3TRHA

Structure of a phosphoribosylaminoimidazole carboxylase catalytic subunit (pure) from coxiella burnetii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
KIFVAILMGSDSDLSTMETAFTELKSLGIPFEAHILSAHRTPKETVEFVENADNRGCAVFIAAAGLAAHLAGTIAAHTLKPVIGVPMAGGSLGGLDALLSTVQMPGGVPVACTAIGKAGAKNAAILAAQIIALQDKSIAQKLVQQRTAKRETLKKADENLQTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase carboxyltransferase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Lyase
total genus 53
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3trhA00
5CLGA 2NSLA 2FW9A 2FW7A 3TRHA 4YCCA 5CLIA 1D7AA 4YCDA 3OPQA 2FWAA 4Z7JA 1O4VA 4YCJA 5BOSB 2FWJA 4JA0A 4YCBA 3LP6A 4ZC8A 5CLFA 5CVTA 1U11A 3KUUA 4ZJYA 3RGGA 2FWBA 5CTJA 4GRDA 5CLHA 4ZK2A 2FWPA 4ZMBA 5CLJA 2NSHA 4AY4A 4B4KA 5C5DA 2YWXA 1XMPA 2ATEA 3OOWA 2FW1A 2FWIA 2FW8A 5BORA 3RG8A 2FW6A 2H31A 3ORSA 4AY3A 2NSJA 1QCZA 5BOSA
chains in the Genus database with same CATH superfamily
4PQGA 3DDSA 5G1OA 2GAIA 5DXFA 5KJFA 4Q37A 4LV6A 1EXVA 4GI5A 1T5BA 2PKYX 3LUBA 1WQ3A 2GH1A 2X0KA 2XDYA 3NHRA 1CQJA 3QY0A 1HLDA 2RKWA 2OQVA 1RWQA 4UM8B 3UJ3X 1PZMA 1GADO 2PSHA 4QWWA 4BNMA 5CW2A 3AESB 2QM8A 4RIGA 2X40A 2JLCA 4O1HA 5LMCA 1CS4C 2J0UA 3QI2A 3VO1A 1O6GA 4X61A 2P79A 2Z9CA 1M7HA 1FFGA 4EMUA 4BP1A 3HU3A 5EXEA 5EERA 1TUEA 2BGJA 2GZHA 1YV9A 2JFXA 1QQTA 2ZI7A 3E0XA 4GI1A 3G2PA 4KLZA 2WC1A 2X0EA 5LD2B 3NONA 2A92A 2AOUB 3QE3A 2H7YA 4M1SA 4GX0A 3R74A 5JCZA 3ONVA 1OU4A 4DB4A 2AN3A 4TTTS 2KLBA 2OORC 4HAZA 2FP4A 2W90A 2O2GA 3N2LA 1UF9A 5JXHA 1F7UA 3Q3JB 3H9GA 2VSFA 4TV8F 3WI7A 1M34A 3EPRA 2FQYA 2BGRA 2CNLA 2OHJA 2QTVA 4J90A 2GYVA 4BJ5A 1MV5A 2O1XA 3IB6A 1L5QA 3I2FA 3MWLA 4CTJA 1D2HA 4KR7A 4RVOA 1FYWA 1DP4A 3OJFA 5JHGB 1SVNA 1PFKA 1X1TA 3DYIA 1F48A 1HLPA 2GXSA 1IY0A 3AIOA 5JVDB 3T0FA 3PK0A 1F2TA 821PA 2WWIA 5D7NA 2VAMA 5BR7A 5EIOA 1CWUA 1T34A 4GXTA 3OCZA 1SA0B 1B3RA 4ZEMA 1Y89A 4E2FA 1TLFA 3A6HA 2L82A 4CV1A 4F4IA 3HVJA 3KLOA 1SQ5A 3KSZO 5A9SB 5JSHA 1GG2A 4LIPD 1S1MA 1W0JA 3SIRA 4EI7A 2VA9A 3DNMA 1IVNA 4HEA1 2W37A 5K0BA 5CD9A 3E15A 3JD0A 3CCBA 2C5HA 2WIGA 5KOIA 3DSRA 4MRRA 2X8WA 2OO7A 4G37A 1NF2A 4ZU1X 4NCJA 3ZQJA 3BMQB 4H4EA 5EPUA 3VFDA 2V8BA 3GLIB 4D5GA 1OBVA 3MN1A 3PU6A 3H2KA 3EYAA 4KFSA 1K63A 2ORED 3CNBA 4ZEWA 5DZSA 4D74A 4G5RA 1D5CA 1G2OA 5CYFA 1KH3A 4I1PA 5DK4A 3IAHA 4WHMA 1RP7A 2QN8A 2DSNA 4I6GA 1B1CA 1USIA 4DPMA 4PG7A 4C4TA 4LXTA 1RXIA 3P9PA 4OXNA 4BTEA 1N33B 3ESXA 1JA1A 4S0ZA 1H69A 1NI3A 3F9RA 5LA6A 2Q0SA 3RSCA 4HUTA 4DR1B 1C0LA 3C15C 1J2RA 2FPGA 4EQ6B 4WBNA 4ND8A 3EUFA 1QFXA 3OLCX 2AH5A 5CYGA 3LFUA 3IPRA 1T26A 3PD7A 2AW5A 2MSNA 2VNJA 3RIEA 5JH7A 1XZDA 1CDZA 1PJSA 3BFJA 3RREA 2IY8A 3PIRA 3F4KA 4XGQA 4JUFA 4LOAA 4PHFA 4GDMA 1YU9A 4HNQA 4N48A 1M2FA 4BC1A 1BG6A 3QFHA 4QE3A 3VU1A 2XGJA 1KOFA 3TD2A 1F4PA 5KSYA 5DNYB 3KKQA 3I6ZA 1S4MA 3G0CA 2W2VA 4A6DA 4ZO8A 1QQBA 3LIPA 1KQ3A 5ABPA 2YASA 1YOBA 1PZGA 4YH1A 3TQCA 5BWBA 2R68A 2Z30A 3PPVA 3ZY4A 4UDYX 3VPFA 1G17A 3I5UA 3KR9A 4HAWA 2C7PA 2DFKB 4XFDA 1O4WA 3BXFA 3WKAA 3A3PA 4ZCTA 3JRWA 4DR4B 2FXVA 3TRFA 4QXQA 1S3GA 3PR1A 1WDWB 3GLGB 2NSYA 4HBZA 2W2KB 5AESA 2CXSA 1X19A 3PJEA 3ZU3A 4NTZA 4RK7A 1PJAA 1KR5A 2V7BA 4BKOA 4FM9A 1JH8A 1VE7A 1KIAA 4LRTB 1J20A 1QG2A 1SVUA 1CP3A 3WQSB 4QD3A 1GKYA 2VHZA 2FFAA 3PBKA 2FR0A 4CM1A 3BULA 3LCRA 4OUDB 4JSYA 4XJXA 1PX2A 4AFNA 3KU4A 3PSHA 2ERYA 1IM5A 1OLSB 4KXFB 2EKDA 4CV0A 1E5DA 3FPGA 3WWDA 2GXAA 3HKCA 4KQFA 5TB5A 1NC3A 2DY1A 2ILVA 5HDBB 4U3JB 2JFHA 1XD9A 4EO9A 3EQ6A 4LCJA 3GXOA 3WXMA 4B6OA 4NBRA 3O4JA 1DIOB 2O0KA 2BFMA 3FYUA 2DTDA 3KKMA 3NB0A 5G4LA 3F6PA 2MYTA 2GAJA 1EWVA 1YS6A 1NQVA 4RKYA 5E6RB 3HUTA 3PQ7A 2Y1KA 3WKDA 2C2OA 2AJCA 3P96A 3TSAA 2O23A 1PS8A 3VHRA 1PVDA 3MS2A 2G6BA 3ZHOA 1PW7A 5KYYA 5IM4A 2GZMA 4TYWA 1DBQA 1DQYA 4KRGA 3IMKA 4OHUA 4K3VA 3FJ1A 3L6BA 3ETLA 5K2OA 3SICE 3TWOA 1UH5A 4ARIA 1LLCA 3JD1A 1FU4A 3PUIA 2ZRMA 4Q9AA 1QRRA 4OJNA 5AQ1A 1R18A 4KITB 1RHRA 5E9WA 2RK4A 3JAWA 2PGOA 1QO0D 4H0NA 4MUNA 2ODWA 5EHNA 3VDMA 4PYQA 4JR2A 4K6HA 4WE3A 5A9TA 3PIDA 2GF2A 3RSLA 5JV5A 3KKOA 5D3MA 1J8FA 1G4HA 2FG5A 4FE3A 5LOVB 2B2XA 3A36A 5HUJA 4B7ZA 1TQDA 4QUGA 2FRDA 1SBQA 1X9IA 1X80B 3AUTA 1ZIXA 2VJQA 3Q7PA 4ZV9A 2MJLA 3RQSA 4EY7A 1Y3CE 1R6XA 1KMIY 5DX1A 5E1BA 2P4HX 4ZV7A 1ZSVA 3O82A 5I6DA 1KK1A 2PGLA 2FQQA 1OFUA 3ZY2A 1AQLA 1OI7A 1R5BA 1E99A 3FCEA 5JZOA 2W6JD 2EWMA 2XDWA 3NHLA 3I45A 3PLAE 3WNVA 3HK2A 1BVUA 5EE5B 1SVMA 4IRUB 2E89A 3TOXA 2AYZA 2BY4A 2Q3CA 4YRDA 4R2LA 1MG0A 5AVUA 1ZISA 1FJ2A 2QRZA 2YNMC 3A11A 4Q01A 2WJ6A 1EWKA 3MQFA 1ZMRA 3HA5A 2NSLA 1EKXA 1RJFA 3GNLA 3HYNA 3IIKA 4ND1A 4OYHA 3CURA 1Z08A 1QVZA 2VHUA 5KVQA 2CVOA 3KV1A 3R5FA 4DANA 1NVUQ 3D7KA 3FRIA 3P0RA 4ILEA 2HSZA 5CRIA 3OQPA 3G9QA 4IHAA 5K7SA 1GCAA 2CDCA 4JOSA 4KMSA 4BNUA 4N76A 4HX9A 3UJNA 1Q19A 4WPGA 1CUVA 2X3YA 3CE6A 5FRDA 3HHPA 2EWWA 1VBNA 4O4HF 3O8CA 4JSTA 3MGGA 2PRKA 5LXTA 3TW8A 1M2HA 1SC1A 2Y8EA 3WWPA 2X8JA 1HF3A 1WTCA 1F7VA 4MP6A 1TT7A 2E21A 1WPRA 3OFND 1UBGA 3D6NB 1M2NA 4CR8A 4M9UA 1ZS9A 4NQRA 1ULUA 5SYAA 3OKAA 5FPSA 2W5UA 3F5DA 1M2OA 3BXZA 1OTXA 1R6VA 3T6KA 1Z45A 3B1ZA 1C0KA 1MX3A 2DBZA 3E7WA 5HFNA 1LW6E 1QYVA 4MVJF 4ALJA 5BXYA 4MKRA 2ZYWX 1KY2A 3FLAA 3IO3A 4KPGA 4DXDA 3WLJA 3NBXX 2WIBA 3N8IA 2ZATA 4L0DA 1QMPA 3GRAA 4I4CA 5DWQA 1JPJA 4R9SA 1I9CA 1UBFA 2FJ0A 3CUEF 4OQPA 2C99A 3WK9A 4DVGA 4RDIA 2GJ8A 4AB1A 3ZCSA 1KZ1A 3SIXA 1NNUA 3QWIA 4DG5A 1XVVA 1V11A 4DJEC 1VMDA 1XCOA 4ZAZA 3FUWA 1IXZA 1ONNA 2I7TA 1R8YA 2DWQA 2PH3A 2YOHA 4TKUB 3MTBA 3LY5A 2GPNA 2F62A 1I7LA 1X7GA 3PFNA 3RRYA 4X20A 4MIYA 2C2XA 3WMGA 2W93A 4FX2A 3GROA 1Q0QA 5EP3A 5HF6A 1B3BA 4Z9XA 3U0BA 5KTYA 4HV4A 4KODA 2K7FA 2R8BA 2C9BA 2H1OA 4DMLA 1L4KA 1TU0A 2YY7A 5LYJA 3SYMA 1ZJ4A 4IS3A 4MQ6A 2OUIA 5EMNA 1RRCA 2ONZA 2XKAA 1DKNA 4EFNA 4M8SA 4X3OA 1GUFA 4LISA 1XTPA 2VRCA 3NBAA 1WV0A 4C7OB 1M2GA 3IUBA 3IJPA 5CLGA 2X7XA 4U2DA 1R4MA 3DF9A 4F46A 2V7VA 1JKXA 2C9MA 5H68A 1V5IA 1D0IA 1W9MA 2O1WA 3Q2OA 5AKIA 4BLWA 4INZA 2REQB 2XQGA 2QUIA 3KAPA 4WSOA 1PGJA 2P0AA 2VAWA 2CFIA 2W2LD 3MXTA 3E7PA 3VZRA 4BOYA 4ZCRA 1NWCA 3NM4A 2ZYDA 3EZ7A 1XXLA 3UAXA 1PSZA 3EGXB 2PS0A 3GF4A 5LBIA 3QVGA 3FLMA 4POOA 4E0BA 2DKOA 3ZZNA 5CLJA 4GGPA 4KQMA 2YDXA 1P1FA 5P8WA 5TQ2A 3C8UA 1U7WA 3TOSA 3OX1A 1B0PA 4EF6A 5KSWB 1K7FB 2OGTA 2QL9A 3GEMA 3MUFA 2WJGA 1JR3E 3LLUA 3UK6A 4QA9A 1KI6A 2D2IA 5EQDA 1XMQB 4BMDA 5GZ1A 5C9ZA 4J9UE 2EAUA 4H31A 5B6JA 1JQ3A 3CLHA 1KAQA 3PPIA 1C81A 4N54A 4GI7A 1GHTA 1XPOA 3BAZA 3ND9A 3KXLA 2VBFA 3ZDCA 3UT5A 3KWFA 1NUQA 4R8MA 1J8QA 3KC2A 2FPMA 3K9HA 3RVLA 3T06B 1G7TA 1GQQA 4CCYA 4MR8B 1ECFA 2Z6VA 4EFDA 4ER3A 5JAHA 2FSSA 4MW6A 4X1YA 3UATA 2BRUC 2G4VA 2ICAA 2PWZA 2ZWPA 1WDLA 2YHIB 3VH2A 1DC6A 3IP6A 3VR2A 3HV2A 5B3AA 4P38A 3QJ5A 4G0NA 1KAHA 3RRMA 1AHIA 3S8MA 1GO2A 3B1WA 3DMRA 1U0TA 1QF7A 3OZIA 3VZBA 4G0MA 5JCOA 2F55A 4I0WB 5L3VA 3LGXA 3L49A 1AURA 3ZN2A 1Z5PA 2BP7B 2ZCVA 3K0CC 1UZAA 4MWGA 3C41J 3W2FA 5CITA 5FWYA 1ZN2A 4UOZA 5CK5A 3KHUA 1QGED 3QELA 1EP1B 3LOUA 4KP7A 1GGMA 3TN7A 4GL2A 2CXQA 1KO7A 5IULC 3T7DA 4B3HA 4QYWA 2FWBA 4MS3B 4B35A 5FJIA 1LU9A 1ZOLA 2LTAA 2QAGC 2QQ5A 3BMOB 4FFBB 4Q3OA 5C3UA 1XQ9A 3LDAA 4BZZA 1Y4SA 3UHPA 5JYEA 3CG4A 1KK2A 4XDHA 2A2ZA 2Q3FA 2INGX 5B3JA 3L1KA 3QFCA 1PJTA 4I8XA 3VZCA 1C8LA 1UJ2A 1DC5A 1QIDA 1YB6A 3FUTA 1L6RA 4BMZA 1KEWA 1X1DA 2O6HA 3U62A 1K9SA 5FI1B 5LR6A 2GN9A 4ABTA 1JI0A 3PR2B 1NLFA 5EKUA 4EYOA 1JQLB 4OEHA 3WMWA 2AX4A 3ILYA 2X6TA 2HI0A 1VECA 1RWOA 1I8TA 3BXEA 3BCRA 2JJQA 1PE0A 3C5CA 3E5HA 3N75A 4IAOA 2OMKA 4LI3X 4K0KB 3UUFA 4IV8A 4EPVA 2F4NA 2VPIA 2WJHA 5FL7A 2IZZA 1UWKA 2H29A 2PD4A 3L6UA 3OT4A 3PFKA 3BH0A 1SB9A 3S70A 1V5GA 4EJSA 3HM9A 1FIUA 1CUUA 2PMDA 1FA9A 2FUEA 1NFQA 3K1AB 4QELA 2JJ2A 1JNXX 4R31A 3THOA 5K09A 2ZVPX 3T7CA 1JGTA 1KDRA 2IEDA 1QG6A 5JG7A 2P27A 5A9SA 2CY0A 1KFJB 3BBLA 1PGOA 2AMFA 1NKVA 1HM5A 1VL1A 1HL3A 1TVKB 3BAFA 3HO8A 4P1ZA 4PS1A 3WLNA 3AEXA 1BE6A 4Z2AA 2YYZA 4JB3A 5KTSA 2XADA 3ROTA 3G0HA 4S1PA 2CE7A 4AJJA 1RI1A 3DCJA 4X1IA 1EFVB 1Q0PA 1ZRSA 3TM5A 1VBFA 2W6MA 2J6IA 4M87A 2WHPA 3TB4A 4EHJA 3IQWA 3PXGA 3CW2A 5DGIA 4QJ3A 1XFAA 1XL0A 3IUEA 3HABA 3RR2A 3U48A 1UMDB 1OX4B 2G1UA 4X93A 4QYIB 3E58A 4MUJA 4WZBA 5HJEA 4MQMA 2WHXA 3LA8A 2YINC 3LUPA 3W8RA 4EGCB 1Q7GA 5EJ7A 2ACKA 2XNSA 3GNQA 4QOIA 1ZQ9A 3UJPA 5KYWB 4G9GA 3TW6A 1T8PA 5DSTA 3HI6A 2B1RA 3KYCA 3ILHA 3UG7A 1DAMA 5F5LA 5AK5A 5HNKA 4JI8B 5CAEA 1Y3HA 2OFXA 2JFOA 3KS9A 4GUDA 1VBMA 1KL7A 2DPHA 3UYKA 1ECGA 1Z12A 1H2RS 3EA0A 2X5JO 3JWPA 3RYHA 1YT5A 2JLAA 1QRUA 1OAOC 3AF1A 4YJ3B 2F1JA 4EWLA 1N5KA 1AMNA 2G09A 3K9BA 4I9NA 5AICA 4OI0A 3DP7A 1G8AA 2YZNA 3R7WA 5AVYA 3Q7IA 1PR2A 5AOCA 3MTEA 5EA2A 2WHRA 4TMZA 2WSYB 4OI2A 1KJZA 3LC2O 3NASA 2FKNA 1Q1AA 4JR0A 5CFNA 4YY3B 2ACWA 4QO8A 1PBTA 2O1SA 1J4AA 3ZCXA 4B44A 4QUDA 3RG8A 3ZWKA 4ZYWA 4JYMA 2O57A 5FTLA 5BV8A 1HQYE 1JB9A 4CG0A 2PYZA 3R7NA 2AGVA 2XDQB 4P3XA 3MJVA 3SS8A 2SNIE 5IU6A 3TNLA 4B79A 5HW0A 1Y1RA 2DY0A 3B6EA 3E7XA 3U5TA 3I9MA 4IF6A 1XELA 5KSZA 4PLTA 3JZAA 2N9UA 4P7FA 1YS7A 3GUCA 4ZVMA 2QQEA 1OLUB 3MWGA 3VOTA 1Y48E 4U7PB 4ZT2A 5DU2A 2C5GA 2VCEA 2Z57A 2ZG6A 1NW8A 4CMEC 4M89A 5KQMA 3ZJ5A 1Q2XA 2YC2C 4TMVA 1CY1A 1OXVA 1PG0A 3HBAA 1LI7A 3RTGA 1EGMB 2R4TA 2VHTA 3AR5A 1YDEA 2QV7A 4J4HA 1WU8A 4TROA 3RJ9A 2C98A 2HSJA 3AERA 4BP3A 5KTTA 1HQDA 3PWKA 2X76A 3W5SA 1MTOA 2DUNA 4CT5A 2BKAA 1B4DA 5K8CA 4M0KA 4JX8A 1MJGA 3C3DA 4LYFA 1QFSA 4NECA 1A04A 4IHQA 4XYGA 4UBKA 1L5SA 3C14C 1C3OA 1JKMA 3KJHA 1XQYA 4QPZA 2Q21A 3QXJA 4BX9A 2YVUA 2JH8A 4UCFA 5DBEX 4MTLA 1H2AS 4LG1A 4P0TA 3WZ2A 1Z6AA 5ECYA 4PZPA 3IR6A 1EWQA 2PKQO 2AN4A 1JLKA 2GBPA 1XA3A 3KJXA 2FPPB 2VH5R 3ZIAD 3A9TA 1KI7A 2IXGA 2IU3A 3VO8A 5CB4B 1IB6A 4PHCA 1CRLA 1F6WA 1JE1A 4M2LA 4ZAFA 3WLFA 3ZHXA 2PR2A 1XAGA 4C2AA 5E4FA 2P9JA 1P72A 4GVLA 5F35A 4YUVA 5FADA 4ACBA 1DC3A 2DWOA 3J7TA 4BMVA 2ESRA 4Z53A 3SYTA 4J6FA 2SCUB 1NRJB 5JECA 3NWOA 3O3CA 2CD7A 4II3A 4YP1A 5I51A 1OXUA 4Y2SA 1RXSA 4LXUA 3U81A 1EU1A 2Z5FA 1KDPA 5JLAA 4DLAA 3UTCA 3O0TA 4PPYA 3U56A 1SBHA 2CNWA 1FK8A 3PC6A 3HN6A 3SIWA 2GTPA 2HLHA 3ITEA 1NJ5A 5CVTA 2CNBA 2JK0A 3HLYA 5D3QA 5EJFA 5KKAA 5C8XA 1RWMA 3H2BA 4X7MA 3TQSA 5JAQA 5JTTA 3CR8A 1MIOA 5BW6B 1L4FA 3TXAA 3KQYA 3STYA 4E2WA 2FPOA 3E84A 3PLNA 3OOWA 3T7AA 4BQOA 4ZQIA 4GIBA 3L18A 1OHHA 4QLOA 3I4LA 3V2IA 1PSDA 3PT5A 1H0SA 4PHTA 2C9YA 5KMGA 3JQFA 4NMWA 3TMAA 4P9NA 3CZPA 1IJEA 1PQUA 3OLVA 1NI5A 1U0RA 2E6KA 2WNSA 3EARA 4YFVA 1R66A 2Y1LA 3K4PA 5AOBA 5BQOA 3TW0A 4IYRA 4IDDA 1X7WA 1X3LA 4TTSA 1P1HA 1TAGA 1L7OA 5ERGB 3P2EA 2Q7DA 4ACAA 1RAEA 1TO2E 1J7KA 2VDJA 1EFPA 3A6LA 3G8AA 4KE7A 4FMCB 4KH0A 4ZC8A 2PUFA 5F1KA 3C5HA 2JFFA 4C3OB 3A6PC 3C39A 3THXA 3THWA 2G1JA 4ZPJA 3KQUA 4FT2A 2YFKA 3B3QA 4UEQA 2AFIA 2AG6A 3TL3A 3B20A 2Q6LA 3KCQA 4AF6A 4CF6A 2NUPA 2HKIA 3NDJA 3CUUA 1O96A 2YWFA 2GTHA 3B12A 3H5TA 4HQ0A 1Z0ZA 4JUIA 4UXHA 1S2OA 3ZDZB 1PWXA 3NHJA 4P54A 2QP3A 1FMLA 1TYDE 2W2OA 3TGWA 1THGA 5IK2D 4R0MA 5KVAA 2H4ZA 4AX8A 3OE1A 4A16A 4NL4H 4QEZA 2X1LA 3ESAA 2X0IA 1P7PA 5CA1F 5KNLA 3OX4A 1DV2A 4JCCA 3KUXA 2C96A 3LP8A 3T3NA 3NMUF 3QPBA 4M9XA 1U3FA 1P0IA 1ZR4A 3F4LA 3H3JA 3DE4X 2BL4A 3F49S 3M6VA 3GLRA 4NICA 4AURA 3GFVA 3BGOS 1TTPB 5AUNB 3KTOA 4LC9A 2ZPAA 1Y5IA 4TRJA 1NPDA 4G65A 5DHUA 5EJ4A 2H1RA 3B1XA 4FCCA 3U7JA 1W5AA 3UJ6A 3W7BA 3C3JA 3S1AB 4E3ZA 5IDWA 4CWAA 5LP1A 1KDYA 2ZYUX 3BIOA 2E82A 3ANNA 3D5TA 4TRRA 1MX5A 4DSUA 2B92A 2LV8A 1JT2A 2QPTA 3BORA 4MWDA 2HYDA 1C8VB 4JI7B 1FU7A 4UXJA 3NTLA 3AB8A 3BDAA 3QEOA 3TSZA 1E2FA 1IE3A 4TXNA 5DBFA 3TAHA 1EVIA 5WRFA 4YJ2A 2XJ4A 4ZYZA 4O3FA 3BIXA 2ODQA 4R1NA 4F5EA 2H3EA 1TTQB 5ALXA 1T4DA 5ALTA 3UMJA 2D2EA 1R5OA 4M7PA 4DQUA 1EXMA 1NMEA 2YVLA 3NGXA 4YCAA 3U7RA 1XNRB 1WXWA 1T3GA 4ARUA 1DBPA 1W2HA 5KNBA 1QQ6A 1U2DA 2ZW9A 3KPUA 1K0FA 1RKQA 4OP1A 1JHUA 4CCWA 4C3UA 3O3NB 4K7JA 3KB6A 3UHOA 2Q1UA 3AF2A 1E69A 2W2QA 4CM8A 2FUG6 2XZLA 1IWBB 1NF3A 1GRCA 1YRHA 3H1TA 2Q0HA 3VYRB 2EKZA 1A9RA 3T9EA 2PXCA 5LQJA 4CLHA 2V7TA 3HWX1 4OFBA 5ALJA 2HA2A 4JWTA 3HDGA 1T1RA 1GAQA 2F00A 2TECE 1GTL1 1ZAKA 1ZD4A 2HF9A 3GZNB 3P9YA 4L4RA 4RSGA 3CKMA 3ZK8A 5L9AA 3FYDA 4MKIA 1MENA 3HJTA 2QVYX 3EUWA 5JYBA 4HS9A 3NP9A 3CXRA 3E22A 4X64B 4KVZA 3A28A 4TL6A 1E4EB 1X74A 3CEPB 3AZOA 3WLIA 4BVAA 3EVTA 2EW8A 5JVDF 4YXWA 5JUWA 4URVR 4B3TB 3QE2A 4ZVSA 5BMOA 3U39A 5JWRA 1O08A 3QVVA 5K03A 1OFIA 1C4XA 3GUYA 1EIZA 2PBZA 4BQFA 3LBHA 1G1MA 1CG6A 2GRUA 2P9ZA 1INLA 5LC1A 1OX6A 1PJ8A 1FYEA 3U3RA 1TLTA 5LQCA 3UMSA 1A96A 3MGCA 4DY6A 5C0OE 5C7LO 2Y0CA 1XR3A 1NVWQ 3F74A 4IBOA 1JG6A 1GL6A 1V16B 5A4JA 1DLIA 3KEGA 2PKEA 4CMIB 3P0JA 3T4XA 1LW7A 3W3ZB 4W63A 2ZE7A 4LFBB 1WVIA 3RC3A 4WNYA 1T8UA 3THYB 1OTYA 2A14A 1WXDA 2FWIA 3O93A 1KYZA 5EY5B 4HLUA 1WMSA 4HLNA 3K9FC 1NTRA 3U26A 1PT6A 1N5OX 4OK6A 3E8SA 4MW9A 2WQ7A 5BSRA 3L8DA 2WVJA 1TL7C 5KPJA 4C2BA 2ZJFA 1EM6A 3RC1A 2AG1A 3KBOA 2VZ8A 2VP2A 1NL3A 2CVPA 2XECA 1TT5B 2CLCX 2FRXA 4IIFA 3U4CA 2UDPA 3JSAA 2YXEA 2R47A 3K5HA 4QQNA 4AG5A 3B2NA 4MLZA 3MB5A 2P6UA 2RAUA 3W5AA 2RG7A 2IYLD 1ENYA 1WKCA 3TSOA 3JD3A 2ADMA 2EP7A 2CXNA 2W2PA 2FYTA 3KEFA 2M9MA 2QI9C 4UTRA 1YR7A 2QW8A 1P7ZA 2WM2A 4MIEA 1JTVA 5KTMA 2YV3A 5IM4F 3KD3A 3V7FA 3V80A 3HY3A 1JIJA 1GGEA 1HT1E 5KYXB 3T38A 2WT4A 2EVWX 1MAHA 4J03A 4N5NA 2LIPA 1WVGA 2TMYA 5HYVA 3ADBA 1VFNA 2DKNA 2ENWA 4FNAA 3E6AA 1B8UA 1QH1B 1GU7A 1AG9A 1Q91A 1U2QA 4K9DA 4QLBA 5ES4B 2GYYA 2NZ2A 2F43B 1GKLA 3UMMA 4ZCSA 4E4RA 2EKBA 1EXDA 1C50A 2OC4A 1JQBA 1YOVB 3KQNA 2ADFA 4DCTA 5K8JB 5KVSA 1M75A 1NUSA 3VR3D 1LS6A 1PNVA 3D31A 3EWNA 3R9IA 1EZ1A 2HXGA 1Y7HA 2VQDA 1XRPA 3FF4A 3JQQA 3N8HA 1SURA 4R69A 3N87A 1S2GA 1V43A 3IP3A 4C0LA 2P2ZA 1QZ3A 4D6XA 4MUAA 3WK7A 2H4JA 3OQ1A 2YV5A 1TOAA 5CHEA 2Y27A 3SBOA 2CXTA 4MLDA 2D0PB 3B3AA 2D1TA 4GP6A 4G01B 3KOUA 2E6UX 1ESMA 2HA0A 4L9RA 3P9CA 4NJMA 5ILGA 2Y1XA 3L79A 5LIRA 2VJOA 3QLJA 1DJPA 4O4IB 3KQOA 2WWXA 3OI7A 2VDNB 5CVJA 1I2DA 3TLCA 3KUUA 1H6AA 3CH7A 1W4LA 1Z83A 1QE0A 4QDTA 4UHBA 4J1TA 4WCFB 4IM7A 5CA0B 2Q7OE 3FNQA 1D4AA 1PUJA 1XN4A 2IXDA 4JUCA 2BJWA 5REQB 4BLPA 2YRFA 3EVCA 2Q6OA 5LWQA 2BHTA 1GA1A 1VL5A 2N75A 4L51A 3QA9A 1R88A 2A33A 3QHPA 1NA5A 2R2GA 5JC1A 4CF7A 4IDGA 4E2YA 4MVWA 1AUXA 4MPPA 1OX4A 2BMDA 1GDHA 3C3KA 4X8OA 2BKXA 2PKQP 2WNIA 1I2AA 3A9CA 2KPOA 3ZHVA 1XF9A 4R2WA 1F1JA 3RCBA 2XA9A 1E3JA 1V4NA 3DT6A 1A98A 1WIWA 2F2TA 2IHJA 4OK3A 4EPXA 4CXMA 3IIMA 4MQEB 4OLHA 4AUKA 4M0UA 2BI4A 1CR1A 1H94A 1NBWB 1T9AA 3WIBA 1FDRA 1L5WA 2MR5A 4NBWA 4XIGS 2WE8A 3F7MA 3ZBPA 2XTJA 3COVA 2VTVA 3E3NA 4OKSA 4I50B 1JLMA 3FKJA 3LUAA 1KOLA 4C3ZA 2H5EA 1E1RA 3FWHA 3T12A 4CI0B 1OCEA 2F90A 4H7JA 1Y63A 3TJRA 1UDBA 2OCYC 3WYCA 3FBTA 4MHSA 3TR5A 4AMYA 4DHEA 3FWPA 1A7AA 4QRIA 3KUDA 2BDUA 2J3HA 4QFBA 2JCSA 1E2LA 1TK3A 1J5XA 3O74A 1G8GA 5CFLA 2X2FA 3GUVA 2DERA 1EGVB 1UR5A 1MDBA 3R3SA 3L8HA 2NQTA 2QTZA 1VJ0A 4MJ3A 4UZFA 3S44A 1XHEA 4EHDA 3PFCA 7ABPA 2FQ1A 2JCGA 3Q41A 4MPTA 3M89A 3DE6X 1N5RA 2BR4A 1G7CA 2P69A 2QVBA 3DAHA 1KVTA 1DKLA 4YQZA 1WUTA 3NC1C 3KZMA 3CNNA 3ZE9A 4J0HA 2O8FB 1ZZGA 5IF3A 1KZGB 3K09A 4WIAA 3VHXB 1U0OC 1WB5A 2X9NA 4RTOA 5KOJB 3WL6A 2JKZA 4UHKA 4X7RA 5K0FA 2QN1A 1FRFS 4BJHB 4IH9A 2D0DA 2I03A 1ZJ5A 1ISHA 3ZR4B 1LBQA 1V41E 3RIYA 5JALA 3QFFA 1Q0HA 2YR0A 3ETNA 1ATIA 4GR9A 3GRCA 2ZJAA 1FUKA 2FZCA 4KXQA 4P7KA 1SBTA 3R7FA 2G07A 4DGSA 5KVCA 4DQLA 4MEBA 1FPMA 3K31A 3GA7A 5E2BA 3UGKA 4E1BA 3H5AA 1JSLA 2P7IA 3EVDA 2XCQA 3BUSA 3GGJA 1XEXB 2CFCA 2VJAA 3EXHC 4RD1A 5CVVA 4QXOA 4CCAA 4LSWA 4PRLA 1JH9A 1ZU5A 4AN4A 1PLKA 2Q3JA 3IA7A 1FJGB 5CIQA 3DDNA 1S9HA 2VXYA 2N3ZA 1LRKA 4NG4A 5CJPA 3HWRA 3EY4A 4HDOB 5C4IA 5LQNA 1IJFA 1WCV1 2WPDA 3H9JA 4QJBA 1J1ZA 1F60A 1FLDA 1OSNA 2Q0QA 2QT9A 4C0QC 2AN1A 2ZIAA 5KB3A 1SUPA 3VHLB 4IJ6A 3ZBUA 1PSWA 2BGWA 3B60A 3IUQA 4TS1A 1KSFX 3V3TA 5MF6A 3X2FA 2ZJ3A 2WSLA 4KJZA 4ARBA 2W0SA 5ICEA 2DFLA 5KNCD 5GADl 3V4ZA 5BVGB 4CRWB 2XEXA 2EG5A 2JIBA 3NETA 4TUYA 1UWCA 5BYKA 5K05A 4CVNA 1Q95A 1JFSA 3C7CB 4JOCA 3ZJ4A 4JROA 4J0EA 5E8RA 2PMEA 4AKEA 2GPSA 1T0PA 3ACDA 4H18A 1XDBA 4BIIA 1HEUA 1C41A 1UKBA 4C30A 2J3QA 2GBGA 4OHXA 4Z2YA 2WSMA 4CM9A 2X7HA 4OQEA 1AV7A 5HKAA 1U90A 3RVPA 1D9ZA 1KJJA 2G0NA 2I2BA 4N39A 5JDIA 1VRWA 2CNDA 4OHMA 3VYTB 1SCNE 4NHOA 1DO0A 3OZ7A 1IBMB 4FR5A 3ZWPA 1T5IA 4W9NC 1UJMA 4XPIB 1EBUA 1A69A 2ZYIA 4X3PA 1FSGA 5BXQC 3JQ9A 3RTAA 3M3HA 1DMRA 1P9NA 2LBPA 3JQBA 4IG4A 3GUZA 1IAQA 2VJPA 3QU5A 5SYMA 3BQMB 4LYDA 4MP8A 1ZUIA 3EE6A 5G4KA 4YRTA 3SP1A 3E18A 3CLSD 4Q0MA 3T7SA 3MWYW 5DT9A 4X92A 4RFSA 3O26A 1JIQA 3TTWA 2PX0A 1N2CA 1BX0A 1K2VN 3ODPA 5GY7A 3NKLA 3BWXA 2QD4A 4JLSA 3ZDEA 4IGFA 1VDZA 4BWFB 5CBKA 5CH5A 3KZXA 1G66A 1P60A 2J5RA 4DQVA 2QL7A 2XXBA 3GI1A 3VNVA 1RXCA 1V0JA 3USCS 2ES4A 3HDVA 1MAVA 2HRDA 2AI3A 3JQAD 3K2QA 5GGXA 3RU3A 3S1LA 3K1JA 3O03A 2YQZA 3KE8A 2OHIA 1LX6A 3G2JA 4FZRA 2WP8J 2PUBA 4EKDA 2WQ6A 2RCNA 4TWJA 3JALA 3PE6A 5HRAA 3ADPA 1D0SA 2P4QA 5CURA 1HQCA 3ZV6A 3QMMA 2P4SA 3PRYA 4GOJA 1JF8A 4LY3A 5IZCA 4QREA 4ZXPA 1BDMA 1XXHE 5CM8B 1BXGA 3FR8A 1EVJA 2A7QA 4PLFA 4B09A 4QJ4A 5ER9A 4E7OA 2JLVA 3DF7A 2NVWA 5ELLA 1S6YA 2H2HA 1WBJB 1NUPA 1U8CB 2BIFA 3UGJA 3DDHA 1HEYA 4TLBA 5AVQA 4NNPA 2QMQA 3KM0A 5H9WA 2QZ4A 2EZ8A 1YRQA 1GL7A 1HG0A 4FXOA 3SQWA 2IWHA 1N9GA 1U0EA 3FPHA 1LD3A 3PZBA 2IKSA 5FH9A 3LX6A 4J16C 4WTOA 2XAUA 3AJDA 1M0SA 2HSGA 2VI5A 1B2RA 3WIOA 4EG6A 3WDSA 3UMFA 3IQIX 2DFTA 5JFTA 4JLWA 2YCBA 4R2IA 2OFOA 2GR9A 4D4JA 3F9CA 2XUFA 2H06A 1C30A 2PZMA 2O2SA 3JU3A 1PFUA 4AD8A 4B3GA 1I6KA 3AGPA 1P62B 4GSKA 3LDGA 3FNGA 4FWBA 1I14A 1ZCJA 2WJPA 3HSYA 5AHOA 1W4BA 2Q41A 2QRGA 2Q49A 5DLQC 2GBCA 2JD0A 4L15A 4QOGA 3SLGA 1JN0A 5JWHA 3O9MA 4M6WB 1QQAA 1RC8A 1RYYA 3UG6A 3SE0A 3C8ZA 4Y2HA 1KPGA 1SCQA 4QVKA 2E4XA 1USKA 3IMEA 3O2JA 5I9LA 5IVKA 1G63A 4LHVA 3VVCA 2O8CB 3LVFO 3UK2A 4RENA 3V48A 4AKIA 8LDHA 3FTFA 5DTIA 3K70B 4NBVA 4LXHA 3PUZA 4RL6A 4C22A 1JWAB 4KXMA 4Q3LA 5BO5A 2AXPA 2QSYA 2WV9A 1GD1O 4RSHA 4HDRA 3IUPA 4P08A 2J9FB 1BCSA 1BEEA 4RVCA 1YZVA 4QM6A 2IHUA 1ZD9A 1GTMA 4HRVA 1KI1A 2EFCB 3DEHA 3QH4A 4RMGA 4W5QA 3QEKA 4RHYA 2Q28A 4DDKA 4CLRA 1HLGA 2A5YB 5CVUA 1G21E 4WMLA 4CM4B 2PLFA 4BX0A 3K05A 4P5PA 1DEAA 4JJKA 2A3NA 2EGHA 2ZANA 2Z8YA 2BF7A 3KB1A 4KO4S 3WL8A 2QUZA 2AOVA 4LVNA 1DU4A 1N2GA 2R8PA 1FCJA 4BYGA 3LCVB 3HFSA 4BUCA 3MNFA 4CMJA 1GQYA 2H7XA 2PGNA 3M6WA 2I34A 4QPNA 3I52A 4I1SA 1TC2A 3F98A 4TQAA 5I45A 2V1UA 2FEPA 1UP7A 3N3AC 2QRMA 3R5KA 4IRXA 4EUSA 1B8NA 3MCTA 3ZLJA 1QVVA 2IOFK 3H4VA 2F48A 1T10A 2R8EA 3P9ZA 4C4ZA 3KAKA 4XUEA 4A8PA 2WUWE 1JR6A 1K06A 1W25A 1MX9A 1E1NA 4I4LA 5TGTA 1OXTA 3VC2A 2H92A 2DR2A 1RC1A 1XZBA 4JXXA 2SHKA 4QHTA 4ER5A 3T8YA 1P19A 1C29B 2NGRA 1YQEA 2YMPA 2PAFA 5AVSA 3CISA 5B3KA 4CLOA 2COEA 4RH3A 5HHTA 1N8SA 4MV6A 5DYNA 5LQSA 4A2PA 1AHPA 4TYQA 1HQKA 2C1ZA 3R77A 2F9LA 3MUOA 5DLYA 2ZIWB 2ZJ2A 5BPFA 5ICGA 1JPUA 3OZXA 5CJ2A 5DASA 1OQAA 5DM1A 3HP7A 5GIPE 2CUZA 4PXSA 1E1CB 2Q2VA 3TGLA 3IQHX 3E9MA 5DW0A 3NANA 4DDVA 4IIDA 2XCTB 1E94E 1NW3A 2B5WA 4KG7A 3QKRA 4E7PA 2OXCA 1FFBA 2M6SA 4AJLA 4BLRA 5B2EA 2LZ0A 2WFLB 3IMCA 4DXAA 1M1NA 1PJQA 2J9RA 3A1EA 4GI2A 4BFUA 2FZEA 3AUJB 3B85A 4JX9A 2HUNA 5JAZA 1OBCA 8ADHA 4Q9DA 5HTKA 4CN9A 4MCJA 1AZSC 3Q9UA 4IIVA 1WY7A 3EZFA 3U16A 1SIBE 1YR1A 1A5AB 1GEEA 3K8OE 1ZRHA 1FFDA 1E0AA 2Q8QA 3DTNA 4P35A 5HM8A 5FOUA 2MSDB 2Q29A 3WNZA 2G63A 3MCVA 2D1SA 1L5GB 3NP7A 1E5QA 1CYEA 2MSCB 3PDJA 1FUEA 3ZS8A 2ZAGA 4JJFA 5AJWA 5AJVB 1I7SB 3JVEA 4YQEA 1I6WA 3ZQUA 1FBNA 4G5YA 2G7MC 3UAVA 5GV7A 4NULA 5C32A 3NRCA 1JSCA 4FYXA 4NZ9A 3C97A 4NR0A 3FB1A 2ZRJA 2XUGA 1OGIA 4HXYA 1Z0SA 2CNNA 1ZCZA 4CIDA 1N6NA 1GVNB 1QX4A 2R751 4YFYA 1V3QE 3NH9A 1Q2UA 3A58B 4MV4A 4PX5A 4R2KA 2DPYA 2QDXA 1KZ7B 3G2HA 2QPAA 1J99A 3K2IA 5C7OO 5IWCA 4I4IA 5ENZA 3ZZMA 4G1MB 1TUGA 3K8ZA 4GZ3A 5GINE 1DUVG 3DCIA 5ALKA 4OQLA 1FXWF 4E1VA 5LNK1 5TMPA 3H2SA 5FD8A 1K1EA 1F9EA 2BFPA 3UB4A 3CRQA 3O94A 3ROQA 1UBOS 1BVYF 1L5KA 4B84A 1F1BA 4URFA 3LHSA 4GXQA 2Y05A 5IAJA 4HXEB 2F3SA 1JQAA 5REQA 2ZJYA 3VVMA 3KKZA 4MITA 1CZUA 3KSAC 1EUCB 1HE5A 3X0DA 2BFEA 1PZHA 1JZSA 1M6YA 3L8MA 4OXXA 3QBVA 4R8SA 5JNRA 5HX7A 4ZODA 4I36A 3RRNA 1YMUA 5BVHB 2GRJA 5CB4F 3OOYA 3CRZA 1BVRA 3QWBA 2G9NA 3RLIA 1TM2A 3PWZA 3NGMA 4YLGA 1QNLA 3VU8A 1Z6YA 2OYCA 3RVJA 4D9FA 4HRAA 4OCZA 1SUWA 1GNSA 3HEBA 3U5ZB 4PE5B 4YT4A 2OV3A 4IJVA 3QYAA 1Z33A 3M0EA 2B2NA 2FWAA 2ZSJA 5ALLA 5TSDA 3ZXXA 4Y1RA 1RMYA 3MRTA 3FRJA 3HBFA 1BXKA 2C9OA 5BW8A 5HKBA 1EHCA 4HY3A 4KQHA 5J40A 1J7JA 4BQEA 5TJHA 4MUGA 2ZYVX 4BO0A 5H4HA 2F8TA 4GF5A 4MX8A 1SQSA 3RRZA 2EHJA 4B74A 4JLPA 3IQFA 3MWDB 2JCXA 2FSFA 1OY1A 3LQFA 4RQBA 1WXQA 4RETA 5G1NA 5KWSA 4BNDA 2QN3A 2JGIA 3OZFA 2XUJA 3KOYA 3FDFA 5E1OA 4DWJA 1LLDA 4R1LA 3MD9A 4KB5A 4O4JB 4MVJA 5JAOA 3M4JA 1ES9A 2MDTA 4KE9A 4PGGA 3FBGA 3FZYA 2W8BB 1T4CB 1VPWA 3T7KA 1N0VC 3U19A 1YR8A 2RHCA 1S7CA 4G63A 4I4TB 3RS3A 2OM2A 3K71B 4BNIA 1H4QA 1LC0A 2D1FA 1UJ4A 3G5TA 4PTLA 4RBNA 3RH0A 4XVCA 1CJSA 3WBKA 4HXFB 2GA8A 4FMCF 3FFWA 4WKOA 1XZHA 3N2KB 3FOWA 4Y6GB 3WNBA 3I5YA 2AEJA 2NNWB 4YALA 4A6XA 1D2NA 2QGZA 4O3MA 1PEAA 2FPIB 1TQHA 1T5TA 3LWDA 1Y8QB 1SVSA 1IBSA 5IEJA 1RWNA 1YR3A 5B6IA 2JLYA 3R9WA 5CX4A 2BGTA 1EEXB 3KLNA 4GMGA 4KRXA 1IBRA 2OKCA 4L85A 3ZDBA 3BD7A 3PP8A 1UFVA 2BJVA 4KIJA 3PE3A 4HDKA 1YONA 1KVRA 3O8DA 1O94D 1QIJA 5BQPA 5HIKA 3D3JA 3CUYA 2UUCB 2XZDA 3F96A 3K72B 1WLYA 3MM4A 2HMAA 2FZWA 1P6QA 3VXKA 3DAFA 1VIDA 4BWVA 2CXHA 3G9UA 1HOTA 3MG9A 4QATA 3TRKA 2OBBA 2IZ7A 4B4OA 5F23A 4KWEA 4CFSA 3T35A 2NO0A 3F9IA 5JCJA 5H3HA 3F7TA 3D4LA 4KRYA 2DQKA 3DV2A 3CLSC 1ZK2A 3F6CA 2QTMA 2II6A 4FMDB 2B2CA 2X0FA 5DW3A 3SNKA 5BR1A 3OJLA 4BXOA 3HJCA 3D2CA 3QYJA 3EW9A 3S28A 1AKYA 1TU3A 2DPXA 3SSOA 7GPBA 4QRHA 1YFJA 2B0JA 2V7PA 2FI1A 3ZGLA 2SKCA 3TI7A 4CF5A 1C9NA 2ECQA 1XMJA 3VKGA 3UT6A 1SHKA 3DV9A 4YCSA 4A5OA 4J8PA 4JUDX 4MW0A 2C42A 4FPXA 1TRKA 1W46A 1SCAA 1Q1GA 1DX9A 4HKTA 2ZULA 1QP4A 3P5SA 2ZBRA 4AO7A 3SOZA 2BEWA 1J39A 1H42A 2QUHA 3IIIA 3L92A 3E7DA 3IR7A 3PFHA 4P84A 3UV6A 1RJGA 4DM7A 4TSFA 3B2QA 1P45A 4BKRA 2BYTA 2QMHA 3OETA 2GFIA 1MFPA 1LK0A 2QG9A 1Z56C 1IXYA 2BM8A 6AT1A 2PX4A 5AKHA 4FWTA 2JA1A 1U0SY 1XQWA 2V45A 2RH4A 4AM8A 3TMKA 2RH8A 3C3XA 2ZAYA 3VU0A 2D2XA 2ZS9A 1O6CA 2VJBA 4KYIB 1G3UA 1R74A 9ABPA 4BMYA 2MTBA 4C1NA 1JSRA 1D2RA 1VE1A 1VBKA 4F8YA 1G20A 2KX7A 5BY2A 2DXIA 1OV6A 3CF4A 4JU9A 4CQMA 2Y1GA 5EKTA 1NNSA 2ZIXB 2A94A 3G82C 4HYYA 2O2CA 3IL2A 2OECA 2BD0A 2YHBA 4IZOA 4D4HA 4EBBA 2IH2A 1D4ZA 3R3YA 4NK4A 1R0XA 3O2NA 5KIAA 2WF8A 4IDQA 2EG9A 3IKJA 4K1XA 4EG7A 1XVUA 3BWCA 2SKDA 3JVVA 4F1WA 3LBAA 5ELMA 1ZQ1A 3B7PA 3KO8A 2W11A 3GLUA 3M1LA 3PJFA 1H8EA 5CEEA 2HHLA 3WGQA 2GEKA 4DWVA 4U7DA 3C6ZA 1PK8A 1S4QA 1V47A 2ATIA 1WCYA 1J56A 3O5AA 4PZDA 5J1TB 1JZQA 1J0XO 1KK0A 1TYEB 2NTJA 5HQ3B 4GKKB 1QTIA 2V7QD 1XCMA 3H4MA 4UZEA 4ZOLF 1ADJA 4CQLA 1KP2A 4XWKA 1F14A 4JDPA 1Y3DE 4EFKA 1JPVA 2I54A 1WP9A 1NN5A 1U7XA 1Z62A 3ZLVA 3GVHA 2OHOA 4YRPA 3TLBA 4JBYA 4F9GA 4IH4A 4UMDA 2F17A 2BH2A 4XAQA 2W83A 3W2HA 1QQ7A 1CZOA 2LW7A 4B32A 1LXCA 2VHWA 3QNWA 2VF8A 1D6NA 3EF3A 3AXTA 4RD0A 3AVXA 1J09A 2W98A 1PR5A 4OG2A 4A8JB 5FOQA 1FL9A 1XF1A 5JPCA 2NU7B 1QIKA 5BN5B 5MGBA 1IN7A 3HYRA 1S3SA 1THMA 4TV9B 3RJTA 1MJFA 4FOTA 3U7IA 5A3VA 4NCHA 4WGGA 4FGJA 1LWNA 1JIIA 1VPEA 3REQB 2P3SA 1F0NA 4LDQA 4LV5B 3PEFA 2GDZA 1M2VB 3LWNA 4WOCA 3O4GA 2LGJA 2IWRA 3T1QA 2OXIA 4KBYA 2XOXA 5HF9A 1U0LA 1SUSA 1A9TA 3Q72A 3KSRA 2AG0A 2ZUUA 3VYSB 2QTWB 1D7OA 2NP6A 3EDMA 1GTVA 4ZANA 1P80A 5I7EA 3SAJA 4CEHA 4Y30A 2D06A 2KMLA 5ECDA 2QP4A 4LOLA 3SDZA 2DHEA 2JFZA 2ZVDA 3QENA 1ZM4A 1WY5A 1R64A 2A59A 2X0JA 1FBTA 1H3NA 1W5BA 3EQ7A 3ONWA 3LSYA 2JJ2D 1M67A 2BFDB 3OHMA 5H0IA 1MVLA 1XYGA 3OY2A 2OZPA 2WF5A 2WD9A 5J4VA 2C1EA 4A3SA 4FB4A 3I28A 3P19A 4RS4A 1SRQA 1TYCA 2XGMA 1EXNA 4JNKA 4JT9A 1M1YE 2QRHA 1QHYA 2BE9A 2EFGA 4NCKA 4YMHA 2YHAA 4NBTA 4NBSA 3OAAD 1WDKA 3PHGA 3N0XA 4NU5A 3VGPA 4HQKA 4AWXA 1NRIA 2O19A 4JVNA 1GQSA 2IYWA 3UTDA 3MJEA 4MS4B 2B25A 2QRKA 3BFXA 5EJIA 1II8A 4F45A 1I3KA 5LMNB 4R7TA 4R3WA 5FNZA 3P2KA 4PINA 3FOAA 5FUMA 2WIDA 3QTLA 1BCRB 4XVQA 2NZWA 1B73A 2VJMA 1FQJA 2GM5A 1KYIA 1U7DA 5ALPA 2AA3A 3FCSB 4AN1A 2QHXA 5T57A 3PJGA 3AEUA 3BH7A 1PLJA 3FETA 1HDOA 4OYRA 4LY9A 5JLJA 3KQKA 3PQ6A 4ND5A 1KAGA 5DISB 1VPDA 4P5DA 4ZVPA 3H1AA 4GQIA 5CPFA 1WULS 5CCXA 3OQIB 4O4IF 5EOVA 4CKWB 3BSSA 4RD6A 2QD3A 3LQ1A 4RQUA 5JY1A 3NJ4A 4F85A 4MRNA 1Z0IA 3CS3A 2P9EA 3GFTA 5CA0F 1D8AA 1EI9A 4TZTA 2AL7A 2O3RA 5ULLA 4DR3B 1I2CA 1BHQ1 2XBUA 4JBLA 2NO9A 4HP8A 2P2NA 1XU4A 3R3JA 3ZCVA 1KQPA 3SMVA 1Q22A 2XXAA 1WE2A 2LPMA 2NU6B 2A1UA 3CRRA 3QZUA 1CDDA 1WHSA 2X5OA 4G41A 4NMLA 1UC5B 3A2NA 1BOFA 3CO5A 5K3DA 4J2OA 4P53A 5EIAA 1J07A 2IHYA 3V8QA 1J5PA 2R48A 3H0EA 3ZD9A 1JKIA 3CGGA 4I1VA 2NIPA 3WQQA 2R11A 5AW7A 3ANTA 1K08A 1ONSA 4GOXA 3MJFA 3V9PA 3PL1A 2J09A 1G42A 4LPKA 3FYUC 3V1UA 4ZMBA 1W75A 3EMDA 2DQZA 2E49A 2RHRA 3Q3HA 4D8VA 3V4PB 4DWOA 1BFUA 1J49A 2HDNB 1D03A 3FD8A 3K0KA 3QNUA 2XTZA 4HX5A 4W8OA 2VUIB 521PA 3RF7A 4B6EA 1SQ0A 1A5TA 1VE6A 1E9FA 3CSUA 2R8XA 4I50F 4RLFA 3R9XA 1L7DA 1W59A 1X7YB 2J08A 2PX8A 1IN4A 2IDJA 2PRIA 3D4BA 1I1HA 4B46A 1AA9A 1HETA 4DCGA 2AD1A 1JHVA 4NAVA 3AU8A 2Z4RA 1NG9A 3UMGA 5KWEA 4NYIQ 5JI2E 3MA0A 4ESOA 3GLFA 3ADCA 3M6IA 1MG5A 3V8VA 3W2EA 3KQWA 1DG9A 1JYEA 1SJ9A 3DQPA 1LBHA 1OTHA 3M34A 4X6UA 5ELXA 2QAIA 1UFOA 5DSXA 3O8RA 2GCNA 3I0ZA 3CT4A 2Q4RA 3L7IA 5J5AA 2QVGA 3GV0A 4U0JA 5IBCA 2QTAA 3IUNA 1GTZA 3MBKA 1PDOA 4EHBA 4QDJA 1V5WA 4J0KA 3IHLA 1AO0A 2R25B 1T3LA 4Z54A 2TMKA 3C45A 1IZ7A 5BORA 3OCUA 5BV0A 1LJ8A 1V8DA 2FRDC 1ULZA 3IPLA 3H97A 4AMGA 1B43A 4QOSA 1TCCA 1X0VA 1QJ4A 1KFBB 2GYUA 1EWRA 1HDEA 2FR1A 2WBLC 2XMZA 2CJFA 4F6CA 5EPEA 3WRYC 3W3AA 1SBYA 3S40A 3HU1A 1ZD1A 2IIPA 1MB3A 4Z4FA 4G5GA 2CJXA 5L3QB 1XLUA 2J3MA 2I4TA 1E60A 4YMVA 4H15A 5A3RA 3GJRA 3N8DA 1N2SA 4K28A 3KJIA 4OHFA 5BRAA 2GN1A 2ID7A 3LOPA 4KQCA 1D9XA 3P5BA 1HFEL 3EPJA 1QGUA 4FDAA 3QEAZ 1KO4A 1Q74A 1U3GA 2H52A 2I87A 3Q9LA 3TIVA 2EGGA 2OXFA 2I4IA 5ITSA 1X7ZA 1AUOA 5DBGA 4MJLA 4YUYA 3CT6A 5IX8A 2IW1A 2J5BA 4DIOA 4EDFA 2FMTA 1MJ5A 4OHKA 4DT1B 5DP2A 3K0FB 2OT3B 2WYWA 2YVKA 4FHCA 3ONEA 5EXDA 2O14A 3QSGA 4R8LA 3ZCRA 2GSDA 1DKOA 2O2YA 2VTDA 3O90A 1UKAA 1J8YF 4JA2A 5FYQA 1O87A 2CL7X 5BUZA 7YASA 1M8PA 4MYHA 8GPBA 1M0WA 2HHCA 3MT9A 4N7JA 3X1KA 4AMZA 1P3DA 2XSZA 5K3AA 2EZUA 1E6EA 2JVJA 1D8TA 3DMDA 3GGSA 3Q9SA 2C3OA 3EW7A 3WL7A 5IT4A 2GHRA 3MXOA 2PT6A 2XW6A 2PKWA 3IULA 3G0IA 3O2QB 3PFBA 5FV7A 3BG5A 1CUSA 1E79A 1K86A 1PV1A 3DBRA 4RA6A 4CU2A 3PTAA 2PT5A 3BEOA 1XMPA 3MGAA 4HDNB 2CXXA 5CNKA 3NPAA 4IHJF 2OO5C 4K26A 1DDIA 2J5KA 1BMTA 1YBVA 1XNQB 3P20A 3ICEA 1G3IA 1K75A 3O7MA 4F11A 2ANCA 1B16A 1K3UB 1RJ9B 3OM1A 3ORHA 4BB5A 2OV1A 1N7JA 1JHPA 3KVRA 2VDKB 1KTIA 3KEMA 1ZITA 4Y9UA 4ZCPA 1XQVA 2GZSA 4XFJA 1S96A 4PYJA 3FWNA 1EDZA 1IL0A 1QIIA 3O47A 4FMPA 1UUFA 1QVWA 4XQ0A 4ZWNA 4DSOA 2JAUA 3FUVA 4F2WA 2F4VB 3JPWA 1ZJZA 4OH7A 4C4XA 3W9UA 4YMIA 4XYBA 1KVUA 2XYVA 5EZYA 4ENPA 2W6QA 2OUKA 1KI2A 1VPVA 1FX0A 2AE2A 2ZOSA 1LK5A 2B21A 3A9VA 3B89A 3PX2A 4BWGA 4MWZA 5JJKA 3BJMA 1DRUA 3OM9A 2XA2A 5DP1A 2G5CA 5KUTA 2P5UA 4G1FA 1N7GA 4OXKA 1A5SB 1MRNA 1MNQA 4H7IA 5JMTA 1AUVA 2YFYA 3LYUA 3E61A 4F4JA 1LI4A 3TVYA 1WCXA 1N4AA 3U13A 4HTFB 1IN1A 2VDLB 3H0KA 4WKNA 3EEYA 1XGKA 2A58A 2DE0X 1ZUHA 2RGEA 1TKCA 3EVGA 5K0TA 1RT9A 2BCEA 1X15A 1ZWLA 1PTJC 1QP8A 1Z6ZA 5F3RA 3T1HB 1AK9A 3NUZA 1U8YA 3IPAA 4OI4A 4D8YA 4ZOEA 2KSQA 4FVTA 3FB4A 4IDOA 4L8VA 4V0MA 5HF5A 3VPGA 3AUKA 5IJ0B 1ZJ6A 2WJAA 1WF6A 1EVLA 2SICE 4LOHA 4TM7A 3A4YA 3SYNA 4KNYA 1NXXA 1Z2PX 3ZTYA 2JIZD 1E6UA 4MWSA 5TMDA 1JEQB 1H2XA 2B8TA 5AUPB 1QRSA 4IQ4A 1FQWA 2JGFA 4LYJA 1PQPA 1O0CA 2PWPA 4PONA 1V71A 3QBTA 3PEVA 4XX0A 2XMBA 3GYBA 5B57C 1E8NA 2LNDA 4FYIA 4PXAA 2HK6A 1CJMA 3G1TA 3H13A 5DN6A 1TPYA 3K2EA 4AK9A 1NW4A 4DV0B 1MQSA 2WF9A 3ESYA 3ZC3A 3IBYA 4DF3A 2X3FA 2X15A 4B3IA 1ISPA 5DGCA 1Z37A 1GEGA 1QCCA 1B8PA 3CMCO 3F67A 3IBTA 1ZGAA 4MNTA 5BUQA 1O5OA 3FYSA 4EY6A 2OV6A 4FS3A 3QHAA 1SCJA 2J31A 5JYCA 5IM5A 1HSZA 1KQOA 4ATNA 1XTKA 2NO5A 1KC1A 4P2BA 1VIMA 3DLPX 1RYFA 2R65A 2VNHA 3KHKA 3OY7A 3QVMA 1TGVA 4G6ZA 1YC5A 2J85A 2OG1A 1PRYA 3EZNA 4Y67A 4D7AA 1R4ZA 3BMNA 4E4YA 3RSZA 2V9ZA 1PQWA 4IV0A 2HC9A 4YAWA 2B1IA 1TM1E 1ZOIA 4B7AA 2WJZB 2ZAIA 1RYMA 3Q12A 1HT0A 3DKPA 4H1UA 1PS0A 1IFXA 2FFBA 5TPZA 1Q1EA 1CVLA 3S2YA 4YXWD 4CEJB 4TUYB 3JAMA 1KEPA 1GNLA 4KO3S 4UEKA 3K9NA 2DUWA 5EGNA 3L0PA 1LLUA 2QA5A 3FROA 4TWRA 1DJQA 3SZOA 3GFOA 3HU2A 3IT3A 2OFFA 4TWZA 2J7PD 4RK6A 4U9UA 3FHJA 5JCOC 3A32A 3RAPR 2VT3A 2QTTA 1GGHA 5IYZF 1SFRA 1K8XB 2P9TA 1Q17A 3BK7A 3KTFA 2TRSB 3WDKA 3QMVA 4BFTA 5I7SA 3L01A 4XQGA 5BQ5A 5E3IA 3BD6A 1C7FA 2ZIXA 4DQKA 3RVKA 1SCBA 2ECPA 4Y7CA 2EYQA 3ML1A 4PIPA 1U3TA 2BN4A 1PJ2A 1VSUA 3D8SA 1I7NA 3CSSA 3E9CA 2R96A 1T0UA 2ZSEA 2UYHA 3TPZA 3TUIC 4ISBA 4Z49A 1VHDA 4F91B 5HJ7A 5B3JC 4D2IA 1EUQA 3IKTA 4OBEA 1MXHA 4YBZA 2R8RA 3A7EA 3U4QB 2EBUA 3U3DA 2OXEA 1RVDA 3PGKA 3WDMA 4BNNA 2D5AA 2HZBA 3ABSB 2N0SA 4Q4HA 4ZAGA 1E9SA 2VIIA 3LDHA 5E9AA 3WGMA 4B9EA 3ZZTA 1KO5A 1UXOA 1HZZA 4NKRA 1ZONA 3ADOA 4Q3KA 2DFVA 3RV3A 4BX2A 1QKJA 5AHWA 1BNCA 1VSBA 1Q6YA 2VUUA 3VDRA 1DEKA 2HJSA 5B4TA 4I8IA 5DBHX 1WCIA 4YLEA 1W5TA 1E1KA 2OB1A 4JLVA 2SECE 3L02A 4FI3C 4D3YA 2FDCA 4OD0A 1AQIA 3KDSE 4ZYLA 4MVYA 4XIIA 5EFZA 1L5YA 3JQ8A 3W1VA 1UKYA 5K3CA 2W2NA 1ZMBA 4E08A 1B14A 3H83A 1Z74A 3BTSA 3GYGA 4PYMA 3NWEA 2QZ9A 4RKWA 1Z0KA 2JFBA 5CP8A 3R6WA 5CBPB 5BSVA 1CFZA 2EARA 3KALA 3M6UA 4AY5A 4DLUA 1P2UA 4H3VA 4Z4QA 1JR4A 5JADA 3SWWA 3DBLA 1V9LA 5HDQA 1FP4B 3IAEA 3REQA 3D6UA 3L8EA 1A9OA 3VC3A 2HREA 4QDUA 3M5PA 5CD1A 2P1ZA 5G0UA 3I9JA 4XDYA 5ALDA 3TFOA 3SC4A 2WMNB 1Q11A 2QRQA 1SEVA 3FW1A 1P0QA 4PWZA 3ISTA 5HE8A 2BUBA 3WDLA 3WIDA 3WYNA 5IPFA 5ALIA 3X43A 2BUAA 4V0RA 1FFCA 2VYVD 3OPYA 1CE8A 3E2IA 4ZZ0A 2ZBFA 1VDMA 2IL1A 3G85A 1TD9A 3OMLA 5DYGA 4H6PA 1FP7A 1UPUA 4IMPA 2ZE5A 3G49A 3VUFA 3CVXA 1OWOA 2AT1A 1VJ5A 2IXEA 1NX6A 2C5LA 1ULHA 2GA9A 4L4XA 3UWMA 2AJ8A 2HTEA 2R8YA 3JARA 3MTJA 1NI4A 4FFMA 4MQUA 5HBGA 3T3EA 1V1RB 2YZ2A 4L5YA 1W9HA 4HAUA 4B6RA 5LKRA 1O0SA 1RJEA 2BFDA 4BJ6A 1U5BB 3L0OA 3WADA 3U3JA 1RPTA 2IDZA 4DAOA 3C74A 3AFOA 2V6BA 3KT3A 4N18A 5ECWA 4N12A 1XKXA 4JU8A 3N2EA 3O95A 1L7BA 1E0DA 3TNDA 3UOGA 3WRXC 4HDMB 3I01M 3HL4A 2Z4TA 1NHGA 3OPMA 5ISMA 3IAM6 1AO3A 5TRTA 5KJCA 4DRYA 1TIPA 1UBSB 2MU1A 4MVXA 3PR3A 2AMLA 4XJVA 2WMYA 1JNYA 2PMFA 2J0QA 3T4UA 2TMGA 5A4KA 5AW8A 5EL0A 2J3EA 1E61A 1E58A 4JXKA 2NLOA 5DHSA 1D3AA 4M53A 4TSKA 3FAZA 1PNOA 2ZWAA 4OV6B 3A6FA 2H65A 4Z4CA 2FEXA 2BGLA 2EJBA 4LE2A 1H0HA 2Q3BA 2PIDA 4IIJF 4AU1A 4XRGA 1UAAA 1ELOA 3SQDA 2IA5A 1N2IA 3SBXA 4JT2A 4W1PA 4W99A 1XXHB 2I4LA 5FPQA 1Z5GA 2ZM6B 3AKCA 3PDIA 4I3HA 1SUCA 2JVKA 1CUAA 4QC2A 1CUEA 1OAKA 5AKXA 4Y2RA 3SSAA 2XNKA 3SF0A 1ZK1A 3JVIA 4QFCA 4Q9KA 3F6RA 1ZZEA 2QRVA 4MB6A 2C57A 4YECA 1AGPA 2O3TA 1Q1QA 5IKOA 2UUPA 2I9KA 3OIUA 4RIHA 3CPSA 1ZOSA 3FNRA 5EP2A 2WYOA 4PX3A 2HIHA 2ZTMA 4ZJYA 5CLLA 3CR3C 5I7RA 4BRWA 4EMBA 4L78A 5JI3E 5I9BA 4WY5A 3MJTA 4XASA 4J9VA 5FYDA 3Q2IA 3BWDD 2D5IA 3CU5A 5ICCA 3LCUA 2RFLA 3ELDA 4PCLA 3LM8A 1M73E 2QR5A 3NO4A 1QGYA 2VO1A 3QRWA 1W94A 1YK1A 1LPNA 5EWMA 2GHIA 4HYTA 1KZHA 1A97A 4BECA 4BE7B 4UMFA 1AM4D 2IQ5A 2JCVA 1JJBA 3DZ8A 4JQCA 4ZCLA 2Q9AA 6CHYA 1UIMA 2MSLA 1YZQA 3V97A 4TTPA 4P7BA 3NHKA 3QOXA 1X8XA 1NDUA 3BS4A 4W5NA 4PC1A 1CEXA 1P5JA 5EE9A 1SWWA 4IO0A 5K0JA 1L5OA 1QHEA 1WHTA 1EM8A 1X7YA 1FLNA 1JMKC 2WUEA 4C4RA 1Y82A 4H6WA 1QHGA 1ICEA 3CG0A 1VRCA 5D87A 1NXWA 2VRWA 1KK3A 1KMHB 2R1VB 3A2MA 3JD4A 4X1OA 2ZIFA 5A5GA 2PA3A 1GNRA 2G06A 2J0SA 3IXMA 2CNKA 4RGVA 4WKCA 3KFVA 1V2HE 4MI6A 4AECA 2BZ1A 1GG5A 3PNMA 4O4JF 2ECFA 1BGXT 2BR3A 4IOLA 5SZIA 3WMFA 4A0SA 1AQUA 1L8LA 2FPLA 4PHHA 4V0NA 1G21B 5AK0A 5B53A 4OF4A 1GPMA 4M9CA 2Y4NA 3EJ6A 5DJ5A 3WYBA 1UMKA 4DR2B 1XE3A 2LXNA 2WWFA 3GMTA 4F5DA 2CLEB 2IYTA 4BMSA 2WPDD 2GD0A 1OFGA 5DSZA 4FT4A 2V7UA 2Z1DA 3NTVA 4ALKA 3DVQX 3PQ3A 4L22A 1DCKA 1ISSA 1HMYA 1SCUA 2VJDA 4QDXA 4WNAA 4O59O 5A71A 3JQFC 4MUBA 2OYRA 4BO2A 3WV4A 5C5DA 1UOEA 5DX0A 1PVVA 3GPLA 4URYR 2NQ8A 4IUYA 4IZIA 1W581 2COKA 2FLVA 3BHIA 4QOJA 2P3LA 4WFJA 3IPYA 4Q47A 2Z43A 4LWZA 3OF5A 4XH9B 1I3LA 3DGEC 2EBWA 2GAFA 2GPJA 2H9YA 2VP9A 3GCDA 3R09A 5EWLA 5F12A 5FBWB 5LZ8A 5JAMA 4UHJA 5LBUA 1DBVO 3RYFB 3V55A 5KU1A 1B6RA 2BMVA 1D1SA 1Y1KE 2C0CA 4IKOA 1MVNA 4PZYA 5E4TA 1BW9A 2FETA 4N3BA 3AK4A 3ENVA 1KXZA 1TCAA 4PLVA 4X54A 3ZVNA 4DA0A 2Q1XA 3EC2A 2CZGA 2HEGA 5KWJA 1UDXA 1FNNA 1Z8NA 2B5OA 1HNZB 2E48A 1NHWA 3L8CA 4F60A 2WUGA 5CDFE 4CL0A 3FSJX 3RJZA 4LDAA 4M8IA 4YWJA 3IUSA 5JS2A 3HGQA 1NPYA 5CDHA 4E5MA 4D9GA 2BM0A 2HWXA 1U28A 4FMDF 3GD5A 2VQ3A 3BQNB 4IX1A 4RPCA 4F9TA 4Y6SA 3W77A 4ZJPA 1WB9A 1Z16A 2M32A 3L82B 2IDMA 3VKWA 3ZKWA 1ND6A 2RE8A 3CNHA 1QORA 4DLVA 1DARA 3FOFC 5JIBA 2GKOA 4QGBA 5T64A 4JOQA 4HH0A 4EYGA 1B1AA 4HWKA 2ZIEA 2PUTA 1BWQA 2D2FA 3GDGA 3NAGA 3FX2A 1HE3A 3PDHA 4IDBA 4Q9IA 5IVIA 4TMWA 4QUEA 5IZ4A 1T1JA 1XDDA 1R0RE 2ZAMA 3ANLA 4XM0A 1WBBA 2WT8A 5CDGA 1GSIA 3PHIA 2XWSA 2NTVA 3CX4A 3B9RA 3CPJB 1U9CA 2O2IA 4Y0VA 2BGNA 1KO8A 2EJVA 2XI4A 3N2GB 5CM9C 4OMDA 4LXIA 4QUHA 1U2SA 1E8MA 1IMOA 2DPLA 2GDJA 2OPBA 3UT0A 1C2TA 1Y4ZA 2C3YA 2HD4A 2IVFA 4KEAA 3JQ7A 3MTGA 1BHO1 2G67A 2IUYA 3C3BA 3T7EA 3EXAA 3QX7A 3TRHA 2OG2A 4Q82A 5TEWA 4UHEA 3UV7A 4Q3EA 3LKVA 3KL4A 3NCTA 3KB8A 2C20A 3VV2A 2W6IA 4PYLA 3TM4A 2F1OA 3W8EA 2JRLA 1XDZA 4EVRA 3M5DA 2V6MA 3VTZA 1U2DC 3PXXA 4IVPA 2NM0A 3NFRA 2WY2D 4C7KA 4D81A 2Q62A 3WGIA 2JDID 1MB9A 1P2SA 4CDMA 2QE6A 1FDSA 1QAMA 3TTSA 2OZLA 4OAQA 2CLOB 3R3HA 3LSTA 1P75A 4MR9A 1FQKA 2ID9A 4DA4A 4KO2S 4C0BA 2B36A 5IFKA 2FN3A 1Z4QA 3HVIA 4HLDA 3TNYA 2IX3A 1P1BA 1V5FA 4HTAA 5E95A 3GCXA 2Z09A 2YMLA 5BOVA 4XLZA 2B4TO 5EPOA 4KPYA 3P27A 2O0MA 3RIMA 5E6UB 4BZXA 1YQXA 2JI6A 3SBEA 5MN4A 2OTCA 3A4NA 4DLSA 4GVPA 5HOQA 2IEZA 2IYFA 3ICVA 4GL4A 5IANA 1U1FA 3IE2A 2OM6A 2Q3LA 4JQSA 4BHTA 1M6EX 1F8XA 3EF1A 1J0CA 1RHKA 1GKIA 4F2GA 5FUBA 3C6QA 4RWZA 4YAGA 2ZR0A 3UJ9A 4I2VA 1U1DA 4U2EA 2VZ0A 1TLLA 3FVWA 1NQTA 3V7NA 3NYWA 5DBOA 4FX5A 1GR0A 1ADBA 1MQ8B 2C9CA 2PQ2A 1CIVA 4QGFA 5FUQA 3WO0A 3KWJA 3TLEA 5EQJB 4J4TA 2W6NA 2CBGA 4QOFA 3EJWA 4DJTA 3OECA 4AF7A 3EQ9A 4TV9F 5E7MA 3FR7A 1KPHA 1V26A 3I76A 2HT1A 2OAQ1 1RKXA 3DV0A 2I76A 3T5GA 4B4UA 1QZZA 4BBZA 1L7PA 2H5JA 5ADWA 1RU3A 1NKTA 1PEYA 5AXDA 1L8AA 2R2AA 3PHLA 4LRUA 2IGTA 1H85A 1L7VC 1TKAA 2ZTVA 3DT9A 3INGA 1NX9A 3HM2A 4PZLA 5LJLA 3O84A 4AS1A 3WHLA 1MC5A 5U9CA 1LH0A 4EOGA 1SC4A 3P32A 4RFLA 1HKUA 2PVSA 3E4DA 3UK1A 3EGIA 3ET5A 4EKEA 1DFIA 3L1JA 3AR6A 3ONDA 3FOBA 2Q4EA 3UWKA 5BSFA 3E53A 5E7QA 2BEUA 4UE6A 4PSKA 5ITZB 1YMVA 1A9QA 2I1WA 1I0IA 1L8OA 5IXSA 4JYPA 4M99A 3D4IA 1U04A 3V1MA 3K6SA 2Z98A 4M1MA 4B83A 1J2TA 4MRSA 3U4DA 1I6MA 3PC8A 5KI6A 3PNVA 3DWIA 2ZPTX 1JL3A 1E63A 1GFSA 1P81A 4MQ5A 1BXRB 1RTKA 3ZXYA 5IN4A 4Z4IA 3NVMB 3R2JA 1SZPA 3H7AA 5AW2A 3GA0A 4YRRA 4UVGA 3S2FA 4BKUA 4H4DA 2JKVA 4TQGA 3COWA 1UK9A 3CB2A 4LNUA 3TF5A 1XEAA 1Z9BA 2D4AA 3CW8X 3A6GA 1X2EA 3MFQA 4FGSA 4Q39A 4NU8X 1FFEA 5JSFA 4V0KA 3I2IA 5KYKA 3Q3VA 4M22A 4M8LA 4B3BA 5A3SA 2A5FA 4AX4A 2XH8A 4MAAA 5JBNA 1Z4JA 1DX4A 4FKMA 4E5NA 3ROGA 4F1JA 2O05A 3U4QA 2P1RA 3HXPA 4WY2A 4GLBA 3NC4A 4XJSA 3NRBA 1ISJA 5A0TA 3RKSA 2O8EA 2LKDA 2IEYA 3PGMA 3K32A 5FL3A 4IDEA 3WWOA 4FFLA 4CUKA 3L8YA 2V7GA 1H2YA 1W1UA 3LHIA 3VYUB 5FPKA 1PNRA 3BA6A 5JNLA 4RH1A 3KYJB 2JARA 2W6OA 5CLHA 3TLGB 3C7KA 3ZY3A 2B5VA 1N6LA 1Q7CA 4ETNA 5B30A 5HIIA 5FA6A 3T5MA 1U63A 4R4JA 1MIHA 1B0ZA 2GAOA 2QLFA 3WGOA 4BVLA 5ADUS 2WYHA 1DBWA 4MRVA 3Q6IA 3G9TA 1P4GA 2ZYGA 4DRXB 5K6TA 2FZKA 3K6RA 1H1LB 4OKIA 3KDPA 5CBPA 4IP0A 1QP7A 1LRLA 3MWEB 4HN4B 3P2OA 5J2TB 5FBQB 1HSOA 1RQ7A 2PXXA 4KC0A 3VTKA 3IRVA 2P9HA 2PH5A 1NYLA 2OBMA 4BGVA 1N32B 3OQHA 5KCZA 2X4DA 3SC2B 5A4AA 3FI9A 3IDOA 2Q9CA 5CLFA 1I4EB 4F4DA 1YE8A 3SN6A 2GWHA 1FXWA 4Q12A 2I3AA 2XYPA 1YZLA 4L0MA 5GJVC 3L6CA 1YS1X 5BNFA 1FJXA 4AJPA 1G4AE 1TC1A 3BIFA 1C0EA 5CJJA 1X70A 2ON6A 2VNKA 2Y76A 4GSYA 4D0NA 5KZMB 1KAMA 2MSWA 2G04A 1G3QA 1YJBA 3AM4A 2E4AA 2VUHB 1IIRA 4NP6A 3H84A 1PS9A 4O2RA 1L3CA 1YB2A 3X1DA 4CNQA 2CMHA 4J2HA 5TC4A 2BHNA 1DOZA 4EGSA 1N6OA 2IODA 4I19A 4AJ9A 4G1CA 2DT5A 3ZDXB 1OKKA 3W9BA 2ZJ6A 1HEIA 1RZ3A 3N70A 5A7GA 5U1PA 3RGGA 3D8UA 4COKA 5AVWA 1QCYA 4K9PA 4OOEA 4QYXA 1WXEA 1ABFA 5CMLA 1FS5A 1N0IA 2CNOA 3O21A 1G8KA 4S1WA 2VL7A 3WLHA 5FWNA 1RBYA 1G5FA 2FY8A 4ER0A 4G86A 1R0SA 2VFAA 4OJYA 2YV1A 3JZFA 1MMFB 2PSEA 2IS1A 3U4GA 1UJ5A 3IC5A 3VOBA 3D7LA 5L51A 1EESA 3GJ5A 2V3CC 3U9LA 1UDCA 2DP4E 2JEZA 1D2EA 5JSQA 1XCBA 4CMAA 1DQZA 2D6FA 1QNFA 2ZYAA 5HKLA 1OLXB 1YJ8A 3EZLA 1YHZA 2RGNA 1EUDB 2MT9A 2QXUA 4FEAA 2R6DA 4LK2A 2TMDA 2EX1A 1PV2A 3TVDA 3I58A 5I7HA 5J4YA 3JRNA 1HDZA 2RKOA 5IAGA 2B82A 2JGEA 1JHYA 4EEKA 3H18A 4EUNA 1XDGA 2Z5GA 4YB8A 5CFZA 4TTJA 3NALA 4UHCA 4DNQA 1BRMA 1OMOA 1I9GA 1RYDA 2J07A 1GPH1 2OENG 3HFJA 4JC4A 2FU5C 4PNPA 2ZUSA 4GPZA 3NLLA 4B6FA 2W48A 4V3BA 4ARAA 1F17A 2X8BA 2MIIA 4R81A 2XYHA 4IY1A 4BKMA 5FX2A 1O95A 1UC8A 5BN4B 2YWJA 4EW1A 5JSZB 1KPIA 1N25A 3VPBA 3RFVA 4XGNA 4UUMA 2WD7B 2Z3ZA 1MEOA 2PMKA 2CF6A 3VR4H 3NR2A 2QUKA 5HIAA 1TADA 2CFRA 4R83A 1O5IA 1OX5A 3OX3A 5MFZA 3EDYA 4DQDA 2JF0A 2WHQA 4KLCA 5FTKA 5CTJA 1NUAA 4CG3A 2H85A 3CJTA 3OFVA 1C4OA 1SXJA 3V33A 2NSHA 1HMPA 1DXQA 1L7RA 2C2WA 2GJ9A 2XR1A 1DTEA 1SXHA 2CYCA 1E66A 2HDHA 2X23A 3VAYA 4AKSA 5HJ5A 3PI6A 3D1VA 3R4CA 4KIWA 3VNBA 2NXNA 4LKRA 5C8YB 4LX8A 4OU5A 1FMCA 5SY6A 3KSUA 4NV1A 1SRRA 3HRHA 4RLQA 1VLJA 2AUNA 4PXYA 2DM6A 1U0GA 1OBOA 1N8TA 3K20A 3CLTD 4P58A 1NBEA 4FLMA 4A23A 2I91A 5K5EA 4HMOA 3KZOA 3OF3A 4DMHA 1GIAA 1M1YB 2VHYA 2P30A 2HO4A 3BHMA 1R0CA 4ZHQA 4HWSA 5AJUA 1XUOA 2C7QA 1REQA 1IYZA 1NSYA 1ULBA 2PMWB 1N2BA 2RGCA 4AYTA 6NULA 3MPUA 4LN1A 1A71A 1RW4A 2O4CA 1SQFA 3JQ9C 3K53A 4Q21A 4QNRA 2NTNA 2NU8A 4IL5A 4KGXA 4GGMX 5JCJD 4HO1X 3EBLA 1AGYA 1B23P 1UBTS 4ZAYA 3OM0A 5I7WA 2R0QC 1JPNA 2G4LA 4RTNA 1T9BA 1Y9DA 4K9QA 1C4WA 1ORHA 4JJ8A 5JY6A 1RMQA 2JFNA 5LMUB 3QPVA 1PYDA 5HGXA 2LKCA 3G3EA 1SKAA 1NIJA 4KMRA 2OC9A 1QTNA 3D6FA 4FZJA 4FC7A 1X7XB 3H5VA 5BT8A 2VH2A 4I1OA 1AXEA 3GJ0A 3BN3A 3BKWA 1ZY2A 4NS4A 1WJGA 2JFWA 1NYQA 3DZKA 3RS2A 3WGJA 3INTA 1LSSA 2JJ1D 3QX9A 1P61B 2R6GA 1W87A 1RD4A 5IJ9B 2OHXA 3MLEA 3V4SA 2R6ZA 1E8DA 1WDMA 5CU7A 3VR5H 4BYMA 5IFLA 4YXFA 2WKQA 3CQ9A 4EY8A 2P9YA 1WD7A 3LNCA 3GFFA 2QZJA 1FYDA 1FNDA 1G6KA 1NN3A 3AC0A 1NUHA 3EEIA 3QU2A 5IZCC 1LTKA 2HHHB 2Z3VA 2FFHA 3E3OA 4BFVA 2H00A 1WOYA 2JVIA 3W3AH 1Y33E 3HY4A 3LP6A 2M6RA 2BTQB 2G5GX 2V6GA 1XD2A 3FVVA 4UE2A 4YJFA 3HRIA 4NCAA 1IZZA 4JZYA 1S7GA 5L53A 1TAQA 2GEUA 2XEDA 1E3WB 5D85A 4Q5IA 1WXXA 4C29A 2IVZA 4J4BA 5TR9A 4IDHA 2VP0A 3A06A 3WIUA 1KFEB 3NDBB 2O8DA 1VHTA 1VIYA 4LFAB 5J1SB 3EFOA 1E9CA 2KE5A 2KM1A 4NPHA 2GVNA 4ZOLA 1WL8A 2NVUA 2VDMB 5HJ2A 3WKCA 3QF4B 1RWXA 2P68A 2V6FA 3H1BA 3ND6A 4KQ9A 2P6OA 1JKJA 2ZPUA 3BRCA 3CUVA 3MELA 3NRJA 1R0WA 4JELA 1J22A 5E0OA 5EHZA 5I3ZA 3AL0C 4P4TA 1BO6A 1EZ4A 1WD5A 4Z9YA 5FPHA 2W6CX 3T7TA 4YDQA 1DC7A 1LQUA 3HG7A 1QWSA 4O2AB 2Z56A 1X7DA 5F4ZA 5H8WA 1EPUA 3QY9A 2OAP1 1WRBA 3ETGA 1K97A 3A1DA 4FCVA 3OOJA 1YF3A 3OJOA 3I83A 3KFLA 3K4QA 3NHMA 4IRMA 4Z0TA 1S5PA 4UJ3A 3ANSA 3F73A 5LQMA 1NW5A 3RUPA 3ND7A 4DDHA 2I4RA 1JLLB 1L8QA 2XGGA 4L3VA 4YO8A 2UZ4A 2D1YA 1A9PA 1M8JA 1PX0A 4HDSA 3DE2X 1NWHA 1XC7A 1CRZA 1GKKA 2A1IA 4RNCA 5ESXA 1AN0A 2A78A 3DNPA 1DIAA 2F3PA 1NOJA 2IT1A 1MZVA 2QV0A 5KEIA 1FVXA 3H8JA 4EB6A 3HE3A 2DULA 1AS0A 2I4NA 3CCCA 2CLMB 4L73A 4O8ZA 1IRIA 2QUBA 3OTHA 4PFQA 5KQSA 2TYSB 2NV2B 4FEGA 1IK6A 3QV2A 4C5AA 4QVIA 4QHSA 2G8LA 4TL8A 5FUWA 2HHAA 1KQNA 4AUMA 4Q00A 1FFXA 3G2MA 2WIAA 3LT5A 4LZJA 5EQFA 1X1QA 2HW8A 5I7UA 2Z2XA 4EAAA 2EX0A 4YRGA 4W5OA 2B4KA 3QBDA 1EK2A 4I1UA 4ZTUB 4KR2A 9ATCA 3L07A 4TWBA 1M2KA 2WYUA 2PHZA 5DLPA 5FPYA 1HA3A 1LC3A 1A8HA 1QFJA 3CEHA 4P86A 3TPCA 4ICIA 3HJUA 1K3FA 1JVSA 1OA1A 2C4UA 1FSZA 2PPLA 4E5YA 1XLTA 4BZPA 4PGFA 1ESZA 4MQFA 3V42A 3WX0A 3GRUA 5JXIA 3HV0A 4EY4A 1QCDA 4RE5A 3K70D 1ULTA 2FEOA 1UM9A 4I55B 4M1ZA 3W6NA 1RLUA 4XR9A 3GLIE 4OHYA 1CDOA 1XCGB 1YUMA 1YASA 2FPKA 3AZQA 3I0NA 4Z7OB 1T2NA 1PJ3A 3I2JA 3MTQA 4JC0A 4W7IA 2VDVE 3QNMA 1DAKA 3K9QO 3O4FA 4P7JA 3TTUA 4YAKA 4M86A 4NE9A 3OUTA 4FNGA 4ENWA 4F5ZA 4IUBS 2JLXA 5JD3A 2HMTA 1H9BA 1Q7EA 2Q9BA 2X2PA 1JDZA 3NEYA 1K88A 3FVRA 2JEOA 1LVUA 2I6FA 4W6ZA 2PU7A 4WWHA 1XG5A 4NFLA 3COJA 4UPEA 3AP3A 1Q5PA 2HMSA 2C3PA 3ES9A 3NIFB 2C8JA 1N0UA 3OIYA 3UWDA 5LZ2A 2ZIUB 4DSAA 5DGDA 1R4NA 5CNJA 2O8BA 3AF4A 4KIUA 3DBOB 1Y9EA 1A27A 2OCPA 4GPD1 1LCIA 3M6AA 4OJQA 2CL6X 2FN8A 3A70A 2A0KA 3VR4D 5KHLB 2GJKA 2Q4BA 2ZUEA 4BNJA 3QA3E 3GN1A 1GRVA 4BN5A 2OHGA 4D6YA 3BOSA 1PHRA 1VQ1A 4KLNA 1KY4A 4KSBA 1S01A 3U1TA 4NYJR 5K8IA 2OYSA 1T43A 5DN9A 4CPDA 5TMEA 1R10A 1VKZA 2HL6A 3E48A 1KBOA 1AKWA 1P7VA 3IP5A 4IF4A 1OZGA 1XK6A 3TZEA 1G98A 3PT9A 1LTQA 1YJAA 3ABZA 1YD7A 3PA8A 2I65A 5NLLA 2O2ZA 1RLMA 3ROFA 3IQDB 2JI8A 4XUDA 1ML4A 3LE8A 1XT6A 2ZRCA 3HCPA 4KQ6A 2FF7A 2AF3C 4AMVA 4DSZA 4R8VA 3KAJA 1YBHA 1F38A 5CNIA 4HAYA 1WZIA 1L1RA 1KJNA 3NYQA 3NKVA 3OZBA 4ETMA 1AY0A 5DNAA 4CMKA 1FSPA 5EMLA 2A8YA 2POCA 1LFDB 5ALUA 4EJ0A 5EIBD 2NZJA 3DXXA 4ETIA 2GPYA 1SN7A 2DC1A 4I66A 3DVLA 3FCAA 2QZSA 4R9VA 2C7VA 4QPJC 2Y92A 1O9HA 3P9XA 3PQEA 5FP0A 4PSCA 5BP7A 3M5CA 4U5QA 2VPXA 3OMXA 3V4OA 4G97A 3D64A