  5K2Y A;  4YAH X;  4IGR A;  4G8M A;  3TCF A;  2PBW A;  1B4Z A;  3GBA A;  3S9L C;  3IB2 A;  1H44 A;  3Q25 A;  4DXB A;  3OOA A;  3TCH A;  5CI5 A;  3FUZ A;  2I48 A;  4P0G A;  2O51 A;  3RT6 B;  3H6U A;  3VVF A;  3IOU A;  2I3W A;  3PV0 E;  3B6T A;  5AA2 D;  1B3L A;  1Y3Q A;  1M5E A;  2ZXT A;  4HTG A;  3C32 A;  1FW0 A;  1S9T A;  3VXB A;  4YZZ A;  5I58 A;  4QHQ A;  2ALU A;  4LAT A;  1B05 A;  2DE4 A;  1US5 A;  3H4Z A;  2Q9T A;  3RN8 A;  1IXI A;  1LST A;  3C31 A;  4KHZ E;  3T9H B;  4X48 A;  2YPN A;  4PFY A;  3SES A;  3HHG A;  4R2F A;  1FTJ A;  1MXW A;  3K00 A;  2AYS A;  4IY6 A;  3T93 B;  3IB1 A;  1NNP A;  1B32 A;  3C35 A;  1UTB B;  4EXK A;  1AMF A;  3A3C A;  1R9L A;  3TUS A;  1P99 A;  1LLS A;  3I3V A;  2QSX A;  3D4G A;  3UOR A;  3T9X B;  3MPK A;  2X26 A;  2P0S A;  1UTH A;  2A5T A;  3IB0 A;  4EF1 A;  3G3F A;  4L17 A;  1SI1 A;  4GL8 A;  1Q1K A;  3FAT A;  3IJX B;  1B7Z A;  3OSQ A;  3SEV A;  4EUO A;  2D3I A;  3B6W A;  3UA8 A;  2R6G E;  5CM6 A;  2XX8 A;  3PMW A;  5H8H A;  4YMA A;  2XXY A;  4R72 A;  1Y3P A;  2OK2 A;  2QPQ A;  3CRB A;  3QSL A;  2ANJ A;  1MM7 A;  3I6V A;  5I59 B;  3CSB A;  1ZJL A;  3G3I A;  3H03 A;  4DLD A;  4GL0 A;  1PB9 A;  2NOO A;  2Z8E A;  1EZP A;  2Y7R A;  3E3K A;  2ZNS A;  3UP9 A;  2QS4 A;  1SBP A;  4FE8 A;  3H06 B;  4H8J A;  4F1Y A;  3V8X B;  3ODB A;  3T9U A;  1N3W A;  1JVX A;  1R9Q A;  2UYE A;  3BKI B;  4QFL A;  3K01 A;  4LZ5 A;  1N3X A;  1PDA A;  2I58 A;  4G68 A;  4ND9 A;  3U72 A;  4OHN A;  4OEV A;  2O1L A;  4QSD A;  4G8H A;  5I84 A;  1ZKB A;  3MAM A;  2GRV A;  5JEI A;  2GHA A;  4PFU A;  3JYR A;  4YKI A;  2PX1 A;  3MC2 A;  2QS2 A;  3PUY E;  1MM6 A;  4JDF A;  3PU5 A;  4NF4 B;  1NNF A;  1PEB A;  1B5J A;  1MH4 A;  1MDQ A;  3EHU A;  3MZ9 A;  4GVO A;  1JET A;  3T66 A;  5H8F A;  3ONM A;  3FVN A;  3RT8 A;  4OEU A;  1YAE A;  1RKM A;  5KCJ A;  5I2K B;  1NL5 A;  4Z0I A;  4C1U A;  1USY E;  3VLV A;  3PPP A;  3RLF E;  3C33 A;  2RC9 A;  5FHM A;  2DVC A;  3TZA A;  4NMY A;  2DWI A;  1MY3 A;  2REG A;  4FAJ A;  3QUJ A;  4TLM B;  3OEL A;  1LCF A;  5I2N B;  5LOM A;  1SDX A;  5FTH A;  3FIR A;  1SW5 A;  3CSG A;  1T0K A;  5AA1 A;  1IEJ A;  1B5H A;  3LSF B;  3B7D A;  3TKD A;  1US4 A;  2XXH A;  3N6U A;  4RA1 A;  1XHY A;  4RJZ A;  5F7V A;  1SQY A;  3K1N A;  1NFT A;  1LB8 A;  3U1O A;  3SET A;  2E1S A;  3QXM A;  1A55 A;  4KI0 E;  5K2X A;  3K02 A;  4I1D A;  5EYF A;  3O97 A;  4LQ5 A;  3K6V A;  2GFE A;  2DQV A;  3W9V A;  1UIV A;  2VOZ A;  4F18 A;  2LAO A;  5CMC A;  4NF6 B;  2H4I A;  3FV2 A;  4DIG A;  1P1Q A;  1UQW A;  3G3J A;  2OBG A;  5H8F B;  3MWB A;  1IXC A;  1GV8 A;  4ONY A;  4RY1 A;  3K4U A;  1POT A;  4GF8 A;  4N07 A;  2CMO A;  4G2Z A;  1I6B A;  2NUV A;  2Z22 A;  3K2D A;  4R9G A;  5I57 B;  4XXU A;  3Q29 A;  4M1V A;  3O6I A;  3PPQ A;  1B4H A;  5BWJ A;  3H6W A;  4KCD A;  4YIC A;  1Z7M E;  4F19 A;  1QJM A;  3V5A A;  3SEX A;  2R9J A;  3EPE A;  4BDM A;  2RCA A;  1B7H A;  1IXG A;  2I4B A;  1B7U A;  1BLF A;  2F5X A;  4KR5 A;  4F39 A;  4PFT A;  4YB7 A;  3THI A;  1WOD A;  4KPT A;  3PMV A;  1ANF A;  1N7W A;  3G3K A;  1SI0 A;  2QS1 A;  3QAX A;  3FGS A;  4E0W A;  1XVY A;  2E0S A;  4WKM A;  1ZLQ A;  4DE8 A;  4PET A;  4NF5 B;  3MUQ A;  5FHN A;  2PT1 A;  4YKK A;  2ZYO A;  5EHS A;  2I0B A;  2X7Q A;  3CR9 A;  1MXX A;  3N94 A;  3K6U A;  2UYF A;  4ZZA A;  3KN8 A;  3G3G A;  4YMB A;  2XXR A;  1O7T A;  2FA7 A;  4KYS A;  4IO5 A;  2F7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...