3TRKA

Structure of the chikungunya virus nsp2 protease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
321
structure length
321
Chain Sequence
NAFQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPVNRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nonstructural polyprotein
publication title Structure of the Chikungunya virus nsP2 protease
rcsb
source organism Chikungunya virus
molecule tags Hydrolase
total genus 87
structure length 321
sequence length 321
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3trkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3trkA01
1JTEA 3EVAA 2PJDA 3DLIA 1M6YA 1YFJA 2P8JA 1BKYA 2YQZA 2ZWVA 2JH8A 4QVGA 4RX1A 5DX1A 5T64A 1P1BA 3ELWA 3EVBA 3FZGA 3UA4A 2AVNA 3UJ7A 5K01A 5CIYA 1AQJA 3VSEA 3PS9A 2Y1WA 1KHHA 3E7PA 3SM3A 3UJ8A 2O57A 3O31A 3PB3A 1L3BA 4FT4A 4X1OA 2Q41A 2I62A 4CTJA 4EKIA 3GRRA 3MGGA 2ONZA 4KW7A 3GRYA 4OA5A 5P8WA 3UA3A 4E33A 1FPQA 5CCBA 2IH2A 3BKWA 4MIKA 4AZVA 2B78A 1JG4A 4AZSA 3ORHA 2XVMA 4ATNA 2O05A 2BR5A 3GRUA 3MB5A 1RI1A 3CJTA 3M6WA 3MCZA 3NDIA 4QPPA 4RTNA 3MAGA 1JG3A 4C06A 1NW3A 1I1NA 3CJRA 4GC9A 3CC8A 2R3SA 3HCBA 1YB2A 4KIFA 5E2BA 3BWMA 5ICFA 3FPGA 2NXNA 2P35A 5E1OA 2NP7A 4PYQA 5FCDA 4GC5A 4DCMA 2NXJA 2AOWA 3LHDA 1H1DA 2PV0A 4R8RA 2ADMA 4GOLD 1VPTA 4MHTA 2B2CA 4FSDA 4HTFB 3CGGA 5K0FA 2H1RA 5K0BA 4DQ0A 1QZZA 2EFJA 4M36A 1KYZA 5LSAA 3GCZA 2OXTA 2IDKA 3DLCA 3B3JA 3EVCA 3KU1A 3DTNA 4RVFA 4AUKA 2NXEA 2PT9A 2IPXA 1NBIA 5EQJB 2ZZNA 3KR9A 4RWZA 4PYJA 3KR1A 5K09A 4QPNA 4DM3A 5DTRA 4R05A 1XCJA 5IH3A 4PONA 2BH2A 1X1BA 4PCLA 4AZWA 3PVCA 4YV1A 3NVKI 5FUBA 3M6VA 2OPBA 3D2LA 4PCAA 5D1NA 3KPWA 4A6EA 1M0EA 3AXSA 4C4AA 2WK1A 2HR1A 3TMAA 1EJ0A 4YUYA 3PFGA 1G60A 2HWKA 5HOQA 5K8VA 3DXZA 4A6DA 1R8YA 3UFBA 5EC8A 2BM8A 3LKZA 2IH4A 5K03A 4HC4A 1O9HA 3LBFA 5GM1A 3BGDA 4MTLA 1U2ZA 3FPHA 2PX2A 3EMDA 5DLYA 3CVOA 3ERCA 4XUCA 3PX2A 2O06A 3REOA 3FTEA 3NVMB 3ME5A 1FP1D 5U4XA 2OB1A 2ONYA 2UYQA 2AOXA 5GM2A 1XDSA 3F4KA 3FUVA 3CBGA 4WXHA 5DXAA 1XJ5A 3A7DA 1G8AA 4YV2A 2YX1A 3I9FA 1IXKA 3HCDA 4L7VA 4CXMA 2GLUA 2ZZMA 1JTFA 1HNNA 1HMYA 3HCEA 4PINA 4RSRA 1Y8CA 3LGAA 2O0LA 2BM9A 3TFWA 3PT9A 3T7RA 4C04A 1NE2A 2OY0A 3V97A 4GOMD 3BWCA 3UBTA 3SGLA 3FPJA 2QY6A 2PLWA 5E9WA 5D1HA 5JR3A 2AR0A 2FYTA 2WA1A 3EMBA 5KS2A 1XCLA 1ZQ9A 3B89A 2CL5A 4OQEA 4PYOA 3FPEA 1F3LA 3LCCA 2JHAA 3G5TA 4LG1A 4RTOA 2P1DA 3FUWA 3HVHA 3KPVA 3LSTA 4HRAA 4POOA 5BW5A 2QYOA 4DMGA 2EJUA 1PRYA 3GNLA 7MHTA 2BR4A 4GOOD 5EG5A 1Q0TA 5CVEA 1L3IA 4E32A 2XBMA 4V0RA 2IBTA 2AN3A 3SSNA 3HEMA 3UWPA 3R6TA 4CWAA 5EKUA 4GOND 3I53A 1QAMA 2GPYA 2O07A 5ICEA 4FSXA 1RJEA 4HG2A 3Q87B 1L9KA 1KXZA 1WG8A 3KQYA 2A14A 2H00A 4KDRA 5HEKA 2QRVA 4C05A 3LBYA 3M6UA 4EMSA 3T7SA 2FK8A 2ZZKA 3THSA 3LDUA 3RIEA 5E9JA 3SXJA 5DM1A 2ZCJA 2PY6A 1UFKA 4PWYA 4QQNA 3NMUF 5DSTA 2VP3A 1TW3A 3M4XA 3G88A 3NJRA 1X19A 2PSSA 1ZGAA 5T67A 5DPMA 3GO4A 1QYRA 5LQRA 1G6Q1 9MHTA 2UYOA 3EEYA 1NV8A 1SG9A 2I7CA 2PX5A 2R6ZA 5HIIA 3HTXA 1T43A 3UJBA 2NXCA 5EIFA 4M37A 3LKDA 5FA5A 5C9ZA 1RJGA 2DULA 3B3GA 3JWIA 3THRA 1VIDA 1VL5A 4QDJA 5K0NA 2IBSA 3P2IA 5E8JA 3DMFA 1WS6A 5C0OE 2I6GA 1ORIA 3T7TA 1KPGA 3OU6A 2ZIGA 1XDUA 2IIPA 5EVJA 3G2QA 4MWZA 1KYWA 5DRTA 4AX8A 5LQKA 2VS1A 3G8AA 3IEIA 3OU2A 3T0IA 5KQRA 2VZ9A 1AQIA 5BP7A 3HA3A 4R6XA 2KW5A 4DCGA 1N7IA 2HNKA 3SMQA 4ER7A 5FQOA 2PVCA 3UJDA 1WY7A 1RI5A 2HMYB 3IYLW 1F38A 1RI3A 1SUSA 4P7GA 3MTIA 2C7PA 3E8SA 5EZSA 4E2XA 5FHRA 3LDFA 3EVZA 4R8SA 4KDCA 4OQDA 3HCCA 3G2OA 3S68A 3E23A 3SVZA 1VQ1A 1VP3A 4QTUB 3R0QA 5CUQA 4LECA 5G02A 2QRVB 4GBED 3PLAE 3FPFA 3SR4A 4F86A 2FCAA 1JQ3A 4IWNA 4DZRA 2ZVJA 5BW4A 3DH0A 5EMLA 2PKWA 4OBWA 3FRHA 4FGZA 4ER3A 5LR6A 5CVDA 2PWPA 5LQJA 3E05A 3DXXA 1SUIA 3EVDA 2BZGA 3OU7A 4LWOA 5EKXA 3KPYA 3UJCA 3TM4A 5GOZA 2H11A 2OB2A 5DSXA 3JWHA 4CKCA 1L3CA 5EGSA 3K6RA 4FZVA 5CM2Z 1AF7A 3OE4A 2ZIFA 5FWDA 1PJZA 2JJQA 2YXEA 1O9GA 1DCTA 5DXJA 4RTKA 5CCXA 5F2KA 4QTTB 4G56A 4Y30A 1YF3A 1WZNA 1XTPA 1BOOA 3KR0A 4HGZA 4PGHA 5DM2A 3DR5A 4KRGA 2JHCA 3OCJA 4X63A 5ICGA 1G8SA 1G38A 2AOUA 3X0DA 4E31A 1VLMA 2IP2A 1KR5A 3ELUA 2ZSUA 5DT2A 4RTRA 1INLA 4RTLA 1FJXA 2CMHA 2PT6A 2PX8A 3KQTA 3OZRA 1P39A 2VDVE 3LECA 1P91A 4CKEA 3MCTA 3KQSA 2CKDA 4E70A 1VBFA 2OO3A 1NV9A 5EOVA 3ELDA 1NW8A 3EPPA 1YFLA 1NT2A 3MERA 2YXDA 1G55A 4RVHA 4RV9A 3OZSA 5LQNA 2XYVA 3A25A 2C7QA 3G89A 4RTQA 4MQ4A 3WSTA 2AS0A 2P3OA 4B17A 1SKMA 4HSGA 2YUIA 1ZGJA 1NBHA 3P9IA 5DRYA 3BUSA 4PIPA 4PIMA 1JG2A 2HV9A 3DP7A 3LCVB 4YUWA 1QAOA 3TOSA 2P7IA 1JQEA 2AOVA 2PXAA 3FYDA 3EGIA 5E8RA 3R3HA 1JQDA 4P58A 4KWCA 1NW7A 1NW6A 2B3TA 5E1BA 3FUUA 3NDJA 3HCAA 5FHQA 5LQCA 3IHTA 4OA8A 4BY9E 1RI4A 5BXYA 4CKBA 3OZTA 4BLWA 1AV6A 1YZ3A 2PWYA 2VDUE 5IKMA 8MHTA 5HIJA 3SSOA 2AN5A 3BGVA 3KQOA 3NW9A 4BLVA 3EEOA 2JG3A 4PYLA 3KQVA 1Z3CA 1RI2A 2EJTA 2OKCA 1EQAA 1X1AA 2VDWA 2ZBQA 3TR6A 5FWAA 5LQUA 2IDJA 4FS8A 2FPOA 1YUBA 4P7KA 3EGEA 1R74A 3U81A 2P41A 3AWIA 5JUWA 3NWEA 4X60A 3M33A 3RW9A 3A7EA 2UZ4A 3B5IA 3CJQA 5K0CA 3FRIA 3GJYA 4KIGA 4OBXA 4KVZA 3VYWA 3R9XB 3K0BA 1FBNA 3HM2A 3OFKA 1R6AA 2AOUB 3QOWA 4M7RA 3G2MA 4WVLA 5E2AA 2ZULA 2XYRA 3C3PA 2PXCA 3A27A 3I64A 1IM8A 3DULA 5EZQA 3V8VA 3DMHA 4E2YA 3OE5A 3PFHA 3A4TA 4E30A 4UOEA 2C7OA 5DX0A 5HFJA 3G7UA 3SX0A 2E5WA 4HH4A 2YR0A 2P40A 5E9QA 2PXXA 2K4MA 5EEHA 4K6MA 1NW5A 2PBFA 4ER0A 2P7HA 3EVGA 2N47A 5DWQA 3AY0A 4HGYA 3HVIA 2GA9A 3CKKA 5LQAA 5M5BA 4RVDA 3EVEA 1B42A 2FRXA 2P3LA 4IV0A 3KPJA 1P1CA 3HP7A 5K0EA 3EVFA 2Z6UA 5FA8A 3LPMA 3P97A 2XYQA 4C08A 5CD1A 3P9KA 5K0JA 2PGXA 4EKGA 3G2PA 4RYLA 1JSXA 1FP2A 2G71A 3R24A 1RJFA 5DM0A 4F84A 2EG5A 3C6MA 3TPZA 1EG2A 5E1DA 2NP6A 1I4WA 1ORHA 3HA7A 2AOTA 1R00A 2CWWA 2ZBPA 3NWBA 10MHA 3I58A 3JWJA 4X41A 5F2NA 3P2KA 5T6BA 5HIKA 1R18A 2AVDA 3RODA 4DA4A 1M6EX 1EJ6A 4FR0A 2GB4A 4BLUA 1VE3A 3BXOA 3UJAA 5CVUA 4RTSA 2Z6QA 3GGDA 3IV6A 2AN4A 3FTCA 4RTJA 2ORED 5B1SA 2GAFA 2YTZA 5GINE 2UYCA 4PYNA 3QOXA 1JSZA 1UIRA 3HA5A 5K0GA 4QDKA 5EMJA 4E2ZA 5FADA 4F85A 4P7JA 1XXLA 4EQZA 3G5LA 3M70A 3GIWA 1SVUA 3Q7EA 2NNWB 3FUTA 3GRVA 5FULA 2GS9A 3AXTA 4YMHA 3FUXA 1WXWA 1KIAA 5H02A 3BT7A 2ZBRA 1ZKDA 4NECA 1SQFA 3ELYA 3TKAA 4DKJA 5EMMA 5DTMA 3NTVA 1DL5A 1I9GA 2NYUA 3C3YA 3I5UA 3P71T 5DX8A 4YMGA 1X1DA 4E2WA 2QM3A 2Z6AA 3QV2A 1XDZA 3C6KA 2ESRA 1JR4A 1IY9A 5E1MA 3TKYA 3TQSA 2PX4A 3CCFA 4PYKA 4EVIA 3B3FA 4GUAA 4O29A 3ER8A 3LCUA 4EK9A 1TPYA 3PX3A 3BKXA 3LDGA 4ER6A 2AZTA 2OBFA 3G8BA 1BC5A 3OFJA 4OX9Y 3DMGA 4XUEA 3KKZA 4CTKA 1JG1A 1QANA 2IH5A 4BP3A 1KPHA 5EPEA 3UZUA 4AZTA 4XUDA 2G70A 4LWPA 5HIMA 2OYRA 3MTEA 3DXYA 4PYIA 4XCXA 5K0LA 5MHTA 3DOUA 1D2CA 1O54A 1D2HA 3OPNA 3TRKA 2F8LA 2FK7A 2ZTHA 1KP9A 1ZG3A 2GH1A 3HVKA 5EHGA 2IGTA 3GXOA 1MHTA 3BGIA 1YZHA 2B9EA 3M6XA 2DPMA 1L1EA 3GWZA 4PYMA 2LD4A 4U7TB 5C1IA 2AOTB 4JXJA 3LL7A 4GQBA 4Y2HA 4YUZA 3KHKA 4ER5A 1DUSA 3GU3A 4ZTBA 4YUXA 4M38A 4R6WA 3BZBA 5CVVA 3KQMA 4RVGA 2YVLA 3KPUA 5HILA 3KQWA 5ICCA 2FHPA 3MHTA 3UJ9A 4QVKA 1R8XA 5FQNA 4GF5A 1SQGA 3FYCA 4P7FA 4PNEA 4GEKA 3ID6C 3BWYA 2P3QA 1V39A 2I9KA 1EIZA 3EGVA 4X61A 5EMKA 3HNRA 1X1CA 5GWXA 1OR8A 3KR2A 5F2OA 1VP9A 3ER9A 3PTAA 5KYGA 2EX4A 2JH9A 3H2BA 3P9CA 4YUVA 3FTFA 5EEGA 2CMGA 2YXLA 2ZIEA 1QAQA 1EAMA 3A26A 3AJDA 3GRZA 3DUWA 4FP9A 5CVJA 2C7RA 1NKVA 2G72A 2ZFUA 4H0NA 5KVAA 3P2EA 3SSMA 2QE6A 3ANXA 2IFTA 3HVJA 4C07A 2BR3A 5HZMA 3TM5A 1N2XA 1XVAA 3B7PA 3MQ2A 5DM4A 3KQPA 5FTWA 1UWVA 4HTFA 1TW2A 4U7PB 4YV0A 5GIPE 3O7WA 1D2GA 2ZW9A 5GIOE 5EHIA 2V74B 4FT2A 5KQSA 4V0QA 4Z2YA 4RTMA 2JHPA 3LX6A 2OZVA 5ERGB 3TLJA 1WXXA 2ZWAA 2WA2A 5DTQA 5GP1A 3VC1A 2V7EA 1N7JA 2Y1XA 2ERCA 5K05A 2G8NA 3GDHA 4BP1A 3P9NA 4PGGA 3C0KA 2B25A 4IV8A 4DF3A 2G1PA 1BHJA 3L8DA 3HCFA 3UJ6A 3VC2A 2ZLBA 3O4FA 4ISCA 3JWGA 2XVAA 4C03A 3FTDA 4QQKA 1RJDA 2HTEA 3P8ZA 4RTPA 2UYHA 1MJFA 1KPIA 1ZHFA 4IKPA 5EIWA 3KQQA 1Q0SA 3BWBA
chains in the Genus database with same CATH superfamily
4IZHA 5FLEX 5M04A 1O3YA 3ZVRA 4RK5A 3UJPA 1RCTE 2X0JA 2FQ1A 1QFXA 2P4EA 1KQ3A 2R97A 3FTQA 3IERA 4UREA 5K01A 3EHDA 4KMSA 4A9AA 5CDTA 3KZNA 5LJLA 4MQ5A 1KI3A 3UJ8A 2O8CB 4L6CA 3C5HA 4GMDA 1F20A 4ERNA 1T8SA 1JHYA 1K7XB 2YMMA 8ADHA 2PVPA 1O03A 3WNDA 5MF6A 1MJGM 2EKPA 3L40A 2ZIZA 1G7TA 3MJ5A 2PFSA 2NTVA 1XYVA 3AVYA 1O96B 4AJHA 1A72A 3MB5A 2NPIA 1KYXA 1N6OA 3PC3A 3MJEA 1R5OA 1T1RA 1PZEA 4NVRA 3FLBA 4EG7A 4A36A 3CJRA 4ZOEA 5GINE 1GFZA 1HKUA 1X7HA 3JSXA 5E2BA 2Y1LA 4MQFA 3WGJA 3SC4A 3GEMA 2PBZA 3HBMA 1A9XA 2ZITA 3FFBA 3UN1A 3LUCA 3TX6A 5EUCA 3OCCA 1DC7A 3QU4A 3DT9A 4GICA 2O4UX 2QKYA 5K0BA 3ZVKA 4DQ0A 1QZZA 4OHOA 5AI9A 3PGJA 1A5TA 4K6GA 4FFLA 4N3CA 5TX7A 4QEDA 5K6RA 4C87A 4N5HX 3BE4A 2P5YA 3P5WA 2H51A 1IZ9A 4RVNA 4YMTA 2J31A 5C81A 1DBPA 2ZZNA 1DAFA 2O2SA 1A9TA 3HMKA 3KWJA 3QF7A 2ZRFA 2D2VA 4MS1A 1K1EA 1BWSA 5KWVA 1QWOA 5JFOA 2QVGA 2W6IA 3ONEA 4BX8A 4IDHA 3PP8A 2A5YB 1MHWA 3LHIA 2GPAA 3T3GA 4D98A 1DXQA 1UBFA 4FBLA 4XLTA 3RFTA 1Z5VA 3AFNA 3HWSA 4AJIA 3QXHA 2CFIA 4BMVA 2QP3A 1BH2A 1FFWA 1ME4A 4QDZA 1U3VA 2X8JB 1CVIA 2MSKA 3BC1A 2D2IA 2WFLB 5BT8A 1SQSA 3DWFA 4RH3A 1WKVA 4MVYA 1GNQA 1O9HA 4RNDB 3RFVA 3RC3A 1YQQA 1T5TA 2N75A 3AETB 2PKCA 2VPXA 1U2ZA 3N39C 4QDOA 3T5DA 4B8WA 5CA0B 4WCFB 2IZOA 4IIXA 4DPMA 2O06A 1HSOA 3WXFA 1M5UA 3TRFA 1KAGA 1F2DA 1XHEA 3N28A 2ONYA 1LB1B 4AY2A 4PZ0A 1AN0A 5EL0A 2XJ9A 5ECDA 3ZXIA 3HDHA 1T1SA 3HP1A 4IO0A 1NZDA 3LLUA 4HRXA 4JLWA 4RKYA 3HYLA 4LOJA 3THOA 2VWGA 1DHRA 2J32A 4U4AA 2ZZMA 4OMDA 3NR2A 2AZXA 4WBNB 2Q5IA 3CRMA 3PUXA 1C9YA 1XT6A 3I6ZA 1WW2A 4LCBA 1A8QA 2FWAA 2BM9A 2CK3A 2MIIA 3EIFA 4HH1A 4JWTA 4M60A 2IUUA 4ZGBA 3TMYA 4A6XA 2R4TA 4DHWA 2BGMA 1BS9A 4MV9A 4W6ZA 4GOMD 2BGLA 1RAGA 1I3CA 1A97A 2RI1A 2R0QC 2MHCA 3NT2A 4IDDA 4URHA 4XVHA 5D1HA 5D3ZA 4BCCA 3NOVA 4BQOA 4F11A 4MGEA 4YMLA 2H2DA 1X92A 3AGPA 3DEZA 3WDKA 3HI4A 4CCAA 5JXHA 1GPAA 1UC8A 4LTDA 4OFZA 3G5TA 3ESRA 1PT7A 1T1IA 1VDZA 2XOKA 2QYOA 3L01A 3V33A 4EHHA 2J3EA 2LDXA 3V4SA 1R0LA 2DC1A 3WK4A 2A78A 1IE3A 2JTCA 3IPYA 1W88A 2Y1CA 4MUBA 4YAFA 3WZ2A 1RMTA 4DA7A 4RSGA 1PBHA 3UWPA 1YDEA 2E3JA 4KVAA 1U4SA 2JLWA 4AUMA 2PUWA 1QFZA 1PWZA 1VC2A 1Q16A 2HIHA 5J2TB 3CVYA 821PA 4DCOA 3T3PB 1ZOSA 2H00A 5KYWB 2OGUA 1Z6PA 2BHRA 2IP1A 2WM9B 1QGZA 1Z5WA 5HUJA 4LF5B 2EWMA 1FFDA 2H06A 3MFQA 3UUEA 4E08A 3KKKA 3THYA 3O9VA 1THEA 3M1LA 3LVRE 2X4GA 1OH8A 4LHVA 5KNBD 3DLHA 1OI4A 1U28C 2QZSA 3SJCA 3BGWA 4B6GA 3NJRA 4CGZA 1D1SA 1YHYA 4LWQA 1V7QA 2BJVA 3MA0A 4UHFA 1X7WB 2E4YA 3ZBQA 3CW8X 1BGVA 2FR8C 3C0RA 1CD5A 3N2ZB 1J0XO 4A3SA 3PEYA 4HAIA 2W6JD 3S1AA 1Z0ZA 3NGMA 2JLUA 3EEYA 3ZIAA 2C0PA 2JLZA 2WTMA 3UC5A 3BICA 3GEEA 1TVEA 3HXPA 4MVXA 1HNWB 4CLOB 5A2GA 1Y3IA 2DULA 5DYWA 3LT2A 4DLAA 2YMQA 1C81A 4HNUA 5J4KA 4KIJA 4L75A 3EASA 5C0OE 3LFHA 1U0FA 5FP0A 1QPBA 2C97A 4R1UA 4HLUC 4LOIA 1G8FA 1B8PA 1VB3A 1DKRA 1ZN9A 2BF4A 2VDOB 2WMYA 3PK0A 4Y8VA 1AYVA 3CVJA 3U4CA 2HDNB 4MTCA 3S2GA 3IEIA 3WRYC 2A57A 5ADVA 3PICA 1AQIA 1A2BA 2VRNA 5EMHA 2PAAA 2H7YA 1YDMA 3E5MA 3JQDA 2IU0A 1XQ6A 4IRMA 1O5TA 3UJDA 3VHLB 1AG9A 3E8XA 5ABPA 5KX5F 1WLYA 1RI3A 2FE4A 1K5GA 1DIBA 1Z5ZA 2Q1UA 4PRZA 1T2EA 1ZK0A 3K6SA 3PKJA 1ZXXA 4DR3B 2B4KA 1DKUA 3I32A 1IBKB 4AKSA 1TJPB 3JWEA 5BYAA 1S9DA 4JT8A 1KI6B 4JCOA 4L2IB 4URVR 3DFZA 5JNVA 1QC5A 2EQ5A 2IVZA 2H4HA 4KZPA 1MHPA 4GZMA 1Q74A 3Q3JB 5G02A 1T6XA 3G8CA 3MK31 4IFIA 4RBNA 2VJOA 3FTPA 5CITA 3BMCA 4JP5A 3ACDA 5G4LA 5IJWA 4DN6A 4G0YA 4YBRA 3SHVA 4FHGA 4UHKA 3ZNHA 4TKUA 5A4KA 4BX9A 5GVSA 2VP6A 2R9CA 1TVKB 4HQOA 2GEDA 4OBEA 3GEGA 1O0CA 4EHBA 4WZAA 1WD7A 3N0WA 4BRUA 4K6FA 3WLNA 3V5NA 5GOZA 1LVGA 1TZCA 1CJVC 1NN0A 2CFRA 3ECCA 3M9LA 3HGQA 4A5UA 3GVXA 1POPA 3KSUA 3FYUC 5FWDA 3UPDA 5EXEA 4MLZA 1EFCA 2KM1A 2PA0A 2WF7A 2D3WA 4L5CA 1P61B 3PPWA 1ZH6A 2CVOA 1KJWA 2OAEA 2QRJA 4RFSA 5ARCA 4U39A 2DY0A 4OXRA 2Q3CA 2A7XA 3RBAA 4F71A 4LE2A 5DM2A 5J4HA 2AWOA 1OLUB 2JLCA 4IEEA 2EP8A 1QM5A 4NESA 4WECA 3WVNA 1MEGA 1N34B 3FPBA 1G38A 4D8WA 2XHEA 1DAHA 3AR5A 2HV8A 3AUSA 5JH7B 1FMTA 2Q5QA 2HRCA 4TTQA 1ZHHA 4FE3A 1UPCA 4XLLA 3DF0A 1IHPA 3KZVA 5DB4A 1P39A 3RS8A 3LVBA 2AD1A 3QEMB 1NQTA 1UKBA 2HSDA 2I4TA 1SD5A 2QL9A 3B5JA 5C3UA 3UMGA 4D9FA 4EF5A 1SB8A 1GZ4A 1CIPA 1RC0A 3TIIA 4CM4A 2OD9A 1WLSA 4QGFA 3ELDA 4G5YA 3PWZA 2OO5A 5FIUA 3UVEA 5JY1A 5DN9A 1G55A 3IRUA 5I01A 3CF6R 1GCIA 1HV8A 1IC6A 2BDTA 3DLTA 4OREX 4PLGA 5LQNA 2C3OA 1KI2A 4CMIA 1WPXA 4PP1A 4CTOA 4Q7MB 2I66A 3BUSA 1FDIA 2G4LA 2YN0A 4B9EA 1JQEA 1L4LA 2BH9A 2PXAA 3ITEA 4H1TA 1FYVA 4LDPA 3AINA 2OR3A 4H7FA 2ZAGA 1DQRA 1NW6A 4P3YA 3ZEIA 1X1EA 2GSWA 6LDHA 2JIZD 2PH3A 1U3WA 2GM5A 1RAFA 3CTPA 5CTAA 3IQHX 3A6JA 2VDUE 3AJ9A 4TX1A 2JLYA 2BOVA 3W4IA 2Q8NA 3SBXA 1RXEA 3IEKA 5CMLA 5D7NA 3TLCA 4BV2A 2YXBA 5IVHA 2JG3A 4S2EA 2HU8A 3O5AA 2GGSA 3WI7A 2B9VA 2R65A 4FXPA 1U7DA 3CZCA 1YVDA 1IBMB 1MD9A 1U1FA 2VH1A 4OSOA 2HA2A 4MI9A 5HTOA 2PQ2A 1SBCA 2IYXA 1VBMA 3EGEA 4ZZ2A 1RM0A 4EG6A 5MGNA 3HFRA 1AS2A 5IX8A 1QDEA 1L4BA 1JKFA 2XE7A 2MYPA 3CLSC 3OQPA 4FEEA 1V35A 2ZE8A 1W87A 3JZFA 4Z9YA 2GD0A 2IYPA 1GKLA 2ZT7A 2E87A 3SFVA 4LKOA 3A27A 4G54A 1PKEA 2HJ9A 4DV6B 3LWBA 2ZYRA 3H13A 4G65A 2DHCA 2WICA 4KN9S 4DQKA 2DM6A 3F5DA 2GYUA 1GQ2A 5DP1A 3ZQ4A 2FWPA 4CKEB 2A3RA 2JHFA 4NH0A 3R7NA 4IHQA 5EEHA 3KP1A 1XALA 1Y6JA 2JCXA 3JYOA 4R1PA 2F1IA 2FV8A 4LJ8A 5ESDA 2B4TO 1LDMA 1OYVA 3LW8A 5AK3A 3I72A 1E64A 4HZUA 4WRRA 1GGNA 1E6LA 3H4MA 4J3NA 4PR0A 1PZMA 3Q6NA 2OQIA 4KQ9A 4YK7A 3K1AA 2FRXA 2P3LA 1Q6ZA 4ME6A 4DCTA 3OQVA 4R7TA 3PITA 4QBTA 1PI3A 4TWZA 3U7JA 2YJ8A 1NNLA 2X76A 1C1HA 2GM4A 2AC7A 4EGFA 5CB6A 2JGLA 2RHOA 1YRBA 3F7MA 1EK2A 4JEHA 3KBBA 3C6MA 1UK7A 2FJUA 2P4HX 3P96A 3KAPA 1CQIA 1GARA 2DOKA 3DFFA 3PEVA 2OFXA 1O95A 3A8TA 1X15A 3Q3HA 2WWFA 5KSWB 5A4MS 2BZ0A 4RACA 2AYXA 2VN8A 1G18A 2V3WA 5COQA 3GGDA 3OX2A 3MCVA 4TUYA 4D6YA 4D4MA 1QV9A 3IX7A 1EE2A 3K0KA 1I7SB 4H7HA 3IEXA 1F51E 3V1MA 4LXGA 4RSMA 3QOXA 2GFQA 4Q34A 2JLBA 2EFCB 1GQRA 2QTLA 3A4MA 3R44A 5FNZA 3A9RA 3KSMA 4JKOA 4E2ZA 5IDXA 2H31A 4GEGA 3A05A 1NULA 4AZ0A 1XRJA 3OY7A 1CLEA 5ULLA 5B53A 4UHDA 3PXCX 2G1KA 4GP9A 4HWSA 3B7WA 4MQEA 1KIAA 2DAPA 3UCFA 2ZBRA 4DQDA 4DR7B 3HB9A 4RA9A 3RTCA 1OFVA 2WTXA 3TTXA 4GWKA 2FRQA 5LP6F 5HQJA 1PGQA 4UJ5A 3HPRA 4J91A 1X1DA 1C7RA 5JSUA 2NN3C 5JXIA 3GNQA 4EG1A 1QP4A 1XQVA 2N3ZA 4D8XA 5IM4F 2FQYA 3QRWA 1QBGA 2CV2A 8OHMA 1OC4A 2ID7A 2IHNA 3NTLA 2AN9A 3T35A 2VJMB 4LOHA 4ZVNA 4C5BA 1YKFA 3QVMA 1SD2A 1VLQA 2P0YA 4YX9A 4F8YA 2AIMA 2IH5A 1E1QA 1U2SA 3MCAA 3QSDA 3OAAA 5ALRA 1SHTX 4L9SA 3KQNA 2J87A 2PZ8A 4FC6A 4QD3A 3RSQA 4L6AA 4G23A 1TMGE 2GZDA 3PNLA 4OGGA 3KYCB 4IIUA 3A1DA 5FI5A 1JFSA 3JYHA 5JH3A 4ACBA 4YAWA 5AJUA 1QRRA 4B3IA 3KKOA 1OHHD 2XZDA 4RKRA 1BXKA 1IZYA 1YT5A 4TRJA 4AW9A 4EENA 2Z5GA 1ZW6A 3C6YA 3K8OE 4MQMA 3VM6A 1IONA 3R7SA 4NCIA 3WGGA 2K7ZA 4CM1A 2CB9A 3PDFA 2NZ8A 4N4ZA 4FC7A 4OD0A 3EZLA 4B09A 2FQ9A 1II0A 2HD4A 4NU0A 2Q9AA 3D3KA 3GLHB 4DG9A 1KFEB 4FR2A 3MC1A 2O8CA 3RTBA 4DR4B 2E4XA 3GUYA 3GLIB 3OFVA 1RYBA 4Q02A 4P7FA 3FNQA 1EQ2A 3MS7A 3DZ8A 3R09A 4GEKA 2MSNA 4PNEA 2DZYA 3KSDO 1NXTA 3MYRA 3NDRA 4FPXA 16PKA 3EK2A 1S2IA 1X14A 4JBYA 1O96A 4R3UC 4YASA 2GBPA 4GIBA 4ND3A 5THKA 3VKHA 2AXEA 3KJFA 3K9CA 2JH9A 2G8EA 4FD3A 4M8SA 3R0ZA 3ZDAA 5EEGA 2A1IA 1IAQA 2YXLA 2ZYIA 1QHHA 4FP9A 3WGQA 3AGQA 4BAZA 3G1WA 3MTQA 1AXGA 4RZIA 1IDN1 5JRDS 4YRFA 2PLAA 5DM4A 3K6JA 5TSDA 3F6EX 4K1XA 5KQMA 2CUKA 5FPPA 1GUYA 3U16A 1LF5A 1XF1A 2YICA 1DWQA 3SXPA 3ZV4A 3IVGA 1BH6A 1QORA 1W0JD 1P2DA 3B6IA 1M2GA 1ZITA 3FG9A 4FNOA 4I19A 5CYGA 3IELA 3MORA 3A6ZA 1HLFA 1XBTA 3EQ2A 3A28A 5IKOA 2IYAA 2QJFA 4E94A 1WXXA 1KE1A 4QUEA 2VF4X 5L3ZA 2XLCA 2V7EA 3K9WA 2DLDA 1H2EA 3H05A 3NG1A 4KJZA 4KOAA 5DP2A 4ZEWA 5HJEA 2A33A 2G8NA 3UC9A 2H5IA 5KSZA 4EJ0A 4JLJA 3U80A 3RRMA 1SXGA 1U2DA 4CT0A 3O95A 2JIDA 2ODAA 1R66A 1XJCA 1NN1A 3DW3X 1NVEA 1B8OA 1SCBA 2XUGA 5H0IA 3VDMA 4Y9RA 4H3SA 3VC2A 4BX2A 4NCJA 1VHTA 2MSWA 1FVFA 3VUEA 1Q1EA 5KMGA 3QBEA 4DDWA 2X8JA 3GH1A 2ZJOA 1KO5A 3G17A 2DKOA 2WFLA 3OZUA 4FTWA 4IQGA 3SMVA 1MORA 1GZDA 2P6UA 1Q6YA 2VRCD 1QHYA 3AR8A 3FR7A 3V1KA 3W04A 4B4WA 3WA7A 2EZ4A 1JTEA 3GP5A 1P0CA 2FZ4A 1M6YA 2AYZA 3AETA 4L73A 5DNVA 3BPFA 4QRDA 4QVGA 1BKYA 5CA0A 4WCFA 4OYHA 2XYHA 3FI9A 2HZBA 1H4QA 4JUDX 5LU8A 2YZMA 4IWXA 3NBQA 2QVCA 4H7KA 3GRFA 4MSUA 4D6XA 2E1RA 1X2BA 2F90A 3N9IA 4K87A 3ENQA 5ALPA 3DL7A 1KL7A 1JG4A 4BQIA 1XKLA 1ZIDA 2J9RA 3BSWA 3NH9A 1OFUA 4CE6A 3CJTA 4F21A 1YKGA 2FPRA 1ISRA 4WBNA 1PCIA 3FFTA 3ICWA 4A8JA 3L4BC 4BVFA 3LIIA 1I1NA 4C06A 1XTVA 2WSLA 2NXNA 3BIFA 2HGSA 5CDYA 1LBIA 5ALUA 4DCMA 3KBOA 1VJGA 4K9RA 3NIWA 1BQEA 1PS9A 2I4OA 1GU1A 3KL2A 3IIJA 1XSEA 4BCDA 2JKZA 4NXMB 1I4EB 2DQ4A 2ST1A 4Y2XA 3MELA 4UHBA 3I0MA 3WICA 1H4VB 3OTQA 2R5NA 1V16A 4AUKA 3WZLA 4FWBA 2C5EA 2DJIA 4FDVA 2XGMA 4JLOA 4DM3A 4M83A 2P6RA 1ACLA 4H31A 4PONA 4BOQA 4AZWA 3ERVA 3DMNA 2C59A 1QGUB 2DHRA 3M9WA 5HDQA 2WY2D 2VA8A 3D2LA 1QH8A 2BV3A 5JQGF 4BFYA 1TC2A 4OGKA 1IJEA 3A4YA 1EJ0A 1SUPA 4MULA 5BN1A 5KYWA 4RMGA 1JN0A 2XQVA 2ZKLA 1OZGA 1L7PA 4RESA 2XZOA 2XOXA 4ICIA 3SFTA 3WLFA 2Q0HA 1IY2A 1CY1A 3A3YA 2C9ZA 2CZCA 4GOXA 2WW8A 2WG1A 2QVZX 2IPPB 4K9SA 2NACA 2YFYA 3DD5A 3WA6A 5LZ8A 1NG1A 2H3HA 5A5DA 5D5QA 1WSBA 2IC5A 2XNCA 3KO8A 2Z9BA 1X7WA 2C0YA 2G5PA 2M1ZA 1GVHA 2ZRKA 4K9PA 4TMFA 3GYGA 3TRIA 1ZUIA 2CSXA 3FBGA 3NTUA 3RYTC 3QELB 4YV2A 3FYSA 2YX1A 3G3EA 3KTAB 4M9RA 2R1TB 5HQ3B 1W35A 1TAUA 1HMYA 4YRLA 1N36B 2ZYAA 2VF7A 4CLOA 4D8TA 5AQ1A 2RJNA 4YP5A 4Z0NA 3X1KA 4F4CA 1XTKA 4H4EA 3AQ4A 1P33A 5K20A 4NE2A 4HAWA 3WMFA 1SGWA 4MUEA 2BBTA 4AXMA 2PMWB 5T6MA 5IM5A 5JD3A 1ECCA 3DQPA 1FB5A 4INJA 1YA4A 2W90A 2XCQA 3FVQA 3MZ0A 4IL5A 4PYOA 3TZCA 2IXEA 3TTSA 3C39A 2PX6A 4JI7B 4RTOA 1XNQB 1IUKA 1KU0A 3EDRA 1T5IA 3FUWA 1H5UA 2QUAA 3DO8A 1YRLA 2HSEA 3MJHA 1AV7A 2GN0A 4JGIA 4OXQA 1PGJA 4CYMA 3EPLA 4MCJA 1Y7LA 2F9LA 4C21A 5CH5A 2VL7A 2BHSA 1QJCA 1YMVA 1L3IA 2EARA 1Q0TA 2NUPB 1I6WA 1L0BA 3HEMA 1M8GA 1EVZA 2QAGB 2REOA 3DEJA 3H2YA 1Q20A 2QQ5A 3FJ1A 1FP4B 1MRNA 3GZJA 4G4SO 2HK9A 3LQRA 4JBWA 4TOIA 3TI9A 4BNTA 1KI6A 1HDCA 3Q87B 1MVNA 1ZBDA 4L2IA 4O8ZA 2PVSA 3I04M 4AJ4A 3D6AA 1R6XA 4YNBA 4ENPA 4YCSA 4EFLA 1YWGO 2ENWA 3GZNB 4R40A 3AHFA 4DA6A 3I3TA 1LPOA 1F2BA 3M99A 4DT1B 2HFJA 2ZZKA 5CGQB 1L5OA 3FD8A 2PY6A 3ET5A 2X1HA 1XEXA 4QQNA 5EXPA 2ZCJA 3ZCRA 4Q3LA 1TVKA 4W9RA 1ISJA 4HDAA 3ZDBA 1MX9A 4CIAA 2B1NA 3MHSA 2BTOA 4GKKB 3IT3A 3O8DA 3CNNA 3PC4A 1O1YA 2QR2A 2IZ0A 3L41A 3C70A 2AEMA 4HB2A 5LN1A 1LS1A 1SXJD 5JZBA 3KJGA 3R6WA 3I52A 4HCJA 4D74A 5C3MA 4C4TA 5LQRA 2XB2A 2Q21A 4E12A 2F1RA 5CDUA 4B33A 1KWGA 2PX5A 2EIHA 3FZYA 4U9UA 2JFBA 4XGKA 1ECGA 3PA6A 5G0SA 3TD2A 1PE6A 2I6SA 1E1DA 2TS1A 2W2XA 1DUVG 3L6RA 5C9ZA 3DDWA 1OLUA 2QV7A 3EA0A 3JWIA 1JW9B 3K53A 4OQXA 4OGLA 4XIFA 3JVVA 4MRNA 4JOCA 2I6GA 2VZLA 2WPDA 3C5EA 1RJWA 1JG7A 2ET6A 2YWEA 1FTNA 3H5NA 3MTDA 4KNWA 4LMBA 1QS0B 2SKEA 3NBFA 2Q3EA 3G2QA 1CZKA 2GPWA 5LQKA 2YDXA 4JI4B 4WINA 3T0IA 3CWCA 2PSFA 4G1CA 4OU5A 3PSAA 4G0MA 4UNSA 3GFVA 1OZHA 3CE9A 3LY9A 4J1TA 1XZEA 3JS5A 3A9TA 3E22B 3ZV5A 4U6QA 5SYMA 5ELXA 4LJLA 1RI5A 1XTQA 1IWDA 4YTEA 2FI1A 2I67A 1ZX1A 4P7GA 1YD7A 2O23A 5EPOA 4MEJA 3WL7A 4MEAA 3W3AH 4C4OA 2W43A 5AVQA 2JEZA 4RVCA 5I9TA 3HCCA 2ZUBA 4HDKB 4INZA 2KBFA 1L4UA 3KFQA 4CKBB 3B70A 3FVWA 1FLNA 3GLGB 2G77B 3G82C 2E02A 4HK4A 5JI3E 5K99A 2QRVB 4G0NA 4GBED 1V48A 3GZTB 4TZKA 2JATA 1QMGA 2YIMA 4B85A 3FMOB 4A2QA 2ZI7A 2EYQA 1CQZA 1XD2B 2WJHA 3I39X 3HJUA 4QH6A 3S7ZA 4ZYWA 1TMKA 2QN2A 2ZREA 3K5HA 1VMIA 3E05A 4GVLA 4QUGA 4C20A 4KTVE 5TE9A 2UZAA 4QXPA 4RIIA 2I54A 4PZAA 4UUBA 4ZVTA 1CEEA 1PADA 1H93A 2AJDA 2VTDA 4WOPA 5JS6A 4WZAE 4XZ3A 3KZXA 1SZPA 3W1VA 4A0HA 4UU1A 4N5LA 4ZOLF 3IUEA 3SHOA 4BASA 4AIIA 5BSHA 4J7AA 2EXXA 2AU1A 3UMMA 1PEKE 1H5QA 4OQMA 1ZMBA 3E48A 3UBMA 1DVRA 2KJQA 1Q1NA 5JZVA 1YRHA 1BY8A 3CBJA 3IODA 4R2MA 1SQ0A 4LC0A 1JJAA 3WK8A 4Z2AA 5BMVF 4JLDA 5A71A 1RFLA 2EX1A 2Q99A 4CQMB 3SR3A 3QU2A 1PF7E 2CFCA 2AYYA 4DNFA 3WFZA 1EP1B 4CKEA 3KQSA 1FXWA 1F4PA 2VHWA 2ZK7A 3E0XA 4HI0E 1RCFA 1R7RA 1OYWA 4MICA 2C54A 4BKRA 4B2YA 3NONA 3HLYA 2AB0A 2Z6VA 4UJ3A 1J2UA 2ODTX 5DLQC 2WWVD 1PEAA 4C88A 2RAFA 1BGOA 4QGAA 1B1CA 4TQUS 4ZVOA 1JALA 1S2LA 3OCVA 2DTDA 4KOEC 4OQLA 1WVMA 3NYWA 3LWDA 1RXCA 2X13A 2MU1A 3DWGA 5DU2A 2IK8A 1ULBA 4RZHA 4RK0A 2CXHA 3T9FA 4JJGA 3CH2X 3BHJA 5LU9A 1KFUL 4QC2A 1IB0A 5CDFA 1NRXA 1AZSC 3E5HA 2XTMA 5A4DA 2ZB3A 3I92A 1EESA 4CI9A 5J40A 4P4UA 5JJCA 4PQFA 5CVOB 3GD5A 1J5EB 1G5HA 2NZ2A 5IJ9B 1C9DB 2ASEA 3QVXA 1GZ7A 1W4BA 1IBSA 1RI4A 1WUYA 4YCJA 5J2TA 4ENSA 2WABA 1NVFA 2OZLB 5A4JA 3RUDA 5FPWA 4I2NA 4OHPA 1WBJB 2O2JA 3TSZA 4B3HA 2GF0A 1PZFA 1LLCA 1KNQA 3KQOA 2GN4A 5GY7A 1YQXA 5KC9A 3BL5A 3LTNC 1X1AA 3NYIA 5CGZA 2VOEA 5B3KA 1U2RA 5FWAA 1O87A 1NNUA 2ZROA 4I0WB 3PW3A 4GS5A 1Q1AA 2FPOA 4ZRMA 2IS4A 3CRNA 3EDMA 4ND4A 1S3SA 1XRSB 2DJFB 1P7PA 3B1ZA 3HLTA 4L1KA 4Z54A 5I7SA 4IIHA 1KRXA 3B5IA 3S1LA 1V4BA 5L51A 3U39A 2YV3A 1L7BA 4D0RA 1SU6A 2C4TA 2FKAA 5GZ3A 4CM3A 3BFJA 2IEDA 3WIBA 5EIBC 4RQAA 4C4YA 4CIDA 5FXMA 2LKCA 4HR7A 5AVXA 4UBIA 1EDBA 1GPWB 2GAJA 3A2NA 4UOEA 4N8WA 3ZI7A 4TTTS 4XOIA 2C7OA 2LCQA 3LHSA 4P0QB 3MTVA 4YVFA 2JA2A 1MA0A 3YASA 1WETA 2J6BA 2PUTA 1SKBA 1OT5A 4PGMA 1YR3A 4X44A 3CZ5A 2OD7A 3CO0S 2VJMA 3V2GA 1B00A 1TNDA 3HSKA 2IW3A 3WXBA 1DCMA 3H2JA 1HRDA 4Q9IA 5IASA 1TLOA 2C2WA 1N3YA 1B42A 1ENPA 5KTTA 3O38A 1Y8QB 2PMEA 3E84A 1N75A 3T3NA 3HYRA 3MJSA 1JU9A 4UE2A 2N42A 1JIXA 3VUFA 1Z4PX 4CQLA 2PBLA 3A9VA 2P30A 4FHDA 1GGMA 4MV7A 1PP4A 3OEEA 2HJGA 3AX6A 3F2IA 5L4SA 2XU4A 1CQDA 1GKIA 4PADA 1DO8A 4O08A 3CA8A 1V1RB 2G9NA 1X9GA 2CDAA 1LV8A 2EFEB 3RBZA 4QU0A 3W2TA 3SLGA 2VHZA 621PA 2Z95A 3GLHA 1OREA 4RHUA 1M6EX 1YZKA 4IG4A 2XSZD 4HS9A 3TEJA 1YH3A 2WZDA 1Z74A 3E9DA 4JL6A 4E7PA 2ZUFA 4MP6A 4U8GA 3NHLA 1K5DA 4HNQA 3GN1A 1PFUA 1G2PA 1UADA 1D0VA 1TPZA 3GUCA 1N77A 1LSOA 3DEHA 4Y1EA 1KFBB 1EUDA 2VEOA 1UBLS 4ZAGA 4Q7QA 4JUIA 1T5BA 3T3HA 3ZDCA 2AUTA 4QDKA 2DETA 1BVYF 4RXUA 3EDOA 2VTEA 1KEEB 1SVUA 5F51A 2YW9A 3Q0IA 4WDQA 3HKCB 2GS9A 1HLGA 2FHSA 2Z8XA 2GZHA 3ZS8A 3INRA 4HPJB 4ENVA 2P9ZA 1UDCA 4UCWA 2NO4A 3TAXA 1TTHA 3F97A 5LLSA 3ELYA 1SVIA 1XHFA 2BRUC 3BXEA 3EQ8A 4HNRA 3TJRA 3PRPA 5EKTA 1O58A 4DLVA 3AOEC 3M8KA 4UFNA 3ASZA 2OP3A 2ZANA 3BJZA 3JPYA 3PIRA 3U3DA 1GVNB 4QTZA 3D6SA 2YOGA 3CCFA 1ZS9A 3B3FA 3FCOA 5B58T 1C1YA 3RASA 4BGVA 2AUMA 3C7AA 1U0EA 3E5NA 3TZKA 3IHKA 3VNVA 5BN4A 4FYVA 4H0CA 4DLYA 1KSJA 3DMGA 5TPZA 1LPMA 4TXHA 1OH6A 4GDFA 3CEPB 4AWBA 4B46A 5FI0B 1PJQA 2F1GA 3IBSA 2G70A 3H5IA 3C8DA 5HJ2A 1U4NA 4JQYA 4NCAA 4QUBA 3VX4A 1ZCMA 4Q8HA 3TRKA 3N7UA 1VA5A 4NU6A 2JW5A 5L3RA 5BQPA 1F2AA 4DZZA 3DKVA 2NM0A 4DCVA 1C9MA 2OC9A 4DADA 1LC3A 3OUTA 3Q3VA 4PYMA 3M6XA 4AURA 3IR6A 1Z75A 5JZSA 2C83A 1DPFA 4CL3A 4JXJA 3TGLA 3MJCA 1DUSA 1YSCA 5IVDA 3L93A 4EABA 1JVBA 2QD1A 4DV1B 4GPBA 2XEXA 4IVRA 5J2UB 3X2SA 1LDGA 4C3VA 2IE0A 1E94E 1G41A 5DMHA 2ZI5A 5HTKA 3KEMA 1YBMA 2XIJA 1V5FA 4JVLA 4KQHA 5AOVA 5AM2A 1XA0A 1KH2A 4DZTA 5KOHB 1R8XA 2ZDQA 3OM9A 2JFVA 5EXTA 3O84A 1LCIA 1NBME 4V0OA 3HRHA 2P3QA 3ACBA 1NVDA 1TAHA 2VTVA 2X6TA 1UKZA 2OD2A 3EC7A 3BHIA 9GPBA 4UFOA 3SC2B 4O2AB 1Y34E 2G08A 3LTEA 3N2GA 1PWHA 2E9SA 4F2DA 4OBBA 2PZAA 1HDZA 2KMLA 3KKQA 4CR6A 3ZD7A 5JC8A 1ZVJA 5H8WA 3PQ8A 3DT6A 2WWXA 5IUJC 1AU2A 4MM3B 1DEKA 3K05A 1NIJA 3OD1A 2O2YA 3MRSA 5DISB 3JQQA 2DTXA 3AT1A 1R8QA 1J90A 2AMFA 4CETA 4LYHA 3O7WA 4ZQFA 1TFUA 3H9JA 1JHQA 3B82A 4HRVA 4O33A 5C8XA 3J80A 2P5TB 5EJMA 4BY9E 5FEUA 1HX7A 1UMCB 1SIOA 4I6JA 2W6CX 1V0JA 1E2PA 2GTHA 1JFRA 1QYDA 1T34A 3DMDA 2I7VA 4CMCA 4MI1A 1WMSA 4KHPB 5JRZA 2ERCA 3IH5A 1G21B 1LLDA 1QGUA 2FP3A 2R79A 3C0KA 1WPQA 4LYJA 2Z09A 3CCBA 4R1TA 1RZRD 3E9MA 1NAIA 1NXOA 1IYZA 1BHJA 4D3ZA 1FQJA 4YMWA 2RGYA 1B6TA 2XKAA 5KQLA 1VJVA 2YQ4A 1CULC 1FUYB 1Y7TA 5SY4A 4HDMB 2QOEA 1I5RA 2DFDA 3VTFA 3INTA 2YJ6A 2FLVA 4IKPA 5EZYB 2ZYHA 2DEUA 3P5VA 1R5NA 2ADOA 1KHPA 2G9UA 3EXHC 3L46A 1X8JA 2YQZA 2JH8A 4RX1A 1AECA 2CKMA 1ZIOA 1PZXA 2B21A 1RPAA 2Y1WA 5CTJA 1P4GA 4ZJPA 5F5XA 1HZZC 3JQ8B 2RGNA 3LY8A 2NUAB 3K1YA 5LUBA 5T4FA 4KW7A 3QELA 4ZYYA 1PGOA 4I8IA 5DNYB 1BHQ1 4M49A 3EXIB 3P9XA 2R1TA 5HQ3A 2H6EA 2WT8A 3GRUA 1GLVA 4BWFB 3R0XA 3B1FA 3NDIA 1ULSA 4RTNA 1IHDA 1U63A 2R11A 2B35A 3H2GA 1Y4AE 4FIDA 4HOYA 4CLEA 4ETIA 2EW2A 3GT3A 1IULA 3QSGA 2FZ5A 4I1YA 2HT1A 3FPGA 2CVFA 3JARB 3OHSX 4HQRA 2QVBA 3D2CA 4GC5A 3WO0A 5B4VA 4JC4A 3K71B 1ZHOA 4I7EA 3D2BA 3DNMA 4UM7A 4KTTE 3ZJTA 3GCBA 2P9EA 1UBGA 2GYVA 2XTAA 1ORTA 3CGGA 3UMCA 4A26A 1RQLA 1GCOA 4FZRA 2HUPA 2QDXA 4NULA 2J0EA 1SCKA 5AW7A 1EHYA 3EAFA 1QIGA 3DLCA 3K8YA 3QNUA 4OQPA 2OXTA 3RROA 3D1VA 3VR5H 4B83A 5EUMA 4BMPB 5BW4A 5IRCD 1OVGA 5KTMA 3O8LA 2YNMD 3FBTA 5A05A 3N8IA 4PYJA 1E0JA 2NUPA 3II6X 1LFAA 3O4VA 3RYIB 3ZDQA 4KG7A 2QAGA 3SQLA 1CF4A 1YZLA 1B74A 2F7DA 1JS1X 1FP4A 2W0SA 1S7CA 3K2IA 4FJ2A 3DBRA 4A6EA 4D0NA 1JI0A 1WXQA 3AXSA 1I5OA 2OBMA 3RSOA 2O8NA 1VMAA 4P92A 5DH9A 3GZNA 2C2OA 2P9CA 3M1IA 2UZIR 2WUFA 4DT1A 1N2IA 4F91B 4YYUA 3TR0A 5JARA 4CNQA 2OMEA 1NBWB 4IY1A 2DWOA 4FCVA 4LI3X 4MVJA 2DJ5A 5BQOA 2RSLA 1DAGA 4B7UA 1Q15A 3V1LA 2FWJA 1NJ5A 3FPHA 4MUIA 5SYNA 1N4AA 3M82A 4LUCA 3ERCA 1P0QA 5FBKA 5TV2A 1G4HA 5JAHA 5GONB 4WA6A 1YVEI 3OIUA 1JTVA 2CJPA 3V1TC 4IW3B 5DEIA 4I1PA 1UUFA 2EERA 2GPNA 1XJ5A 2C03A 1PZHA 2VDPB 4IDAA 1X3LA 2YHAA 4B3SB 2I34A 4ZCQA 1I51A 2Y92A 2DB3A 3JVEA 3EBLA 4LBWA 3OZWA 4NDAA 2HF9A 4XVCA 5TJ9A 4CEJB 2ZWMA 3GJ4A 2JAUA 1QHGA 4LJ7A 1JAZA 3PT9A 5D51S 3V8EA 3Q7PA 3ZLBA 2Y1FA 5AW9A 1EX1A 1HE4A 2G1UA 4NMMA 3MHPA 2BMJA 2PLRA 3L8YA 5JYBA 1R0SA 1OWOA 1RHUA 1W8DA 2HCBA 4GM1A 4U2FA 4XXHA 3VOBA 1ZUWA 3TB4A 5EJ6A 1Z8HA 1QS0A 2QMEA 2H0RA 3FFAA 3BTUA 1BMDA 3CNQS 4WFKA 4E51A 5JMTA 3B89A 4ENQA 2VJPA 1PXVA 4UU0A 1NOKA 1M73E 2EFGA 5BW5A 5J5CA 3DOFA 2CLEB 4QWMA 4POOA 5CA1B 2YV4A 5JCZA 3Q72A 5EP4A 1DG1G 3BZUA 3E22A 4D9NA 3CV3A 4PFKA 5A1JA 1U2QA 1HL7A 4C7XA 3QGMA 4QQRA 4MYSA 1JP7A 2HPZA 2B1MA 2QW8A 1T5SA 2NSLA 2B2XA 1A1SA 1BAPA 5IH7A 5JAPA 4HDKA 2AKEA 2I6XA 2MDTA 1MDWA 4HG2A 2IEYA 1PD1A 1V5WA 2A88A 1L9KA 2MSDB 2Y93A 3I9V6 1TUEA 1OBVA 3ZJYA 3P5XA 3N05A 4FJCA 1VE9A 1YAJA 2QRVA 3QEBZ 2JS7A 1TAQA 1GTMA 2JK1A 4REOA 3K9QO 4TPKA 3IQXA 1R12A 4BBAA 3GLTA 2DCAA 3L8HA 4HKTA 1XD2A 3EZYA 4HTAA 1HT2E 3I9KA 1H8EA 3CLUC 2PV7A 1N2HA 1FYWA 3OBBA 1V9LA 2X8WA 1JR6A 4GMFA 5IAOA 2CVHA 4ALNA 2VO1A 1VL2A 2QTTA 4K6HA 1O5OA 2O1EA 1EXNA 3KX1A 5L3SB 3CEMA 3RRYA 2J3DA 1JHDA 4OH7A 1CLUA 4DLTA 2BCGY 1QDQA 1YONA 4KR2A 2VCEA 2XUQA 1B1AA 3PCXA 2H92A 2VZ0A 3AR2A 4JBIA 1QVVA 1T9GS 1ICIA 1DBSA 1K7SN 1NVAA 1SY7A 4PQYA 4AQYB 3IV9A 3N87A 4BO2A 1YIAA 1ZNYA 4JI6B 3JQGB 4U1RA 3SNKA 1YQEA 3OI7A 4C3ZA 3WL5A 4BNWA 2PMFA 1JHPA 1RQXA 2ZIGA 1B7GO 3WY9A 1P7CA 5GJBA 3IKVA 4MWZA 3DPSA 1MQ8B 5DRTA 2K2WA 1N1DA 5I3CA 1FQWA 1PG2A 1D6MA 1TKCA 5CFLA 1KVQA 1UJ5A 2JD2A 4G01B 1CHDA 2ZUEA 4HVAA 1GXSB 4ALLA 3QMWA 2W8BB 4LHWA 1S4VA 4LYYA 4BO0A 1S6YA 2PL9A 1XKGA 4FYYA 4XIGS 2C7PA 2FG7C 1L1FA 4R3DA 4LE0A 2VPTA 2HIMA 3K2EA 3QJ5A 4R8SA 2NU8A 2QWXA 4YACA 1TB4A 3MOIA 1KIFA 4O2RA 4WNYA 4Y6GB 2FW0A 4BRWA 1U3FA 2RGAA 4EPXA 2PO7A 3R4CA 5C7IO 4AY6A 4MZOA 1U3UA 5BR1A 4I9GA 4EKNB 4N5DA 1IN4A 1GGFA 3R0QA 3RUEA 4HXYA 2FEMA 1TIPA 2IYFA 3TNFA 3F73A 1UKFA 4YP1A 4CIWA 2FCAA 4P4GA 3DH0A 5IJ9A 4QYTA 1C0LA 4R71A 1UZMA 5A0VA 1A5ZA 1GA1A 3WJAA 2X5NA 2PWPA 2FMKA 2OZLA 4F1JA 2FFHA 2PANA 1SUIA 4BQSA 1P9LA 3OICA 1KU6A 2HH9A 2P0AA 3UJCA 2ATXA 2QPLA 5DSXA 4GOKA 1EM8B 2KX7A 1FSGA 2OLEA 2JFHA 4JUAA 5EGSA 4AAYA 4QTXA 2A59A 1U0HC 3IMGA 4TT8A 4PLHA 1T1JA 4WY2A 1OA0A 4BVAA 2XZTA 4NJMB 3CTMA 2QAJA 3AF0A 3I23A 3UV3A 5BVHB 5G0UA 1FDSA 2Q5HA 4XGNA 1S8AA 1A5SB 1MC1A 4YFVA 3LQQA 4DXAA 2BJHA 3DOIA 4GSKA 3OQCA 5ENDA 4XM2A 4KRGA 5G0WA 2P2ZA 2A35A 4G4JA 2XVXA 1IXZA 1DQYA 4PLZA 3WGHA 3ZCVA 4R2KA 4DDMA 3P0HA 3X1WA 1X1TA 1INLA 2YWHA 2OBBA 1FY2A 4XZXA 3NUQA 3OP4A 1C14A 2NGRA 1QHIA 4EGJA 1U0GA 2O2GA 2HIGA 2IW1A 2K87A 3C87A 1IK6A 3D5TA 3AOGA 2EDCA 3TIGA 1VB5A 3S2ZA 1XQ9A 1Y3FE 2M6RA 4PPYA 2CZGA 4TLAA 1N8KA 1Y37A 1SC6A 2DUMA 5F9FA 1GV0A 1EFDN 1AYWA 1W76A 1Y8QA 1N8TA 2ZQYA 4RLSA 4YRZA 2VTBA 4WEQA 1JLMA 5K2OA 4B84A 1ZCZA 3WHPA 3H19A 1NL3A 2ANCA 2A86A 4D4IA 2CY0A 3AERA 3AHDA 5JAIA 1P9WA 4BFXA 1RPTA 4I5EA 4UUQA 3OFNA 2J07A 3FYUB 1H85A 3RVDA 3D0RA 4YJGB 4EI2A 2Z8ZA 2JVIA 3CLRD 3N74A 3HB0A 3HCAA 1YUNA 4FBGA 4LJKA 3VC3A 5CDFE 5JXJA 1M8PA 2B8JA 2WSSA 3BA6A 2XXBA 3EXEB 4MRVA 4B8YA 4C89A 2PWYA 3QBVA 2GBLC 2XCRB 4F72A 8MHTA 4MYCA 1MABB 3GFRA 4ARZB 3GCDA 4F9GA 1C0IA 2SICE 3EAQA 1O2DA 3TXXA 2HLDA 4G67A 4OJQA 5TVGA 2EJTA 3EIUA 3KHSA 3S28A 3IDQA 2FFQA 1E4VA 1NGSA 2AFVA 1U0NA 4JEMA 3ZHBA 3TNYA 5HWSA 5FAKA 1Z37A 2AL7A 4W8GA 4QLBA 1N9GB 3KKMA 3TDNA 3W7AA 4D9IA 4DG8A 3BB3A 1H2AS 2BGRA 2CVZA 1X2EA 3MWFA 3QHQA 4OQFA 3WL8A 4ZZ0A 3A6KA 1KEEA 1SOAA 1FF9A 3UYKA 2FNAA 3F6BX 4PCUA 5JAMA 3HKCA 3FDXA 4IHJF 4LOAA 1I1OA 2VKQA 1HMPA 2RE8A 1JECA 1RLTA 3GAZA 5B2EA 3HU3A 2RGUA 3LHFA 3MJFA 5A7FA 2I55A 3KUKA 1RRGA 2FX5A 1QOZA 1RKXA 2H0AA 3I64A 1PZNA 2B5VA 1EFRD 1G42A 3D8TA 1GKUB 4NU8X 1VBNA 1UJ2A 3CFYA 3MWGA 2NO6A 3STYA 3TFOA 4OVZA 1DKMA 1UKCA 1X74A 1RM5A 1CDOA 4HGQA 4TQGA 5ALGA 4D3SA 5GPBA 3T15A 5JJLA 5JTTA 5DMXA 5C34B 1GL6A 1EVLA 1CJTC 1Q5PA 1Y1TA 2D0IA 2FSVA 1O97C 2GA9A 2R6R1 1O94A 2FMFA 2VHTA 4YLEA 1DJPA 1FLVA 3F2VA 4DA0A 4U7FA 1SD1A 2P5UA 2XITA 1CB7A 5KDOA 1OI3A 4X6XA 1V47A 3C24A 1AX9A 4GMGA 4RKXA 1QDLB 1JSXA 3LYLA 3UEOA 5LKAA 1RJFA 4ZT5A 2F2TA 5KEIA 3HA7A 1LK7A 2Z3VA 2BEVB 2IYSA 2VP4A 2Z1DA 4KQEA 3LO8A 5I7WA 1HDRA 5J2UA 1LSUA 1BGXT 1YC2A 5JDCC 3OESA 3WHKA 1YZGA 5KOHA 1V1JA 3UHOA 4YRJA 2AE2A 5HNKA 3RT1A 3BBPA 4N40A 1UBHS 2GBFA 1KDZA 1P17A 5ENZA 2I2CA 3PT2A 2GZSA 5A1TA 1Y4SA 2WOOA 1JI3A 4UNRA 1ZM4A 3GLIE 3SC2A 1ZNQO 4HH3C 1GZSA 4O2AA 4JR1A 1VL1A 2X9LA 3GFQA 3V8NA 2BZ1A 1JSCA 4M98A 2G0AA 4CW7A 2HT6A 4MA4A 3Q7EA 1ACJA 3FUTA 3T9AA 5B7GA 2V6BA 4KXUA 4EUKA 4R8VA 2PQMA 2Q2NA 1M83A 1O6GA 4Q24A 2C9DA 3LA8A 5IWCA 3Q4GA 2Z84A 1TA9A 3WLMA 4DKJA 2Z6AA 1WMEA 3ZH2A 4Z3OA 2GETA 3QNMA 3ZGZA 1GCBA 1WCV1 2D06A 1XDZA 5FPHA 4YT8A 4PYKA 1UMCA 4A6PA 1CTQA 2P1RA 2WR8A 1H05A 1FP7A 2X9NA 3BKXA 5AKHA 3TW4A 3P4UA 4ZARA 4JFAA 1NJFA 1W49A 4GBMA 1KVRA 4CTKA 4YRNA 1G21A 3SHFA 2F59A 5JS2A 2JGDA 5DO9A 2ZR0A 4M1WA 3NPMA 3QX9A 3L7CA 3NO4A 5ERYA 4CV1A 1K6EA 3DXYA 1PK7A 3VR3A 1TM5E 5EKSA 1RC8A 2RI0A 3I2KA 3AP2A 3IOEA 4NENB 1ID1A 4R9VA 4X45A 3ZW8A 1J6UA 3BXZA 1CUYA 4X20B 3IEJA 4WXYB 3ETEA 2EDAA 5JDIA 3IEMA 5JPCA 1ORWA 3TFQA 1Y1QA 4QHTA 2VQDA 5TY0A 1JSRA 4PLTA 4EFKA 4NBKA 1UC4B 4M38A 4I05A 3OJCA 4L02A 2CVPA 5CLFA 3IQGX 1LTKA 4OELA 2VCHA 2I87A 3KQWA 4PG5A 1GWNA 3LUFA 4AYXA 4F7DA 1CTEA 3JQ8A 3ND7A 1Y3DE 2NUAA 2C94A 2V7BA 1TL9A 3OTIA 1V8OA 5ALEA 4BEVA 3VJRA 3WQRA 2EHJA 3LPLA 4AMVA 3WMGA 4XFJA 5DWDA 5EMKA 4F4HA 5CFRA 1F06A 4S1NA 4LRTB 4J0FA 4LE1A 5FR1A 1CQPA 3BY4A 1OR8A 2YIJA 3E3NA 4KQWA 4O02B 2HU5A 1OJ7A 4HEHA 1TJNA 1SWWA 3FTFA 1VKZA 1U7UA 1ADFA 2A9PA 2CMGA 3LY7A 1QAQA 1USUA 4O6VA 1W93A 3IJEB 1XPJA 1IVNA 2I5PO 2PH1A 3QPDA 4FSHA 1HDEA 5KVAA 3QLVC 4C07A 2W2MA 1A2QA 3ZG6A 1N2CE 3H97A 4L78A 1VLHA 1N2XA 5CAEB 3WDSA 2AK3A 4R2XA 4O5OA 2OOKA 4WJLA 2H2HA 4TMVA 1G3MA 3Q1KA 1YVPA 1N8NA 1L5RA 1YXMA 4Z0TA 3KTFA 5BVGA 3MWKA 3ETHA 3IPAA 3QT4A 2ZU0C 1XO1A 2F1OA 4WPGA 4KLRA 4EW2A 1P2FA 1V3UA 3AFOA 3D0QA 3DL2A 5EHIA 5IBRA 1RP1A 1KRHA 3LPCA 2Q4TA 4Z2YA 2DTEA 4Q9DA 2OZVA 4ZEOA 2QTMA 1I2MA 4J0IA 1E58A 5IJ0B 3KOWA 4MAAA 3LPAA 3RYIA 2DFNA 1YQTA 4FGJA 1KDOA 5AVWA 1RKUA 3BDIA 3ADBA 2J67A 2HWXA 3P9NA 3PFIA 2QSZA 4KPFC 3U49A 5HUHA 1ME3A 3VMMA 4D99A 1OWNA 1GNVA 1RWNA 1Z8NA 2W6ID 2ZGVA 3F3YA 3KAJA 4I3FA 2I3AA 4RPJA 2H2GA 4UBJA 4URYR 4WA7A 4DOMA 2YWGA 4DHEA 4UE6A 3ICPA 4UVHA 5FWNA 1KY4A 2Q3LA 3L7IA 5JD6A 3GLFB 1DTWA 1YZVA 4Z0HO 4G5SA 3UO8B 1YHNA 2HTEA 1XMQB 2BEUB 4W5HA 4FBMA 4R8LA 5E0KB 1ZHFA 3T1YB 2AQHA 4CF7A 3OF9A 4Q7EA 3Q1LA 5BXQC 2FMUA 4YAEA 3GLVA 4XWOA 2ZWVA 5CDSA 3EVBA 4PS0A 3RR2A 3OPYA 1J8YF 1AQJA 5GONA 3PS9A 2NPFA 3AFHA 1QXPA 1YGYA 1BE6A 1I14A 4IFTA 2P79A 4G8BA 1GJRA 2ETXA 3S2IA 4BMOB 5CHEA 2VCYA 1KEZA 2X8BA 1ADJA 3Q0EA 5CK5A 4CM6A 3TG2A 2Y1GA 4N49A 1V8BA 4IMJB 1NHWA 3V7YA 5AI5A 4ATNA 3U7FB 4X1KB 1EJBA 2HA4A 3W5CA 4H7DA 4CEJA 3CVWA 1AH2A 2QI9F 5SICE 3LUAA 5EUBA 3UGTA 3UV7A 1H8HA 3K9FC 3QVTA 3VPDA 1YE8A 2EWWA 2FN9A 3A1WA 2VQFB 1CRQA 4M1YA 3HYSA 1GTJ1 2CK3D 2V6JA 1LBHA 1V37A 4HZGA 4JBHA 5F21A 4H2DA 1JQAA 2PKQO 2XUFA 4LJ6A 4AS1A 1I36A 2F9FA 2VJQA 2WAOA 4IXTA 4Q9LA 1G8YA 1UT8A 4GKVA 5T8KA 4FZ3A 1BXRB 4IZ6A 1AO0A 3LDAA 4GYWA 2EFJA 2HDWA 3H7AA 4KP7A 2IDKA 2VWPA 5CA1A 4RVFA 5K6AC 1JBKA 3A3PA 3PRYA 4KN6A 2IPXA 2J30A 1G5QA 1TF7A 4I99A 1ABBA 1E66A 4REZA 2Y1OA 2XOKD 3VAYA 2VDLB 2OZEA 3WS7A 4FX5A 2VPWA 3DZHA 5E3HA 4GKJB 2O9JA 4BNHA 1GNPA 2JBHA 5H80A 4DLNA 3ZDDA 1HEUA 1RT9A 2FUG6 5FV7A 2I7TA 4UQPA 2WK1A 4CU5A 3OIWA 4QBBA 2A0YA 2HR1A 1IEVA 4GI7A 4DIEA 5HOQA 1KRWA 3I83A 2LWIA 4L72A 4XWKA 2RHGB 2HHAA 2IS2A 3A2LA 4A6DA 2KBEA 3FVRA 2C9MA 1BEUB 5K03A 3ROTA 5TGTA 1U3GA 3HSYA 5DBEX 1TU0A 1GZ3A 4JVNA 4UVEA 1QDUA 2JRLA 5LQMA 2GCOB 4H4CA 3ETCA 4D9MA 2A58A 2Q50A 2J9XB 4D4HA 2PUEA 3RS0A 1OFUX 5IC4A 2VPYA 3P0EA 1H3EA 1SQ6A 4FUQA 1TGYA 2OB1A 1RLIA 4ACAA 2Y2VA 1MX5A 4WNIA 1UOEA 2WP0A 1FRNA 3D8NA 4XOUA 3GR6A 5L3SA 1FFSA 2ADFA 2RDMA 3L5OA 5BSUA 3D1JA 1QNFA 1RM4A 5I7OA 2B0CA 1ZD8A 3RNVA 3L7MA 3M5CA 1Y48E 4JEIA 2R8ZA 4COOA 4HWPA 3DF9A 2O0LA 1DF0A 2OESA 5KNBH 4TUYF 2RHLA 3TFWA 2RAVA 3LAWA 4RSHA 3EJ6A 2DUWA 2I78A 2ZAOA 3JQGA 3K0AB 3QTLA 4I50A 1KEVA 4PNPA 3RKSA 3ZWYA 2RKOA 3DCIA 2GZ2A 4Q01A 1PVJA 5T5QA 4YMUA 1IQRA 4JOQA 8LDHA 1JU4A 4XJSA 2RD2A 4D7AA 2CZQA 1E69A 3MN1A 2VT7A 3IOMA 4I5GA 3A32A 5B1IA 1DQSA 4EB6B 4DUZB 3HYCA 4LHSA 5AJWA 3H2SA 4ZZ3A 3IOBA 4CKWB 3EAGA 2X3YA 3FCSB 3COVA 3M6IA 3FHCB 3Q2OA 3KALA 3LQKA 1GXSA 1S02A 4R16A 1ZRMA 5F64A 3JQBC 2H1SA 2W8BA 3JRNA 1WVGA 2B7CA 4P5EA 4M1MA 5K3FB 3MJ4A 5C37A 5AKGA 2DH5A 4V0RA 2IBTA 2AN3A 2B37A 3ESZA 3SE0A 3BMOB 5B36A 1TM3E 3D6MA 3H0EA 1Z5PA 1U28A 5JSYA 4DA8A 3I4LA 3GJ6A 1RJEA 1Z2AA 1HYEA 3RSZA 2QLJA 4WVFA 3U3ZA 1V96A 4BNJA 4CLXA 5K4HA 1HC7A 1KXZA 4US0R 2O3UA 1LRJA 4JL5A 5AYVA 4B4KA 4KDRA 1C9EA 2FR8A 3LBYA 2XKBA 1A4IA 1HG0A 2ZYSA 5KHLB 3BF7A 3SXJA 3HO6A 4UEWA 1PWXA 3U5TA 2WFMA 4XYBA 2XU3A 1M1YB 3UJNA 4TMTA 4OY3A 3V6CA 1VHWA 1AUVA 1IHYA 4CQNA 4M88A 2C1XA 3M83A 3U6KA 1QHNA 3A1CA 4YYQA 1EM8A 4MJ7A 3BWVA 3UAYA 4LRSB 2MYUA 4HLUA 1FUKA 1RLMA 4NJMA 2PWBA 2SCUB 2BFAA 3O4GA 3TQCA 3IKTA 1ADCA 9MHTA 4IIEA 5BVHA 2JIRA 1X7XB 3IKLA 3MLAA 5F76A 3UMJA 1SG9A 3WRYA 4X71A 2CLHB 2LUOA 2YHUA 3QPUA 3WK6A 5JBNA 2DHQA 3T99A 2NO5A 4AMBA 1HSZA 2IKSA 1MB3A 3NHUA 1DE0A 1OI2A 4KAAA 2ZAMA 3IGFA 1RYYA 1AO3A 2BEWB 4G5FA 3ZHOA 4P1ZA 2VPIA 1W75A 1C4OA 4HUQB 3GHYA 1PW7A 3R75A 3H8WA 4JY7A 4ONEA 3NQ41 5AVKA 1K7CA 3SQWA 5JCXA 2QRLA 4IBOA 2GXQA 1X77A 1W59A 2Q8QA 3I1IA 2R84A 2EYUA 3CWZA 3PFBA 4GSYA 3B9QA 4G89A 3LY5A 4K2AA 3ZK8A 3GEDA 1ZLXA 3PHCA 2BUBA 2BTWB 4H6VA 1RIIA 1WY7A 3SP1A 5BY2A 5ARBA 2HMYB 4Y2PA 3UGJA 4KAJA 1A76A 5L45A 4X93A 1Z6QA 4JFRA 2FZKA 2AXNA 3UNXA 1HRKA 4CN8A 1VG1A 1UXIA 1TMOA 4JLSA 4OHCA 1Q0LA 4KCGA 3I2GA 1MX3A 1ILWA 3DOEA 3IUNA 2PRSA 4D9JA 3COSA 1SR8A 3H75A 1KZYC 2AGAA 1IUOA 2GJ4A 4JROA 3FCCA 3FPCA 2IYRA 3NBUA 3F7OA 4JJAA 3SR4A 5I4IA 3FYUA 3M4NA 4W5RA 1NKSA 4YJGA 1TM2A 2A5GA 4IXMA 3NJ8A 3SLKA 3C1UA 1VM6A 4F5EA 2D7CA 4OBWA 4J6FA 4G84A 1G5FA 2OVBA 4BGIA 2EIXA 1I1HA 1AHPA 1QIJA 1P4SA 4RH1A 2OYSA 1CRPA 2REBA 4XSGA 4WKGA 3ZR4B 3IBYA 3AESB 3K32A 4EG4A 4US2R 1X3SA 3GXBA 3R0JA 1GEGA 2QU8A 2FG5A 2VK2A 5CA0F 4P4SB 5IVIA 5CB0A 4UD6A 3IUQA 3AUJB 4KZKA 4QYMA 1ECJA 1OLXB 2GD6A 1UH5A 1N9GA 2JAOA 3PGKA 3LX8A 5F2KA 3KS9A 1XE3A 4G81A 4QFDA 1KIMA 1TA4A 2MYTA 2J7PA 5U1PA 3HWX1 4BV9A 4HWYA 4GHWA 1CNEA 4D81A 5JHHB 3Q2IA 2PM8A 5JI2E 3EQ9A 3IULA 1DFGA 1I5EA 2VHXA 4WBNF 4Y2QA 3U40A 1J1ZA 5LDHA 5IC5A 3T12A 5PGMA 2XMPA 4PF1A 3NWPA 1TIKA 1JBQA 2D1TA 3PENA 3L8MA 3RK1A 3BB1A 4ZQEA 3AP1A 2PX8A 1SWVA 3E2PA 3IJPA 5U4QA 3WGOA 1EVIA 2HI0A 2YFKA 1HLPA 1R3UA 3Q9LA 2WQ7A 4A0GA 1D0SA 1ZMTA 4GR5A 2VP9A 1MKYA 4PLPA 1PQUA 2BGUA 2HEIA 1UJ4A 2V54A 4U2KA 3VPGA 1CPJA 1AGXA 1U8XX 3OF5A 1H94A 2JFPA 1BFDA 4EG5A 2NQIA 2BLNA 1QP7A 2X8LA 2FEAA 2P75A 3IQDB 1IXSB 4D5EA 3OZGA 4YP0A 1F0KA 3VQTA 3AB8A 1SKMA 1L8QA 1BW9B 4O4JB 1M1UA 5FOUA 4UTNA 4FOSA 2OHOA 1YBVA 2Q3MA 3FW1A 2IA5A 4D8UA 5A02A 1PNOA 5K3DA 1RHJA 3FYDA 1OU0A 3FF4A 1A50B 1JQDA 1R0ZA 4MK4A 4LSGA 4XFDA 5ERXA 5JVDB 3TBFA 5CXQA 2BEVA 1VPWA 4E14A 4KO3S 1NXXA 4ZVQA 3D5QA 4LY3A 2GWHA 1QRUA 4UHJA 1NXQA 5I8PA 3H1AA 3DCJA 1XZNA 3PNOA 4U6NA 4UPEA 4US1R 4C5CA 2H5LA 2RBKA 4FFDA 2ZR8A 4ZAYA 2ATCA 1EI9A 2PS0A 1O95D 4A1FA 1STFE 3AI8A 4EF4A 3G0GA 1MFPA 3QK7A 1GTRA 4GRDA 2HO4A 3WKAA 3BWKA 5IAGA 4X8LA 1XU9A 1HURA 2IDJA 4ZREA 4BO1A 3F49S 1KZHA 1HWYA 1QMPA 1WNTA 2V4ZA 2VWHA 3GG9A 4OHZA 3WJ7A 4Q18A 1A4XA 3A7EA 3IUJA 4IP3A 3GJYA 3DUFB 2Z2YA 3WRXA 4DV5B 4DC0A 4L5IA 4Q82A 4GW3A 2JDIA 4MB6A 5CNKA 3PUJA 1IPHA 1L8XA 2JI8A 2JZOA 2CUZA 3G2MA 1MNAA 3VO2A 2QT1A 2I4NA 4ALIA 4TYNA 5A3QA 3RKRA 3PNBA 3PFHA 4LISA 5CLHA 4E30A 4YRAA 3EPHA 5LDGA 3HO1A 3X3HA 1NFRA 4YCCA 3F67A 4DGQA 4OW0A 4K6MA 2P9FA 1A5AB 4QBGB 4QASA 2X2EA 2XMZA 1KXJA 4CTNA 3D6FA 1RMYA 1WDMA 2UZ0A 4LJYA 1TK3A 3R5XA 4WMLA 1AMUA 4IV0A 3UTCA 5LC1A 4G2NA 1FNNA 4L0CA 5IKEA 3URMA 4YYRA 3D8RA 4ZYTA 4FWIB 1E1QD 2H1VA 3PC8C 4MPRA 4OMUA 5FA8A 4EHFA 2D6FA 2JCGA 3A1NA 2YJ2A 2PR2A 3IO5A 4NENA 4CMBA 4P2BA 3PUYA 1F2UB 1NZFA 3MAJA 3N4CA 2FSGA 2HF8A 3G2PA 3JZAA 4X20A 2G71A 4XEHA 3PQ5A 5J4VA 3TUIC 1I4WA 1ORHA 1TE2A 1POXA 2QTFA 1E2GA 3RJ5A 1M0SA 2ZYUX 5EQDA 3NALA 1W4ZA 2VJKA 3TOVA 1NLMA 1K7YA 2M1XA 5HF8A 4YLYA 4TXMA 1VSUA 4Z4HA 1Y5MA 3RODA 1GT91 5KWSA 1JEAA 2VHEA 4G1FA 1ODLA 5JZEA 3QBJA 1NBMD 3WRVA 3SZUA 3IV6A 3L0PA 3M2PA 4CLRB 3PQ3A 4RS3A 4KIWA 1B8VA 2WMOB 2YTZA 1MAAA 4NMLA 4J0QA 4QOJA 1UIRA 4LQCA 5AKXA 2JGMA 4L5AA 2GZ1A 3GIWA 3M70A 4YRTA 3VFDA 1Z4IA 3FDZB 3K0EA 2PZFA 4Z99A 5A3SA 3BBLA 2VA9A 2H4XA 4EH1A 2O20A 3BREA 5E7QA 4W5TA 3QE2A 2FX3A 1ZKDA 2G3YA 5CAEA 2W2PA 2NSYA 3SYRA 3PUVA 2B98A 4H17A 5CH8A 1APBA 4P0PB 3OHMA 1CZLA 2VSOA 4NEGA 1AKVA 3OEHD 3OTGA 2O59A 3DBIA 1BU5A 1ZOLA 2HLNA 3F6RA 3OC0A 3OOWA 1OIXA 5AH0A 5F3RA 3M89A 5JH7F 5ESWA 1OTYA 3AKYA 4PS1A 3ST7A 1NX9A 4JC0A 1Y1KE 2X1MA 3WLAA 5IJ0A 3ZKWB 4C4PA 1OJLA 1SULA 3A31A 3ZBUA 4XUEA 3SJBA 2B4QA 1TCCA 1E2HA 3L8FA 3TLZA 4O8CA 1KQNA 2WINI 1JPVA 2FJ0A 3AEZA 5AW0A 3CF4G 2LKDA 3ZLUA 1QQTA 4PYIA 2JGIA 2XDAA 4M0DA 3TQQA 4BMXA 2ZJZA 1YR2A 1D2CA 2VF2A 3HN7A 1JMYA 5DV9A 3TLKA 4KC0A 1G21E 1WRBA 1W48A 3ZHYA 3CEJA 4HWGA 1Z16A 1U1DA 3C8UA 1L7MA 3FGOA 1XHLA 3GBVA 5KYKA 4ZYLA 2BEUA 1Q91A 3CZMA 2XIQA 1Q21A 4GQBA 1JB1A 2HJWA 4Y2HA 3KHKA 4ER5A 4GGPA 3B1WA 1U3TA 1UXKA 3ETLA 2QNRA 2CDRA 4YHBA 1KZ6A 3U4DA 4Y6QA 5JJIA 4B6EA 1A4UA 4PC3A 4WEOA 5HE8A 1ZD2P 5B7PA 3WAJA 3F5VA 1UZLA 4ZCPA 3BSYA 4HQFA 3IVRA 1PVOA 2RMKA 1LWOA 2FWBA 3ID6C 5KTOA 4HZIA 4DANA 1V39A 4LSMA 3RM3A 1DBVO 4MVJM 4P36A 4BVHA 3U6BA 4LV8B 4X1KA 4BO5A 4C0HA 3CPJB 1N2EA 3GGJA 1P81A 1HUQA 2FPSA 3WXMA 3S2YA 3CUTA 1MZPA 3LNTA 1KTVA 2H5EA 4PO1A 3A26A 4DWJA 4UFPA 1TU3A 5KAMA 3E7WA 3OKFA 4LWZA 1PHRA 5COBA 4P6VF 1FU7A 3P0IA 3CLKA 3L06A 4BP3A 2BR3A 1CQJB 1SHJA 3B7PA 5FTWA 3D0KA 3ZUPA 5LB4A 4QGSA 1BWQA 1BXRA 1W73A 1KMMA 3AUFA 4PFJA 4TV8B 3I1YA 1OFHA 1R5JA 4OHUA 4OXIA 2OULA 4KXMA 2P2SA 1P5ZB 1P62B 1P7VA 3FUCA 2IRWA 4J0HA 4RUKA 5KKAA 5B2FA 1XZAA 3PR2B 2IS1A 3K1JA 3VC1A 2GK6A 3O7MA 3PNSA 1NMQA 3THWB 1N7JA 1FXWF 2B99A 2X5XA 3KJHA 4CFZA 1XZLA 4E11A 4JP2A 5KTSA 4FGWA 2E1PA 3TL2A 4PGGA 4DF3A 4FU0A 3H16A 2H7XA 4FMDB 4JB8A 3LKBA 2NTNA 5EIXA 2ZLBA 1ZJ4A 2QQFA 4G97A 4ISCA 2VSXA 4IVQA 1ULHA 1AK9A 5CNJA 4S0ZA 1W2HA 2ORWA 5DTEA 3QH4A 2H9YA 4Y98A 3CVXA 1QFJA 3QWIA 4P31A 4YCMA 4OKIA 1J06A 4PW0A 1Z47A 2GCOA 4M4SA 2E4VA 3T3MB 1EZZA 4YPVA 3GB9A 4ND6A 1I4LD 4P8RA 1P1BA 3L4BA 3FZEA 5FL3A 4XCQA 1ZRSA 2F7SA 2FN4A 3Q8WA 4HYTA 1X87A 1EQUA 3FOBA 3UGQA 3WWEA 2XUIA 4OP3A 5J2TF 4EKDA 1ZUD1 3D3NA 1O8CA 2KSQA 2IHZA 3IA2A 3R3SA 1KEPA 3CIOA 3FNHA 2BR5A 2SKDA 4F3CA 4JHXA 4N01A 4TL9A 3H99A 2EL7A 4AULA 2ZR9A 4HYQA 3PYMA 5JRJA 5MGBA 1C0PA 1P2UA 4GC9A 1OCEA 3CNEA 3GMSA 5ICFA 1BX1A 1RYDA 2AYNA 1YCDA 1OUMA 3B6JA 3K0AA 3ILYA 3ONWA 3R40A 2ZAIA 2Q45A 1W5SA 2HMWA 2AOWA 1M2JA 5E7IA 3RUHA 4C2AA 1JFTA 1QF6A 4MZSA 4RAOA 1ZIPA 1D8AA 4WADA 3GIDA 1PS8A 1XZBA 1E7RA 3X1YA 1NVWQ 4Y2TA 5T3YA 1AA6A 4ZTZB 3KKNA 1QYCA 2Y6EA 4PPNA 1NB5A 1EHIA 4EB6A 2O6XA 1PUJA 2YJZA 1QHXA 4RJ2A 4CKWA 2BDLA 3GA7A 4ND8B 1C9JA 3W8DA 2R00C 4Q4JA 3FDFA 3FZQA 3TNDA 2PU7A 2PT9A 5K3FA 2GTIA 4EM6A 4BL5A 3MCUA 2VP5A 4G5RA 4RD1A 2EBFX 2JGFA 1UINA 1Z7WA 3L6BA 3LFTA 2R8PA 4KUGA 3BMOA 4UQLA 3JPWA 2CCKA 4Q4CA 3EXHB 5D1NA 4UEJA 3WADA 1KH1A 4M54A 3CUWA 4Q4LA 3N07A 1SVNA 3HZOA 2ANBA 1SUAA 2HWKA 2XWJI 3D64A 3TIFA 3OF2A 5B3JC 3F90A 1WXGA 2G06A 3HCRA 5DYNA 3Q5EA 2OG2A 3VKVA 3IP1A 4ZICA 1XOIA 4OHYA 4L22A 4UZFA 3IE2A 2V0CA 1KJNA 3FPKA 5G53C 5TGZA 3KHUA 1M1YA 3EE6A 2PX2A 2W6MA 3ND9A 3CVOA 4LOLA 1W581 4Q00A 3V4OA 3I5YA 4MKFA 1B2LA 2WOJA 4IP0A 3FTEA 3VSCA 2BIFA 3LV8A 1FP1D 4JWKA 5L4NA 5JNTA 3WLJA 2IGBA 2V4MA 2W22A 1XDSA 3G13A 3EPJA 3BOWA 3UW1A 1UMBB 1M9NA 3OT1A 1JTFA 1X7XA 2QX6A 5IAEA 1THZA 2V5VA 5C4IA 5JOQA 5B1EA 1U5AA 2WJJA 4V0NA 2YJ5A 4RPKA 3ANYB 4Q12A 1RRPA 1VMDA 3A4LA 5F7OA 3E1ZB 1FSZA 3T5AA 3WMRA 4A8PA 2P68A 3TH5A 4ZRNA 2ZBEA 4BFTA 2FW7A 4HUQA 3ZIUA 4YVAA 2J08A 1I01A 4MMXB 4GL2A 2IEIA 4EHLA 4HRAA 4ZU1X 5ALYA 1LPPA 4WZ6A 3RVVA 2EJUA 1R27A 4KPYA 2BTWA 4CL0A 2BHLA 4R51A 4DSAA 1GNRA 1J8DA 5AW6A 3CF2A 5JT1A 3U37A 4H1VA 2XBMA 3I9JA