3TRKA

Structure of the chikungunya virus nsp2 protease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
321
structure length
321
Chain Sequence
NAFQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPVNRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Chikungunya virus nsP2 protease
rcsb
source organism Chikungunya virus
molecule tags Hydrolase
molecule keywords Nonstructural polyprotein
total genus 87
structure length 321
sequence length 321
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3trkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3trkA01
2NXCA 3HVKA 3E05A 3V8VA 3T7TA 1D2HA 1SUSA 2OY0A 5K0JA 3GRZA 2IH4A 2CMHA 3LGAA 1ZG3A 5CM2Z 2ADMA 3NJRA 2AVDA 3T7SA 1RJFA 3CJTA 2XVMA 3NVKI 3UJ9A 2PXAA 8MHTA 3CKKA 2VDVE 3DXYA 4AUKA 3HCDA 5E9WA 2AN5A 2XYQA 2C7OA 4OQDA 4F84A 3UJ8A 2NXNA 4XUEA 1HMYA 4PCAA 5E1DA 3G7UA 4YUVA 5K05A 4PIMA 5D1NA 4C07A 2A14A 3A7DA 5DPMA 1Y8CA 4BP1A 2IFTA 1TW3A 4P7JA 4C04A 3KU1A 1VL5A 4XUDA 4QDJA 5DXJA 5K03A 4YUYA 4R8RA 2I6GA 3GRYA 5DM2A 1I4WA 3NWBA 3I5UA 5BW4A 5KVAA 3HA5A 3D2LA 3KQOA 2YVLA 1SQGA 3HCAA 3I53A 4PYIA 2IBTA 3JWIA 5K8VA 3B3GA 2ZWAA 3C3PA 1XTPA 2OZVA 2VDUE 3F4KA 3NDIA 4F86A 1EG2A 2HV9A 4FT2A 2IGTA 5EMJA 2LD4A 4Z2YA 3G88A 3TRKA 2IH2A 2ESRA 2H11A 2O0LA 5EEGA 2ONZA 5GWXA 1KYWA 2GAFA 1YUBA 4RX1A 3KQTA 2PT9A 1RI4A 2P3LA 1BHJA 4CWAA 4RTOA 3ERCA 3FTFA 2FYTA 4QVKA 1RJDA 1X19A 5K01A 1ORIA 1NW5A 3P97A 5C9ZA 2CL5A 4XCXA 4C4AA 4Y2HA 3JWJA 5DM1A 5HILA 3TM4A 4DCMA 3GRUA 1XDUA 3QOWA 3P2KA 4A6EA 3RW9A 2P40A 3KQVA 1WXWA 4CTKA 1WS6A 5ICGA 5FA5A 4PONA 3ELDA 5E8JA 3A26A 1U2ZA 4HRAA 1SQFA 3BGDA 5EHGA 1WXXA 2QRVB 3EGEA 5P8WA 4BY9E 4EK9A 2P8JA 1R8XA 3MHTA 3KQMA 5FWDA 1P39A 2OBFA 5CVJA 4QVGA 5ICFA 1ZGJA 3P2EA 2HTEA 1P91A 3FTDA 3K0BA 5EIFA 5GM2A 1PRYA 3NTVA 5EMLA 2OPBA 5HIIA 3U81A 3FUVA 3BKXA 1XDSA 2HNKA 3ORHA 3TPZA 2IBSA 3GWZA 5K0LA 2YXEA 1DUSA 5MHTA 2P7HA 2ZBPA 4IV0A 4M7RA 3PTAA 2OB1A 2PVCA 1EIZA 1BOOA 3HTXA 4A6DA 2YQZA 3LBYA 2C7RA 4Y30A 2Z6AA 2P35A 3E23A 2Y1XA 4GOND 2O07A 4YUXA 2FK8A 4GEKA 3P2IA 3UA3A 5HZMA 4RTRA 1JSXA 5CVEA 5HIJA 3KR0A 3Q87B 4PGHA 2IH5A 2I7CA 2PJDA 3E7PA 3FUWA 3IV6A 4RTSA 3OZTA 3HA7A 1VP9A 3PVCA 3KPJA 2PX8A 4BLWA 2ZBRA 3BT7A 3B7PA 4FS8A 2OYRA 2DPMA 3MQ2A 1X1BA 2AN4A 3A7EA 4KRGA 4M37A 4LWOA 2YXDA 1B42A 1G55A 3T7RA 1KR5A 5FUBA 4RTNA 1RI1A 4DA4A 4PYNA 5KQSA 3THSA 1R8YA 2HR1A 2NYUA 4GOMD 4E31A 2JHCA 4GUAA 2G70A 5K0BA 1F3LA 2PX4A 3GU3A 4X41A 5EGSA 5JR3A 1JQ3A 3OE4A 4QTUB 3ELUA 2FRXA 3EMBA 3KQQA 3AXSA 3ER8A 5D1HA 1KIAA 1NW3A 5FTWA 2VDWA 2XYRA 2BR3A 2HWKA 1EJ0A 1NW8A 4DQ0A 4RVHA 3NWEA 1XCJA 4O29A 5CD1A 1EJ6A 1L1EA 4CKCA 4QDKA 3G2MA 3GJYA 5EG5A 3L8DA 3FTEA 3G2QA 5DRYA 1YZ3A 3UFBA 2ZFUA 2AVNA 4IV8A 4HSGA 3VYWA 3VC1A 3LDGA 2PLWA 4KVZA 3EPPA 4IKPA 3KKZA 3GCZA 3LDUA 3MCTA 4CKBA 5EEHA 4RYLA 3GNLA 4HTFB 3SMQA 2UYQA 3G8AA 3EVZA 5E9QA 1KXZA 1UWVA 1EQAA 3BWYA 4ER5A 3NVMB 4RTQA 5DWQA 4PGGA 5EMKA 1QAMA 5C1IA 2BM9A 2XVAA 3MTIA 1ZHFA 4IWNA 2OB2A 2VS1A 4ISCA 1YB2A 4H0NA 4X60A 5DX1A 1ZKDA 3DLCA 4XUCA 3LKDA 3KR2A 3SM3A 4PNEA 1QYRA 2BZGA 1HNNA 3VSEA 2KW5A 2O05A 4PYOA 1RI5A 1NV8A 4YV1A 2PXCA 2AOUB 1AQJA 5HOQA 1JTFA 2AOTA 3K6RA 3M70A 4R8SA 5EPEA 5H02A 2EFJA 1X1AA 5JUWA 1L3IA 1VE3A 2P1DA 4RSRA 3KPYA 3REOA 3GO4A 2PY6A 1P1BA 3MTEA 3OU6A 2UZ4A 1SKMA 2V74B 3PX3A 1YFLA 3KR1A 1YF3A 5DT2A 3KQSA 5DTRA 3DOUA 3B89A 3DMGA 1KPHA 1KPIA 1QANA 2H1RA 3PFGA 1RJGA 2GS9A 5E2BA 2ZZNA 4DM3A 5HIKA 2B25A 3DMHA 4FSXA 4YV2A 1VQ1A 5E9JA 3THRA 1KYZA 4C03A 4YMGA 3CCFA 5K0GA 2VZ9A 1SG9A 3ME5A 3PS9A 1XXLA 2WK1A 2YR0A 2YTZA 1FP1D 4EMSA 4C08A 3G5LA 2N47A 3BXOA 5DXAA 2FPOA 4OA5A 5B1SA 4OBWA 3TR6A 1F38A 5DM4A 2ZLBA 2YXLA 4YUZA 2QRVA 2IPXA 3M33A 4P7GA 3EGVA 2PX5A 3EMDA 5BXYA 1R6AA 4E32A 2C7PA 3EEOA 3EVFA 4HGZA 4NECA 3M6VA 2GA9A 2BH2A 3GXOA 3UWPA 2B3TA 1G38A 2ZIEA 2GH1A 2PBFA 3GIWA 1DCTA 1VIDA 4YMHA 4KDCA 4X63A 3FPHA 3R0QA 4RTLA 4RTMA 3IEIA 2ZZMA 4QQNA 5LQUA 5DSTA 3NW9A 4B17A 1FJXA 3FUXA 1QAOA 3LKZA 2IDJA 3UJAA 1D2CA 3HCEA 3UJ7A 2FCAA 1R00A 1BKYA 5CUQA 3FYCA 2YUIA 1Q0TA 3EGIA 2E5WA 5E2AA 2NXEA 5LQAA 5K0EA 3M6WA 1AF7A 3MERA 4E2ZA 1MJFA 1M6YA 5EZQA 5LQKA 3FPFA 1FBNA 3KPWA 3WSTA 3HCCA 5EIWA 1WY7A 4C05A 2QYOA 1DL5A 2ZBQA 2ZTHA 3P8ZA 5CIYA 1R74A 3UA4A 4R6XA 3B3JA 3I64A 3BWCA 4RVFA 4LG1A 3DUWA 5CCBA 1JQEA 5DM0A 1WZNA 3SSMA 2V7EA 3I9FA 3A25A 4U7TB 3TQSA 1RI3A 1NW7A 2ZIFA 4P7FA 3M6XA 2IIPA 3M6UA 3TMAA 3TM5A 4X1OA 3UJBA 3C3YA 2DULA 1JSZA 1UFKA 5CVVA 3CVOA 1RI2A 2B2CA 3A27A 3LX6A 4X61A 5FADA 4ER0A 3LCVB 2JH9A 2R6ZA 2B9EA 4KWCA 3FPGA 4ZTBA 4OQEA 1NV9A 4AZWA 1SUIA 3LHDA 4DF3A 4E30A 3TFWA 2Z6UA 5LQNA 2UYOA 1FPQA 3P9IA 3UJ6A 2PWPA 5F2NA 2QE6A 1O9HA 4MWZA 5FQNA 3SSOA 4E2XA 3LPMA 1Z3CA 1ZGAA 5KYGA 3P9KA 1WG8A 3AWIA 3OZSA 2PGXA 3KHKA 3PT9A 4RTPA 3BGIA 3X0DA 4FSDA 4DMGA 2PWYA 1VBFA 3H2BA 5EQJB 2AR0A 5T6BA 1I1NA 4BLUA 1ZQ9A 3MB5A 4OBXA 2PX2A 5K0CA 3BWMA 3QV2A 2R3SA 2OXTA 3TKYA 3UZUA 3AXTA 3HCFA 2AN3A 2GPYA 4PCLA 4MTLA 4RTKA 2ZCJA 5ICEA 3ELWA 3OFJA 2PXXA 3BGVA 5DLYA 2O06A 1UIRA 2G8NA 2HMYB 4V0QA 5FHRA 3SSNA 1L3BA 3HVIA 5ICCA 1JQDA 3DP7A 3O7WA 5CVDA 1TW2A 2P41A 3FRIA 4ER7A 5FULA 4DZRA 2NP6A 4AZVA 3ID6C 2QY6A 3GDHA 3O31A 5K0NA 1NBIA 1I9GA 4GF5A 1D2GA 3EVGA 4HG2A 4V0RA 2PSSA 2CWWA 3DTNA 2PKWA 3JWHA 4R6WA 1X1DA 1RJEA 2AZTA 3EVCA 3FYDA 3IHTA 2FK7A 3PB3A 3R6TA 2WA1A 4OA8A 4E2WA 1QAQA 5E1OA 2NP7A 1SVUA 4ER6A 2GB4A 3CGGA 3Q7EA 2PV0A 3R9XB 4P7KA 3C0KA 1NKVA 4GOOD 3GRRA 4ATNA 1NW6A 5LQJA 2H00A 3E8SA 1JG4A 1G8SA 5CCXA 1VP3A 3LECA 3GRVA 2CKDA 5GOZA 1EAMA 1FP2A 1XVAA 2F8LA 2GLUA 3A4TA 5DRTA 4YV0A 2FHPA 3BUSA 4CKEA 2NNWB 5F2OA 5G02A 4AZTA 1KPGA 3T0IA 2XBMA 3CJQA 1IY9A 4PYQA 4QQKA 3NMUF 3AY0A 10MHA 5DX0A 3MCZA 3ANXA 5LQRA 3OPNA 1PJZA 5M5BA 9MHTA 3EVBA 2EJTA 5E1BA 2P7IA 3OE5A 1X1CA 2UYCA 3G2OA 4RTJA 4LWPA 4ER3A 2OO3A 2ORED 4KDRA 3KPVA 1IXKA 2IDKA 3MGGA 3SGLA 3FUUA 4POOA 4EQZA 2P3QA 5DTQA 3O4FA 3LCUA 3V97A 3G2PA 2EX4A 2P3OA 2Y1WA 2EG5A 1AQIA 3KQYA 5F2KA 3PLAE 3DULA 3FRHA 2NXJA 3C6MA 2I9KA 2ZULA 4GQBA 1JG1A 1JR4A 2O57A 3LL7A 3R24A 4RVDA 5DTMA 5HIMA 1Q0SA 2B78A 2ONYA 4FT4A 3FZGA 5EHIA 4GC9A 5GP1A 4CXMA 3DXXA 3DR5A 3P9NA 3ER9A 4K6MA 1KP9A 4U7PB 5T67A 5GIOE 4E33A 3P71T 5E8RA 4KW7A 4QPNA 5EKXA 4L7VA 4E2YA 3DXZA 3BZBA 1G8AA 1M0EA 3VC2A 3IYLW 1N7JA 1O54A 4HTFA 4RV9A 5GINE 5K0FA 2K4MA 3EVEA 5GM1A 1TPYA 3BKWA 3OU7A 4GBED 1JTEA 1NBHA 4C06A 1N2XA 1BC5A 2QM3A 3LCCA 4FZVA 3P9CA 3TKAA 4F85A 1L9KA 4QTTB 4RVGA 5EMMA 4PINA 3NDJA 2Z6QA 4HGYA 3DH0A 5ERGB 3SX0A 1O9GA 2ZSUA 3B5IA 2OKCA 1QZZA 5LR6A 5LSAA 1MHTA 5EVJA 5HEKA 3FTCA 1JG3A 2C7QA 2JHAA 4LECA 2WA2A 1P1CA 4MQ4A 2G72A 4FR0A 1KHHA 4OX9Y 2JHPA 2ZIGA 3I58A 3OCJA 4WXHA 4DCGA 4PYKA 1OR8A 2I62A 4MIKA 5E1MA 2ERCA 3HM2A 2IP2A 4GOLD 2JH8A 5U4XA 3HA3A 1N7IA 3SR4A 5C0OE 1G6Q1 4AX8A 2BR4A 1T43A 1XDZA 1H1DA 4G56A 5FHQA 3LSTA 4KIFA 3G89A 2G1PA 5HFJA 3DLIA 4QPPA 5FWAA 4E70A 3GGDA 3UJDA 3EVDA 3S68A 2AOUA 5BP7A 4AZSA 4HC4A 2AOTB 4EVIA 5DSXA 4EKIA 3OFKA 4M38A 4YUWA 5EZSA 3KQWA 3R3HA 1XJ5A 2ZZKA 1V39A 3HVHA 2ZWVA 5BW5A 3G8BA 4UOEA 1YZHA 1VLMA 1XCLA 3KPUA 3PFHA 3OZRA 3CC8A 4P58A 2ZW9A 5FA8A 4PYJA 2BM8A 1G60A 1R18A 5EOVA 1L3CA 3UJCA 3OU2A 2ZVJA 3KQPA 3DMFA 3LBFA 3SXJA 3HNRA 3UBTA 2AOWA 3HVJA 3MAGA 5EC8A 7MHTA 3FUTA 5FCDA 2AOVA 3CBGA 3FPJA 2BR5A 4PYMA 3SVZA 3EEYA 5CVUA 5KS2A 2JG3A 4PIPA 1YFJA 3RIEA 1IM8A 2AOXA 4WVLA 2AS0A 3B3FA 2G71A 3HEMA 3QOXA 5FQOA 4FP9A 5DX8A 4CTJA 2CMGA 2Q41A 3HP7A 4BLVA 3HCBA 4RWZA 2YX1A 5IKMA 4PWYA 5KQRA 4JXJA 5GIPE 4M36A 2XYVA 3C6KA 1M6EX 3CJRA 4BP3A 5K09A 3G5TA 1NT2A 1VPTA 5IH3A 1JG2A 3TLJA 2PT6A 3FPEA 5EKUA 4R05A 3JWGA 4PYLA 3RODA 3ELYA 1NE2A 4MHTA 2VP3A 3M4XA 2JJQA 3PX2A 4HH4A 5T64A 3AJDA 2UYHA 4DKJA 3EVAA 4KIGA 3TOSA 4FGZA 1AV6A 4EKGA 3BWBA 4GC5A 1INLA 3KR9A 3LDFA 1ORHA 2EJUA 5LQCA
chains in the Genus database with same CATH superfamily
3UXHA 2BUBA 3HVKA 4PCVA 4J76A 3B1WA 1TD1A 3SYRA 3ZY3A 1E60A 2ODPA 1E69A 1KS2A 1W48A 1W581 1ZA1A 2AW5A 2FGJA 3E9DA 1DHTA 3EQ9A 4Y2TA 3DNFA 2ADMA 4YRGA 1DAFA 2CJYA 1WDMA 3O95A 2I2FA 3PYLA 2O4CA 3UJHA 3SK0A 4F04A 4ETNA 4BQSA 2D5BA 3T94A 1N8TA 3FSGA 1CR0A 5LP6B 1MHWA 3OBBA 1LKZA 4DCUA 1C14A 5HQTA 4F84A 1DKQA 2OK7A 3WG9A 3B1XA 3U4QB 5IARA 1M67A 2OA0A 1PV4A 3MS7A 3REQB 1J7KA 1TFUA 4MIEA 4BCBA 3LUFA 3MT8A 4HNQA 3A31A 1Z62A 4L16A 2CGEA 4AMUA 3DEKA 4MQLA 4Y1RB 2R79A 1FFDA 1L0BA 1C2YA 1FVOA 3PR1A 4CHTA 2Q27A 1Y8RB 1HFWA 3DTVD 1I6LA 3L93A 4GG1A 3OF5A 5LP6C 1E3QA 1A95A 3ESQA 3I5UA 4NHOA 3WLNA 4DG5A 4EYGA 5BW4A 2ST1A 3IELA 3ONNA 2V59A 3ADKA 3A6LA 2JH3A 1PR0A 2YHAA 1Q3HA 2KMLA 4JI8B 2RGYA 2GKOA 1HYBA 1UPTA 4HDRB 2QNIA 5ALGA 1W0CA 1G8FA 3KJEA 3NDIA 1JXAA 1XI2A 4D1YA 3DHYA 4HN9A 3WXGA 2LD4A 2VK1A 1TF2A 2FE1A 3W5IA 2IH2A 2ESRA 4PRZA 4TV8A 1B76A 3S44A 1NXPA 1Y1SA 1SXJD 1E3WA 3GBVA 2AFRA 4YCBA 5CLHA 3IODA 2O6XA 1DCMA 4DKXA 2ECPA 4GLBA 4KXXA 2UUCB 2ZVQX 4CEHA 1HDCA 2DZDA 2HFJA 4ZICA 3ZK8A 2Q5QA 2FZVA 3IMEA 3LK6A 5HS6A 4JUCA 2B5OA 1NW5A 3DZHA 2AE2A 3D6JA 4DV6B 4N0PA 4B4KA 2QPOA 4IMRA 2V7PA 5HILA 1V8DA 4EGJA 1V8OA 1OKKD 4WCDA 4MCIA 2QGFA 5DI3B 3LTNC 4HZIA 1BE8A 1P2BA 1EFAA 3OIDA 4BC1A 4X6LA 5FA5A 3U44A 4ZZ3A 1YVPA 3P0FA 4MX8A 1QRDA 3SC3A 3MTNA 1H2ZA 1YT7A 3PRHA 4KLAA 5DHAA 1AKWA 2Z1MA 4BNIA 1VLLA 3KG2A 5LB4A 1T2DA 4AIIA 4AUEA 4CLEA 4RSHA 1GU1A 3DHNA 4MK4A 3J80A 3HXQA 1V8FA 3GLQA 4R2XA 5B1DA 1ZGJA 1YS9A 4GGOA 5H68A 3L7OA 4OXNA 3VSCA 1P4SA 2ID4A 4RM2A 1M7BA 2JCVA 2WMNB 3PRJA 2VFAA 3GP5A 2B7LA 4C30A 3E18A 2FSSA 4CTNA 5KU1A 1UJNA 5DT9A 3IP3A 3EFEA 3AB8A 5ALUA 3H5OA 1BHQ1 5FLEX 4LOAA 4YJ2A 1TUBA 2CMKA 5EIEA 3OZBA 4I8IA 2HCRA 5I4BA 3DEJA 2XNDA 3P2MA 3HZHA 4ALIA 1PL6A 3SQNA 5CVEA 1E9VA 4K9KA 4HUTA 2DP4E 3E0XA 3KYCA 4URFA 2IH5A 2H1OA 5NULA 3L01A 3WBBA 3EXG1 4M0UA 4P4GA 1Q0ZA 1IONA 5CDFA 4AF7A 1AKVA 1ZEJA 4ZCMA 4GW3A 4M89A 1VE6A 4WGGA 3REFA 2AN4A 5HW0A 4UEJA 5K4HA 2PBRA 1U7WA 1L5RA 1GT6A 1B42A 3UAOA 1PUIA 2B7BA 2WU8A 3T3GA 3NBFA 1JYFA 3UMYA 2ZWOA 2PD4A 2E37A 2E82A 2WJVA 2E01A 3NT5A 4AXMA 3W3ZB 3FKSD 2RK3A 3HUFA 3IQEA 1TLFA 3OOWA 3PJEA 1EX1A 4IEIA 4NMWA 5IEBA 3WNDA 1U1GA 5LU8A 1G2PA 2RGDA 4WURA 4Y2RA 4NOLA 2PMKA 2FRXA 1MOQA 1M2OB 4I6GA 4HDMA 4J0JA 2P6MA 1PQYA 1Y1RA 2WDPA 3F71A 2NZXA 5ILGA 4CDDB 1AMNA 3L46A 1NF3A 3OA2A 2OVBA 4YAOA 4N39A 3UUGA 1MDWA 5ECDA 1K27A 3KVVA 3GEMA 2YJCA 4P16A 3K32A 2RK6A 1DS6A 2Q3BA 2VUHB 1NVMB 4JT9A 4R3WA 5D87A 5A7GA 2CHUA 5M3BA 5EF4A 3GDWA 3LC2O 3LUPA 3N75A 5T3UA 3OF2A 1MR3F 1C1HA 2BY4A 2CB9A 2VSOA 3OT4A 4G1EB 4PO1A 4PR0A 3H86A 4K88A 2PUAA 3AF0A 1SIWA 4XH9B 3V80A 3HCNA 4OSEA 3GPIA 3NIWA 1WMBA 2OHGA 2OBBA 1NXOA 2ZR8A 1TE2A 4P3OA 2HJSA 3G8AA 1EWVA 2IOFK 3EGWA 4F9EA 1SXPA 1REQB 1T9HA 4HRYA 5H80A 3DOEA 4V0NA 5DBFA 5PNTA 2J6BA 4PT5A 2IA5A 1RNLA 2X3YA 2YMMA 3UVEA 3G68A 4F3NA 3KB6A 1M9NA 1UFOA 3IE0A 4FDMA 4I99A 4O59O 5A7HA 3AFOA 4Q9IA 5JNVA 1GCIA 1RRPA 1XDGA 2Q1XA 5LN1A 2B8EA 3WICA 4WKBA 2QIOA 4MP8A 1ONOA 1NV8A 3D6NB 1LPNA 2PXCA 3KUXA 3O4HA 3QMMA 2I8LA 2PBLA 3DF7A 3N2IA 4UU0A 4WA6A 1QPBA 4Z1MA 1YZTA 3FDZB 1L3IA 2P1DA 3TVTA 3KPYA 4QARA 2GZ3A 2UZ4A 3JW8A 2FF7A 2V74B 1R3UA 1WWKA 2HRQA 2O0MA 2WAMA 3E5MA 4IJQA 3ZGXA 3PW3A 3IKLA 2C1EA 4DR6B 3DOUA 3LW7A 3KQNA 1U8AA 3NFRA 3PPYA 5LD2C 2C03A 2XCUA 1P19A 3BMCB 3HBAA 2OCGA 3H5LA 4ZEMA 1FUYB 2JGIA 4FDTA 5CDUA 3QWFA 1HRDA 1TJ5A 2NTVA 4MRMA 2RHCA 1SG9A 4YPFA 3JALA 4LF9B 3BY4A 3FPBA 1JAYA 1QV7A 2HPAA 2WOJA 3BQMB 3UCEA 4KE8A 4HXYA 3QBDA 1U9VA 1TKRA 2W8BA 1KXRA 2HRCA 4LXTA 4OA5A 5EWMA 3DDOA 2HDOA 5ADHA 1GYPA 3GV0A 4ZU3A 4JVNA 3QHQA 1UZUA 5CA1A 2BDEA 2GHIA 5C1PA 2ANBA 2IPXA 5K2OA 3OTOB 3R7LA 2C7GA 1OXTA 2BAGA 3HJCA 3KZNA 3L3BA 1QG4A 2PDAA 4RYDA 1SUWA 4J49A 2ZKIA 1HEYA 4RVNA 5JADA 3SYLA 1BCRA 1CDEA 2HCBA 1XQ9A 2JAHA 4UNSA 5F5LA 3A6PC 2XRFA 1TQHA 2G25A 2GZ1A 2Q07A 2C4WA 5EYPA 4AMGA 4D44A 3GFFA 1BJTA 5CA0B 2Q4RA 3FB1A 1UQUA 3RADC 4RPLA 5AMXA 4DYVA 1F2AA 3CINA 4TYNA 2LPMA 2Q5FA 3N6RA 4MUXA 5I9LA 4BQIA 4RSGA 1X7YB 2PS1A 2CVOA 1T91A 2CXHA 1W87A 1E96A 4I04A 3R7BA 1M6YA 3T5BA 4ID9A 1RQXA 2FZCA 4RD3A 2ZDGA 1S2MA 2CK3A 2DECA 2PO7A 4TZTA 2OXCA 1O77A 2XB9A 3I73A 4OH1A 5C8DA 1FS4A 3H7AA 1B6TA 4D4KA 1IUKA 5GJVC 4DG8A 1V8ZA 4YRFA 4Q5IA 1JQEA 4F1JA 3QENA 1M8KA 3LJKA 2P79A 3EBPA 1CIJA 1QSGA 3BZWA 3SSMA 4FDLA 4L28A 2Q9BA 1E7SA 3EDQA 2R87A 2IELA 2A9OA 2O2DA 5D7BA 6ADHA 2EKBA 2WUFA 4W8GA 4CNBA 1TRHA 5UKDA 2L19A 4FOPA 3EY9A 1L4MA 2Z2KA 1V9LA 4K03A 5F7ZA 3ZKWA 5J47A 5KSWB 3V6CA 1ZD8A 2A57A 1UC8A 4UUMA 1RHKA 4WZBB 3RIYA 4V0OA 2EBHX 1W44A 3T7JA 4EIWA 1V47A 2X42A 2Z5VA 4AZWA 2QMZA 1YOBA 2BONA 1Q7RA 2A0KA 1W88A 1FPQA 2WIBA 2WYUA 1WABA 2QAGB 2XE8A 3PQ5A 4WZAB 5I4IA 3UO8B 3WAKA 1D6SA 3PSAA 3VC7A 1VL1A 4HDSB 4RBNA 2QD5A 4NOJA 1HYEA 3A36A 4I4CA 4TVOA 5KREA 1F2VA 2PWYA 3I8SA 4ZQCB 1Q1AA 2I4OA 5DLEA 3U3RA 1MRNA 3K1AB 2WWHA 5C7LO 3GCGA 3GUYA 4X1IB 3TPCA 3ZHRA 4LXXA 2ZBDA 2PQ0A 4H7DA 4FLEA 5HF9A 2R3SA 2AX3A 2XD9A 3EAFA 4NBKA 4S3MA 1J6UA 3BWDD 4KO3S 2NU6B 4EHKA 4JP3A 1PS8A 3CPSA 4DLAA 1YR1A 4K3UA 5L6LB 1SOMA 1JQDA 1M66A 3MA0A 3QJ5A 5AM2A 3AW8A 5ALQA 3STXA 1XL0A 4OG2A 4V0SA 2VJLA 2V7GA 3UHOA 1TAQA 1EWLA 3IKVA 1JTVA 1WQ3A 3EVGA 1R0WA 1QS0A 1VRVA 1XLUA 3MINB 4YJHB 3CVWA 2OZLB 1LJLA 3J81k 4FTWA 4INAA 5DW3A 1O96A 1TMKA 4UM5A 4H15A 1ZJ4A 5JT1A 1QAQA 2XMDA 5ER9A 1AHNA 3DEIA 4AMYA 1XD8A 4WERA 3IUMA 2VDQB 1UBHS 2ZSHA 4YAWA 2BEVB 5B2EA 1EGAA 2NZWA 2VWHA 2WTUA 4AQ7A 1O95C 1I2DA 5CLFA 4KO4S 1ADYA 1G5FA 2DX7A 1T2FA 4XYBA 1ZM9A 2BE7A 1UBJS 2VYVA 1JVBA 1KI4A 2W2KB 1JFFA 1MH1A 3JYQA 1A04A 3LECA 3IVMA 4Y9RA 3HADA 4EEKA 2Q3LA 2PRIA 2RGBA 3H2SA 3W4IA 1MTZA 3RUCA 5F9FA 3AOEC 1T1JA 1YDEA 3O8QB 4JNKA 4AZTA 5AW9A 2F00A 3H05A 4QQKA 1CJCA 2AKAB 5LMZA 2J3HA 2V55B 4TWRA 4NNJA 1P2VA 3FWNA 3V7UA 2P7IA 1KSGA 3FNIA 3H5VA 3PNLA 1DHRA 3N0RA 1NSFA 3BIJA 4JI5B 2PX6A 5JYEA 4NDZA 4KDRA 4IJVA 1H2RS 2P9BA 4ZAFA 3N0TA 3CBKA 4C4OA 2HQRA 5AJVB 5JARA 1OB2A 2QW8A 3AX6A 1TUIA 2PAFA 3CKMA 5AR1A 3GUHA 1JX6A 3KQYA 1YZKA 1GKUB 2HSGA 3WWYA 3LL7A 3PEUA 2HREA 1OPRA 4RXTA 3MUFA 1B1AA 2Q4OA 1Z4OA 1QB8A 1WBJB 3A4YA 1D7OA 4KQ2A 3UGKA 3T12A 2RD2A 4JENA 3PTZA 2GCGA 4ZOLB 5EKXA 4ZYLA 2CLDX 1I6WA 1TAGA 3D3KA 1A9YA 5AHKA 3IYLW 4BP9A 3BD7A 5A4KA 4J8PA 4RADA 1L5SA 1JLKA 3RBZA 4LNAA 3S5UA 2DPLA 3M6AA 1DKPA 4V1CA 2BRUC 2CUZA 2BFEB 1QF9A 3NDJA 1ACMA 1CS0B 3DH0A 4ZEVA 2PUVA 4B7UA 1VI6A 2FG7C 3K0CA 3NOQA 2R1VB 3H9GA 4LE0A 2QX7A 5J2TF 5KOHB 4BNDB 3T1TA 2O7SA 1N75A 3KJHA 3KJQA 5K3FA 1ZVQA 2ZSIA 1QDLB 3S2YA 3IESA 5LQMA 2JHAA 2IXDA 1D6NA 3N0XA 1T8RA 4R5HA 3JPWA 3KLNA 5M7EA 2XUGA 2BZ0A 3AHIA 4J29A 4Z86A 5JRDS 1T5BA 4KLCA 5KIAA 4P98A 5FX2A 4YNBA 3LU1A 4DSZA 1JEQA 4FILA 1WLSA 1YR6A 2CSUA 5BNZA 4ZCTA 3A6HA 1NJ2A 3HNOA 3LO8A 1K7YA 2JH8A 2Q1UA 3U3XA 3DE6X 2EOAA 4CEJA 3W0LB 3GNTA 1IMOA 1FZQA 1YCGA 3I3TA 4FIPA 2JFPA 1U31A 2FU5C 3OP4A 4EBFA 4QRGA 1B7GO 1QHHB 3CF6R 2OP0A 3JCZA 4UD6A 3O3NB 4WBSA 5AXAA 1TMOA 1UXOA 5ALNA 1ESEA 1U6JA 3L1UA 4HDKB 2AZDA 4A0QA 1TJ3A 3LQQA 4HWOA 2JA2A 3N59A 3TRHA 5KQGA 1F9AA 4OGKA 5DYNA 1OX4B 5C8YB 3OM9A 2D59A 3SJAA 2EHJA 1JKIA 4FKMA 4QA9A 1V11A 3TRIA 4YMWA 3NV9A 1V5FA 3AUTA 1ST2A 1VDMA 3AETB 3RFCA 3BERA 1ZOIA 4CL0A 1K7CA 2IZ5A 4U6NA 2BM8A 4C0BA 4DUYB 2IK8A 1UAGA 3PIRA 3R1IA 4OQQA 1ZNWA 4IRUB 3LFHA 1O0EA 5JWHA 4DIDA 4EZBA 4FCCA 3DDSA 4JXKA 4MRPA 2P9QA 4X1YA 3KNZA 2FP3A 5JFGA 1KF0A 2AOVA 3A05A 3QVGA 5BN1A 1QH1A 1L4KA 4F6RB 1NYTA 4WDQA 2H92A 1E79A 4H7IA 3K05A 2JLAA 3PX7A 1U63A 2CMGA 3MYRA 4IILA 3SEAA 2OUKA 2Q29A 1Z26A 4DABA 1AU3A 4ZCRA 1IJEA 5TVGA 5ALXA 2Q8PA 3DD1A 1L1QA 3GL9A 3EVTA 1NT2A 3A1FA 3LVRE 4NTZA 4F5EA 2ZJFA 1M10A 5C80A 5JY6A 1J0XO 4O2RA 2P86A 3ELYA 1DTEA 2OFXA 2XNCA 4KJZA 1Q19A 3QEMA 2DZZA 4WXEA 1AV6A 1HYGA 1LPPA 2E3JA 2YXNA 1INLA 4TS9A 4P82A 1HPLA 5JZBA 1HLFA 3L40A 1BGWA 3R41A 5CNKA 1QE5A 4X7PA 4ALMA 1AZTA 3VGJA 3RK4A 5BWLA 1U4SA 2YV3A 4Y9SA 1JHXA 3CLSD 3ET4A 4MUGA 4ZWNA 3GVXA 4LTMA 3EGXB 1NP7A 3WLFA 5C37A 2SBTA 1U8FO 3RSGA 3WY9A 3NJRA 1L2TA 4LZWA 4C2AA 3PENA 4JLDA 1CWUA 3N6VA 3E9CA 4M0EA 1G1AA 2F3PA 2OHXA 4MVJA 2EKPA 3UT5B 5CAEA 1FNNA 3AJ9A 3DXYA 1AQYA 2ZSAA 4IDOA 4WESA 1BDJA 4D57A 1UBLS 4M0DA 1NB5A 4XRRA 1UZNA 5G41A 1GNRA 3IKJA 1VRWA 1QIFA 1GYQA 3CX7A 1DAPA 1TEHA 1V71A 3HL4A 4X3CA 2VDOB 2GM5A 1Y8CA 1T2EA 2W58A 2YWDA 3JQFC 4NX2A 5ENVA 4B0OA 4IJKA 1O94D 4GYKA 3IQIX 1SC1A 4A73A 2YFYA 4CF4A 1BS1A 1EYZA 4JJ8A 5BSHA 2RGRA 4ND8A 1XTZA 2JLBA 4TLCA 1ZW6A 2PS0A 3L7LA 4CMEA 3AI7A 4QO7A 2IOFA 3ZBQA 4D0NA 2EF0A 3W4KA 4BMVA 1QGAA 3I53A 4U4AA 5DIFA 1EA7A 2EGHA 1RM4A 3LLCA 4XARA 2Q8QA 1WIWA 3PU6A 2FZGA 3DCNA 4IOKA 4KJXA 5GZ6A 2P78A 4GMKA 1DO8A 1EG2A 1EVLA 2HV9A 3AUJB 3MJTA 4IQGA 4POAA 4ZVQA 5H3HA 4ZO7A 4BDSA 5KYYB 3TRKA 1GPJA 2HWXA 3N2LA 1QIDA 4UXJA 2CNWA 5EEGA 1T6XA 4BDTA 3PBHA 1BX1A 1R0YA 2XMSA 1UC5B 1Q6KA 4YV7A 4ZQIA 1M6VA 2ZBGA 4Z8YA 4RY9A 1F8UA 1XZAA 2GZHA 1LK0A 2HLNA 2PH3A 5HSGA 3CLVA 2DC6A 3GDOA 2WABA 1ENPA 1V1RB 4M7OA 4R2LA 3Q8LA 2ALJA 3DXFA 3O1HB 1PG5A 1GQQA 2XNSA 3NRCA 4YIKA 3ZOKA 5DGCA 1DLIA 3O26A 3TNDA 5DM1A 2XEXA 2AQIA 3OT5A 5DGXA 2Z0MA 1FDRA 3PYMA 2QK4A 3RW9A 4D8WA 4WZAE 1Q83A 3HUTA 1SPBS 1UR5A 4MTCA 2VOEA 4DSTA 4PONA 3NHYA 3WKEA 5E8JA 2DHDA 3BGDA 2OBNA 3SNHA 2B5VA 5IJ0B 1NBEA 4Q9JA 5EZ5A 3EGEA 2PZJA 2X4IA 1KYIA 4PHHA 1CDDA 5KB3A 3D4PA 1R8XA 3GJ5A 4BFYA 1ZD3A 3QEOA 1JN0A 4ZK6A 3WYCA 4FGSA 5LQDA 1YK0A 4NYJQ 2JGJA 3K0BA 1QHYA 4M3NA 1JB1A 2IQIA 2QJRA 2FQYA 3BTUA 4PRLA 1BJRE 1VL0A 3MWEB 5BN3B 3HXOA 5AH0A 3QLJA 4H6XA 5C5EA 4DCCA 3WGUA 2GCNA 5G0VA 2R7MA 1YGPA 2Z6AA 5GJWC 1CS4C 1GRQA 3A10A 4JEHA 1XFDA 4X20A 1QNLA 2GA8A 1AU9A 2ZJ2A 3CCBA 3H4IA 3VKUA 5JSHA 1KO7A 4BTLA 4HNHA 1QK3A 2X9LA 2M6SA 3ROGA 3EWSA 3OZTA 1H9CA 1CERA 4FGUA 1BMTA 1A1SA 4ND2A 4BLWA 2OHIA 4RHCA 3B7PA 3VR0A 2H18A 4LHYA 5G40A 3VNQA 3ZXIA 3ITNA 3C1OA 1G7TA 1IEWA 2QLLA 4G5GA 4NL4H 4GWGA 4YYSA 2QZZA 3E3OA 1KR5A 2WAAA 2WM9B 2XE6A 3OETA 3AERA 4BUJA 4I05A 3IR5A 2XMRA 4B2IA 5HJEA 3PITA 4BFUA 2BJWA 3HS3A 2PCLA 1GZSA 4BU1A 4BVJA 1BY8A 3O2NA 4H1TA 3T5PA 3HUDA 1LDEA 1UPCA 2Z5LA 1P5ZB 4LBWA 1ID8A 3OIGA 1LNQA 2AU1A 2Q2QA 2EJWA 3DV2A 5JQGB 4GMGA 5BMOA 1GQ2A 3I6ZA 3OVZA 1PFGA 1UZLA 3W3AA 4PZPA 3NRBA 1SOVA 4U2BA 5BXQC 1BDHA 1KJIA 4GQAA 5EP3A 1QQBA 1VSBA 2C83A 3OTWA 4PX5A 3VMFA 4RNAA 3UC5A 1CR4A 3Q7QA 4IMIB 3OCUA 1SOAA 3BG5A 4QU8A 1HWYA 1T6YA 3UFBA 4DBVO 1JHYA 2DFTA 4I6JA 4N8SA 2EKQA 4XWTA 3ZGOA 1EM8B 3GCZA 2AFIB 2ZRQA 3EF3A 3FG9A 3CFYA 5EEHA 3W7BA 1NMQA 4KQJA 5HMLA 1L5GB 3L2OB 3N2GB 2WD7A 1Z56C 1J4AA 2RB5A 1ORRA 2VTEA 3DTVA 4MKIA 1S2NA 4MUYA 5GONB 4ZMBA 4RLSA 3S4YA 5L4NA 3JRXA 421PA 3G1TA 4S1NA 4TMXA 2O7VA 1CPJA 1PS0A 1PBHA 1P6QA 4J3JA 1BFDA 1R0CA 2IXTA 2X5XA 2DPYA 4BMPB 2VHSA 4OVZA 2Y1LA 2BM9A 4YP6A 3JQ7B 1K8RA 4MPDA 1OH7A 5BPFA 1NUPA 4WECA 4YEDA 3ZDQA 2ODNA 1YZLA 2BZGA 2H06A 4BXOB 2Y9PB 1VI2A 1YKSA 3H11B 4XDGA 4XJVA 3B38A 2RHDA 4U7FA 3D1JA 1BXZA 2VBFA 4F2DA 3VSAA 5BN5A 2P4QA 5B4UA 1ZKMA 3VPCA 4CIXA 3K6RA 1N7GA 1E7WA 1KJ8A 4TVKA 4YAEA 2UU9B 4YMUA 3OZDA 2XXAA 4UATA 4NCBA 1OW3B 4ECAA 3HDGA 1I14A 1SBYA 2DE0X 4HGPA 4Q7QA 5BSUA 3R9XA 3FLBA 5GV8A 4P7BA 1JW9B 2WJGA 2GS9A 4O8CA 2MINA 2EYUA 4TQAA 1XROA 1PKXA 3L0BA 2Q28A 2DUWA 2R7AA 5AKIA 4ND4A 2XWPA 3VYRB 5KYUB 1SB9A 4M9CA 1QHXA 4GP9A 1Z3IX 2BT4A 3D7KA 4FW8A 4AKEA 4BPBA 3BXOA 4UQOA 2UUOA 2C54A 1F8FA 2Z2ZA 3C85A 3CLHA 4HZGA 3AUKA 1XU7A 4MM3B 1GIAA 3IBYA 3PD1A 2QHXA 3WYEA 2BBOA 1EIWA 1JP7A 3EMDA 2EATA 1Y4AE 2QX4A 2VAWA 1SA0B 4GOJA 4MQ5A 1K63A 2DFDA 2H5EA 1VFNA 3ZGVA 4A2WA 3M6VA 2CXUA 4EG8A 1AHIA 2YQ4A 2ZIEA 4YX9A 2PBFA 1N8KA 3EK2A 3FNEA 5IW8A 3VQTA 2FPWA 4URWR 3A37A 4RTMA 1QGYA 2A59A 3IEIA 4QQNA 4DLYA 5CFNA 2I4TA 4JHLA 5H81A 1ZCZA 2AC7A 3FFAA 3HDHA 3LKZA 4HZUB 5CK5A 5EIXA 1GFSA 4E13A 1D2CA 1MEJA 1P5HA 3N9IA 4MRNA 4N18A 3TO5A 1KOLA 4YRTA 3ZCTA 4Z9FA 5KNDH 2FGKA 4P81A 4HNAB 4ND5A 3ESRA 2A5FA 4AJLA 2JAXA 1GMYA 4RHFA 4M7WA 1UKBA 1CY7A 1DJPA 2Z09A 5HVNA 3K0SA 4CLRB 4DRXB 2X0FA 4UOQA 5AXBA 4ZEOA 5IANA 4BO2A 3KJXA 4JLJA 3QNMA 3W5VA 5FUQA 4C5CA 3C0RA 1FP6A 3EIWA 4W82A 5AVOA 3OJEA 4Q1FA 3BMNB 3CA8A 5BQFA 2P4EA 1Q50A 4B2LA 4BLRA 2OM6A 5F1PA 3GT7A 1QFXA 3WKBA 2OAEA 2QX9A 2R9NA 2JK1A 3K0FA 3SLRA 2FR8A 5SZIA 2XUPA 4K81B 1WULS 1G291 2JEYA 4KGDA 4E12A 1THGA 4YT4A 3AP1A 4KKXB 1TK2A 1OE0A 5EJFA 4AS2A 4BNGA 4YT8A 2RJ3A 2HXYA 4P80A 4TLMB 5G1NA 4BGIA 2J0UA 1GG8A 3W5HA 4DV4B 2G63A 3AJEA 3VU8A 5AO9A 4XEHA 1TZMA 2UVPB 4Z2AA 3CKLA 3TQRA 4K0KB 1E6UA 3IUTA 1WXHA 1MAWA 3MUEA 4D4MA 2J31A 5LZ9A 1R4AA 5AK5A 4XLLA 3RIMA 3V3KA 1Z0KA 1C7FA 3H9BA 3HWX1 1TCCA 3R5XA 4KOEC 1RCUA 3FZYA 4IIYA 3VYVA 4X1KA 5ER6A 1HH4A 4BJHB 1D3AA 1Z5VA 2ZI6A 1Y5LA 3OIYA 3DT8A 2HH5A 1MU0A 1SZDA 1EHCA 3WGQA 1VMAA 4OI4A 2Q9CA 2A30A 4CQMD 2RAVA 13PKA 1X92A 2JJ1D 4G4SO 3KWFA 1EUDA 4J07A 5B7GA 4RE6A 1R8QA 1ABEA 4PC6A 4MUJA 1L4UA 4KFRA 5I8ZA 4CMIB 4BAUA 2LCFA 1Q5PA 2E49A 4UUOA 2XRYA 3CBJA 1J97A 3VSDA 5C2JB 3LXMA 2G8NA 4YS6A 1CUSA 4TS1A 2FUG1 3V6LA 1QDEA 2FWIA 3NBXX 2BKEA 1N6HA 1VJRA 1X0VA 2HUNA 4V0KA 5FTLA 4MWTA 3GDHA 3E2MA 5K0NA 2WWYA 1L4EA 3NOXA 3RYCA 3W5BA 2B82A 3VSBA 3BBAA 2FRVA 3REGA 1JMKC 3WI7A 4MYDA 4UBOA 2QL7A 3HR4A 3ILXA 3WL8A 5ITWA 1TUBB 4OA8A 2INGX 5DGHA 5GOTA 3WLOA 5B7QA 5IPFA 4L27A 1QR2A 4JVLA 1ONSA 5KNCD 3BPMA 5AVJA 3V3TA 4ZREA 3U49A 4XWYA 4Y1GA 2BTQA 3ZQUA 5ELXA 2RGAA 4DANA 1POXA 4MUNA 3UWDA 3A2KA 4G0OA 1T2UA 5LUBA 4GBMA 1EEHA 3AGQA 4HB2A 1MW9X 4OLFA 3OG9A 4JIMA 4Q4LA 4DHEA 2G9NA 4CMCA 2WG1A 5B37A 1S3FA 1IQUA 3GX1A 3Q3HA 3NORA 1KEVA 4M6WA 3IBFA 4Q3OA 5G02A 4RF1A 1OWMA 3DT9A 5BSEA 5M5BA 3H4TA 1F2UB 2YZ2A 4JQCA 4LJRA 4NYJR 3EISA 3HN7A 2DFPA 2EZ9A 2EF1A 4PFKA 1DDOA 3RSSA 3V2UA 2EKDA 1DADA 3BC1A 5DMXA 3WO0A 5HQ3B 1ESCA 4EQZA 1AH2A 2YQ5A 4WOJA 3G2PA 3GLHE 4KMRA 1M2OA 3DDZX 5A3QA 3DBLA 2CEAA 3BRQA 4I1YA 1XD9A 3LCRA 2OECA 2GF2A 1UJ6A 4LJ7A 5EXPA 1EVEA 3WNBA 3WYNA 5FPPA 2FKAA 4J7CA 1JG1A 2J46A 3D0QA 5JJLA 5TQ0A 1LEHA 2IW1A 5AVXA 5T8KC 1NI5A 2Q1WA 4MUFA 4RKEA 3HM9A 4P38A 2NO1A 1YVUA 3FKQA 3CEPB 3COJA 5LZ8A 4EA8A 1FNSA 2O5RA 1NUUA 3PQ6A 5IKOA 2GETA 1XTSA 3MF4A 4OHUA 1KH3A 1RLIA 2VAVA 3B6KA 3WYAA 4REZA 1PHRA 3L84A 3QE4A 2XDWA 2WSSA 1JTEA 3NIBA 5JCOC 1XRLA 2C4NA 3D31A 3HCWA 1L9KA 3PC2A 4U5XA 4MWDA 5D00A 3B9PA 4I9NA 4W1SA 1SEVA 1VM6A 3FHCB 4IIBA 4QICA 5C8ZA 1IH8A 1Y7LA 3GLFB 1K7FB 3EXG2 2C7QA 4JYBA 4HK4A 4JEIA 2BFOA 1G20B 4LZNA 3TZBA 4RJJA 1OHHD 3L18A 2HHHB 4RDXA 4AY4A 2ECKA 1ZDMA 4GPZA 3H2IA 1QBKC 3HYSA 5EFZA 4HMPA 2EDCA 3O6VA 2XTNA 1L6IA 3NU1A 4FFWA 4DCGA 4MULA 4GT1A 4GYJA 1H9AA 4HWGA 4R16A 3HO1A 4RHEA 3HO6A 1PK9A 1UDWA 1V45E 4IQFA 4LVNA 4AJNA 3FDZA 4AJKA 2C20A 3B51X 1A8IA 4ITUA 3W78A 1PJ8A 3DMTC 1KDRA 3H4VA 4F2PA 4JP2A 2YZGA 3AEXA 1XIVA 3JAWA 1NU6A 5ICMA 4I3GA 3HHIA 4DEXA 4KL8S 1KAGA 1UXJA 2DKFA 2ZKLA 4LPKA 2JATA 3DAGA 2R84A 2DTEA 3O7MA 4EG5A 3AEKA 3S68A 3AR7A 3H2GA 3QVOA 4JX9A 3ETDA 5LCXA 3ZUGA 1EB9A 4B2YA 4EA7A 1VSVA 1U8XX 3EZYA 4DM4A 2AG5A 5BMVB 4JYZA 2YJ9A 4JKIA 4M83A 4MVJF 3O75A 2PYIA 3T5MA 4CKZA 4TLDA 1TF5A 1ND5A 1GA4A 2RARA 2FPUA 3H1BA 4FYJA 4UOZA 3UJCA 1P9NA 4EO7A 2K7FA 1E32A 3DMTA 5AUPB 2XAAA 5EWLB 3NTRA 2AOWA 3ZVLA 2FW7A 5EC8A 2YV2A 3WMGA 4EHNA 1BN6A 2RGGA 3NBUA 1V7ZA 1S2DA 3G8CA 1W85B 4JJ4A 3T54A 3RIEA 4WFQA 3AM5A 4WUTA 4ZANA 3W2FA 5LFAA 1XZEA 5IBCA 4CTJA 5JBIA 4LFCB 3KHSA 4ZO8A 5LLTA 1FNCA 2B2NA 1EWKA 4CLOB 3I45A 1U6KA 2I4NA 4N6GA 2D0IA 1J0CA 3UG7A 2QA5A 4C21A 4CM8B 5JISA 3TRJA 1IDN1 3EXFA 4I50A 1VMKA 3WA6A 1G5TA 5J4VA 1NVUQ 1Z83A 2PFKA 3FJYA 3JWGA 4NZOA 2AJTA 2PLFA 2TMDA 3DL4A 2GBLC 3IIKA 5KOYA 2DHEA 3AJDA 1GRNA 3I61A 1C4KA 2HO5A 1G0NA 1IFXA 2AKYA 3LDFA 3QLVC 5A02A 3GJQA 3LUKA 3ZHVA 2NXCA 1J0DA 1MCZA 4RPJA 3EIHA 5B6JA 4FZ5A 3T7TA 4DR1B 4F56A 3HACA 5KNDD 2UZ1A 3E9MA 3WLSA 1IC6A 4ALNA 4JCOA 3ZJVA 2YBEA 3CR8A 4HNSA 1IHPA 5IDWA 2XU4A 3AY7A 1SM4A 3WGTA 4J0GA 1TUGA 5HIAA 2J45A 2D5LA 1EBUA 3PFBA 4LJ4A 4US0R 1JYEA 3BIXA 3DV9A 5HF6A 2GDZA 3TTYA 2JANA 2A0UA 3B5EA 3PWSA 1KL7A 4RZUA 2OGSA 3HYLA 3UJ8A 1B26A 1FU7A 3L1VA 2B99A 2JIQA 4YWJA 5TB5A 2C5LA 4RESA 4YMLA 2GFQA 3KVNA 4WEQA 3PNKA 2IFTA 4WZBA 5IVHA 4UEOA 4U6SA 3MXTA 1P4JA 3IVRA 2O14A 2H48A 4QDJA 2HCJB 4DEVA 1NI4B 4CI0B 1GADO 1I4WA 4WZAA 4Z4HA 1DQSA 1TIKA 4FMDF 3TF5A 3HLKA 2AXEA 3NTOA 2Y68A 2XXJA 2WOOA 1NFQA 1XHFA 2JVKA 2WDZA 3K7EA 4TTJA 4XIJA 1A2KC 4LQCA 1TADA 3B3GA 3K9CA 2WNIA 4MCHA 5AOAA 1V4VA 2PUJA 3R3YA 7AT1A 2Y6VA 4F86A 3O1LA 2HCTA 9LDTA 1FZTA 4F9GA 5EMJA 2GX6A 4QXMA 4WNAB 3X43A 2H11A 2REOA 2X9NA 5NLLA 1D9XA 3E8MA 3LLVA 4KQXA 1YQUA 3IJRA 3HPQA 4H3VA 1Y9DA 5JIBA 1LNZA 4CKYA 3MN1A 2GOYA 4H27A 4DSNA 1X38A 4I55A 2OV2A 3AEUA 3O9ZA 2OGZA 4CN8A 3PD7A 4U7WA 2I3ZA 3IV7A 2XWJI 1CE8B 2FMUA 4EJ6A 5EINA 4Y2HA 2XKKA 4DY4A 1K88A 1PJSA 1H5QA 4GECA 4A6EA 3AVVA 4GKKB 1XCGB 1WAMA 2FEPA 2FPIB 4FPXA 1FE8A 3QBTA 4UBLA 4HX5A 3VR1A 1WS6A 4DR2B 1NG9A 2UZ0A 1MNQA 2ADOA 4BTVA 3OAAA 3RFFA 3WGKA 4BKQA 1ZN8A 3EIQA 1H22A 1Z47A 1VC2A 3HJNA 4MB0A 1M2WA 2E4ZA 4NSNA 3OQBA 2VN8A 4RO0A 3P4YA 2DFLA 2VKQA 4JUBA 4GLOA 3ENNA 4HVAA 5T7BA 1VMDA 2ZQYA 1YR9A 2ZJ6A 1GQSA 4GWKA 4J0IA 1GKLA 2Y0PA 2KJQA 3U0VA 4BX3A 3ZNHA 3T4PA 3ZQJA 1R6DA 4QU0A 3WLHA 4ZTZB 2GBIA 3BN3A 3DE7X 4LC0A 2V7TA 4ZAZA 1NZJA 1G18A 1NOJA 1W76A 5GM2A 5GVRA 3TZEA 2OM2A 3LFUA 2RDMA 1Z88A 2H1FA 1B3RA 2B7CA 4H4CA 5ALSA 4MRSA 1MDBA 2HJVA 2J9XB 1BIFA 4LOHA 4XOIA 4GDFA 1Y6QA 2RHWA 1MFZA 2QVZX 2H4FA 1U3VA 3C5VA 3OPYB 1T8SA 1YUMA 3ASUA 4QWMA 1NDHA 1PJ3A 1ZX1A 2QG9A 2XCQA 3ER6A 3MFQA 2Y1XA 2YFHA 4NHEA 1YL7A 4QIHA 2VSXA 3RUHA 3F73A 4KIUA 3QUAA 4LY0A 3MJEA 3F9RA 4ZVOA 4ESOA 2IOYA 4GZMA 4RTSA 1CEQA 3H42B 3OIFA 5TQ2A 4UQLA 3TQQA 1LPOA 2YMPA 2WI8A 2PD3A 3I3SR 3FWYA 3MJRA 4KDEA 1GUAA 4OYYA 1MGPA 4RFSA 3RSCA 1W29A 4MGKR 4PW0A 2OYRA 3OJCA 4JWTA 1EA5A 4RZQA 4FD3A 2GCEA 4QDXA 3U1VA 4BKRA 1XN1A 4L0MA 3VYSB 4QVIA 5KQSA 2AFIE 4U8GA 4I8XA 4E31A 2JHCA 2GFHA 3TFOA 4TM8A 1NR5A 4C3UA 4LXQA 5ED0A 3C98A 2P9JA 3OE4A 3PHIA 4B6PA 4C5AA 4ZOLA 3N2ZB 4EAAA 4TZ6A 3ZVKA 5CXUA 1U0FA 4KR6A 1OQAA 4PTYA 1DG3A 3MWFA 3NDPA 1WD7A 2DCBA 3L9WA 2BR3A 3QE2A 3RUFA 1NW8A 4CV3A 3H13A 3JARA 3ND8A 1Z35A 4E4YA 2NACA 1L1EA 4TKMA 4B9EA 2HQ1A 1MV5A 3CG4A 3R5SA 1RHQA 4UVIA 4FOLA 3WYGA 5JJCA 2I80A 1PIWA 1JIIA 2V7QD 2W2MA 3LDGA 2DBZA 4Z9XA 4HR7A 4QTZA 3OX4A 5K3FB 4YMTA 4MS4B 3V4PB 2CWDA 2D1SA 3OMLA 1QFMA 1O58A 3INYA 4MCAA 1YMVA 3JQPA 3UIEA 4F2HA 4XWKA 3HXTA 1PV1A 4R1LA 4GR9A 4Q4JA 4GE3A 3ZXXA 3NKVA 4GOKA 3LX8A 1H42A 4ER5A 3PGA1 1KAOA 1U0NA 1SXJB 1DC7A 2NTYC 3JYHA 3OZEA 4UZSA 1OYYA 3DYIA 5JPDA 3FETA 3SEQA 2OB2A 4F3RA 1F2TB 2XE4A 3TAUA 3DKVA 1VLZA 1UT8A 2CF5A 2WYVA 4JJKA 2Q0HA 5DX1A 5FI3A 1MIOA 5E6JA 2FPLA 4Q47A 3V8BA 1QYRA 2AUZA 2CEKA 1E2MA 4C7XA 1LTHR 2C2WA 4PYOA 3AUAA 5IC6A 1XCBA 4GE0A 1E3JA 4OMFG 2IEDA 3H97A 4IF6A 3LRPA 1LF5A 4NE9A 2O1WA 2VYNA 3K0CC 3NBAA 2EKZA 1EDEA 4KCGA 1KK0A 3G5UA 1GOTA 2E0IA 1ATZA 4YFVA 4PAQA 3KR1A 4RIIA 1UMBB 1F2BA 4LDNA 2CSXA 1UBGA 4KH0A 3WBKA 1KYTA 2AJDA 2CF6A 4MDFA 2JI6A 4II7A 3RARA 3OJ0A 3PNYA 4P4UA 1KBZA 3EEIA 1OH6A 2WLSA 3Q41A 1CUVA 3QVGB 3FIJA 1V1MB 2XGSA 4R1QA 1CY0A 4YUAA 1PJCA 3SHVA 1YB5A 3AFHA 4BFXA 3T0GA 2VAXA 3CH6A 3TTWA 3L4KA 1P18A 4HUJA 4KO2S 4QRXA 3SF0A 4Z4FA 3RTGA 1QG6A 4JP8A 3KDSE 3PFFA 1OIWA 1N2CE 1NVAA 2FPOA 1Y37A 4QGBA 5JRZA 2XOKD 4EKDA 2ZJBA 4F4HA 4BQOA 4BOYA 1VPWA 3R77A 3U7QA 1NVGA 3SNKA 2AZMA 3QMVA 3E7FA 2C7PA 4IIVA 4GPEA 1RZRA 2F8SA 2FQ9A 5CH5A 5IDVA 1KGDA 1Q15A 1YDGA 2DVMA 3EVFA 3PHCA 5ANRB 3W34A 3ZD8A 4RFVA 3W8NA 1EX9A 2BH2A 4ZPXA 2YWJA 3QWAA 2ZJ7A 1ZM4A 4QYTA 1P2SA 2AG0A 2BFNA 3DFIA 2NXWA 3FYTA 3LQYA 3R0QA 4OJMX 3QKUA 2IOQA 2J33A 2C2MA 1HL3A 2V7WA 3EGXA 1K0FA 1WHSB 3UJAA 1GCBA 1R00A 4DADA 1XMXA 3TQOA 4N6NA 1BO6A 2XYHA 4R1OA 5BT9A 4GZ6A 5BQ5A 1IWPB 3ODGA 1LV7A 1PZGA 1C0LA 1TRKA 2BP7A 3JYLA 3O2SB 2Q2OA 4MMZB 3VJMA 3NT4A 1X87A 1ANKA 2CUTA 1M1NA 3M6WA 4RK0A 4M22A 1V6AA 1XZNA 4UVHA 2GD1O 2NGRA 1FTNA 3ZY4A 2OCIA 5FUYA 2G08A 3G59A 5HZMA 4DYDA 3I6MA 2QYOA 2UAGA 4MYRA 3DYVA 1AM4D 1X70A 2GYVA 3CX3A 3D4BA 3W79A 2FSPA 3KZKA 1WUHS 1NDUA 4B1FA 4F4FA 1RMQA 4KIWA 5IZCC 2R8PA 3LUBA 3H8SA 4DMRA 3RT9A 5CCBA 2FOXA 2ZJ4A 4FU0A 1ADCA 1MC5A 2J9YB 2K6GA 4GGPA 2D1YA 2FG5A 5D3KA 4B3MB 3GFVA 1DPGA 1Z0SA 2QVCA 2QKYA 3M5CA 2PUTA 5ERYA 3F5DA 2IIPA 4GX0A 1ZBDA 4QOEA 3WQRA 3LE8A 2A4KA 5KHLB 4IUCS 5HF8A 9PAPA 2VHUA 4C4YA 1DI0A 2H4HA 3EUEA 3ZKAA 5I3ZA 3KLMX 3HI4A 5FAXA 3E61A 4A0GA 4BMNA 4RANA 1U9IA 2C8KA 2QRJA 3SE7A 3N86A 4DF3A 5AUOB 5LQKA 1FYXA 4IGIA 4IQ8A 2BKVA 2PIAA 3PV0A 2W5UA 2P90A 2GPTA 3T41A 3QG1A 5FPYA 1G16A 4BB5A 1QQTA 2P30A 3KOXA 4OKSA 4IOJA 1Y5IA 2H4XA 4QBBA 3AWIA 3DZFA 2G28A 4MKZA 2H2WA 3WJ2A 4HP8A 4N76A 4FSDA 3LO5A 5IBRA 1DTWB 3QI7A 3R0ZA 2DT8A 4HBZA 3IIIA 3CNLA 3GEHA 5KX5F 1A9OA 3ILYA 4X24A 1TOAA 1LY1A 3MB5A 1JDZA 1YU9A 5L3ZA 1C9YA 1ID1A 3UK6A 2ZYWX 5BR1A 1Z74A 2J4DA 5JZOA 2JGDB 3AVWA 2IYLD 1VPEA 3O8DA 1WHTA 5KSPA 3QSYA 1USUA 5FHRA 1A9PA 2OMKA 3I3OA 3UK2A 4CYMA 1M83A 2JFBA 1DZIA 5CDFE 1GZHB 3LT1A 3UHFA 1MB4A 4DMCA 2BD0A 4AZ3B 2W37A 2NO7A 4QEZA 4G2NA 2B98A 1IK6A 3KXDA 4X6UA 4DZRA 2GWHA 4ER7A 5G3ZA 5A24A 4IHJF 3WLMA 3HQ4O 2QY6A 3ID6C 3NBMA 1QP0A 4ZPJA 3HBMA 3Q3GE 3G1UA 3MMNA 2NG1A 4UNIA 4YP9A 5KVCA 2BFBB 4NBLA 4BNXA 1U99A 5ULLA 1T9KA 4DIFA 5FFMA 1T8PA 2E4UA 2C3YA 4DY6A 3P5BA 4NDAA 4W6ZA 1TM4E 4G5HA 1IJKA 3S7TA 3DW1X 4AUMA 3PRYA 1WPRA 4F0JA 2P69A 1L4LA 1AURA 1YRHA 5ES3A 4ATNA 5HUHA 1NW6A 2XKJE 4KXVA 3W3AD 4N9WA 2Z56A 2FEWB 5C1DA 4RK7A 1C9DB 3B3QA 3K2EA 3VPFA 1PDVA 4QYIB 5AI4A 2Q2VA 4WGFA 1YVEI 2CJXA 3RVLA 4P9NA 5J40A 3BB4A 4FBGA 4XKJA 3U1TA 4WASA 2C95A 1Z7EA 2IYXA 3CW9A 4ND7A 3QLEA 5FPQA 4ODIA 3F3MA 2GHQA 5IC5A 4DNPA 3OOSA 4ZO9A 2JCGA 2FP4B 2UYCA 2ISQA 1UZAA 5LZ2A 1OH5A 4LF6B 1NBWB 5HQJA 2RSLA 3A1TA 2A94A 3MGGA 4FKBA 5EXTA 3GF4A 3T9FA 3YASA 5FNVF 3ROQA 4BHTA 1Q1NA 2GQ0A 4GZLA 2WQ7A 1MVLA 2AK3A 2J5BA 3DG9A 3G6WA 5LMCA 1CVZA 1K2WA 2R8XA 2X4LA 1S2OA 1ZGBA 2X1LA 4XGNA 5A6SA 4DBZA 1BYUA 1R6VA 1Y42X 2PQ2A 3S2FA 3HBLA 1AMOA 4J90A 4KLNA 2NN3C 1H5NA 4F2GA 3NGMA 2YFQA 1ZK0A 2OFWA 3GJTA 3KEQA 5AVKA 4X65B 1OLXA 3GLRA 4XJTA 1XQXA 3EB9A 1ZD9A 2IEAA 4D25A 3QWIA 5FJJA 3RNOA 4OM7A 1ZLXA 1O54A 1E3DA 1EXNA 1TKAA 1ZIXA 2GI4A 3MCAA 3ICCA 3RRBA 3V4OA 4C22A 2HDNB 2X14A 2QVGA 1H85A 1N2XA 4HL6A 4BGVA 4BMYA 1MAVA 3TKAA 4C2BA 1EWOA 2HEIA 5KVSA 3JQ8B 3VNAA 2Z5FA 4L51A 5L3SA 2BI8A 2ZSUA 3HWSA 1DSSG 1P0QA 2FT2A 3EFOB 3G2KA 4RCVA 4LKRA 1Z25A 2ETXA 4CGZA 1KKLA 1HG1A 4GKBA 4XXHA 1ZGZA 1PGPA 2G5PA 3Q0IA 3H11A 2AIRA 5CK4A 3DLBA 4LPSA 1GPBA 5SZKB 2KBEA 1HZZC 4G5FA 3CVVA 3RJTA 4JI7B 1PLKA 1ESZA 1N2BA 4A8TA 3N7TA 4LDQA 1AU2A 2QD3A 4LOIA 1QH8B 721PA 1Q12A 4BO8A 3KBOA 5E6RA 4AX8A 1YSCA 4TMVA 3T7KA 2NOAA 3R7WA 3L5OA 3L7JA 1S3IA 1J25A 1OZGA 2NV2B 3W2TA 3DTTA 4OP1A 5J23A 4RF0A 2LE0A 1Y3HA 2FTDA 3WQQA 2D00A 4IXMA 3FSRA 5FPSA 3X44A 5DCYA 2IX9A 3IT1A 2O8EB 1C0EA 2CDNA 1GPAA 1JG6A 4NEQA 5ALYA 2ONJA 1NFFA 3DQPA 5TF4A 3DO6A 3G8BA 3M9XA 3CTPA 3OJFA 5DF1A 3T5DA 2ZR7A 3QVTA 1RKBA 4QYXA 3U7EB 5KYWB 1GL6A 4L5IA 1U8UA 1GKYA 1V6SA 4JJIA 2AGVA 4FGKA 3LBFA 2WWRA 4BIIA 3RNLA 4M0KA 4OSOA 3N07A 3MAGA 4MCJA 5G4KA 1P2DA 4IIEA 1W4RA 2QMEA 4KH1A 5CB8A 1Y3AA 1VBNA 2B5WA 1U5BA 5JD4A 1L7PA 4NENB 3UGQA 3VOSA 5CYGA 3IEVA 1RXCA 2TS1A 2QY9A 1OGJA 3HB9A 3KB2A 3GR6A 2HU8A 1GG2A 3QPBA 4TQGA 4R7GA 5FD8A 1JWLA 4K28A 3V32A 2NU9B 4JY7A 2A5YB 1FMCA 2YVQA 3BAZA 1CF4A 4WNIA 4OCZA 3IOMA 8ADHA 2XYVA 1PL7A 3QKIA 5JASA 1I5EA 3F3YA 2GYWA 3H4MA 2I03A 3IO5A 4KBFA 4ENUA 3P27A 2JIMA 2I2BA 2BKLA 5AW4A 5T64A 4W5CA 3U40A 4O4IA 2PMWB 3EUAA 4CQLB 4DWJA 3ECCA 1E4YA 3OQCA 4RK4A 4YDQA 1A82A 5H70A 3T9AA 4TZ0A 2O8FB 4Z4IA 4ANFA 1W34A 3T3NA 3D6UA 4KNYA 3GK3A 3LGAA 3O1JC 1ME3A 3IEJA 4HPWA 2DKNA 2VTDA 3DPIA 2IXEA 2XUHA 2YOHA 1X7ZA 2WICA 2YYZA 3WWZA 1MO4A 3N0VA 1YZBA 2Z9DA 3CKKA 4MJXA 1ZHOA 1AQLA 4WY5A 1BKSB 1V41E 4GYWA 3VR4H 4ZN6A 1HURA 2HH9A 4H08A 4OQDA 3LFYA 5KMGA 2NXNA 1HMYA 1G0OA 4XDYA 3OVXA 1RQ7A 3VDQA 5D1NA 2XV1A 4GXRA 3DAPA 3IP6A 4K86A 1PTJC 4YR9A 3AR4A 3VR5H 1JXOA 1RD4A 3IR6A 1U2GC 3C41J 1LU9A 2I67A 2BKUA 3ZDEA 1YZQA 5BPHA 3H8CA 4JA0A 4PHTA 4RPKA 4ME6A 4U8HA 2J9GA 5JSZB 1GPYA 3B6EA 1A9XA 3HA5A 3D2LA 2ZRPA 1QYWA 3KKPA 4ZXFA 2HDWA 2IYPA 1G42A 3KVRA 3HCAA 4B2PA 1HNXB 3S2EA 3DKPA 2VPYA 3HB0A 3R09A 3C3WA 4RKWA 3RHFA 1COZA 4OV6B 2A9RA 1X13A 5FUVA 4FT2A 5GVSA 3A9VA 3TB6A 3AO0B 4YHHB 1Q7BA 1P73A 3OP1A 5ITZA 1IVYA 3LPLA 2KYRA 2QL9A 4DREA 1AKRA 2ONZA 5BVGA 1C8KA 2QAJA 4JYMA 3SZLA 4I9UA 3PUIA 1RFGE 4HGOA 4JGBA 4HY3A 5H83A 2XB2A 1Y4HA 2XX3A 3CURA 1RIIA 2V9CA 3MMSA 2EWVA 1OBFO 2ACVA 4DMYA 4I1OA 2EFHB 2XZLA 1U2DA 1EDDA 1EFCA 4FYIA 4AT1A 4PE5B 1WM1A 5C9ZA 4WX2B 3JATA 3TXAA 4BMZA 5E3HA 3B6MA 3K9BA 2G1JA 4ZVTA 3QOWA 4QDZA 4DV7B 3RSLA 2VCYA 2PPLA 3KQVA 3KDPA 2VYFA 3IIJA 1KO5A 5KINB 3I9NA 2PMCA 3HJAA 3V1MA 4BAGA 3RYCB 3DVQX 1U2ZA 2XUJA 3NALA 4G1BA 4TXMA 4Q9HA 5A62A 2Q6LA 3PPXA 1WXXA 1VZ2A 3D0OA 5IJ9B 4TRJA 4PC1A 3B6ZA 4P5EA 1EFVA 4ARZB 4J3NA 4C7OB 1LPMA 2GD6A 2QQEA 3AVPA 1Y33E 2HYDA 3COSA 2P5TB 4RELA 5BNTA 2PUCA 3BWKA 3VRHA 3Q11A 5B57C 1MJGA 1CVLA 3I2GA 2BTQB 3DWFA 3F6YA 5I51A 2C88A 1PW7A 1T3ZA 3MTVA 1NNSA 3GJ4A 1PRYA 1QRRA 1BN7A 4J0EA 4MVJI 1K8XB 1VG1A 1BNCA 4WJZA 3MT7A 2W2VA 4KQMA 4DT1A 2IBSA 1Q95A 1Y4SA 5IAEA 3C7AA 1ZCFA 4UZEA 3NHZA 3GXBA 4NLLA 2QXTA 1IZ7A 1KDOA 1XTQA 4CMKA 2VYCA 4P3KA 3ET5A 2XQKA 2X3UA 3PQ4A 5HTOA 2IS1A 4YUXA 2JLSA 3FYUA 3A04A 2FFBA 3P2IA 4GEKA 4JBWA 2ODAA 4RSMA 4B76A 4UNPA 5LA6B 5KNDA 5ED4A 4PGHA 3RS9A 5LZ5A 1JJVA 2PJDA 1FYWA 1E7QA 3EDMA 1KVSA 5F9HA 3RU9A 1XRRA 4B3SB 5DHUA 5FNZA 2IHUA 1QC5A 1FYEA 1C8BA 3LYLA 5I7VA 3PUKA 4IHKA 4DV0B 1LCIA 2QTCA 3ROMA 2SCUB 3X1JA 2UV8A 2ZI4A 3FR8A 5FOVA 4YXWA 3E9EA 3NYIA 1BVRA 4YT2A 2Q46A 4N7RA 4WZBE 1AA6A 2D54A 3KTDA 4II2A 1Q0PA 4N5HX 3FNHA 3TTUA 4PU0A 2PX4A 3GU3A 3C8ZA 1A9QA 4JMPA 2EARA 4NCIA 4AW9A 2OO7A 4GEGA 3PSHA 1E6LA 1UKVY 3N2EA 3QVJA 4FFNA 3H9CA 1XYGA 4R1PA 2FETA 3IAS1 3W7VA 2QTGA 2X8LA 2TMKA 4HFNA 4L4UA 1NUTA 4IJWA 4AU1A 1Z6AA 2FR0A 1XZGA 4DQ0A 3AWDA 1ZNYA 5AWFC 2D13A 5A5EA 1U9QX 1TA0A 1TT5B 3T7AA 5E4JA 2FPGA 5K51A 4IIJA 1ORDA 3UMGA 1B8UA 1XA0A 3LS2A 3VVCA 5L6MB 3AL0C 4MQFA 3R76A 1CUJA 2JB9A 4J2HA 1ULBA 3BL5A 5DN6D 3LDUA 5BSRA 3IQXA 3CIOA 4EITA 1A8SA 2JFNA 2F6RA 4PSVA 4YBRA 1FRZA 1E4EB 3UXMA 3RUEA 2O59A 1TFRA 4AJOA 2WINI 3LM8A 4BFLA 2C2GA 4R2WA 4FN4A 5FEMA 4GM4A 1QRSA 4FCWA 2JGLA 4UULA 3TZKA 1HUCB 3GHHA 2BHTA 2HLPA 2O0JA 2R7KA 3DEYX 3F6RA 4XVRA 1KRXA 1PPDA 1GG5A 2VS1A 1ICEA 1WDLA 5LMUB 3KL4A 4COOA 1NTRA 4H3KB 4E0BA 3IC5A 2ET6A 5LIPA 1EGMB 4KI7A 2JQFR 1N5JA 2OLEA 2KQUA 3VAAA 4E5NA 3JQ9C 4PS0A 2R6NA 3U6BA 2AOUB 3CRW1 3LH5A 2B8JA 3WGMA 1FQOA 1XTKA 1ENOA 5CNMA 3EDOA 4MP6A 1IZ9A 3R6DA 4J9UE 3SKYA 5JO9A 2I7XA 1M72A 3H2HA 4A8JC 4DJTA 1U8YA 1Q1QA 3DOHA 3AVUA 3EIXA 1JSCA 2OWDA 3F3KA 2QLJA 3JYNA 3VZCA 4A03A 4L3OA 4W6QA 4ENPA 5TQVA 2R9MA 5J4HA 2CLSA 4UKDA 3DE4X 2PUFA 3BCHA 3LUJA 4HAVA 2UYGA 1T25A 3AY6A 3H3FA 3B2QA 3CISA 5KOJA 1W85A 1OXBB 4CMBA 2FWMX 1XZQA 2ES4A 1R5BA 1HDYA 1N4AA 2YR0A 2YTZA 4WKNA 1O6ZA 2HMWA 3HKEA 4MIYA 5K3CA 3L6CA 4L4RA 2KB0A 3R3JA 4JP5A 1H3EA 1PWXA 4IP3A 2ZR9A 4CM8A 2Z9CA 1HX7A 3FOBA 4M8KA 3I83A 2HHJA 3QG5A 4BLSA 4BX9A 1KIMA 2VCEA 4LVCA 5TPZD 3ZLJA 2F1GA 2OPHA 1N3BA 2PX5A 1NASA 1BGXT 3NONA 3D6HA 4PY2A 3EEOA 2OVFA 3U9LA 4HGZA 3ZE6A 4D56A 4R2MA 2JASA 3GXOA 3R8CA 3UWPA 3VKHA 2KE5A 1SH7A 5ALIA 2BZ1A 1DCTA 3AB3A 3C14C 2WJIA 3FPHA 1E4OA 1T8YA 2X15A 1M6NA 1FL9A 1RZUA 2XOKA 3L5KA 2RH5A 2IDJA 4ZOEA 1CS8A 4B6FA 5LQCA 2WUDA 4U3JB 1Y6FA 3WL5A 4TWIA 5I9NA 2V54A 2GHUA 4MLPA 5KHOC 3WB1A 3OLQA 5FTNA 1QZUA 2LVBA 4QFCA 3BREA 2N0SA 3I62A 3N4CA 4D81A 1VDZA 5F52A 1GRRA 4GI2A 5EWJB 3B1FA 1NXWA 4RVCA 4WLFA 1ZJ5A 1JIJA 4RQAA 1CVIA 4H1HA 4HH3C 4MGEA 2G40A 4LCEA 2YIDA 1GLOA 3KPWA 3WSTA 1RBMA 3LZ6A 4DA8A 2FA9A 2EERA 4GI5A 1N6LA 1Z8DA 4Y6PA 1YZGA 2OQVA 4UFPA 4AP6A 4HGQA 3CB2A 1LDBA 1Q21A 5JS6A 4L9SA 2NUAB 4ZRMA 2RCYA 2AQKA 3LPAA 4KBYA 2PKRA 3VKFA 4WWHA 2IKQA 5DYTA 3ZVRA 3TMAA 5AXCA 4REMA 1FUIA 1BS2A 1ZITA 4F8JA 2QYHA 5IDXA 3HHAA 1T5HX 1Y89A 2HY7A 2PNFA 1PNOA 2X4GA 3LX6A 1B8VA 3LC1O 2SKEA 4ZTBA 2FJ0A 1QX4A 3CEMA 4WNAA 2PWPA 2QTBA 1F5NA 1R0BA 3SSOA 1TC2A 4ENTA 4O4HB 4G63A 4PRKA 3OSZA 1I5OA 2L2QA 1L8XA 1F6DA 2P4UA 4OUDA 4RTPA 4JIGA 2P0YA 4L4XA 5JSQA 2H59A 3EULA 4DMGA 4JEMA 1YS2X 3NDRA 3E6AA 1CJBA 1I6KA 4M76B 4Q4CA 1QCCA 2QX6A 1VJ1A 2CV0A 4Z1MD 1P0PA 2GERA 1RYEA 2JZCA 2I6TA 7GPBA 3T6KA 3CVXA 4QXRA 3GFPA 5A4DA 1Z6PA 2Q6IA 4ARIA 4U9UA 4B6OA 4RTKA 1I3KA 1AN0A 1CHNA 2ZUVA 1OYOA 3GMIA 3HV2A 3UQYS 3CZAA 2FMKA 3DZBA 3QYPA 4XVHA 4AI6A 3FYSA 5KC8A 1GZ6A 1QRAA 4DEYA 1C3JA 2WVAA 1FTWA 4HXGA 3WB2A 4X71A 1PYDA 3CWCA 2NT4A 2HJHA 4JGGA 2NP6A 4BN5A 1NPZA 3T7EA 2WHPB 4R0VA 5J5VA 3ED5A 2BEWA 3O31A 5AP9A 2VUIB 5HDBB 2J5KA 1GL9B 2Z84A 1USWA 2HOQA 3ENVA 4TUYB 2XQVA 3Q3EA 3PCXA 1M2FA 3DTNA 5EZYA 1DFIA 4DPLA 3OZCA 4JFRA 1FXSA 1SULA 2PJZA 1TECE 2OCXA 2YIVX 4P93A 4Q93A 5BWMA 2V6JA 5JI2E 1JMVA 3MT9A 2NVUA 3Q7EA 4OHRA 1MMFB 1I13A 1F7UA 3D81A 3JVUA 4GM1A 1THEA 3GUCA 1VE5A 3FNGA 1C30B 1RFLA 3AIIA 3ML1A 4BCDA 4BYGA 4ZVUA 3K16A 4QUKA 2RKWA 5C53B 1J70A 3GRVA 4UW9A 4EG1A 2A33A 2CB0A 3DMRA 2HZBA 4IDQA 3WXBA 4CHGA 3K8UA 3SC2B 2G9VA 4L3VA 1UK6A 1XKQA 2KLHA 3H65A 3MWGA 3AY0A 3N05A 4XVQA 1ZR4A 5I7SA 4PNZA 4D9JA 2GHTA 1M7HA 1QKJA 2GVDC 3UGJA 9MHTA 2PNSA 3WAGA 1T36B 3PHUA 3KB8A 4LQLA 4TM7A 4ER3A 1PKEA 1AYUA 2I99A 1I32A 2WNHA 4L07A 4LX8A 2QJOA 3TX2A 1FIUA 3TNXA 4H17A 3GOQA 2JIDA 3OPXA 3SHOA 5FKJA 5HM6A 4UUNA 1AQIA 3SP1A 4O2BF 1U7DA 2YWRA 3KVYA 1AN9A 4IKEA 4KE6A 4YQEA 1K66A 2Z2XA 1L7OA 3Q6MA 4DRZA 5IASA 1SFRA 1IXSB 5GV7A 1UWKA 2QBYA 2C29D 2N3ZA 3IDQA 1D04A 4RVDA 3HYTA 5HIMA 1ICIA 2RK4A 4LXIA 2B4RO 1DBSA 4FHCA 4ZJZA 4XQGA 1DDGA 2I34A 5F7OA 4E3ZA 4GX5A 4H6PA 3B85A 1A71A 1TJ4A 4KW7A 3DHEA 4DLWA 3DXZA 4PP1A 4GH5A 2IYVA 3VBCA 3W6ZA 1I4TD 1M33A 1TNDA 4JSYA 4IFEA 5JWRA 1UJCA 2PYZA 3KYDA 3G8YA 2CXQA 1QVAA 2ZVPX 3NPMA 4IIXA 2Y1KA 3L49A 3C45A 4RVGA 4WLNA 1JPNA 2WSYB 3FZNA 3NOOA 1G3MA 1SXJA 1ZYUA 4HGYA 5EPUA 3T3MB 2Q6KA 4B5LA 3KWLA 1NXQA 3IMGA 1CV8A 3SHWA 3ESAA 3E7DA 5JS2A 2XE7A 1F2TA 1SAYA 4JUFA 5AKHA 3KQUA 3NAGA 4IDFA 2AUNA 4KACA 2JAOA 3KSBC 3C1UA 3V00A 1D1TA 4A9AA 3AKEA 4PO3X 2WA2A 1T1GA 4L5BA 3PD0A 2PUEA 4IDBA 3FPKA 4G9GA 4KQIA 4MQ4A 5B1IA 1KHHA 3QHAA 2ZIGA 3RVJA 5MN5A 4YY3B 1CEYA 1NLMA 1I24A 4KFSA 2PADA 3WHKA 2CDBA 1NE7A 3A9UA 3ZS9A 1XVUA 1E2QA 2ONCA 3RUDA 3ZBPA 3TW4A 2FR1A 2D8MA 1ODJA 4ES6A 1W9MA 4D8IA 3WIBA 4Y2VA 4HQKA 1UMCA 3C15C 3PF9A 4RC9A 1RC8A 5JH7B 1QP7A 3G89A 2EQAA 3KX2A 1SVIA 2J87A 2OC9A 4Y7CA 5BO5A 2CXOA 3M82A 4C6RA 1CZRA 2ZJ8A 4N9QA 1MJHA 4OHPA 4QO8A 1A2QA 4ZALA 1KI2A 2ZRNA 3BJIC 2VK4A 1V1MA 4MW4A 3MILA 2JLXA 4TMTA 3TBKA 2Y1FA 5MDHA 2CLCX 1PN3A 1TCUA 2PQ6A 2HXGA 1ZMRA 1NVFA 4PSDA 3UT6A 3GEGA 1EAYA 3MCWA 3UBTA 4V0LA 3W7AA 2QMQA 5EHQA 3VDMA 3NWOA 5DLQC 3EEYA 4QGAA 2X0JA 3Q2OA 3RVBA 4EO4A 2I91A 1IIRA 3ONVA 1VJDA 3DE3X 1C3EA 1LI4A 4FLFA 1UMKA 3GAFA 5HBGA 3AKZA 2FRQA 1BXRA 1IBKB 2OT3B 3CXUA 3IJPA 1EGVB 1H4QA 2VH1A 1A4XA 1IAVA 2IHTA 1N92A 1XZCA 1MEEA 1VPTA 3ICQB 4ARUA 5K3EA 1DC3A 1FNMA 3IUNA 3FD8A 4IO0A 3WLRA 1JDVA 1YKGA 1YHYA 2NYAA 1M2VA 3ZZTA 2DBRA 2XDYA 3EJ6A 2W22A 3EVAA 1ZC3A 2FRDC 4HGRA 3GVCA 3TRFA 1MX5A 3RS3A 3TSZA 1DEUA 1GEGA 4QAQA 4EY4A 3H5IA 3QFTA 4TS4A 1Z0UA 3P2YA 4Z0HO 2WJPA 5AW7A 3O1IC 2IV7A 4I5FA 4B44A 3ABQB 1MENA 1UFVA 1FX0A 1R16A 2CCGA 2O2XA 4QUEA 4CKCB 1UAAA 5IVKA 3F2VA 3KOYA 4KZKA 3L0DA 4L7QA 4TGLA 5DBEX 2XVMA 4BS9A 2DUMA 1G66A 4F5WA 4J1NA 4DNQA 1OWNA 2YRWA 3VR3D 1W19A 5B3AA 3KKUA 1SC3A 1NYQA 2Z4SA 5BV1A 4A1FA 1II8A 3H1FA 4EMUA 2XA2A 1POPA 4V38A 5E1DA 5K05A 1PVVA 2ACKA 1FK8A 1PVDA 2A1UA 3CT4A 1DXQA 3FFXA 3GEIA 3IULA 3MRSA 3OEHA 4HYYA 4OHVA 1AKQA 4XCVA 1AUXA 1SU7A 4NFSA 5IDYA 3VKGA 4FR2A 2R97A 3GQBA 3LWZA 3KYJB 2P8SA 4M2LA 2HPVA 4IIGA 3AM1A 3AF2A 2HU7A 3KAKA 3FTNA 4I4TA 1BWPA 4LOKA 5DM2A 2OGWA 3MUOA 3PHJA 1U1EA 3GCDA 5AJHA 4XPIB 4DUGD 2WU1A 1SU4A 1DQNA 4EDHA 1QNFA 3O3OB 5A05A 1SKBA 4MZXA 5E95A 1JKFA 4RF4A 1OA1A 1BEEA 1H0HA 1LVUA 4MUEA 3CKYA 4R4JA 2GK3A 1KSJA 4IAOA 2J3EA 1DE0A 1O2DA 2PRKA 4UDOA 4DYHA 3VI4B 2BHNA 4RY0A 4HVCA 5KPJA 1TJPB 3T06B 2YFKA 2P3LA 3B7WA 3OIVA 1PX0A 1VKNA 3LBHA 4G4JA 3G9UA 4Q82A 1SK8A 4U7JA 1XWFA 4AYXA 3FTFA 2WMYA 2ZSDA 4N8WA 3TNYA 1KH2A 4I9HA 3OEYA 4FMBB 3F6EX 4HVLA 2QS9A 2DJ5A 4QBGB 1T9ZA 4DCMA 2GCOA 2Q3DA 4W63A 1DXHA 2W6ZA 2CBGA 3DMDA 2F48A 3PR3A 5CRIA 4ZT4A 5B1HA 4B73A 5B3JA 4C0SA 2RJNA 3LXUX 3V1TC 1CNMA 2NSYA 4F11A 3HKDB 4FE3A 4DMKA 4DWOA 4RS4A 1GTMA 1T2CA 2FV8A 1MPXA 2B36A 1EZZA 1I1HA 2FN7A 1JFVA 1GPLA 1UP4A 4O2BA 3ASYA 4DA6A 2HW8A 2E18A 3RTCA 3G5AA 2IUUA 1FH0A 4AD8A 4RM3A 3ZD7A 4MWBA 3Q3JB 1JECA 1WOYA 1THMA 2G6BA 2H0QA 4N8DA 1LQUA 4FJ0A 5EUMA 3A1DA 2Y67A 3R7SA 4KQGA 5E4YA 3TDMA 3ORHA 2J32A 2LV8A 1A9RA 2WVGA 1O4WA 3I5AA 2C5BA 3GWZA 3LNTA 3MJ4A 3JTEA 4NICA 5IHXA 3U61B 3CIFA 4OHKA 1PR5A 3BD6A 2QUKA 1C50A 1BOOA 5IAKA 4BPRA 5A5FA 5ICSA 4I2VA 1SVOA 1MKYA 2AJBA 1QXSA 5TRTA 4CM5A 4CQNA 4GPBA 6ABPA 1OLUA 4PXAA 2GZAA 4YCMA 2FUDA 3BMXA 2WMOB 3EPHA 3OISA 3U7JA 4OL9A 4ZQGA 2ERYA 1AT1A 3SQDA 4CF3A 3OESA 3AI8A 4I4NA 4EYQA 5HKOA 2ZBRA 3RTAA 1A7AA 4Z3KA 2O3QA 2R65A 4MH0R 4RV5A 3O38A 4D5EA 4DQXA 2Y2VA 3STTA 5AVYA 1JA9A 4AECA 1ZGHA 2OV6A 2VO1A 2V0CA 3ES9A 1G55A 2GPJA 3PGMA 4DGSA 1LNSA 4XYGA 4JLSA 4CF6A 1SXQA 2PBHA 3L4SO 1Q1BA 4CVNA 4DA4A 3VKVA 2C5EA 4YRZA 1BQ3A 4GOMD 1VHJA 4NIMA 1U0EA 1I0IA 2WUEA 4IIFA 2O52A 2OP3A 3TMKA 3GLHB 5JR3A 3A3KA 4GMHA 1FXUA 1K0UA 1T10A 1ZW1A 2RGNA 3LBAA 4FE4A 4RLQA