3TQLA

Structure of the amino acid abc transporter, periplasmic amino acid-binding protein from coxiella burnetii.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
225
Chain Sequence
TDTIKFATEATYPPYVYMGGQVEGFGADIVKAVCKQMQAVCTISNQPWDSLIPSLKLGKFDALFGGMNITTARQKEVDFTDPYYTNSVSFIADKNTPLTLSKQGLKGKIIGVQGGTTFDSYLQDSFGNSITIQRYPSEEDALMDLTSGRVDAVVGDTPLIKQWLKQNGRREYVLIGKPVNDPNYFGKGVGIAVKKGNQALLLKLNKALAAIKANGVYAAIVQKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transport protein
molecule keywords Arginine-binding protein
total genus 71
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tqlA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tqlA02
4RK2A 2XXYA 1MY3A 3JV9A 4DIGA 1D3KA 1NNKA 1VFEA 1WODA 5FTHA 1H43A 4R6HA 4OMBA 1LAGE 3IO6A 4MLQA 5I2NA 4ZEIA 3I3VA 3Q29A 1MQGA 1MS7A 4EUOA 2VHAA 1Y9UA 1B1HA 4X1BA 2D3IA 4PFTA 3O66A 1ZKBA 5DTBA 1N7WA 4YZZA 1MDP1 3TODA 4QFLA 3SESA 4F3SA 4YKJA 1FTLA 2FYIA 3TUSA 1OQGA 2PBWA 4K3FA 3PPOA 1P1OA 3H6TA 3RTWB 3V8XB 5L9MA 4HW8A 3HHGA 3K02A 1B58A 1MM7A 5KZTA 4GOTA 4RPOA 1B40A 5DYHA 1ZU0A 5AA1A 1NH8A 2QS1A 1LLSA 3B6WA 3EN3A 3FVNA 3FVKA 1MXUA 1S7YA 1FQBA 2HCAA 2Y84A 3H03A 1EZ9A 1QULA 1VFDA 2PMSA 3H3GA 3QXMA 3ZS6A 4F29A 3C32A 4P0IA 3UA8A 4HCYA 1ZJLA 1POY1 1PBPA 1BKAA 4ZECA 3IB2A 5H8SA 2F6PA 3R6UA 4JWOA 3RGYA 4OTEA 3FV2A 4F3PA 5J1DA 2X7QA 2XD2A 1FQFA 1DPEA 2UXAA 4RXLA 3C33A 2Z8DA 3OSQA 4LZ5A 5H8HB 3U94A 3EQ1A 4KFQA 3K00A 1IXHA 4OFOA 1B05A 5H8QA 3RY3A 4N07A 3PPRA 5TP9B 3ZKLA 1URSA 5IKBA 1P99A 1XT8A 4GL0A 1URGA 1JW5A 3DP6A 1D4NA 2D21A 5I2KB 4QSDA 3FJ7A 4PE5B 2UVJA 3IOTA 2Q2CA 4YMBA 2Y7RA 3IJOB 3TCHA 1BIYA 1D9YA 2XXQA 3UN6A 4U2RA 1O7TA 1P1UA 2RC8A 3FXUA 1PC3A 4XKPA 4F31B 3MJNA 4BDLA 5BWJA 3M3FA 2F7BA 3E3KA 3H7MA 2I49A 4F2OA 3RLFE 5CMKA 3IORA 2F97A 4H8JA 4OHNA 1MH3A 3BFTA 4H5FA 1R9LA 5TPAA 3K6UA 2PX1A 3FV1A 4H1XA 2Z8FA 4KYEA 3G3HA 4PQJA 5DVFA 4R72A 3UGWA 1BLFA 3IOVA 4DZ1A 1LB9A 4F18A 5DEXB 2DVZA 1B46A 1PBQA 2DP8A 3N6UA 3ODBA 1ATGA 2Q89A 2RCBA 3IB0A 3KSXA 3OO8A 3QUFA 3R26A 4IO7A 4LATA 4ZZEA 4EQ9A 1H45A 2O6AA 3V83A 3OO6A 4H67A 2A5TA 4LZ7A 2O68A 4RK9A 1XVYA 3VFJA 4FAJA 1JEVA 3H6UA 4MFIA 1H3DA 3EHUA 1SW5A 3EHSA 3N5LA 3SEVA 3WAEA 2QPQA 4R75A 1OIBA 3T9VA 2DSFA 1Y4CA 2CMOA 3G3KA 3PUVE 3W15C 1ELJA 2DWJA 2THIA 3HPIA 3ONMA 3IJXB 1B4ZA 2ZNUA 3U93A 1OVBA 4ZEDA 3IR1A 3PUWE 3KN7A 1T0KA 1EU8A 3IB1A 2V25A 2BJJX 4LONB 3UP9A 5DVJA 3VVDA 3HN0A 1XC1A 3O6HA 4R9GA 4XKNA 4XKQA 5AA2A 4H8IA 1A8FA 3MBPA 1NNPA 5I2NB 1GR2A 1MXWA 2I0CA 1FQAA 4FIMA 5H8FA 4XXUA 2V93A 1IITA 1R6ZA 4YKPA 4ZEKA 5CBSA 1A55A 2RCAA 3A3UA 2ZMBA 3TQLA 4U1ZA 1JW4A 2OBGA 3MP6A 4G68C 1MG1A 1B51A 4H65A 4GD5A 4KYDA 3SEYA 3USDA 1XHYA 4QSCA 1N76A 1IEJA 1MY1A 1US5A 2DWIA 3TAJA 2Q2AA 3L6GA 1B7UA 1Y1ZA 4F19A 5LOMA 4BLAA 4OQOA 2E0SA 2AYSA 3B6TA 4I1DA 4POXA 4R9FA 2O7IA 4LUBA 4ELOA 4F3GA 4QHQA 4LZ8A 1DTZA 1LAHE 3QK6A 1MY2A 3QSLA 4YICA 4OEUA 3TQWA 4C0RA 1QKBA 4JWXA 1ZTYA 1DOTA 3KOSA 2V3UA 3OO7A 2ANJA 4AB6A 1A54A 4IO6A 4IY6A 3MUQA 5F1QA 3C34A 3IK6B 3CI8A 5DT6A 3LSXA 2QL3A 1PB7A 3PD8A 5ITOA 2F36A 1I69A 1ZIUA 4KI0E 4QFOA 3LBSA 4ZS9A 5DVIA 5F7VA 1Z7ME 3FATA 2HZKA 2HXWA 3A3CA 5KCJB 1OLAA 5I57A 2DE3A 2DVCA 3G3IA 3Q28A 1MPBA 1SQYA 1SD3A 3HCQA 2I58A 3QIMA 4QFNA 3K1MA 3SDFA 3IAZA 3S9EA 1SVXB 1FQDA 2I6EA 2H25A 1DSNA 4YKKA 2PT2A 1VE4A 3CG3A 1B7ZA 4OXVA 4UACA 3U92A 1SBPA 2PYYA 3O2AA 4THIA 5AA4A 3ILUB 4KD5A 4RNSA 2LAOA 1A40A 4FEBA 1H44A 4GIZA 1Y3PA 4ONYA 4YB7A 3TFLA 3THIA 1M5BA 2DWHA 3HO7A 2O69A 5FHOA 3KSJA 4OEVA 1B5HA 5EHMA 2OWSA 3LUYA 4XKRA 3FVGA 4NF6B 1LAFE 3C4MA 3TELA 2QS2A 4OZ9A 1CE2A 3A09A 2V84A 4HS7A 1FQEA 3IX1A 3UK4A 1SI0A 1OVTA 2H99A 3QAXA 3OEMA 1MQIA 1FCKA 2F78A 2F7CA 2QJEA 2QRYA 3KN8A 4OFLA 3C36A 3FIRA 4GLIA 3PUXE 1XS5A 3F11A 3FVOA 5HPQA 1P1NA 1HSJA 2H9BA 1MXXA 4PFYA 5M2VA 4BDRA 1YCJA 5ICTA 3E9XA 3FJGA 5EHSA 1NKXA 1PB9A 2YLNA 4G8NA 4NWCA 1FTOA 3TCFA 3RPWA 3PUYE 5L8DA 3TTMA 4IO2A 4ECFA 2NVUB 1Y3QA 1XVXA 2H5YA 2DQVA 4ESWA 1MDQA 2F6GA 2VD3A 3CRBA 5I58A 2ONKE 4JB7A 1SDXA 3OOAA 4RYAA 1AH5A 4OERA 1QKAA 4QSEA 2UVIA 2ZNTA 4QFPA 3LSFB 3OSRA 4TLMB 3VVEA 1PEBA 2O1MA 3QYTA 3TTLA 4O3CA 3CFZA 2Q8JA 1OLCA 4NWDA 3PPNA 2P0SA 2Y7IA 4MBPA 2H4IA 1UTHB 2QSXA 4NTLA 4PETA 4QFKA 3PV0E 4XTCQ 4F1VA 2ZYNA 1I6BA 1R1NA 3LC8A 4PFWA 5FTIA 3M3KA 1IXGA 4X9TA 2Y7WA 3HHFA 4FE8A 1M5CA 1UIVA 1B1XA 2HFBA 2Z23A 1MXVA 1WDNA 2VGQA 3E13X 3GBBA 1POTA 2Y7KA 1QW0A 3KBRA 3Q26A 4R6KA 4U4SA 3C35A 1YTVA 2UVGA 4BDMA 1MRPA 1NH7A 1Q1KA 4X48A 5EYFA 3TEPA 3M8UA 3MC2A 4KYSA 2NWJA 3CIJA 2OJTA 4R2BA 3VLWA 3FUZA 1B3LA 4NEDA 4OFJA 1GVCA 2V3QA 3PMXA 3VXCA 3GZGA 3C9HA 5KCJA 4JWYA 4DE8A 3CFLA 3JZJA 2F8DA 2XXUA 4P0GA 3PGFA 4DCXA 2F5XA 3O6GA 5KDTA 3CFXA 2DOJA 4ZE8A 2GRVA 3U8QA 2GFEA 5CMCA 3CG1A 1B3HA 2XX9A 4IGRA 1B0HA 3TCGA 2REJA 3KOTA 3KZGA 4JDFA 3K01A 3P7IA 4RY1A 3RQTA 1NNTA 4GQOA 4H5GA 2ZXTA 1M5FA 4GXSB 4PFUA 3AXFA 4M4GA 3RN8A 3FJMA 4ESXA 1CB6A 5K2XA 4LQ2A 1FQCA 5JK4A 3TTRA 2XHDA 3EF7A 2R9JA 3I6VA 1M5EA 1SW2A 1VSOA 2NUVA 1D9VA 3BKIB 3K1PA 3MP8A 2V3TA 3CR9A 5TU0A 3SEXA 4NF4B 2OCUA 2Y7PA 4JBZA 3CVGA 1B3FA 5AA2D 4ZDMA 4DXCA 3R7XA 1IIWA 2ALUA 3PMVA 3TMGA 4U4XA 3D4CA 1GGGA 2Z22A 5I59A 1LBCA 2A5SA 2I3VA 3T22A 2F35A 1MQJA 5H8FB 4WXJA 3SEUA 2KLFA 3I5OA 1JEUA 2XXHA 4IY5A 3CSGA 3PU5A 1JVYA 2NXOA 1NL5A 3SETA 2E1SA 3O97A 2NOOA 3MZ9A 3VVFA 1B5IA 1TWYA 4DCYA 1LGBC 1NFTA 2QMXA 3OMBA 4EDPA 5DEXA 4Q8RA 1B3EA 3G3GA 4DXUA 4FECA 3UIFA 3W9VA 4EXLA 1LFGA 4I62A 1P1WA 2O51A 2X26A 1USYH 2RINA 5TPAB 1M5DA 3S9MC 3IOUA 4GRKA 5AE4A 5FHNA 5FHMA 3G7WA 4GL8A 4KR5A 1MY4A 1VR5A 2YPNA 3B7DA 3TPAA 2QS4A 4KCCA 5CRYA 4U21A 4YB5A 4ZEFA 2ABHA 3U72A 1KWHA 2O84X 3RT6B 5IAIA 4ELRA 1P1QA 3TTNA 4C1UA 3K4UA 1N3XA 4ZZAA 3GLBA 3H6WA 2P2AA 3V5AA 2FNCA 3E4RA 4F1YA 3W9WA 1AOVA 4JSDA 1XOCA 1B32A 2VD2A 1H76A 4OENA 4ELPA 1AL3A 1B7HA 1MPDA 3H4ZA 1JETA 4P11A 4R2FA 4U23A 3KG2A 4Z0IA 2QMWA 3N6TA 5CI5A 4BDNA 4GXAA 1AMFA 3RTFB 4YU0A 1MM6A 2Z8EA 4JSOA 3RUMA 5AA3A 2AIXA 4GVOA 1A7LA 3OENA 2Q88A 2UYFA 3ZSFA 3GXAA 4OWDA 4EXKA 5CM6A 2Q9TA 2WKYA 3IO4A 4NF8B 1J1NA 1MPCA 4IO3A 1TFAA 3TZAA 5TP9A 3KGCA 4H0WA 4YB6A 4TLLB 2XX8A 2GH9A 3PUZE 2H98A 5ICQA 1JQFA 3OEKA 2DXYA 1N04A 2O1LA 3K1NA 4LP2B 5JEIA 3O9PA 1N3WA 1RYXA 4AB5A 1DMBA 1IQ7A 4OYVA 4H6DA 4TQUQ 2D5WA 2UYEA 2ZYKA 3B6QA 3MP1A 4WKMA 3T9HB 4G77A 4E0WA 1B2HA 1USYE 2VP1A 3LR1A 3H6VA 3MPLA 3PPPA 1L5TA 3H06B 5I59B 4N13A 2DS9A 1II5A 4FJPA 4YKIA 2PVUA 3MPKA 5ELVA 1SI1A 4ISUA 4NF6A 1N0TA 4BDQA 3BFUA 1IUDA 2AL4A 2RC7A 1EH3A 1MXZA 3G3JA 4NF4A 5AA4B 1US4A 3MAMA 1Q35A 1GTKA 4G8MA 3S2VA 3UORA 1QVSA 4G2ZA 2XXIA 3MW0A 3T9XB 4AQ4A 3KFMA 1LSTA 3MVXA 3M3LA 1GV8A 3OO9A 3K6XA 5L9OA 3KJ7A 1LBBA 4F22A 3FD3A 1A8EA 2DYXA 3N94A 1MXYA 4TOZA 4ELQA 1SW4A 2R71A 3D4GA 3S9LC 3TTKA 4N6PA 4F39A 4M1VA 3T93B 3IL1B 3VE1B 4XIGQ 2B3BA 2DXRA 1I6AA 1Y4TA 4G8HA 4G68A 3C31A 4DXBA 3Q25A 2G29A 4IO4A 2AL5A 2XD3A 3EPEA 2RF1A 3FXRA 2XXXA 3PPQA 1S50A 4NMYA 4UA8A 1AIVA 1N7XA 4Q5TA 4U22A 5JTYA 1SYIA 3V89B 3T96B 1OMPA 4G68B 4C1TA 1Z7NE 4QRZA 1B5JA 1DPPA 1O64A 2DWAA 2VOZA 2CZLA 3KN3A 2GHAA 1LFIA 1Y1MA 1IXIA 4KHZE 4KQPA 3S4UA 1EZPA 1R9QA 1Y3NA 5CMBA 1YPNA 1B3GA 1DTGA 1PDAA 1UIUA 2XXPA 3K2DA 4Z7EA 3VLVA 4QF9A 5AA2B 1UQWA 4I8CA 3VLUA 4BDOA 1TXFA 1I6QA 1HSEA 2I0BA 4HCWA 4MLVA 1NNFA 1ANFA 1YAEA 2I4CA 4EQ7A 5KDTB 1RYOA 3OELA 2QS3A 5JTYB 1UTBA 5CC2A 1LFHA 4GFRA 3MQ9A 4KPTA 1SYHA 3L6HA 3TDJA 4RA1A 1LB8A 4IB2A 2XXRA 1EZOA 5B70A 1WVJA 2ONSA 5K2YA 4F1UA 1RKMA 3S9NC 1B0LA 3MZBA 3FASA 4NF5B 4E0XA 1OQHA 1B4HA 1JVXA 4LVQA 5A5XB 1B52A 2I4BA 2DE2A 3TKDA 1LCFA 5H8NB 2I48A 3PD9A 4X1DA 2GHBA 4OESA 1HSLA 3T9UA 4R74A 3WAFA 1QUIA 1URDA 2UVHA 2B3FA 2XX7A 3ZKKA 4EF2A 2F7AA 3VXBA 1Y20A 2OWTA 1UTHA 2PT1A 2OLBA 2ESNA 4RJZA 2RC9A 2XXTA 3FGSA 3K6WA 4JXIA 4WEDA 4FATA 5I56A 4WEPA 4NF8A 4PP0A 4LA9A 5CBRA 3JYRA 4OETA 4DLDA 4FEDA 4O3AA 4F3BA 5ITPA 2P1SA 1FTJA 1NMUA 3O6IA 1LCTA 2XXWA 5I58B 3N26A 5L9SA 1PB8A 3HSTA 1TT1A 2A5TB 3EHTA 3LSWA 2G93A 5BUUA 3ECRA 4EQBA 1MH4A 4ND9A 1ZMGA 4ZEBA 3TYHA 4GF8A 4IO5A 1MQHA 2DE4A 2HEUA 3LSLA 3MVWA 5I2KA 4L17A 3O28A 1FTMA 1FW0A 2HAUA 1S9TA 2ZYOA 3K0VA 3OD7A 4POWA 5I57B 3T66A 1LAXA 3O29A 4Q0CA 4R73A 4U1OA 5H8NA 1BP5A 3GBAA 2R6GE 1IXCA 3IOWA 3VDFA 1QJMA 4O3BA 5ISUA 5HBCA 1MY0A 3DELB 3PMWA 5A5XA 2REGA 4KCDA 2OZZA 4OVJA 5H8QB 1JW1A 3BBRA 2HQ0A 4NF5A 1O63A 2O7UA 4DDDA 1BTJA 1ZBMA 5H8HA 2HZLA 3SKPA 1B9JA 2RKMA 3CSBA 3DP8A 5I56B 1B6HA 1MQDA 3K6VA 1F9BA 4Q30B 4YMAA 4ZE9A 1QUKA 3MZ1A 3SEWA 3ILTB 5HM4B 2XXVA 2W7YA 3DLNA 2FA7A 4HTGA 4YAHX 4LQ5A 2YJPA 4FORA 4MF3A 3Q27A 1SW1A 1A99A 4NE4A 4I9DA 3HV1A 3RNNA 4RPNA 5I84A 3FXQA 3KEIA 3QUJA 3DP4A 2ONRA 3FZVA 3VV5A 4EF1A 5B7DA 1ZLQA 4G4PA 4MH5A 1IZ1A 1N84A 1QUJA 3U1OA 2HAVA 3RT8A 1JNFA 2X7PA 2F34A 3OXNA 4R6YA 2OK2A 3G3FA 3KJTA 2I3WA 2ZNSA 1TFDA 2B65A 2M8CA 2ZYMA 3MWBA 1FTKA 3MVZA 3DM0A 4GWOA 1UTBB 2IEEA 3MVYA 4IGTA 2IA4A 3SERA 4F2QA 5CMMA
chains in the Genus database with same CATH superfamily
4LN5A 1MY3A 1D3KA 3A29A 1RDZA 2P3VA 1MS7A 4EUOA 1B1HA 4PFTA 1MDP1 2WBBA 4O94A 4QFLA 1FTLA 3RTWB 4HW8A 3K02A 5DYHA 1ZU0A 1NH8A 3FVNA 3QIMA 4LQ5A 3S9EA 3FVKA 1MXUA 1FQBA 2Y84A 3H03A 4F29A 1QULA 2PMSA 3H3GA 3C32A 1ZJLA 3IB2A 2F6PA 3RGYA 3FV2A 3OSQA 4LZ5A 3U94A 2V4CA 3LUZA 5TP9B 3ZKLA 3DP6A 5I2KB 3FJ7A 1IMFA 2Q2CA 3IJOB 3TCHA 1D9YA 4F31B 2F7BA 4EQ7A 2F97A 4OHNA 4ZE9A 4PQJA 1VDWA 1BLFA 5EQ8A 4F18A 1B46A 1PBQA 4QRZA 1ATGA 1H45A 4RK9A 3VFJA 4MFIA 4N6DA 1SW5A 3WAEA 2QPQA 5ET8A 1Y4CA 1NUXA 3HPIA 2THIA 3IJXB 5ESYA 3U93A 1EU8A 4FBPA 5DVJA 4R9GA 4XKNA 2I0CA 1K9YA 4XXUA 1R6ZA 3A3UA 2Q8MA 4KYDA 4X8RA 1FPKA 1IEJA 1MY1A 3U65A 4BLAA 2AYSA 3B6TA 4R9FA 4LZ8A 3MSTA 3QK6A 1MY2A 3TQWA 4C0RA 4OEUA 1ZTYA 1DOTA 2V3UA 1A54A 5F1QA 3C34A 5ITOA 1SD3A 2I58A 3K1MA 2I6EA 1LBYA 4UACA 4OXVA 3ILUB 4KD5A 2LAOA 1A40A 4FEBA 3TFLA 4YB7A 5FHOA 2OWSA 1EYKA 3MYUA 4NF6B 4HXVA 1CE2A 3A09A 2V84A 4HS7A 3B8BA 3UK4A 1SI0A 3QAXA 3OEMA 1FCKA 4E0WA 2H9BA 1MXXA 3E9XA 3FBPA 4G8NA 3TCFA 3PUYE 4ECFA 2VD3A 2ONKE 1QKAA 2ZNTA 3BIGA 1OLCA 4NWDA 1UTHB 1I6BA 1UIVA 2UVGA 1NH7A 5EYFA 4NX1A 3CIJA 2OJTA 4R2BA 3FUZA 2L5VA 5KCJA 2V3QA 3JZJA 1NUZA 4P0GA 4MNIA 2F5XA 2DOJA 4ZE8A 2GRVA 2GFEA 2XX9A 2REJA 3P7IA 4H5GA 2XA5A 1M5FA 4PFUA 4M4GA 2R8TA 3RN8A 5JK4A 1FQCA 3MUQA 3MP8A 3PMVA 2HPGA 2Z22A 2I3VA 2CEYA 2F35A 1MQJA 3SEUA 2XXHA 4IY5A 1JVYA 1NL5A 3SETA 2NOOA 1LGBC 3OMBA 4EDPA 3IFCA 5DEXA 3G3GA 4EXLA 4DI3D 1USYH 2RINA 5TPAB 4PAFA 4KCCA 3PTYA 3H6WA 4JSDA 2B4LA 1B7HA 2FVZA 4P11A 1JETA 3KG2A 5CI5A 4JSOA 5AA3A 1A7LA 3OENA 2UYFA 5CM6A 4OWDA 2WKYA 4NF8B 1MPCA 4YB6A 2GH9A 5ICQA 4LP2B 3O9PA 1IQ7A 4OYVA 4G77A 3MPLA 3H6VA 3PPPA 4MIJA 1L5TA 3H06B 2DS9A 4XFEA 4YKIA 1SI1A 1RDXA 1MXZA 2XWOA 3G3JA 1US4A 4G8MA 1GTKA 4G2ZA 1LSTA 3MVXA 3M3LA 4AS5A 3K6XA 1LBBA 2DYXA 4TOZA 4ELQA 2XWKA 1NI9A 3TTKA 4G8HA 4G68A 3C31A 4DXBA 3Q25A 1FPIA 2XXXA 4NMYA 1YYZA 2VPNA 4JVCA 1N7XA 1SYIA 3T96B 1OMPA 3LV0A 1DPPA 4I3EA 2CZLA 5CMBA 3RPLA 3VLVA 1UQWA 3VLUA 1TXFA 3B50A 5KDTB 1UTBA 4JVIA 3TDJA 4IB2A 1EZOA 4GBWA 4MNPA 1RKMA 3MZBA 4E0XA 1B52A 2DE2A 3T9UA 1QUIA 2B3FA 4OVTA 4EF2A 3VXBA 1Y20A 1NUWA 1UTHA 2PT1A 3FGSA 2WYKA 4WEDA 4PP0A 4DLDA 4FEDA 4O3AA 2XXWA 5I58B 1PB8A 3HSTA 1TT1A 3LSWA 3ECRA 1IMCA 3LSLA 3MVWA 5I2KA 4POWA 5I57B 3T66A 4OANA 4U1OA 2R6GE 1QJMA 1MY0A 3DELB 4KCDA 4OVJA 5H8QB 2Y5KA 2HQ0A 4NF5A 4DDDA 1EYJA 2O7UA 1B6HA 1F9BA 4YMAA 4PC9A 4YAHX 4MF3A 1SW1A 3GYYA 4GWXA 2B4MA 2P3NA 3FXQA 2ONRA 3OXNA 3G3FA 4PDDA 3MWBA 4QSCA 2IA4A 2XXYA 3JV9A 2VPOA 4DIGA 1WODA 2XXKA 4MLQA 5I2NA 1MQGA 4PBQA 2D3IA 3TODA 4YKJA 2PFZA 2FYIA 2ZZXA 4PFRA 1MM7A 5KZTA 4RPOA 3B6WA 2QS1A 3OO9A 2HCAA 1AOVA 1EZ9A 4P0IA 3UA8A 5H8SA 3D1RA 4JWOA 2XD2A 1FQFA 1DPEA 4OVSA 3C33A 4QXDA 4KFQA 3K00A 4OFOA 1B05A 3PPRA 4PGNA 4MNCA 1URSA 4GL0A 1JW5A 2F3DA 3IOTA 2VT5A 4YMBA 3UN6A 4U2RA 3FXUA 1P1UA 1IMDA 4JVDA 4F2OA 3RLFE 1MH3A 4H5FA 3K6UA 2PX1A 4KYEA 5DVFA 4DZ1A 3IOVA 5ET7A 2DP8A 3ODBA 3OO8A 3QUFA 4IO7A 3R26A 3V83A 2Q74A 1DK4A 2O6AA 3OO6A 4H67A 2O68A 1JEVA 3H6UA 1KA1A 3FXBA 1H3DA 2QVVA 3N5LA 5J16A 3T9VA 2DSFA 3ONMA 2DWJA 2ZNUA 4KXPA 3IB1A 3VVDA 3KBZA 1A8FA 2HXRA 1NNPA 1GR2A 4NG7A 4FIMA 4YKPA 5ET5A 1JW4A 3MP6A 1XHYA 1N76A 2DWIA 2Q2AA 5LOMA 2O7IA 4ELOA 4YICA 3OO7A 2QL3A 5EQ7A 5F7VA 5DVIA 3FATA 2HZKA 3A3CA 1OLAA 2DE3A 2DVCA 1MPBA 3HCQA 1LBZA 3IAZA 1SVXB 4P1LA 1DSNA 2PT2A 1VE4A 1B7ZA 5AA4A 1H44A 1M5BA 5EHMA 4XKRA 3T0JA 1FPBA 1FQEA 1YXIA 4P9KA 1MQIA 2F78A 3C36A 3FIRA 1XS5A 1HSJA 5M2VA 4BDRA 4PAKA 5ICTA 3FJGA 1NKXA 1PB9A 1FTOA 5IZ3A 3TTMA 4IO2A 1IMAA 2F6GA 5I7IA 5I58A 4JB7A 1SDXA 1FBEA 4OERA 2UVIA 3LSFB 3OSRA 3QYTA 3TTLA 3PPNA 2H4IA 4PETA 2OX3A 2F3BA 1R1NA 4PFWA 3M3KA 1WDNA 2VGQA 3Q26A 4U4SA 5AA4B 1POTA 1QW0A 2WBDA 1FPGA 4MMPA 2ZZWA 4X48A 1NUYA 4GWUA 2NWJA 4OFJA 1GVCA 3PMXA 3GZGA 2XWIA 4JWYA 2F8DA 4NHBA 3SZPA 4DCXA 3KOTA 4JDFA 3RQTA 4GQOA 4ESXA 1CB6A 2R9JA 3I6VA 1VSOA 2CZIA 1D9VA 3K1PA 3CR9A 4JBZA 4DXCA 2ALUA 3TMGA 4U4XA 4N6KA 1LBCA 3T22A 4WXJA 2KLFA 1JEUA 1TWYA 4O8MA 4DXUA 3UIFA 3W9VA 1LFGA 2O51A 2X26A 1M5DA 3S9MC 3IOUA 5AE4A 5FHNA 3VVFA 3G7WA 5CRYA 1KWHA 3RT6B 3TTNA 4F1YA 2P2AA 1XOCA 1B32A 4AS4A 1AL3A 3H4ZA 1FPFA 1NV1A 1MM6A 2Z8EA 3RUMA 2AIXA 4GVOA 3ZSFA 2Q88A 4EXKA 2Q9TA 1J1NA 1TFAA 4TLLB 4OA4A 3PUZE 1JQFA 3OEKA 2DXYA 2O1LA 3EKIA 1RYXA 2D5WA 2ZYKA 3T9HB 4WKMA 1USYE 4FJPA 2PVUA 5ELVA 1N0TA 4BDQA 2AL4A 4NF4A 1NV7A 1QVSA 3KFMA 5EYHA 4X04A 3N94A 5DW8A 1SW4A 2R71A 1CNQA 3IL1B 4XIGQ 2DXRA 4IO4A 2AL5A 3EPEA 2RF1A 3FXRA 1AIVA 4Q5TA 4U22A 3V89B 4G68B 1Z7NE 1B5JA 4N13A 3KN3A 1Y3NA 2XXPA 1B3GA 5HM4B 1UIUA 4UABA 5AA2B 4I8CA 1I6QA 4HCWA 1YAEA 1FTAA 3ROJA 1RYOA 3OELA 2QS3A 4G61A 1SYHA 3L6HA 4RA1A 1LB8A 2XXRA 1WVJA 1OQHA 3TKDA 5H8NB 3PD9A 2GHBA 1NV4A 2RC9A 2XXTA 3K6WA 1EYIA 4F3BA 1NMUA 3O6IA 3N26A 2G93A 4ND9A 3TYHA 4GF8A 4IO5A 2DE4A 4L17A 1FW0A 3OD7A 5I3SA 1LAXA 3GBAA 1IXCA 3IOWA 1Q9DA 5HBCA 1FPJA 3PMWA 2OZZA 1JW1A 1O63A 1BTJA 1ZBMA 5H8HA 3SKPA 1B9JA 3CSBA 4XEQA 1MQDA 1QUKA 4I40A 2YJPA 3NOHA 4FORA 4I3YA 1A99A 2HHMA 3RNNA 4RPNA 3KEIA 3QUJA 3DP4A 4EF1A 1ZLQA 4G4PA 4MH5A 4NAPA 1N84A 1QUJA 3RT8A 3KJTA 2ZNSA 1TFDA 2B65A 2IEEA 3MVYA 5CMMA 4RK2A 1NNKA 1H43A 4OMBA 3IO6A 4PCDA 4ZEIA 3I3VA 2VHAA 1K9ZA 1ZKBA 1N7WA 4YZZA 2WEFA 2PBWA 4K3FA 3V8XB 3H6TA 5L9MA 1B58A 1B40A 4O7MA 3EN3A 1LLSA 1S7YA 5CMKA 4MEVA 4HCYA 4QBAA 1PBPA 3R6UA 4OTEA 4F3PA 4HE2A 2KQZA 1IXHA 1LEVA 5EQ9A 4PTKA 1URGA 2D21A 4QSDA 1FRPA 2UVJA 2Y7RA 4H46A 1BIYA 2XXQA 1O7TA 2RC8A 1PC3A 4XKPA 1G0HA 3M3FA 3H7MA 3BFTA 5TPAA 3FV1A 2Z8FA 3G3HA 3IFAA 4R72A 4H45A 3N6UA 2Q89A 2RCBA 3KSXA 4ZZEA 4EQ9A 2A5TA 4LZ7A 4FAJA 3EHUA 3EHSA 4PDHA 1OIBA 2CMOA 1FBHA 3PUVE 1ELJA 3IR1A 3PUWE 2BJJX 3O6HA 4H8IA 3MBPA 5H8FA 2V93A 4ZEKA 3TQLA 2ZMBA 4MJOA 2OBGA 4G68C 4H65A 1B51A 5EYGA 3USDA 1FPDA 1DBZA 4OQOA 4I1DA 1DTZA 3QSLA 4N8YA 1KA0A 4IO6A 1FPLA 4P56A 1PB7A 2F36A 1I69A 1ZIUA 4IR8A 1Z7ME 2HXWA 4XF5A 3Q28A 4PFIA 1FQDA 2H25A 4YKKA 5LDZA 3CG3A 3U92A 1SBPA 2PYYA 4THIA 4RNSA 5I57A 4ONYA 3THIA 1Y3PA 5IZ3B 1BK4A 2DWHA 1B5HA 3LUYA 3FVGA 1LAFE 3C4MA 2ZZVA 3IX1A 4PF8A 1OVTA 2H99A 4ZZAA 2QRYA 3KN8A 4OFLA 4GLIA 3PUXE 3F11A 2YLNA 3RPWA 2NVUB 2H5YA 1XVXA 2DQVA 1MDQA 4N17A 1FBDA 1PEBA 2O1MA 2WYPA 4MAGA 4NTLA 4MBPA 2QSXA 4XTCQ 1DCUA 3PV0E 3LC8A 1IXGA 4PAIA 4X9TA 2Y7WA 1B1XA 3E13X 2Y7KA 3KBRA 4R6KA 1YTVA 1MRPA 4GWSA 1Q1KA 3TEPA 3M8UA 3HFUA 4KYSA 3VXCA 1B3LA 2FBPA 4DE8A 3CFLA 5KDTA 3PGFA 3O6GA 3CFXA 3CG1A 1LBXA 1B0HA 3TCGA 4RY1A 1NNTA 2ZXTA 3AXFA 4LQ2A 4N07A 4F22A 3SEXA 2NUVA 3S9LC 1B3FA 2WX9A 4ZDMA 1IIWA 1GGGA 5I59A 2A5SA 1NV3A 4P3LA 3CSGA 3PU5A 2NXOA 4N91A 2E1SA 3KC1A 3O97A 1B5IA 4N15A 1B3EA 4I62A 3CHGA 1P1WA 5FHMA 4KR5A 4GL8A 3TPAA 1MY4A 2YPNA 2ABHA 2CZHA 1P1QA 4C1UA 3V5AA 3GLBA 3E4RA 3W9WA 4OENA 4ELPA 4U23A 2BJIA 1XI6A 3N6TA 4BDNA 1AMFA 3RTFB 4GWZA 2FIXA 4IO3A 1QGXA 3KGCA 4H0WA 2XX8A 2H98A 3K1NA 5JEIA 1N3WA 1DMBA 4H6DA 3B6QA 3MP1A 3LR1A 4NF6A 3BFUA 2RC7A 1Q35A 3S2VA 3MW0A 3T9XB 4AQ4A 4MHFA 3RPLB 1SPIA 1A8EA 1MXYA 4P1EA 4F39A 4N6PA 4M1VA 3T93B 3VE1B 2B3BA 2G29A 2XD3A 3PPQA 5JTYA 1O64A 2DWAA 2VOZA 2GHAA 1EZPA 4KHZE 3S4UA 1R9QA 3K2DA 1DTGA 1PDAA 4Z7EA 4QF9A 1HSEA 4MLVA 1NNFA 1ANFA 2I4CA 5CC2A 5JTYB 1LFHA 4GFRA 3MQ9A 4KPTA 5K2YA 4F1UA 1B0LA 3FASA 4NF5B 1JVXA 5A5XB 1LCFA 2I48A 4X1DA 1INPA 4R74A 3WAFA 5IZZA 2UVHA 1G0IA 2ESNA 4RJZA 2FIEA 1RDYA 5I56A 4LA9A 5CBRA 3JYRA 1IMBA 1FTJA 3ISPA 4PE3A 2CZKA 4HE1A 4ZEBA 1FJ9A 2HEUA 3O28A 1FTMA 3K0VA 3O29A 1BP5A 5ISUA 4O3BA 5EQAA 5A5XA 2REGA 1NV0A 3BBRA 2RKMA 3MZ1A 3ILTB 2W7YA 4I9DA 3FZVA 1JNFA 4N8GA 2F34A 4R6YA 2ZYMA 3MVZA 1FTKA 4GWOA 4IGTA 3SERA 1UTBB 3MZ9A 4ZECA 4MCOA 1VFEA 5FTHA 4R6HA 1LAGE 3Q29A 1Y9UA 4X1BA 5DTBA 3O66A 4F3SA 3SESA 4PFBA 4P8BA 4GX3A 3TUSA 1OQGA 2Y5LA 1P1OA 3PPOA 3HHGA 4GOTA 5AA1A 3OOAA 3ZS6A 3QXMA 1VFDA 5IZ1A 1POY1 1BKAA 2X7QA 2UXAA 4RXLA 2Z8DA 3E79A 5H8HB 3EQ1A 2PFYA 5H8QA 3RY3A 1NV6A 5IKBA 1P99A 1XT8A 4N4UA 1D9QA 1D4NA 4PE5B 1LBWA 5BWJA 3MJNA 4BDLA 3E3KA 2I49A 3IORA 4H8JA 4GBVA 1R9LA 4H1XA 3UGWA 1LB9A 5DEXB 2DVZA 4LATA 3IB0A 1XVYA 3SEVA 4R75A 3G3KA 3W15C 1B4ZA 4OVPA 1OVBA 4ZEDA 3KN7A 1T0KA 4LONB 2V25A 3UP9A 3HN0A 1XC1A 4XKQA 5AA2A 5I2NB 1MXWA 1FQAA 2CEXA 5CBSA 1IITA 1A55A 2RCAA 4U1ZA 4MX6A 1FBGA 1FPEA 1MG1A 3SEYA 2FHYA 4GD5A 1NV5A 1FBCA 1US5A 3TAJA 1B7UA 1Y1ZA 4GWYA 1YZ0A 4F19A 4POXA 2E0SA 4LUBA 4F3GA 4QHQA 5A5LA 1LAHE 1QKBA 4JWXA 3KOSA 2ANJA 4AB6A 4IY6A 3IK6B 3CI8A 5DT6A 3LSXA 3PD8A 2PCRA 4KI0E 4QFOA 3LBSA 4ZS9A 5KCJB 3G3IA 3SDFA 4QFNA 1SQYA 3O2AA 5J1DA 4GIZA 2GQ1A 1IMEA 3HO7A 2O69A 3KSJA 4OEVA 3E78A 3TELA 2QS2A 4OZ9A 2DDKA 2QJEA 2F7CA 1FSAA 3FVOA 5HPQA 1P1NA 4GX4A 4PFYA 1LBVA 1YCJA 1FJ6A 1FBFA 5EHSA 4NWCA 2XWVA 5L8DA 4ESWA 1Y3QA 3CRBA 4RYAA 5F24A 1AH5A 4QSEA 4QFPA 4TLMB 3VVEA 4N81A 4NN3A 4O3CA 3CFZA 2Q8JA 2P0SA 2Y7IA 4QFKA 4F1VA 2ZYNA 4P47A 5FTIA 5I5PA 3HHFA 4FE8A 1M5CA 2Z23A 2HFBA 2QVRA 5K2XA 1MXVA 5BUUA 3GBBA 5TP9A 5FBPA 4BDMA 3C35A 2KR0A 3MC2A 3VLWA 4GWWA 4NEDA 3C9HA 2XXUA 3U8QA 5CMCA 1B3HA 4IGRA 2OWZA 3KZGA 3K01A 4GXSB 3FJMA 3TTRA 2XHDA 3EF7A 1M5EA 5TU0A 1SW2A 3BKIB 3T1BA 2V3TA 4NF4B 1FBPA 2OCUA 2Y7PA 3CVGA 5AA2D 3R7XA 5ET6A 3D4CA 1JP4A 4NQ8A 4PF6A 5T3JA 5H8FB 4OVRA 3I5OA 4DCYA 1NFTA 2QMXA 4Q8RA 3KC0A 4FECA 4GRKA 5LTCA 3BIHA 1VR5A 3B7DA 2QS4A 4U21A 4YB5A 4ZEFA 3U72A 2O84X 5IAIA 4ELRA 3K4UA 1N3XA 2FNCA 2VD2A 1H76A 1MPDA 4R2FA 4Z0IA 5IGAA 2QMWA 4PBHA 4GXAA 4YU0A 3GXAA 3IO4A 3TZAA 3RYDA 4O7IA 1N04A 3QMFA 4AB5A 5IM2A 4TQUQ 2UYEA 1B2HA 2VP1A 2JJKA 5I59B 1II5A 4DI4B 3MPKA 4ISUA 1IUDA 1EH3A 3MAMA 3UORA 2XXIA 1GV8A 5L9OA 3KJ7A 3FD3A 3D4GA 1I6AA 1Y4TA 1S50A 4UA8A 4NF0A 1NV2A 4C1TA 4OVQA 3L6GA 1LFIA 1Y1MA 1IXIA 4KQPA 1YPNA 4BDOA 2I0BA 2MKZA 5B70A 2ONSA 3S9NC 1B4HA 4LVQA 2I4BA 4OESA 1HSLA 3ZKKA 1URDA 2XX7A 1KZ8A 2F7AA 2OWTA 2OLBA 4JXIA 4FATA 4NGUA 4WEPA 4NF8A 2QFLA 2QVUA 4OETA 5ITPA 2P1SA 1LCTA 5L9SA 4PGPA 2A5TB 3EHTA 4EQBA 1MH4A 1ZMGA 1MQHA 4HE0A 2HAUA 2ZYOA 1S9TA 4Q0CA 4R73A 5H8NA 3VDFA 2HZLA 5I56B 3DP8A 3K6VA 4Q30B 1AWBA 4GX6A 3SEWA 2XXVA 3DLNA 2FA7A 4HTGA 3Q27A 4NE4A 3HV1A 5I84A 5B7DA 3VV5A 1IZ1A 3U1OA 2HAVA 2X7PA 2OK2A 2I3WA 2M8CA 3DM0A 4F2QA
chains in the Genus database with same CATH topology
4RK2A 2XXYA 1MY3A 3JV9A 4DIGA 1D3KA 1NNKA 1VFEA 1WODA 5FTHA 1H43A 4R6HA 4OMBA 1LAGE 3IO6A 4MLQA 5I2NA 4ZEIA 3I3VA 3Q29A 1MQGA 1MS7A 4EUOA 2VHAA 1Y9UA 1B1HA 4X1BA 2D3IA 4PFTA 3O66A 1ZKBA 5DTBA 1N7WA 4YZZA 1MDP1 3TODA 4QFLA 3SESA 4F3SA 4YKJA 1FTLA 2FYIA 3TUSA 1OQGA 2PBWA 4K3FA 3PPOA 1P1OA 3H6TA 3RTWB 3V8XB 5L9MA 4HW8A 3HHGA 3K02A 1B58A 1MM7A 5KZTA 4GOTA 4RPOA 1B40A 5DYHA 1ZU0A 5AA1A 1NH8A 2QS1A 1LLSA 3B6WA 3EN3A 3FVNA 3FVKA 1MXUA 1S7YA 1FQBA 2HCAA 2Y84A 3H03A 1EZ9A 1QULA 1VFDA 2PMSA 3H3GA 3QXMA 3ZS6A 4F29A 3C32A 4P0IA 3UA8A 4HCYA 1ZJLA 1POY1 1PBPA 1BKAA 4ZECA 3IB2A 5H8SA 2F6PA 3R6UA 4JWOA 3RGYA 4OTEA 3FV2A 4F3PA 5J1DA 2X7QA 2XD2A 1FQFA 1DPEA 2UXAA 4RXLA 3C33A 2Z8DA 3OSQA 4LZ5A 5H8HB 3U94A 3EQ1A 4KFQA 3K00A 1IXHA 4OFOA 1B05A 5H8QA 3RY3A 4N07A 3PPRA 5TP9B 3ZKLA 1URSA 5IKBA 1P99A 1XT8A 4GL0A 1URGA 1JW5A 3DP6A 1D4NA 2D21A 5I2KB 4QSDA 3FJ7A 4PE5B 2UVJA 3IOTA 2Q2CA 4YMBA 2Y7RA 3IJOB 3TCHA 1BIYA 1D9YA 2XXQA 3UN6A 4U2RA 1O7TA 1P1UA 2RC8A 3FXUA 1PC3A 4XKPA 4F31B 3MJNA 4BDLA 5BWJA 3M3FA 2F7BA 3E3KA 3H7MA 2I49A 4F2OA 3RLFE 5CMKA 3IORA 2F97A 4H8JA 4OHNA 1MH3A 3BFTA 4H5FA 1R9LA 5TPAA 3K6UA 2PX1A 3FV1A 4H1XA 2Z8FA 4KYEA 3G3HA 4PQJA 5DVFA 4R72A 3UGWA 1BLFA 3IOVA 4DZ1A 1LB9A 4F18A 5DEXB 2DVZA 1B46A 1PBQA 2DP8A 3N6UA 3ODBA 1ATGA 2Q89A 2RCBA 3IB0A 3KSXA 3OO8A 3QUFA 3R26A 4IO7A 4LATA 4ZZEA 4EQ9A 1H45A 2O6AA 3V83A 3OO6A 4H67A 2A5TA 4LZ7A 2O68A 4RK9A 1XVYA 3VFJA 4FAJA 1JEVA 3H6UA 4MFIA 1H3DA 3EHUA 1SW5A 3EHSA 3N5LA 3SEVA 3WAEA 2QPQA 4R75A 1OIBA 3T9VA 2DSFA 1Y4CA 2CMOA 3G3KA 3PUVE 3W15C 1ELJA 2DWJA 2THIA 3HPIA 3ONMA 3IJXB 1B4ZA 2ZNUA 3U93A 1OVBA 4ZEDA 3IR1A 3PUWE 3KN7A 1T0KA 1EU8A 3IB1A 2V25A 2BJJX 4LONB 3UP9A 5DVJA 3VVDA 3HN0A 1XC1A 3O6HA 4R9GA 4XKNA 4XKQA 5AA2A 4H8IA 1A8FA 3MBPA 1NNPA 5I2NB 1GR2A 1MXWA 2I0CA 1FQAA 4FIMA 5H8FA 4XXUA 2V93A 1IITA 1R6ZA 4YKPA 4ZEKA 5CBSA 1A55A 2RCAA 3A3UA 2ZMBA 3TQLA 4U1ZA 1JW4A 2OBGA 3MP6A 4G68C 1MG1A 1B51A 4H65A 4GD5A 4KYDA 3SEYA 3USDA 1XHYA 4QSCA 1N76A 1IEJA 1MY1A 1US5A 2DWIA 3TAJA 2Q2AA 3L6GA 1B7UA 1Y1ZA 4F19A 5LOMA 4BLAA 4OQOA 2E0SA 2AYSA 3B6TA 4I1DA 4POXA 4R9FA 2O7IA 4LUBA 4ELOA 4F3GA 4QHQA 4LZ8A 1DTZA 1LAHE 3QK6A 1MY2A 3QSLA 4YICA 4OEUA 3TQWA 4C0RA 1QKBA 4JWXA 1ZTYA 1DOTA 3KOSA 2V3UA 3OO7A 2ANJA 4AB6A 1A54A 4IO6A 4IY6A 3MUQA 5F1QA 3C34A 3IK6B 3CI8A 5DT6A 3LSXA 2QL3A 1PB7A 3PD8A 5ITOA 2F36A 1I69A 1ZIUA 4KI0E 4QFOA 3LBSA 4ZS9A 5DVIA 5F7VA 1Z7ME 3FATA 2HZKA 2HXWA 3A3CA 5KCJB 1OLAA 5I57A 2DE3A 2DVCA 3G3IA 3Q28A 1MPBA 1SQYA 1SD3A 3HCQA 2I58A 3QIMA 4QFNA 3K1MA 3SDFA 3IAZA 3S9EA 1SVXB 1FQDA 2I6EA 2H25A 1DSNA 4YKKA 2PT2A 1VE4A 3CG3A 1B7ZA 4OXVA 4UACA 3U92A 1SBPA 2PYYA 3O2AA 4THIA 5AA4A 3ILUB 4KD5A 4RNSA 2LAOA 1A40A 4FEBA 1H44A 4GIZA 1Y3PA 4ONYA 4YB7A 3TFLA 3THIA 1M5BA 2DWHA 3HO7A 2O69A 5FHOA 3KSJA 4OEVA 1B5HA 5EHMA 2OWSA 3LUYA 4XKRA 3FVGA 4NF6B 1LAFE 3C4MA 3TELA 2QS2A 4OZ9A 1CE2A 3A09A 2V84A 4HS7A 1FQEA 3IX1A 3UK4A 1SI0A 1OVTA 2H99A 3QAXA 3OEMA 1MQIA 1FCKA 2F78A 2F7CA 2QJEA 2QRYA 3KN8A 4OFLA 3C36A 3FIRA 4GLIA 3PUXE 1XS5A 3F11A 3FVOA 5HPQA 1P1NA 1HSJA 2H9BA 1MXXA 4PFYA 5M2VA 4BDRA 1YCJA 5ICTA 3E9XA 3FJGA 5EHSA 1NKXA 1PB9A 2YLNA 4G8NA 4NWCA 1FTOA 3TCFA 3RPWA 3PUYE 5L8DA 3TTMA 4IO2A 4ECFA 2NVUB 1Y3QA 1XVXA 2H5YA 2DQVA 4ESWA 1MDQA 2F6GA 2VD3A 3CRBA 5I58A 2ONKE 4JB7A 1SDXA 3OOAA 4RYAA 1AH5A 4OERA 1QKAA 4QSEA 2UVIA 2ZNTA 4QFPA 3LSFB 3OSRA 4TLMB 3VVEA 1PEBA 2O1MA 3QYTA 3TTLA 4O3CA 3CFZA 2Q8JA 1OLCA 4NWDA 3PPNA 2P0SA 2Y7IA 4MBPA 2H4IA 1UTHB 2QSXA 4NTLA 4PETA 4QFKA 3PV0E 4XTCQ 4F1VA 2ZYNA 1I6BA 1R1NA 3LC8A 4PFWA 5FTIA 3M3KA 1IXGA 4X9TA 2Y7WA 3HHFA 4FE8A 1M5CA 1UIVA 1B1XA 2HFBA 2Z23A 1MXVA 1WDNA 2VGQA 3E13X 3GBBA 1POTA 2Y7KA 1QW0A 3KBRA 3Q26A 4R6KA 4U4SA 3C35A 1YTVA 2UVGA 4BDMA 1MRPA 1NH7A 1Q1KA 4X48A 5EYFA 3TEPA 3M8UA 3MC2A 4KYSA 2NWJA 3CIJA 2OJTA 4R2BA 3VLWA 3FUZA 1B3LA 4NEDA 4OFJA 1GVCA 2V3QA 3PMXA 3VXCA 3GZGA 3C9HA 5KCJA 4JWYA 4DE8A 3CFLA 3JZJA 2F8DA 2XXUA 4P0GA 3PGFA 4DCXA 2F5XA 3O6GA 5KDTA 3CFXA 2DOJA 4ZE8A 2GRVA 3U8QA 2GFEA 5CMCA 3CG1A 1B3HA 2XX9A 4IGRA 1B0HA 3TCGA 2REJA 3KOTA 3KZGA 4JDFA 3K01A 3P7IA 4RY1A 3RQTA 1NNTA 4GQOA 4H5GA 2ZXTA 1M5FA 4GXSB 4PFUA 3AXFA 4M4GA 3RN8A 3FJMA 4ESXA 1CB6A 5K2XA 4LQ2A 1FQCA 5JK4A 3TTRA 2XHDA 3EF7A 2R9JA 3I6VA 1M5EA 1SW2A 1VSOA 2NUVA 1D9VA 3BKIB 3K1PA 3MP8A 2V3TA 3CR9A 5TU0A 3SEXA 4NF4B 2OCUA 2Y7PA 4JBZA 3CVGA 1B3FA 5AA2D 4ZDMA 4DXCA 3R7XA 1IIWA 2ALUA 3PMVA 3TMGA 4U4XA 3D4CA 1GGGA 2Z22A 5I59A 1LBCA 2A5SA 2I3VA 3T22A 2F35A 1MQJA 5H8FB 4WXJA 3SEUA 2KLFA 3I5OA 1JEUA 2XXHA 4IY5A 3CSGA 3PU5A 1JVYA 2NXOA 1NL5A 3SETA 2E1SA 3O97A 2NOOA 3MZ9A 3VVFA 1B5IA 1TWYA 4DCYA 1LGBC 1NFTA 2QMXA 3OMBA 4EDPA 5DEXA 4Q8RA 1B3EA 3G3GA 4DXUA 4FECA 3UIFA 3W9VA 4EXLA 1LFGA 4I62A 1P1WA 2O51A 2X26A 1USYH 2RINA 5TPAB 1M5DA 3S9MC 3IOUA 4GRKA 5AE4A 5FHNA 5FHMA 3G7WA 4GL8A 4KR5A 1MY4A 1VR5A 2YPNA 3B7DA 3TPAA 2QS4A 4KCCA 5CRYA 4U21A 4YB5A 4ZEFA 2ABHA 3U72A 1KWHA 2O84X 3RT6B 5IAIA 4ELRA 1P1QA 3TTNA 4C1UA 3K4UA 1N3XA 4ZZAA 3GLBA 3H6WA 2P2AA 3V5AA 2FNCA 3E4RA 4F1YA 3W9WA 1AOVA 4JSDA 1XOCA 1B32A 2VD2A 1H76A 4OENA 4ELPA 1AL3A 1B7HA 1MPDA 3H4ZA 1JETA 4P11A 4R2FA 4U23A 3KG2A 4Z0IA 2QMWA 3N6TA 5CI5A 4BDNA 4GXAA 1AMFA 3RTFB 4YU0A 1MM6A 2Z8EA 4JSOA 3RUMA 5AA3A 2AIXA 4GVOA 1A7LA 3OENA 2Q88A 2UYFA 3ZSFA 3GXAA 4OWDA 4EXKA 5CM6A 2Q9TA 2WKYA 3IO4A 4NF8B 1J1NA 1MPCA 4IO3A 1TFAA 3TZAA 5TP9A 3KGCA 4H0WA 4YB6A 4TLLB 2XX8A 2GH9A 3PUZE 2H98A 5ICQA 1JQFA 3OEKA 2DXYA 1N04A 2O1LA 3K1NA 4LP2B 5JEIA 3O9PA 1N3WA 1RYXA 4AB5A 1DMBA 1IQ7A 4OYVA 4H6DA 4TQUQ 2D5WA 2UYEA 2ZYKA 3B6QA 3MP1A 4WKMA 3T9HB 4G77A 4E0WA 1B2HA 1USYE 2VP1A 3LR1A 3H6VA 3MPLA 3PPPA 1L5TA 3H06B 5I59B 4N13A 2DS9A 1II5A 4FJPA 4YKIA 2PVUA 3MPKA 5ELVA 1SI1A 4ISUA 4NF6A 1N0TA 4BDQA 3BFUA 1IUDA 2AL4A 2RC7A 1EH3A 1MXZA 3G3JA 4NF4A 5AA4B 1US4A 3MAMA 1Q35A 1GTKA 4G8MA 3S2VA 3UORA 1QVSA 4G2ZA 2XXIA 3MW0A 3T9XB 4AQ4A 3KFMA 1LSTA 3MVXA 3M3LA 1GV8A 3OO9A 3K6XA 5L9OA 3KJ7A 1LBBA 4F22A 3FD3A 1A8EA 2DYXA 3N94A 1MXYA 4TOZA 4ELQA 1SW4A 2R71A 3D4GA 3S9LC 3TTKA 4N6PA 4F39A 4M1VA 3T93B 3IL1B 3VE1B 4XIGQ 2B3BA 2DXRA 1I6AA 1Y4TA 4G8HA 4G68A 3C31A 4DXBA 3Q25A 2G29A 4IO4A 2AL5A 2XD3A 3EPEA 2RF1A 3FXRA 2XXXA 3PPQA 1S50A 4NMYA 4UA8A 1AIVA 1N7XA 4Q5TA 4U22A 5JTYA 1SYIA 3V89B 3T96B 1OMPA 4G68B 4C1TA 1Z7NE 4QRZA 1B5JA 1DPPA 1O64A 2DWAA 2VOZA 2CZLA 3KN3A 2GHAA 1LFIA 1Y1MA 1IXIA 4KHZE 4KQPA 3S4UA 1EZPA 1R9QA 1Y3NA 5CMBA 1YPNA 1B3GA 1DTGA 1PDAA 1UIUA 2XXPA 3K2DA 4Z7EA 3VLVA 4QF9A 5AA2B 1UQWA 4I8CA 3VLUA 4BDOA 1TXFA 1I6QA 1HSEA 2I0BA 4HCWA 4MLVA 1NNFA 1ANFA 1YAEA 2I4CA 4EQ7A 5KDTB 1RYOA 3OELA 2QS3A 5JTYB 1UTBA 5CC2A 1LFHA 4GFRA 3MQ9A 4KPTA 1SYHA 3L6HA 3TDJA 4RA1A 1LB8A 4IB2A 2XXRA 1EZOA 5B70A 1WVJA 2ONSA 5K2YA 4F1UA 1RKMA 3S9NC 1B0LA 3MZBA 3FASA 4NF5B 4E0XA 1OQHA 1B4HA 1JVXA 4LVQA 5A5XB 1B52A 2I4BA 2DE2A 3TKDA 1LCFA 5H8NB 2I48A 3PD9A 4X1DA 2GHBA 4OESA 1HSLA 3T9UA 4R74A 3WAFA 1QUIA 1URDA 2UVHA 2B3FA 2XX7A 3ZKKA 4EF2A 2F7AA 3VXBA 1Y20A 2OWTA 1UTHA 2PT1A 2OLBA 2ESNA 4RJZA 2RC9A 2XXTA 3FGSA 3K6WA 4JXIA 4WEDA 4FATA 5I56A 4WEPA 4NF8A 4PP0A 4LA9A 5CBRA 3JYRA 4OETA 4DLDA 4FEDA 4O3AA 4F3BA 5ITPA 2P1SA 1FTJA 1NMUA 3O6IA 1LCTA 2XXWA 5I58B 3N26A 5L9SA 1PB8A 3HSTA 1TT1A 2A5TB 3EHTA 3LSWA 2G93A 5BUUA 3ECRA 4EQBA 1MH4A 4ND9A 1ZMGA 4ZEBA 3TYHA 4GF8A 4IO5A 1MQHA 2DE4A 2HEUA 3LSLA 3MVWA 5I2KA 4L17A 3O28A 1FTMA 1FW0A 2HAUA 1S9TA 2ZYOA 3K0VA 3OD7A 4POWA 5I57B 3T66A 1LAXA 3O29A 4Q0CA 4R73A 4U1OA 5H8NA 1BP5A 3GBAA 2R6GE 1IXCA 3IOWA 3VDFA 1QJMA 4O3BA 5ISUA 5HBCA 1MY0A 3DELB 3PMWA 5A5XA 2REGA 4KCDA 2OZZA 4OVJA 5H8QB 1JW1A 3BBRA 2HQ0A 4NF5A 1O63A 2O7UA 4DDDA 1BTJA 1ZBMA 5H8HA 2HZLA 3SKPA 1B9JA 2RKMA 3CSBA 3DP8A 5I56B 1B6HA 1MQDA 3K6VA 1F9BA 4Q30B 4YMAA 4ZE9A 1QUKA 3MZ1A 3SEWA 3ILTB 5HM4B 2XXVA 2W7YA 3DLNA 2FA7A 4HTGA 4YAHX 4LQ5A 2YJPA 4FORA 4MF3A 3Q27A 1SW1A 1A99A 4NE4A 4I9DA 3HV1A 3RNNA 4RPNA 5I84A 3FXQA 3KEIA 3QUJA 3DP4A 2ONRA 3FZVA 3VV5A 4EF1A 5B7DA 1ZLQA 4G4PA 4MH5A 1IZ1A 1N84A 1QUJA 3U1OA 2HAVA 3RT8A 1JNFA 2X7PA 2F34A 3OXNA 4R6YA 2OK2A 3G3FA 3KJTA 2I3WA 2ZNSA 1TFDA 2B65A 2M8CA 2ZYMA 3MWBA 1FTKA 3MVZA 3DM0A 4GWOA 1UTBB 2IEEA 3MVYA 4IGTA 2IA4A 3SERA 4F2QA 5CMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RK2 A;  2XXY A;  1MY3 A;  3JV9 A;  4DIG A;  1D3K A;  1NNK A;  1VFE A;  1WOD A;  5FTH A;  1H43 A;  4R6H A;  4OMB A;  1LAG E;  3IO6 A;  4MLQ A;  5I2N A;  4ZEI A;  3I3V A;  3Q29 A;  1MQG A;  1MS7 A;  4EUO A;  2VHA A;  1Y9U A;  1B1H A;  4X1B A;  2D3I A;  4PFT A;  3O66 A;  1ZKB A;  5DTB A;  1N7W A;  4YZZ A;  1MDP 1;  3TOD A;  4QFL A;  3SES A;  4F3S A;  4YKJ A;  1FTL A;  2FYI A;  3TUS A;  1OQG A;  2PBW A;  4K3F A;  3PPO A;  1P1O A;  3H6T A;  3RTW B;  3V8X B;  5L9M A;  4HW8 A;  3HHG A;  3K02 A;  1B58 A;  1MM7 A;  5KZT A;  4GOT A;  4RPO A;  1B40 A;  5DYH A;  1ZU0 A;  5AA1 A;  1NH8 A;  2QS1 A;  1LLS A;  3B6W A;  3EN3 A;  3FVN A;  3FVK A;  1MXU A;  1S7Y A;  1FQB A;  2HCA A;  2Y84 A;  3H03 A;  1EZ9 A;  1QUL A;  1VFD A;  2PMS A;  3H3G A;  3QXM A;  3ZS6 A;  4F29 A;  3C32 A;  4P0I A;  3UA8 A;  4HCY A;  1ZJL A;  1POY 1;  1PBP A;  1BKA A;  4ZEC A;  3IB2 A;  5H8S A;  2F6P A;  3R6U A;  4JWO A;  3RGY A;  4OTE A;  3FV2 A;  4F3P A;  5J1D A;  2X7Q A;  2XD2 A;  1FQF A;  1DPE A;  2UXA A;  4RXL A;  3C33 A;  2Z8D A;  3OSQ A;  4LZ5 A;  5H8H B;  3U94 A;  3EQ1 A;  4KFQ A;  3K00 A;  1IXH A;  4OFO A;  1B05 A;  5H8Q A;  3RY3 A;  4N07 A;  3PPR A;  5TP9 B;  3ZKL A;  1URS A;  5IKB A;  1P99 A;  1XT8 A;  4GL0 A;  1URG A;  1JW5 A;  3DP6 A;  1D4N A;  2D21 A;  5I2K B;  4QSD A;  3FJ7 A;  4PE5 B;  2UVJ A;  3IOT A;  2Q2C A;  4YMB A;  2Y7R A;  3IJO B;  3TCH A;  1BIY A;  1D9Y A;  2XXQ A;  3UN6 A;  4U2R A;  1O7T A;  1P1U A;  2RC8 A;  3FXU A;  1PC3 A;  4XKP A;  4F31 B;  3MJN A;  4BDL A;  5BWJ A;  3M3F A;  2F7B A;  3E3K A;  3H7M A;  2I49 A;  4F2O A;  3RLF E;  5CMK A;  3IOR A;  2F97 A;  4H8J A;  4OHN A;  1MH3 A;  3BFT A;  4H5F A;  1R9L A;  5TPA A;  3K6U A;  2PX1 A;  3FV1 A;  4H1X A;  2Z8F A;  4KYE A;  3G3H A;  4PQJ A;  5DVF A;  4R72 A;  3UGW A;  1BLF A;  3IOV A;  4DZ1 A;  1LB9 A;  4F18 A;  5DEX B;  2DVZ A;  1B46 A;  1PBQ A;  2DP8 A;  3N6U A;  3ODB A;  1ATG A;  2Q89 A;  2RCB A;  3IB0 A;  3KSX A;  3OO8 A;  3QUF A;  3R26 A;  4IO7 A;  4LAT A;  4ZZE A;  4EQ9 A;  1H45 A;  2O6A A;  3V83 A;  3OO6 A;  4H67 A;  2A5T A;  4LZ7 A;  2O68 A;  4RK9 A;  1XVY A;  3VFJ A;  4FAJ A;  1JEV A;  3H6U A;  4MFI A;  1H3D A;  3EHU A;  1SW5 A;  3EHS A;  3N5L A;  3SEV A;  3WAE A;  2QPQ A;  4R75 A;  1OIB A;  3T9V A;  2DSF A;  1Y4C A;  2CMO A;  3G3K A;  3PUV E;  3W15 C;  1ELJ A;  2DWJ A;  2THI A;  3HPI A;  3ONM A;  3IJX B;  1B4Z A;  2ZNU A;  3U93 A;  1OVB A;  4ZED A;  3IR1 A;  3PUW E;  3KN7 A;  1T0K A;  1EU8 A;  3IB1 A;  2V25 A;  2BJJ X;  4LON B;  3UP9 A;  5DVJ A;  3VVD A;  3HN0 A;  1XC1 A;  3O6H A;  4R9G A;  4XKN A;  4XKQ A;  5AA2 A;  4H8I A;  1A8F A;  3MBP A;  1NNP A;  5I2N B;  1GR2 A;  1MXW A;  2I0C A;  1FQA A;  4FIM A;  5H8F A;  4XXU A;  2V93 A;  1IIT A;  1R6Z A;  4YKP A;  4ZEK A;  5CBS A;  1A55 A;  2RCA A;  3A3U A;  2ZMB A;  3TQL A;  4U1Z A;  1JW4 A;  2OBG A;  3MP6 A;  4G68 C;  1MG1 A;  1B51 A;  4H65 A;  4GD5 A;  4KYD A;  3SEY A;  3USD A;  1XHY A;  4QSC A;  1N76 A;  1IEJ A;  1MY1 A;  1US5 A;  2DWI A;  3TAJ A;  2Q2A A;  3L6G A;  1B7U A;  1Y1Z A;  4F19 A;  5LOM A;  4BLA A;  4OQO A;  2E0S A;  2AYS A;  3B6T A;  4I1D A;  4POX A;  4R9F A;  2O7I A;  4LUB A;  4ELO A;  4F3G A;  4QHQ A;  4LZ8 A;  1DTZ A;  1LAH E;  3QK6 A;  1MY2 A;  3QSL A;  4YIC A;  4OEU A;  3TQW A;  4C0R A;  1QKB A;  4JWX A;  1ZTY A;  1DOT A;  3KOS A;  2V3U A;  3OO7 A;  2ANJ A;  4AB6 A;  1A54 A;  4IO6 A;  4IY6 A;  3MUQ A;  5F1Q A;  3C34 A;  3IK6 B;  3CI8 A;  5DT6 A;  3LSX A;  2QL3 A;  1PB7 A;  3PD8 A;  5ITO A;  2F36 A;  1I69 A;  1ZIU A;  4KI0 E;  4QFO A;  3LBS A;  4ZS9 A;  5DVI A;  5F7V A;  1Z7M E;  3FAT A;  2HZK A;  2HXW A;  3A3C A;  5KCJ B;  1OLA A;  5I57 A;  2DE3 A;  2DVC A;  3G3I A;  3Q28 A;  1MPB A;  1SQY A;  1SD3 A;  3HCQ A;  2I58 A;  3QIM A;  4QFN A;  3K1M A;  3SDF A;  3IAZ A;  3S9E A;  1SVX B;  1FQD A;  2I6E A;  2H25 A;  1DSN A;  4YKK A;  2PT2 A;  1VE4 A;  3CG3 A;  1B7Z A;  4OXV A;  4UAC A;  3U92 A;  1SBP A;  2PYY A;  3O2A A;  4THI A;  5AA4 A;  3ILU B;  4KD5 A;  4RNS A;  2LAO A;  1A40 A;  4FEB A;  1H44 A;  4GIZ A;  1Y3P A;  4ONY A;  4YB7 A;  3TFL A;  3THI A;  1M5B A;  2DWH A;  3HO7 A;  2O69 A;  5FHO A;  3KSJ A;  4OEV A;  1B5H A;  5EHM A;  2OWS A;  3LUY A;  4XKR A;  3FVG A;  4NF6 B;  1LAF E;  3C4M A;  3TEL A;  2QS2 A;  4OZ9 A;  1CE2 A;  3A09 A;  2V84 A;  4HS7 A;  1FQE A;  3IX1 A;  3UK4 A;  1SI0 A;  1OVT A;  2H99 A;  3QAX A;  3OEM A;  1MQI A;  1FCK A;  2F78 A;  2F7C A;  2QJE A;  2QRY A;  3KN8 A;  4OFL A;  3C36 A;  3FIR A;  4GLI A;  3PUX E;  1XS5 A;  3F11 A;  3FVO A;  5HPQ A;  1P1N A;  1HSJ A;  2H9B A;  1MXX A;  4PFY A;  5M2V A;  4BDR A;  1YCJ A;  5ICT A;  3E9X A;  3FJG A;  5EHS A;  1NKX A;  1PB9 A;  2YLN A;  4G8N A;  4NWC A;  1FTO A;  3TCF A;  3RPW A;  3PUY E;  5L8D A;  3TTM A;  4IO2 A;  4ECF A;  2NVU B;  1Y3Q A;  1XVX A;  2H5Y A;  2DQV A;  4ESW A;  1MDQ A;  2F6G A;  2VD3 A;  3CRB A;  5I58 A;  2ONK E;  4JB7 A;  1SDX A;  3OOA A;  4RYA A;  1AH5 A;  4OER A;  1QKA A;  4QSE A;  2UVI A;  2ZNT A;  4QFP A;  3LSF B;  3OSR A;  4TLM B;  3VVE A;  1PEB A;  2O1M A;  3QYT A;  3TTL A;  4O3C A;  3CFZ A;  2Q8J A;  1OLC A;  4NWD A;  3PPN A;  2P0S A;  2Y7I A;  4MBP A;  2H4I A;  1UTH B;  2QSX A;  4NTL A;  4PET A;  4QFK A;  3PV0 E;  4XTC Q;  4F1V A;  2ZYN A;  1I6B A;  1R1N A;  3LC8 A;  4PFW A;  5FTI A;  3M3K A;  1IXG A;  4X9T A;  2Y7W A;  3HHF A;  4FE8 A;  1M5C A;  1UIV A;  1B1X A;  2HFB A;  2Z23 A;  1MXV A;  1WDN A;  2VGQ A;  3E13 X;  3GBB A;  1POT A;  2Y7K A;  1QW0 A;  3KBR A;  3Q26 A;  4R6K A;  4U4S A;  3C35 A;  1YTV A;  2UVG A;  4BDM A;  1MRP A;  1NH7 A;  1Q1K A;  4X48 A;  5EYF A;  3TEP A;  3M8U A;  3MC2 A;  4KYS A;  2NWJ A;  3CIJ A;  2OJT A;  4R2B A;  3VLW A;  3FUZ A;  1B3L A;  4NED A;  4OFJ A;  1GVC A;  2V3Q A;  3PMX A;  3VXC A;  3GZG A;  3C9H A;  5KCJ A;  4JWY A;  4DE8 A;  3CFL A;  3JZJ A;  2F8D A;  2XXU A;  4P0G A;  3PGF A;  4DCX A;  2F5X A;  3O6G A;  5KDT A;  3CFX A;  2DOJ A;  4ZE8 A;  2GRV A;  3U8Q A;  2GFE A;  5CMC A;  3CG1 A;  1B3H A;  2XX9 A;  4IGR A;  1B0H A;  3TCG A;  2REJ A;  3KOT A;  3KZG A;  4JDF A;  3K01 A;  3P7I A;  4RY1 A;  3RQT A;  1NNT A;  4GQO A;  4H5G A;  2ZXT A;  1M5F A;  4GXS B;  4PFU A;  3AXF A;  4M4G A;  3RN8 A;  3FJM A;  4ESX A;  1CB6 A;  5K2X A;  4LQ2 A;  1FQC A;  5JK4 A;  3TTR A;  2XHD A;  3EF7 A;  2R9J A;  3I6V A;  1M5E A;  1SW2 A;  1VSO A;  2NUV A;  1D9V A;  3BKI B;  3K1P A;  3MP8 A;  2V3T A;  3CR9 A;  5TU0 A;  3SEX A;  4NF4 B;  2OCU A;  2Y7P A;  4JBZ A;  3CVG A;  1B3F A;  5AA2 D;  4ZDM A;  4DXC A;  3R7X A;  1IIW A;  2ALU A;  3PMV A;  3TMG A;  4U4X A;  3D4C A;  1GGG A;  2Z22 A;  5I59 A;  1LBC A;  2A5S A;  2I3V A;  3T22 A;  2F35 A;  1MQJ A;  5H8F B;  4WXJ A;  3SEU A;  2KLF A;  3I5O A;  1JEU A;  2XXH A;  4IY5 A;  3CSG A;  3PU5 A;  1JVY A;  2NXO A;  1NL5 A;  3SET A;  2E1S A;  3O97 A;  2NOO A;  3MZ9 A;  3VVF A;  1B5I A;  1TWY A;  4DCY A;  1LGB C;  1NFT A;  2QMX A;  3OMB A;  4EDP A;  5DEX A;  4Q8R A;  1B3E A;  3G3G A;  4DXU A;  4FEC A;  3UIF A;  3W9V A;  4EXL A;  1LFG A;  4I62 A;  1P1W A;  2O51 A;  2X26 A;  1USY H;  2RIN A;  5TPA B;  1M5D A;  3S9M C;  3IOU A;  4GRK A;  5AE4 A;  5FHN A;  5FHM A;  3G7W A;  4GL8 A;  4KR5 A;  1MY4 A;  1VR5 A;  2YPN A;  3B7D A;  3TPA A;  2QS4 A;  4KCC A;  5CRY A;  4U21 A;  4YB5 A;  4ZEF A;  2ABH A;  3U72 A;  1KWH A;  2O84 X;  3RT6 B;  5IAI A;  4ELR A;  1P1Q A;  3TTN A;  4C1U A;  3K4U A;  1N3X A;  4ZZA A;  3GLB A;  3H6W A;  2P2A A;  3V5A A;  2FNC A;  3E4R A;  4F1Y A;  3W9W A;  1AOV A;  4JSD A;  1XOC A;  1B32 A;  2VD2 A;  1H76 A;  4OEN A;  4ELP A;  1AL3 A;  1B7H A;  1MPD A;  3H4Z A;  1JET A;  4P11 A;  4R2F A;  4U23 A;  3KG2 A;  4Z0I A;  2QMW A;  3N6T A;  5CI5 A;  4BDN A;  4GXA A;  1AMF A;  3RTF B;  4YU0 A;  1MM6 A;  2Z8E A;  4JSO A;  3RUM A;  5AA3 A;  2AIX A;  4GVO A;  1A7L A;  3OEN A;  2Q88 A;  2UYF A;  3ZSF A;  3GXA A;  4OWD A;  4EXK A;  5CM6 A;  2Q9T A;  2WKY A;  3IO4 A;  4NF8 B;  1J1N A;  1MPC A;  4IO3 A;  1TFA A;  3TZA A;  5TP9 A;  3KGC A;  4H0W A;  4YB6 A;  4TLL B;  2XX8 A;  2GH9 A;  3PUZ E;  2H98 A;  5ICQ A;  1JQF A;  3OEK A;  2DXY A;  1N04 A;  2O1L A;  3K1N A;  4LP2 B;  5JEI A;  3O9P A;  1N3W A;  1RYX A;  4AB5 A;  1DMB A;  1IQ7 A;  4OYV A;  4H6D A;  4TQU Q;  2D5W A;  2UYE A;  2ZYK A;  3B6Q A;  3MP1 A;  4WKM A;  3T9H B;  4G77 A;  4E0W A;  1B2H A;  1USY E;  2VP1 A;  3LR1 A;  3H6V A;  3MPL A;  3PPP A;  1L5T A;  3H06 B;  5I59 B;  4N13 A;  2DS9 A;  1II5 A;  4FJP A;  4YKI A;  2PVU A;  3MPK A;  5ELV A;  1SI1 A;  4ISU A;  4NF6 A;  1N0T A;  4BDQ A;  3BFU A;  1IUD A;  2AL4 A;  2RC7 A;  1EH3 A;  1MXZ A;  3G3J A;  4NF4 A;  5AA4 B;  1US4 A;  3MAM A;  1Q35 A;  1GTK A;  4G8M A;  3S2V A;  3UOR A;  1QVS A;  4G2Z A;  2XXI A;  3MW0 A;  3T9X B;  4AQ4 A;  3KFM A;  1LST A;  3MVX A;  3M3L A;  1GV8 A;  3OO9 A;  3K6X A;  5L9O A;  3KJ7 A;  1LBB A;  4F22 A;  3FD3 A;  1A8E A;  2DYX A;  3N94 A;  1MXY A;  4TOZ A;  4ELQ A;  1SW4 A;  2R71 A;  3D4G A;  3S9L C;  3TTK A;  4N6P A;  4F39 A;  4M1V A;  3T93 B;  3IL1 B;  3VE1 B;  4XIG Q;  2B3B A;  2DXR A;  1I6A A;  1Y4T A;  4G8H A;  4G68 A;  3C31 A;  4DXB A;  3Q25 A;  2G29 A;  4IO4 A;  2AL5 A;  2XD3 A;  3EPE A;  2RF1 A;  3FXR A;  2XXX A;  3PPQ A;  1S50 A;  4NMY A;  4UA8 A;  1AIV A;  1N7X A;  4Q5T A;  4U22 A;  5JTY A;  1SYI A;  3V89 B;  3T96 B;  1OMP A;  4G68 B;  4C1T A;  1Z7N E;  4QRZ A;  1B5J A;  1DPP A;  1O64 A;  2DWA A;  2VOZ A;  2CZL A;  3KN3 A;  2GHA A;  1LFI A;  1Y1M A;  1IXI A;  4KHZ E;  4KQP A;  3S4U A;  1EZP A;  1R9Q A;  1Y3N A;  5CMB A;  1YPN A;  1B3G A;  1DTG A;  1PDA A;  1UIU A;  2XXP A;  3K2D A;  4Z7E A;  3VLV A;  4QF9 A;  5AA2 B;  1UQW A;  4I8C A;  3VLU A;  4BDO A;  1TXF A;  1I6Q A;  1HSE A;  2I0B A;  4HCW A;  4MLV A;  1NNF A;  1ANF A;  1YAE A;  2I4C A;  4EQ7 A;  5KDT B;  1RYO A;  3OEL A;  2QS3 A;  5JTY B;  1UTB A;  5CC2 A;  1LFH A;  4GFR A;  3MQ9 A;  4KPT A;  1SYH A;  3L6H A;  3TDJ A;  4RA1 A;  1LB8 A;  4IB2 A;  2XXR A;  1EZO A;  5B70 A;  1WVJ A;  2ONS A;  5K2Y A;  4F1U A;  1RKM A;  3S9N C;  1B0L A;  3MZB A;  3FAS A;  4NF5 B;  4E0X A;  1OQH A;  1B4H A;  1JVX A;  4LVQ A;  5A5X B;  1B52 A;  2I4B A;  2DE2 A;  3TKD A;  1LCF A;  5H8N B;  2I48 A;  3PD9 A;  4X1D A;  2GHB A;  4OES A;  1HSL A;  3T9U A;  4R74 A;  3WAF A;  1QUI A;  1URD A;  2UVH A;  2B3F A;  2XX7 A;  3ZKK A;  4EF2 A;  2F7A A;  3VXB A;  1Y20 A;  2OWT A;  1UTH A;  2PT1 A;  2OLB A;  2ESN A;  4RJZ A;  2RC9 A;  2XXT A;  3FGS A;  3K6W A;  4JXI A;  4WED A;  4FAT A;  5I56 A;  4WEP A;  4NF8 A;  4PP0 A;  4LA9 A;  5CBR A;  3JYR A;  4OET A;  4DLD A;  4FED A;  4O3A A;  4F3B A;  5ITP A;  2P1S A;  1FTJ A;  1NMU A;  3O6I A;  1LCT A;  2XXW A;  5I58 B;  3N26 A;  5L9S A;  1PB8 A;  3HST A;  1TT1 A;  2A5T B;  3EHT A;  3LSW A;  2G93 A;  5BUU A;  3ECR A;  4EQB A;  1MH4 A;  4ND9 A;  1ZMG A;  4ZEB A;  3TYH A;  4GF8 A;  4IO5 A;  1MQH A;  2DE4 A;  2HEU A;  3LSL A;  3MVW A;  5I2K A;  4L17 A;  3O28 A;  1FTM A;  1FW0 A;  2HAU A;  1S9T A;  2ZYO A;  3K0V A;  3OD7 A;  4POW A;  5I57 B;  3T66 A;  1LAX A;  3O29 A;  4Q0C A;  4R73 A;  4U1O A;  5H8N A;  1BP5 A;  3GBA A;  2R6G E;  1IXC A;  3IOW A;  3VDF A;  1QJM A;  4O3B A;  5ISU A;  5HBC A;  1MY0 A;  3DEL B;  3PMW A;  5A5X A;  2REG A;  4KCD A;  2OZZ A;  4OVJ A;  5H8Q B;  1JW1 A;  3BBR A;  2HQ0 A;  4NF5 A;  1O63 A;  2O7U A;  4DDD A;  1BTJ A;  1ZBM A;  5H8H A;  2HZL A;  3SKP A;  1B9J A;  2RKM A;  3CSB A;  3DP8 A;  5I56 B;  1B6H A;  1MQD A;  3K6V A;  1F9B A;  4Q30 B;  4YMA A;  4ZE9 A;  1QUK A;  3MZ1 A;  3SEW A;  3ILT B;  5HM4 B;  2XXV A;  2W7Y A;  3DLN A;  2FA7 A;  4HTG A;  4YAH X;  4LQ5 A;  2YJP A;  4FOR A;  4MF3 A;  3Q27 A;  1SW1 A;  1A99 A;  4NE4 A;  4I9D A;  3HV1 A;  3RNN A;  4RPN A;  5I84 A;  3FXQ A;  3KEI A;  3QUJ A;  3DP4 A;  2ONR A;  3FZV A;  3VV5 A;  4EF1 A;  5B7D A;  1ZLQ A;  4G4P A;  4MH5 A;  1IZ1 A;  1N84 A;  1QUJ A;  3U1O A;  2HAV A;  3RT8 A;  1JNF A;  2X7P A;  2F34 A;  3OXN A;  4R6Y A;  2OK2 A;  3G3F A;  3KJT A;  2I3W A;  2ZNS A;  1TFD A;  2B65 A;  2M8C A;  2ZYM A;  3MWB A;  1FTK A;  3MVZ A;  3DM0 A;  4GWO A;  1UTB B;  2IEE A;  3MVY A;  4IGT A;  2IA4 A;  3SER A;  4F2Q A;  5CMM A; 
#chains in the Genus database with same CATH topology
 4LN5 A;  1MY3 A;  1D3K A;  3A29 A;  1RDZ A;  2P3V A;  1MS7 A;  4EUO A;  1B1H A;  4PFT A;  1MDP 1;  2WBB A;  4O94 A;  4QFL A;  1FTL A;  3RTW B;  4HW8 A;  3K02 A;  5DYH A;  1ZU0 A;  1NH8 A;  3FVN A;  3QIM A;  4LQ5 A;  3S9E A;  3FVK A;  1MXU A;  1FQB A;  2Y84 A;  3H03 A;  4F29 A;  1QUL A;  2PMS A;  3H3G A;  3C32 A;  1ZJL A;  3IB2 A;  2F6P A;  3RGY A;  3FV2 A;  3OSQ A;  4LZ5 A;  3U94 A;  2V4C A;  3LUZ A;  5TP9 B;  3ZKL A;  3DP6 A;  5I2K B;  3FJ7 A;  1IMF A;  2Q2C A;  3IJO B;  3TCH A;  1D9Y A;  4F31 B;  2F7B A;  4EQ7 A;  2F97 A;  4OHN A;  4ZE9 A;  4PQJ A;  1VDW A;  1BLF A;  5EQ8 A;  4F18 A;  1B46 A;  1PBQ A;  4QRZ A;  1ATG A;  1H45 A;  4RK9 A;  3VFJ A;  4MFI A;  4N6D A;  1SW5 A;  3WAE A;  2QPQ A;  5ET8 A;  1Y4C A;  1NUX A;  3HPI A;  2THI A;  3IJX B;  5ESY A;  3U93 A;  1EU8 A;  4FBP A;  5DVJ A;  4R9G A;  4XKN A;  2I0C A;  1K9Y A;  4XXU A;  1R6Z A;  3A3U A;  2Q8M A;  4KYD A;  4X8R A;  1FPK A;  1IEJ A;  1MY1 A;  3U65 A;  4BLA A;  2AYS A;  3B6T A;  4R9F A;  4LZ8 A;  3MST A;  3QK6 A;  1MY2 A;  3TQW A;  4C0R A;  4OEU A;  1ZTY A;  1DOT A;  2V3U A;  1A54 A;  5F1Q A;  3C34 A;  5ITO A;  1SD3 A;  2I58 A;  3K1M A;  2I6E A;  1LBY A;  4UAC A;  4OXV A;  3ILU B;  4KD5 A;  2LAO A;  1A40 A;  4FEB A;  3TFL A;  4YB7 A;  5FHO A;  2OWS A;  1EYK A;  3MYU A;  4NF6 B;  4HXV A;  1CE2 A;  3A09 A;  2V84 A;  4HS7 A;  3B8B A;  3UK4 A;  1SI0 A;  3QAX A;  3OEM A;  1FCK A;  4E0W A;  2H9B A;  1MXX A;  3E9X A;  3FBP A;  4G8N A;  3TCF A;  3PUY E;  4ECF A;  2VD3 A;  2ONK E;  1QKA A;  2ZNT A;  3BIG A;  1OLC A;  4NWD A;  1UTH B;  1I6B A;  1UIV A;  2UVG A;  1NH7 A;  5EYF A;  4NX1 A;  3CIJ A;  2OJT A;  4R2B A;  3FUZ A;  2L5V A;  5KCJ A;  2V3Q A;  3JZJ A;  1NUZ A;  4P0G A;  4MNI A;  2F5X A;  2DOJ A;  4ZE8 A;  2GRV A;  2GFE A;  2XX9 A;  2REJ A;  3P7I A;  4H5G A;  2XA5 A;  1M5F A;  4PFU A;  4M4G A;  2R8T A;  3RN8 A;  5JK4 A;  1FQC A;  3MUQ A;  3MP8 A;  3PMV A;  2HPG A;  2Z22 A;  2I3V A;  2CEY A;  2F35 A;  1MQJ A;  3SEU A;  2XXH A;  4IY5 A;  1JVY A;  1NL5 A;  3SET A;  2NOO A;  1LGB C;  3OMB A;  4EDP A;  3IFC A;  5DEX A;  3G3G A;  4EXL A;  4DI3 D;  1USY H;  2RIN A;  5TPA B;  4PAF A;  4KCC A;  3PTY A;  3H6W A;  4JSD A;  2B4L A;  1B7H A;  2FVZ A;  4P11 A;  1JET A;  3KG2 A;  5CI5 A;  4JSO A;  5AA3 A;  1A7L A;  3OEN A;  2UYF A;  5CM6 A;  4OWD A;  2WKY A;  4NF8 B;  1MPC A;  4YB6 A;  2GH9 A;  5ICQ A;  4LP2 B;  3O9P A;  1IQ7 A;  4OYV A;  4G77 A;  3MPL A;  3H6V A;  3PPP A;  4MIJ A;  1L5T A;  3H06 B;  2DS9 A;  4XFE A;  4YKI A;  1SI1 A;  1RDX A;  1MXZ A;  2XWO A;  3G3J A;  1US4 A;  4G8M A;  1GTK A;  4G2Z A;  1LST A;  3MVX A;  3M3L A;  4AS5 A;  3K6X A;  1LBB A;  2DYX A;  4TOZ A;  4ELQ A;  2XWK A;  1NI9 A;  3TTK A;  4G8H A;  4G68 A;  3C31 A;  4DXB A;  3Q25 A;  1FPI A;  2XXX A;  4NMY A;  1YYZ A;  2VPN A;  4JVC A;  1N7X A;  1SYI A;  3T96 B;  1OMP A;  3LV0 A;  1DPP A;  4I3E A;  2CZL A;  5CMB A;  3RPL A;  3VLV A;  1UQW A;  3VLU A;  1TXF A;  3B50 A;  5KDT B;  1UTB A;  4JVI A;  3TDJ A;  4IB2 A;  1EZO A;  4GBW A;  4MNP A;  1RKM A;  3MZB A;  4E0X A;  1B52 A;  2DE2 A;  3T9U A;  1QUI A;  2B3F A;  4OVT A;  4EF2 A;  3VXB A;  1Y20 A;  1NUW A;  1UTH A;  2PT1 A;  3FGS A;  2WYK A;  4WED A;  4PP0 A;  4DLD A;  4FED A;  4O3A A;  2XXW A;  5I58 B;  1PB8 A;  3HST A;  1TT1 A;  3LSW A;  3ECR A;  1IMC A;  3LSL A;  3MVW A;  5I2K A;  4POW A;  5I57 B;  3T66 A;  4OAN A;  4U1O A;  2R6G E;  1QJM A;  1MY0 A;  3DEL B;  4KCD A;  4OVJ A;  5H8Q B;  2Y5K A;  2HQ0 A;  4NF5 A;  4DDD A;  1EYJ A;  2O7U A;  1B6H A;  1F9B A;  4YMA A;  4PC9 A;  4YAH X;  4MF3 A;  1SW1 A;  3GYY A;  4GWX A;  2B4M A;  2P3N A;  3FXQ A;  2ONR A;  3OXN A;  3G3F A;  4PDD A;  3MWB A;  4QSC A;  2IA4 A;  2XXY A;  3JV9 A;  2VPO A;  4DIG A;  1WOD A;  2XXK A;  4MLQ A;  5I2N A;  1MQG A;  4PBQ A;  2D3I A;  3TOD A;  4YKJ A;  2PFZ A;  2FYI A;  2ZZX A;  4PFR A;  1MM7 A;  5KZT A;  4RPO A;  3B6W A;  2QS1 A;  3OO9 A;  2HCA A;  1AOV A;  1EZ9 A;  4P0I A;  3UA8 A;  5H8S A;  3D1R A;  4JWO A;  2XD2 A;  1FQF A;  1DPE A;  4OVS A;  3C33 A;  4QXD A;  4KFQ A;  3K00 A;  4OFO A;  1B05 A;  3PPR A;  4PGN A;  4MNC A;  1URS A;  4GL0 A;  1JW5 A;  2F3D A;  3IOT A;  2VT5 A;  4YMB A;  3UN6 A;  4U2R A;  3FXU A;  1P1U A;  1IMD A;  4JVD A;  4F2O A;  3RLF E;  1MH3 A;  4H5F A;  3K6U A;  2PX1 A;  4KYE A;  5DVF A;  4DZ1 A;  3IOV A;  5ET7 A;  2DP8 A;  3ODB A;  3OO8 A;  3QUF A;  4IO7 A;  3R26 A;  3V83 A;  2Q74 A;  1DK4 A;  2O6A A;  3OO6 A;  4H67 A;  2O68 A;  1JEV A;  3H6U A;  1KA1 A;  3FXB A;  1H3D A;  2QVV A;  3N5L A;  5J16 A;  3T9V A;  2DSF A;  3ONM A;  2DWJ A;  2ZNU A;  4KXP A;  3IB1 A;  3VVD A;  3KBZ A;  1A8F A;  2HXR A;  1NNP A;  1GR2 A;  4NG7 A;  4FIM A;  4YKP A;  5ET5 A;  1JW4 A;  3MP6 A;  1XHY A;  1N76 A;  2DWI A;  2Q2A A;  5LOM A;  2O7I A;  4ELO A;  4YIC A;  3OO7 A;  2QL3 A;  5EQ7 A;  5F7V A;  5DVI A;  3FAT A;  2HZK A;  3A3C A;  1OLA A;  2DE3 A;  2DVC A;  1MPB A;  3HCQ A;  1LBZ A;  3IAZ A;  1SVX B;  4P1L A;  1DSN A;  2PT2 A;  1VE4 A;  1B7Z A;  5AA4 A;  1H44 A;  1M5B A;  5EHM A;  4XKR A;  3T0J A;  1FPB A;  1FQE A;  1YXI A;  4P9K A;  1MQI A;  2F78 A;  3C36 A;  3FIR A;  1XS5 A;  1HSJ A;  5M2V A;  4BDR A;  4PAK A;  5ICT A;  3FJG A;  1NKX A;  1PB9 A;  1FTO A;  5IZ3 A;  3TTM A;  4IO2 A;  1IMA A;  2F6G A;  5I7I A;  5I58 A;  4JB7 A;  1SDX A;  1FBE A;  4OER A;  2UVI A;  3LSF B;  3OSR A;  3QYT A;  3TTL A;  3PPN A;  2H4I A;  4PET A;  2OX3 A;  2F3B A;  1R1N A;  4PFW A;  3M3K A;  1WDN A;  2VGQ A;  3Q26 A;  4U4S A;  5AA4 B;  1POT A;  1QW0 A;  2WBD A;  1FPG A;  4MMP A;  2ZZW A;  4X48 A;  1NUY A;  4GWU A;  2NWJ A;  4OFJ A;  1GVC A;  3PMX A;  3GZG A;  2XWI A;  4JWY A;  2F8D A;  4NHB A;  3SZP A;  4DCX A;  3KOT A;  4JDF A;  3RQT A;  4GQO A;  4ESX A;  1CB6 A;  2R9J A;  3I6V A;  1VSO A;  2CZI A;  1D9V A;  3K1P A;  3CR9 A;  4JBZ A;  4DXC A;  2ALU A;  3TMG A;  4U4X A;  4N6K A;  1LBC A;  3T22 A;  4WXJ A;  2KLF A;  1JEU A;  1TWY A;  4O8M A;  4DXU A;  3UIF A;  3W9V A;  1LFG A;  2O51 A;  2X26 A;  1M5D A;  3S9M C;  3IOU A;  5AE4 A;  5FHN A;  3VVF A;  3G7W A;  5CRY A;  1KWH A;  3RT6 B;  3TTN A;  4F1Y A;  2P2A A;  1XOC A;  1B32 A;  4AS4 A;  1AL3 A;  3H4Z A;  1FPF A;  1NV1 A;  1MM6 A;  2Z8E A;  3RUM A;  2AIX A;  4GVO A;  3ZSF A;  2Q88 A;  4EXK A;  2Q9T A;  1J1N A;  1TFA A;  4TLL B;  4OA4 A;  3PUZ E;  1JQF A;  3OEK A;  2DXY A;  2O1L A;  3EKI A;  1RYX A;  2D5W A;  2ZYK A;  3T9H B;  4WKM A;  1USY E;  4FJP A;  2PVU A;  5ELV A;  1N0T A;  4BDQ A;  2AL4 A;  4NF4 A;  1NV7 A;  1QVS A;  3KFM A;  5EYH A;  4X04 A;  3N94 A;  5DW8 A;  1SW4 A;  2R71 A;  1CNQ A;  3IL1 B;  4XIG Q;  2DXR A;  4IO4 A;  2AL5 A;  3EPE A;  2RF1 A;  3FXR A;  1AIV A;  4Q5T A;  4U22 A;  3V89 B;  4G68 B;  1Z7N E;  1B5J A;  4N13 A;  3KN3 A;  1Y3N A;  2XXP A;  1B3G A;  5HM4 B;  1UIU A;  4UAB A;  5AA2 B;  4I8C A;  1I6Q A;  4HCW A;  1YAE A;  1FTA A;  3ROJ A;  1RYO A;  3OEL A;  2QS3 A;  4G61 A;  1SYH A;  3L6H A;  4RA1 A;  1LB8 A;  2XXR A;  1WVJ A;  1OQH A;  3TKD A;  5H8N B;  3PD9 A;  2GHB A;  1NV4 A;  2RC9 A;  2XXT A;  3K6W A;  1EYI A;  4F3B A;  1NMU A;  3O6I A;  3N26 A;  2G93 A;  4ND9 A;  3TYH A;  4GF8 A;  4IO5 A;  2DE4 A;  4L17 A;  1FW0 A;  3OD7 A;  5I3S A;  1LAX A;  3GBA A;  1IXC A;  3IOW A;  1Q9D A;  5HBC A;  1FPJ A;  3PMW A;  2OZZ A;  1JW1 A;  1O63 A;  1BTJ A;  1ZBM A;  5H8H A;  3SKP A;  1B9J A;  3CSB A;  4XEQ A;  1MQD A;  1QUK A;  4I40 A;  2YJP A;  3NOH A;  4FOR A;  4I3Y A;  1A99 A;  2HHM A;  3RNN A;  4RPN A;  3KEI A;  3QUJ A;  3DP4 A;  4EF1 A;  1ZLQ A;  4G4P A;  4MH5 A;  4NAP A;  1N84 A;  1QUJ A;  3RT8 A;  3KJT A;  2ZNS A;  1TFD A;  2B65 A;  2IEE A;  3MVY A;  5CMM A;  4RK2 A;  1NNK A;  1H43 A;  4OMB A;  3IO6 A;  4PCD A;  4ZEI A;  3I3V A;  2VHA A;  1K9Z A;  1ZKB A;  1N7W A;  4YZZ A;  2WEF A;  2PBW A;  4K3F A;  3V8X B;  3H6T A;  5L9M A;  1B58 A;  1B40 A;  4O7M A;  3EN3 A;  1LLS A;  1S7Y A;  5CMK A;  4MEV A;  4HCY A;  4QBA A;  1PBP A;  3R6U A;  4OTE A;  4F3P A;  4HE2 A;  2KQZ A;  1IXH A;  1LEV A;  5EQ9 A;  4PTK A;  1URG A;  2D21 A;  4QSD A;  1FRP A;  2UVJ A;  2Y7R A;  4H46 A;  1BIY A;  2XXQ A;  1O7T A;  2RC8 A;  1PC3 A;  4XKP A;  1G0H A;  3M3F A;  3H7M A;  3BFT A;  5TPA A;  3FV1 A;  2Z8F A;  3G3H A;  3IFA A;  4R72 A;  4H45 A;  3N6U A;  2Q89 A;  2RCB A;  3KSX A;  4ZZE A;  4EQ9 A;  2A5T A;  4LZ7 A;  4FAJ A;  3EHU A;  3EHS A;  4PDH A;  1OIB A;  2CMO A;  1FBH A;  3PUV E;  1ELJ A;  3IR1 A;  3PUW E;  2BJJ X;  3O6H A;  4H8I A;  3MBP A;  5H8F A;  2V93 A;  4ZEK A;  3TQL A;  2ZMB A;  4MJO A;  2OBG A;  4G68 C;  4H65 A;  1B51 A;  5EYG A;  3USD A;  1FPD A;  1DBZ A;  4OQO A;  4I1D A;  1DTZ A;  3QSL A;  4N8Y A;  1KA0 A;  4IO6 A;  1FPL A;  4P56 A;  1PB7 A;  2F36 A;  1I69 A;  1ZIU A;  4IR8 A;  1Z7M E;  2HXW A;  4XF5 A;  3Q28 A;  4PFI A;  1FQD A;  2H25 A;  4YKK A;  5LDZ A;  3CG3 A;  3U92 A;  1SBP A;  2PYY A;  4THI A;  4RNS A;  5I57 A;  4ONY A;  3THI A;  1Y3P A;  5IZ3 B;  1BK4 A;  2DWH A;  1B5H A;  3LUY A;  3FVG A;  1LAF E;  3C4M A;  2ZZV A;  3IX1 A;  4PF8 A;  1OVT A;  2H99 A;  4ZZA A;  2QRY A;  3KN8 A;  4OFL A;  4GLI A;  3PUX E;  3F11 A;  2YLN A;  3RPW A;  2NVU B;  2H5Y A;  1XVX A;  2DQV A;  1MDQ A;  4N17 A;  1FBD A;  1PEB A;  2O1M A;  2WYP A;  4MAG A;  4NTL A;  4MBP A;  2QSX A;  4XTC Q;  1DCU A;  3PV0 E;  3LC8 A;  1IXG A;  4PAI A;  4X9T A;  2Y7W A;  1B1X A;  3E13 X;  2Y7K A;  3KBR A;  4R6K A;  1YTV A;  1MRP A;  4GWS A;  1Q1K A;  3TEP A;  3M8U A;  3HFU A;  4KYS A;  3VXC A;  1B3L A;  2FBP A;  4DE8 A;  3CFL A;  5KDT A;  3PGF A;  3O6G A;  3CFX A;  3CG1 A;  1LBX A;  1B0H A;  3TCG A;  4RY1 A;  1NNT A;  2ZXT A;  3AXF A;  4LQ2 A;  4N07 A;  4F22 A;  3SEX A;  2NUV A;  3S9L C;  1B3F A;  2WX9 A;  4ZDM A;  1IIW A;  1GGG A;  5I59 A;  2A5S A;  1NV3 A;  4P3L A;  3CSG A;  3PU5 A;  2NXO A;  4N91 A;  2E1S A;  3KC1 A;  3O97 A;  1B5I A;  4N15 A;  1B3E A;  4I62 A;  3CHG A;  1P1W A;  5FHM A;  4KR5 A;  4GL8 A;  3TPA A;  1MY4 A;  2YPN A;  2ABH A;  2CZH A;  1P1Q A;  4C1U A;  3V5A A;  3GLB A;  3E4R A;  3W9W A;  4OEN A;  4ELP A;  4U23 A;  2BJI A;  1XI6 A;  3N6T A;  4BDN A;  1AMF A;  3RTF B;  4GWZ A;  2FIX A;  4IO3 A;  1QGX A;  3KGC A;  4H0W A;  2XX8 A;  2H98 A;  3K1N A;  5JEI A;  1N3W A;  1DMB A;  4H6D A;  3B6Q A;  3MP1 A;  3LR1 A;  4NF6 A;  3BFU A;  2RC7 A;  1Q35 A;  3S2V A;  3MW0 A;  3T9X B;  4AQ4 A;  4MHF A;  3RPL B;  1SPI A;  1A8E A;  1MXY A;  4P1E A;  4F39 A;  4N6P A;  4M1V A;  3T93 B;  3VE1 B;  2B3B A;  2G29 A;  2XD3 A;  3PPQ A;  5JTY A;  1O64 A;  2DWA A;  2VOZ A;  2GHA A;  1EZP A;  4KHZ E;  3S4U A;  1R9Q A;  3K2D A;  1DTG A;  1PDA A;  4Z7E A;  4QF9 A;  1HSE A;  4MLV A;  1NNF A;  1ANF A;  2I4C A;  5CC2 A;  5JTY B;  1LFH A;  4GFR A;  3MQ9 A;  4KPT A;  5K2Y A;  4F1U A;  1B0L A;  3FAS A;  4NF5 B;  1JVX A;  5A5X B;  1LCF A;  2I48 A;  4X1D A;  1INP A;  4R74 A;  3WAF A;  5IZZ A;  2UVH A;  1G0I A;  2ESN A;  4RJZ A;  2FIE A;  1RDY A;  5I56 A;  4LA9 A;  5CBR A;  3JYR A;  1IMB A;  1FTJ A;  3ISP A;  4PE3 A;  2CZK A;  4HE1 A;  4ZEB A;  1FJ9 A;  2HEU A;  3O28 A;  1FTM A;  3K0V A;  3O29 A;  1BP5 A;  5ISU A;  4O3B A;  5EQA A;  5A5X A;  2REG A;  1NV0 A;  3BBR A;  2RKM A;  3MZ1 A;  3ILT B;  2W7Y A;  4I9D A;  3FZV A;  1JNF A;  4N8G A;  2F34 A;  4R6Y A;  2ZYM A;  3MVZ A;  1FTK A;  4GWO A;  4IGT A;  3SER A;  1UTB B;  3MZ9 A;  4ZEC A;  4MCO A;  1VFE A;  5FTH A;  4R6H A;  1LAG E;  3Q29 A;  1Y9U A;  4X1B A;  5DTB A;  3O66 A;  4F3S A;  3SES A;  4PFB A;  4P8B A;  4GX3 A;  3TUS A;  1OQG A;  2Y5L A;  1P1O A;  3PPO A;  3HHG A;  4GOT A;  5AA1 A;  3OOA A;  3ZS6 A;  3QXM A;  1VFD A;  5IZ1 A;  1POY 1;  1BKA A;  2X7Q A;  2UXA A;  4RXL A;  2Z8D A;  3E79 A;  5H8H B;  3EQ1 A;  2PFY A;  5H8Q A;  3RY3 A;  1NV6 A;  5IKB A;  1P99 A;  1XT8 A;  4N4U A;  1D9Q A;  1D4N A;  4PE5 B;  1LBW A;  5BWJ A;  3MJN A;  4BDL A;  3E3K A;  2I49 A;  3IOR A;  4H8J A;  4GBV A;  1R9L A;  4H1X A;  3UGW A;  1LB9 A;  5DEX B;  2DVZ A;  4LAT A;  3IB0 A;  1XVY A;  3SEV A;  4R75 A;  3G3K A;  3W15 C;  1B4Z A;  4OVP A;  1OVB A;  4ZED A;  3KN7 A;  1T0K A;  4LON B;  2V25 A;  3UP9 A;  3HN0 A;  1XC1 A;  4XKQ A;  5AA2 A;  5I2N B;  1MXW A;  1FQA A;  2CEX A;  5CBS A;  1IIT A;  1A55 A;  2RCA A;  4U1Z A;  4MX6 A;  1FBG A;  1FPE A;  1MG1 A;  3SEY A;  2FHY A;  4GD5 A;  1NV5 A;  1FBC A;  1US5 A;  3TAJ A;  1B7U A;  1Y1Z A;  4GWY A;  1YZ0 A;  4F19 A;  4POX A;  2E0S A;  4LUB A;  4F3G A;  4QHQ A;  5A5L A;  1LAH E;  1QKB A;  4JWX A;  3KOS A;  2ANJ A;  4AB6 A;  4IY6 A;  3IK6 B;  3CI8 A;  5DT6 A;  3LSX A;  3PD8 A;  2PCR A;  4KI0 E;  4QFO A;  3LBS A;  4ZS9 A;  5KCJ B;  3G3I A;  3SDF A;  4QFN A;  1SQY A;  3O2A A;  5J1D A;  4GIZ A;  2GQ1 A;  1IME A;  3HO7 A;  2O69 A;  3KSJ A;  4OEV A;  3E78 A;  3TEL A;  2QS2 A;  4OZ9 A;  2DDK A;  2QJE A;  2F7C A;  1FSA A;  3FVO A;  5HPQ A;  1P1N A;  4GX4 A;  4PFY A;  1LBV A;  1YCJ A;  1FJ6 A;  1FBF A;  5EHS A;  4NWC A;  2XWV A;  5L8D A;  4ESW A;  1Y3Q A;  3CRB A;  4RYA A;  5F24 A;  1AH5 A;  4QSE A;  4QFP A;  4TLM B;  3VVE A;  4N81 A;  4NN3 A;  4O3C A;  3CFZ A;  2Q8J A;  2P0S A;  2Y7I A;  4QFK A;  4F1V A;  2ZYN A;  4P47 A;  5FTI A;  5I5P A;  3HHF A;  4FE8 A;  1M5C A;  2Z23 A;  2HFB A;  2QVR A;  5K2X A;  1MXV A;  5BUU A;  3GBB A;  5TP9 A;  5FBP A;  4BDM A;  3C35 A;  2KR0 A;  3MC2 A;  3VLW A;  4GWW A;  4NED A;  3C9H A;  2XXU A;  3U8Q A;  5CMC A;  1B3H A;  4IGR A;  2OWZ A;  3KZG A;  3K01 A;  4GXS B;  3FJM A;  3TTR A;  2XHD A;  3EF7 A;  1M5E A;  5TU0 A;  1SW2 A;  3BKI B;  3T1B A;  2V3T A;  4NF4 B;  1FBP A;  2OCU A;  2Y7P A;  3CVG A;  5AA2 D;  3R7X A;  5ET6 A;  3D4C A;  1JP4 A;  4NQ8 A;  4PF6 A;  5T3J A;  5H8F B;  4OVR A;  3I5O A;  4DCY A;  1NFT A;  2QMX A;  4Q8R A;  3KC0 A;  4FEC A;  4GRK A;  5LTC A;  3BIH A;  1VR5 A;  3B7D A;  2QS4 A;  4U21 A;  4YB5 A;  4ZEF A;  3U72 A;  2O84 X;  5IAI A;  4ELR A;  3K4U A;  1N3X A;  2FNC A;  2VD2 A;  1H76 A;  1MPD A;  4R2F A;  4Z0I A;  5IGA A;  2QMW A;  4PBH A;  4GXA A;  4YU0 A;  3GXA A;  3IO4 A;  3TZA A;  3RYD A;  4O7I A;  1N04 A;  3QMF A;  4AB5 A;  5IM2 A;  4TQU Q;  2UYE A;  1B2H A;  2VP1 A;  2JJK A;  5I59 B;  1II5 A;  4DI4 B;  3MPK A;  4ISU A;  1IUD A;  1EH3 A;  3MAM A;  3UOR A;  2XXI A;  1GV8 A;  5L9O A;  3KJ7 A;  3FD3 A;  3D4G A;  1I6A A;  1Y4T A;  1S50 A;  4UA8 A;  4NF0 A;  1NV2 A;  4C1T A;  4OVQ A;  3L6G A;  1LFI A;  1Y1M A;  1IXI A;  4KQP A;  1YPN A;  4BDO A;  2I0B A;  2MKZ A;  5B70 A;  2ONS A;  3S9N C;  1B4H A;  4LVQ A;  2I4B A;  4OES A;  1HSL A;  3ZKK A;  1URD A;  2XX7 A;  1KZ8 A;  2F7A A;  2OWT A;  2OLB A;  4JXI A;  4FAT A;  4NGU A;  4WEP A;  4NF8 A;  2QFL A;  2QVU A;  4OET A;  5ITP A;  2P1S A;  1LCT A;  5L9S A;  4PGP A;  2A5T B;  3EHT A;  4EQB A;  1MH4 A;  1ZMG A;  1MQH A;  4HE0 A;  2HAU A;  2ZYO A;  1S9T A;  4Q0C A;  4R73 A;  5H8N A;  3VDF A;  2HZL A;  5I56 B;  3DP8 A;  3K6V A;  4Q30 B;  1AWB A;  4GX6 A;  3SEW A;  2XXV A;  3DLN A;  2FA7 A;  4HTG A;  3Q27 A;  4NE4 A;  3HV1 A;  5I84 A;  5B7D A;  3VV5 A;  1IZ1 A;  3U1O A;  2HAV A;  2X7P A;  2OK2 A;  2I3W A;  2M8C A;  3DM0 A;  4F2Q A; 
#chains in the Genus database with same CATH homology
 4RK2 A;  2XXY A;  1MY3 A;  3JV9 A;  4DIG A;  1D3K A;  1NNK A;  1VFE A;  1WOD A;  5FTH A;  1H43 A;  4R6H A;  4OMB A;  1LAG E;  3IO6 A;  4MLQ A;  5I2N A;  4ZEI A;  3I3V A;  3Q29 A;  1MQG A;  1MS7 A;  4EUO A;  2VHA A;  1Y9U A;  1B1H A;  4X1B A;  2D3I A;  4PFT A;  3O66 A;  1ZKB A;  5DTB A;  1N7W A;  4YZZ A;  1MDP 1;  3TOD A;  4QFL A;  3SES A;  4F3S A;  4YKJ A;  1FTL A;  2FYI A;  3TUS A;  1OQG A;  2PBW A;  4K3F A;  3PPO A;  1P1O A;  3H6T A;  3RTW B;  3V8X B;  5L9M A;  4HW8 A;  3HHG A;  3K02 A;  1B58 A;  1MM7 A;  5KZT A;  4GOT A;  4RPO A;  1B40 A;  5DYH A;  1ZU0 A;  5AA1 A;  1NH8 A;  2QS1 A;  1LLS A;  3B6W A;  3EN3 A;  3FVN A;  3FVK A;  1MXU A;  1S7Y A;  1FQB A;  2HCA A;  2Y84 A;  3H03 A;  1EZ9 A;  1QUL A;  1VFD A;  2PMS A;  3H3G A;  3QXM A;  3ZS6 A;  4F29 A;  3C32 A;  4P0I A;  3UA8 A;  4HCY A;  1ZJL A;  1POY 1;  1PBP A;  1BKA A;  4ZEC A;  3IB2 A;  5H8S A;  2F6P A;  3R6U A;  4JWO A;  3RGY A;  4OTE A;  3FV2 A;  4F3P A;  5J1D A;  2X7Q A;  2XD2 A;  1FQF A;  1DPE A;  2UXA A;  4RXL A;  3C33 A;  2Z8D A;  3OSQ A;  4LZ5 A;  5H8H B;  3U94 A;  3EQ1 A;  4KFQ A;  3K00 A;  1IXH A;  4OFO A;  1B05 A;  5H8Q A;  3RY3 A;  4N07 A;  3PPR A;  5TP9 B;  3ZKL A;  1URS A;  5IKB A;  1P99 A;  1XT8 A;  4GL0 A;  1URG A;  1JW5 A;  3DP6 A;  1D4N A;  2D21 A;  5I2K B;  4QSD A;  3FJ7 A;  4PE5 B;  2UVJ A;  3IOT A;  2Q2C A;  4YMB A;  2Y7R A;  3IJO B;  3TCH A;  1BIY A;  1D9Y A;  2XXQ A;  3UN6 A;  4U2R A;  1O7T A;  1P1U A;  2RC8 A;  3FXU A;  1PC3 A;  4XKP A;  4F31 B;  3MJN A;  4BDL A;  5BWJ A;  3M3F A;  2F7B A;  3E3K A;  3H7M A;  2I49 A;  4F2O A;  3RLF E;  5CMK A;  3IOR A;  2F97 A;  4H8J A;  4OHN A;  1MH3 A;  3BFT A;  4H5F A;  1R9L A;  5TPA A;  3K6U A;  2PX1 A;  3FV1 A;  4H1X A;  2Z8F A;  4KYE A;  3G3H A;  4PQJ A;  5DVF A;  4R72 A;  3UGW A;  1BLF A;  3IOV A;  4DZ1 A;  1LB9 A;  4F18 A;  5DEX B;  2DVZ A;  1B46 A;  1PBQ A;  2DP8 A;  3N6U A;  3ODB A;  1ATG A;  2Q89 A;  2RCB A;  3IB0 A;  3KSX A;  3OO8 A;  3QUF A;  3R26 A;  4IO7 A;  4LAT A;  4ZZE A;  4EQ9 A;  1H45 A;  2O6A A;  3V83 A;  3OO6 A;  4H67 A;  2A5T A;  4LZ7 A;  2O68 A;  4RK9 A;  1XVY A;  3VFJ A;  4FAJ A;  1JEV A;  3H6U A;  4MFI A;  1H3D A;  3EHU A;  1SW5 A;  3EHS A;  3N5L A;  3SEV A;  3WAE A;  2QPQ A;  4R75 A;  1OIB A;  3T9V A;  2DSF A;  1Y4C A;  2CMO A;  3G3K A;  3PUV E;  3W15 C;  1ELJ A;  2DWJ A;  2THI A;  3HPI A;  3ONM A;  3IJX B;  1B4Z A;  2ZNU A;  3U93 A;  1OVB A;  4ZED A;  3IR1 A;  3PUW E;  3KN7 A;  1T0K A;  1EU8 A;  3IB1 A;  2V25 A;  2BJJ X;  4LON B;  3UP9 A;  5DVJ A;  3VVD A;  3HN0 A;  1XC1 A;  3O6H A;  4R9G A;  4XKN A;  4XKQ A;  5AA2 A;  4H8I A;  1A8F A;  3MBP A;  1NNP A;  5I2N B;  1GR2 A;  1MXW A;  2I0C A;  1FQA A;  4FIM A;  5H8F A;  4XXU A;  2V93 A;  1IIT A;  1R6Z A;  4YKP A;  4ZEK A;  5CBS A;  1A55 A;  2RCA A;  3A3U A;  2ZMB A;  3TQL A;  4U1Z A;  1JW4 A;  2OBG A;  3MP6 A;  4G68 C;  1MG1 A;  1B51 A;  4H65 A;  4GD5 A;  4KYD A;  3SEY A;  3USD A;  1XHY A;  4QSC A;  1N76 A;  1IEJ A;  1MY1 A;  1US5 A;  2DWI A;  3TAJ A;  2Q2A A;  3L6G A;  1B7U A;  1Y1Z A;  4F19 A;  5LOM A;  4BLA A;  4OQO A;  2E0S A;  2AYS A;  3B6T A;  4I1D A;  4POX A;  4R9F A;  2O7I A;  4LUB A;  4ELO A;  4F3G A;  4QHQ A;  4LZ8 A;  1DTZ A;  1LAH E;  3QK6 A;  1MY2 A;  3QSL A;  4YIC A;  4OEU A;  3TQW A;  4C0R A;  1QKB A;  4JWX A;  1ZTY A;  1DOT A;  3KOS A;  2V3U A;  3OO7 A;  2ANJ A;  4AB6 A;  1A54 A;  4IO6 A;  4IY6 A;  3MUQ A;  5F1Q A;  3C34 A;  3IK6 B;  3CI8 A;  5DT6 A;  3LSX A;  2QL3 A;  1PB7 A;  3PD8 A;  5ITO A;  2F36 A;  1I69 A;  1ZIU A;  4KI0 E;  4QFO A;  3LBS A;  4ZS9 A;  5DVI A;  5F7V A;  1Z7M E;  3FAT A;  2HZK A;  2HXW A;  3A3C A;  5KCJ B;  1OLA A;  5I57 A;  2DE3 A;  2DVC A;  3G3I A;  3Q28 A;  1MPB A;  1SQY A;  1SD3 A;  3HCQ A;  2I58 A;  3QIM A;  4QFN A;  3K1M A;  3SDF A;  3IAZ A;  3S9E A;  1SVX B;  1FQD A;  2I6E A;  2H25 A;  1DSN A;  4YKK A;  2PT2 A;  1VE4 A;  3CG3 A;  1B7Z A;  4OXV A;  4UAC A;  3U92 A;  1SBP A;  2PYY A;  3O2A A;  4THI A;  5AA4 A;  3ILU B;  4KD5 A;  4RNS A;  2LAO A;  1A40 A;  4FEB A;  1H44 A;  4GIZ A;  1Y3P A;  4ONY A;  4YB7 A;  3TFL A;  3THI A;  1M5B A;  2DWH A;  3HO7 A;  2O69 A;  5FHO A;  3KSJ A;  4OEV A;  1B5H A;  5EHM A;  2OWS A;  3LUY A;  4XKR A;  3FVG A;  4NF6 B;  1LAF E;  3C4M A;  3TEL A;  2QS2 A;  4OZ9 A;  1CE2 A;  3A09 A;  2V84 A;  4HS7 A;  1FQE A;  3IX1 A;  3UK4 A;  1SI0 A;  1OVT A;  2H99 A;  3QAX A;  3OEM A;  1MQI A;  1FCK A;  2F78 A;  2F7C A;  2QJE A;  2QRY A;  3KN8 A;  4OFL A;  3C36 A;  3FIR A;  4GLI A;  3PUX E;  1XS5 A;  3F11 A;  3FVO A;  5HPQ A;  1P1N A;  1HSJ A;  2H9B A;  1MXX A;  4PFY A;  5M2V A;  4BDR A;  1YCJ A;  5ICT A;  3E9X A;  3FJG A;  5EHS A;  1NKX A;  1PB9 A;  2YLN A;  4G8N A;  4NWC A;  1FTO A;  3TCF A;  3RPW A;  3PUY E;  5L8D A;  3TTM A;  4IO2 A;  4ECF A;  2NVU B;  1Y3Q A;  1XVX A;  2H5Y A;  2DQV A;  4ESW A;  1MDQ A;  2F6G A;  2VD3 A;  3CRB A;  5I58 A;  2ONK E;  4JB7 A;  1SDX A;  3OOA A;  4RYA A;  1AH5 A;  4OER A;  1QKA A;  4QSE A;  2UVI A;  2ZNT A;  4QFP A;  3LSF B;  3OSR A;  4TLM B;  3VVE A;  1PEB A;  2O1M A;  3QYT A;  3TTL A;  4O3C A;  3CFZ A;  2Q8J A;  1OLC A;  4NWD A;  3PPN A;  2P0S A;  2Y7I A;  4MBP A;  2H4I A;  1UTH B;  2QSX A;  4NTL A;  4PET A;  4QFK A;  3PV0 E;  4XTC Q;  4F1V A;  2ZYN A;  1I6B A;  1R1N A;  3LC8 A;  4PFW A;  5FTI A;  3M3K A;  1IXG A;  4X9T A;  2Y7W A;  3HHF A;  4FE8 A;  1M5C A;  1UIV A;  1B1X A;  2HFB A;  2Z23 A;  1MXV A;  1WDN A;  2VGQ A;  3E13 X;  3GBB A;  1POT A;  2Y7K A;  1QW0 A;  3KBR A;  3Q26 A;  4R6K A;  4U4S A;  3C35 A;  1YTV A;  2UVG A;  4BDM A;  1MRP A;  1NH7 A;  1Q1K A;  4X48 A;  5EYF A;  3TEP A;  3M8U A;  3MC2 A;  4KYS A;  2NWJ A;  3CIJ A;  2OJT A;  4R2B A;  3VLW A;  3FUZ A;  1B3L A;  4NED A;  4OFJ A;  1GVC A;  2V3Q A;  3PMX A;  3VXC A;  3GZG A;  3C9H A;  5KCJ A;  4JWY A;  4DE8 A;  3CFL A;  3JZJ A;  2F8D A;  2XXU A;  4P0G A;  3PGF A;  4DCX A;  2F5X A;  3O6G A;  5KDT A;  3CFX A;  2DOJ A;  4ZE8 A;  2GRV A;  3U8Q A;  2GFE A;  5CMC A;  3CG1 A;  1B3H A;  2XX9 A;  4IGR A;  1B0H A;  3TCG A;  2REJ A;  3KOT A;  3KZG A;  4JDF A;  3K01 A;  3P7I A;  4RY1 A;  3RQT A;  1NNT A;  4GQO A;  4H5G A;  2ZXT A;  1M5F A;  4GXS B;  4PFU A;  3AXF A;  4M4G A;  3RN8 A;  3FJM A;  4ESX A;  1CB6 A;  5K2X A;  4LQ2 A;  1FQC A;  5JK4 A;  3TTR A;  2XHD A;  3EF7 A;  2R9J A;  3I6V A;  1M5E A;  1SW2 A;  1VSO A;  2NUV A;  1D9V A;  3BKI B;  3K1P A;  3MP8 A;  2V3T A;  3CR9 A;  5TU0 A;  3SEX A;  4NF4 B;  2OCU A;  2Y7P A;  4JBZ A;  3CVG A;  1B3F A;  5AA2 D;  4ZDM A;  4DXC A;  3R7X A;  1IIW A;  2ALU A;  3PMV A;  3TMG A;  4U4X A;  3D4C A;  1GGG A;  2Z22 A;  5I59 A;  1LBC A;  2A5S A;  2I3V A;  3T22 A;  2F35 A;  1MQJ A;  5H8F B;  4WXJ A;  3SEU A;  2KLF A;  3I5O A;  1JEU A;  2XXH A;  4IY5 A;  3CSG A;  3PU5 A;  1JVY A;  2NXO A;  1NL5 A;  3SET A;  2E1S A;  3O97 A;  2NOO A;  3MZ9 A;  3VVF A;  1B5I A;  1TWY A;  4DCY A;  1LGB C;  1NFT A;  2QMX A;  3OMB A;  4EDP A;  5DEX A;  4Q8R A;  1B3E A;  3G3G A;  4DXU A;  4FEC A;  3UIF A;  3W9V A;  4EXL A;  1LFG A;  4I62 A;  1P1W A;  2O51 A;  2X26 A;  1USY H;  2RIN A;  5TPA B;  1M5D A;  3S9M C;  3IOU A;  4GRK A;  5AE4 A;  5FHN A;  5FHM A;  3G7W A;  4GL8 A;  4KR5 A;  1MY4 A;  1VR5 A;  2YPN A;  3B7D A;  3TPA A;  2QS4 A;  4KCC A;  5CRY A;  4U21 A;  4YB5 A;  4ZEF A;  2ABH A;  3U72 A;  1KWH A;  2O84 X;  3RT6 B;  5IAI A;  4ELR A;  1P1Q A;  3TTN A;  4C1U A;  3K4U A;  1N3X A;  4ZZA A;  3GLB A;  3H6W A;  2P2A A;  3V5A A;  2FNC A;  3E4R A;  4F1Y A;  3W9W A;  1AOV A;  4JSD A;  1XOC A;  1B32 A;  2VD2 A;  1H76 A;  4OEN A;  4ELP A;  1AL3 A;  1B7H A;  1MPD A;  3H4Z A;  1JET A;  4P11 A;  4R2F A;  4U23 A;  3KG2 A;  4Z0I A;  2QMW A;  3N6T A;  5CI5 A;  4BDN A;  4GXA A;  1AMF A;  3RTF B;  4YU0 A;  1MM6 A;  2Z8E A;  4JSO A;  3RUM A;  5AA3 A;  2AIX A;  4GVO A;  1A7L A;  3OEN A;  2Q88 A;  2UYF A;  3ZSF A;  3GXA A;  4OWD A;  4EXK A;  5CM6 A;  2Q9T A;  2WKY A;  3IO4 A;  4NF8 B;  1J1N A;  1MPC A;  4IO3 A;  1TFA A;  3TZA A;  5TP9 A;  3KGC A;  4H0W A;  4YB6 A;  4TLL B;  2XX8 A;  2GH9 A;  3PUZ E;  2H98 A;  5ICQ A;  1JQF A;  3OEK A;  2DXY A;  1N04 A;  2O1L A;  3K1N A;  4LP2 B;  5JEI A;  3O9P A;  1N3W A;  1RYX A;  4AB5 A;  1DMB A;  1IQ7 A;  4OYV A;  4H6D A;  4TQU Q;  2D5W A;  2UYE A;  2ZYK A;  3B6Q A;  3MP1 A;  4WKM A;  3T9H B;  4G77 A;  4E0W A;  1B2H A;  1USY E;  2VP1 A;  3LR1 A;  3H6V A;  3MPL A;  3PPP A;  1L5T A;  3H06 B;  5I59 B;  4N13 A;  2DS9 A;  1II5 A;  4FJP A;  4YKI A;  2PVU A;  3MPK A;  5ELV A;  1SI1 A;  4ISU A;  4NF6 A;  1N0T A;  4BDQ A;  3BFU A;  1IUD A;  2AL4 A;  2RC7 A;  1EH3 A;  1MXZ A;  3G3J A;  4NF4 A;  5AA4 B;  1US4 A;  3MAM A;  1Q35 A;  1GTK A;  4G8M A;  3S2V A;  3UOR A;  1QVS A;  4G2Z A;  2XXI A;  3MW0 A;  3T9X B;  4AQ4 A;  3KFM A;  1LST A;  3MVX A;  3M3L A;  1GV8 A;  3OO9 A;  3K6X A;  5L9O A;  3KJ7 A;  1LBB A;  4F22 A;  3FD3 A;  1A8E A;  2DYX A;  3N94 A;  1MXY A;  4TOZ A;  4ELQ A;  1SW4 A;  2R71 A;  3D4G A;  3S9L C;  3TTK A;  4N6P A;  4F39 A;  4M1V A;  3T93 B;  3IL1 B;  3VE1 B;  4XIG Q;  2B3B A;  2DXR A;  1I6A A;  1Y4T A;  4G8H A;  4G68 A;  3C31 A;  4DXB A;  3Q25 A;  2G29 A;  4IO4 A;  2AL5 A;  2XD3 A;  3EPE A;  2RF1 A;  3FXR A;  2XXX A;  3PPQ A;  1S50 A;  4NMY A;  4UA8 A;  1AIV A;  1N7X A;  4Q5T A;  4U22 A;  5JTY A;  1SYI A;  3V89 B;  3T96 B;  1OMP A;  4G68 B;  4C1T A;  1Z7N E;  4QRZ A;  1B5J A;  1DPP A;  1O64 A;  2DWA A;  2VOZ A;  2CZL A;  3KN3 A;  2GHA A;  1LFI A;  1Y1M A;  1IXI A;  4KHZ E;  4KQP A;  3S4U A;  1EZP A;  1R9Q A;  1Y3N A;  5CMB A;  1YPN A;  1B3G A;  1DTG A;  1PDA A;  1UIU A;  2XXP A;  3K2D A;  4Z7E A;  3VLV A;  4QF9 A;  5AA2 B;  1UQW A;  4I8C A;  3VLU A;  4BDO A;  1TXF A;  1I6Q A;  1HSE A;  2I0B A;  4HCW A;  4MLV A;  1NNF A;  1ANF A;  1YAE A;  2I4C A;  4EQ7 A;  5KDT B;  1RYO A;  3OEL A;  2QS3 A;  5JTY B;  1UTB A;  5CC2 A;  1LFH A;  4GFR A;  3MQ9 A;  4KPT A;  1SYH A;  3L6H A;  3TDJ A;  4RA1 A;  1LB8 A;  4IB2 A;  2XXR A;  1EZO A;  5B70 A;  1WVJ A;  2ONS A;  5K2Y A;  4F1U A;  1RKM A;  3S9N C;  1B0L A;  3MZB A;  3FAS A;  4NF5 B;  4E0X A;  1OQH A;  1B4H A;  1JVX A;  4LVQ A;  5A5X B;  1B52 A;  2I4B A;  2DE2 A;  3TKD A;  1LCF A;  5H8N B;  2I48 A;  3PD9 A;  4X1D A;  2GHB A;  4OES A;  1HSL A;  3T9U A;  4R74 A;  3WAF A;  1QUI A;  1URD A;  2UVH A;  2B3F A;  2XX7 A;  3ZKK A;  4EF2 A;  2F7A A;  3VXB A;  1Y20 A;  2OWT A;  1UTH A;  2PT1 A;  2OLB A;  2ESN A;  4RJZ A;  2RC9 A;  2XXT A;  3FGS A;  3K6W A;  4JXI A;  4WED A;  4FAT A;  5I56 A;  4WEP A;  4NF8 A;  4PP0 A;  4LA9 A;  5CBR A;  3JYR A;  4OET A;  4DLD A;  4FED A;  4O3A A;  4F3B A;  5ITP A;  2P1S A;  1FTJ A;  1NMU A;  3O6I A;  1LCT A;  2XXW A;  5I58 B;  3N26 A;  5L9S A;  1PB8 A;  3HST A;  1TT1 A;  2A5T B;  3EHT A;  3LSW A;  2G93 A;  5BUU A;  3ECR A;  4EQB A;  1MH4 A;  4ND9 A;  1ZMG A;  4ZEB A;  3TYH A;  4GF8 A;  4IO5 A;  1MQH A;  2DE4 A;  2HEU A;  3LSL A;  3MVW A;  5I2K A;  4L17 A;  3O28 A;  1FTM A;  1FW0 A;  2HAU A;  1S9T A;  2ZYO A;  3K0V A;  3OD7 A;  4POW A;  5I57 B;  3T66 A;  1LAX A;  3O29 A;  4Q0C A;  4R73 A;  4U1O A;  5H8N A;  1BP5 A;  3GBA A;  2R6G E;  1IXC A;  3IOW A;  3VDF A;  1QJM A;  4O3B A;  5ISU A;  5HBC A;  1MY0 A;  3DEL B;  3PMW A;  5A5X A;  2REG A;  4KCD A;  2OZZ A;  4OVJ A;  5H8Q B;  1JW1 A;  3BBR A;  2HQ0 A;  4NF5 A;  1O63 A;  2O7U A;  4DDD A;  1BTJ A;  1ZBM A;  5H8H A;  2HZL A;  3SKP A;  1B9J A;  2RKM A;  3CSB A;  3DP8 A;  5I56 B;  1B6H A;  1MQD A;  3K6V A;  1F9B A;  4Q30 B;  4YMA A;  4ZE9 A;  1QUK A;  3MZ1 A;  3SEW A;  3ILT B;  5HM4 B;  2XXV A;  2W7Y A;  3DLN A;  2FA7 A;  4HTG A;  4YAH X;  4LQ5 A;  2YJP A;  4FOR A;  4MF3 A;  3Q27 A;  1SW1 A;  1A99 A;  4NE4 A;  4I9D A;  3HV1 A;  3RNN A;  4RPN A;  5I84 A;  3FXQ A;  3KEI A;  3QUJ A;  3DP4 A;  2ONR A;  3FZV A;  3VV5 A;  4EF1 A;  5B7D A;  1ZLQ A;  4G4P A;  4MH5 A;  1IZ1 A;  1N84 A;  1QUJ A;  3U1O A;  2HAV A;  3RT8 A;  1JNF A;  2X7P A;  2F34 A;  3OXN A;  4R6Y A;  2OK2 A;  3G3F A;  3KJT A;  2I3W A;  2ZNS A;  1TFD A;  2B65 A;  2M8C A;  2ZYM A;  3MWB A;  1FTK A;  3MVZ A;  3DM0 A;  4GWO A;  1UTB B;  2IEE A;  3MVY A;  4IGT A;  2IA4 A;  3SER A;  4F2Q A;  5CMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...