3TRKA

Structure of the chikungunya virus nsp2 protease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
321
structure length
321
Chain Sequence
NAFQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPVNRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Chikungunya virus nsP2 protease
rcsb
molecule keywords Nonstructural polyprotein
molecule tags Hydrolase
source organism Chikungunya virus
total genus 87
structure length 321
sequence length 321
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3trkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3trkA01
2OKCA 3BZBA 3DLIA 3PTAA 1YF3A 2P3LA 5FWAA 1RI3A 3LDFA 3M6UA 1ZGAA 2HV9A 3PLAE 4RTRA 5KS2A 2B25A 2DULA 1P39A 4NECA 1YZ3A 3TPZA 1Z3CA 3A4TA 4FT2A 2FK8A 3KQOA 3M33A 4PYQA 4QVGA 3A27A 1WZNA 5BP7A 2AZTA 4WXHA 1FJXA 5CVVA 3HTXA 5MHTA 3FTEA 5FTWA 3HCDA 4V0QA 3HA3A 1I4WA 1WXXA 3M6WA 4PYIA 2Y1WA 5EKUA 4R05A 4RWZA 3BUSA 1ORHA 4R8SA 1L3IA 3DXZA 5CCBA 2OYRA 1MJFA 1G55A 4ER5A 1IY9A 1RJEA 4Y2HA 2ZFUA 1VLMA 3PFGA 4GOND 5ERGB 1SG9A 4QTTB 4A6EA 3TKYA 4YV0A 2R6ZA 4EVIA 5E2BA 3T7SA 3HVIA 3I58A 3QOXA 5CIYA 4RSRA 2EX4A 2WK1A 2Y1XA 1NE2A 3NVKI 5GOZA 1RJFA 2I9KA 1XTPA 2PGXA 2ZIFA 4M36A 5KQSA 1JSXA 1QZZA 2ORED 2XYRA 3DR5A 4X61A 1XVAA 5DM1A 4HTFB 4RTMA 4PYNA 2YXEA 2PWPA 3CJRA 3JWJA 4FS8A 3S68A 5EG5A 3VC1A 2C7OA 4GOLD 3GCZA 5DX0A 5P8WA 2AOUA 2V74B 3GJYA 3TFWA 4U7TB 4AZSA 1X19A 5FQNA 5E1OA 2NXCA 2FRXA 1NV8A 4PYMA 8MHTA 4LWOA 1YZHA 1O54A 2FCAA 2P41A 3FTDA 4YUXA 4DKJA 1IXKA 2AR0A 3DXYA 1ZKDA 3OU2A 4CTKA 1NBHA 4CKCA 5K09A 2ZBQA 2IH2A 5K03A 1QANA 5FA5A 2G70A 3B3FA 3KR1A 4KDCA 5CVJA 2ZTHA 1R8XA 2PKWA 3K0BA 3UJ9A 3NJRA 3FPJA 4YMHA 2BR3A 2PXXA 2IGTA 2B9EA 2AVNA 3GWZA 5F2KA 4ER0A 5HIKA 2F8LA 2ZZKA 3FUWA 3GXOA 3P2EA 1ZQ9A 1OR8A 5DRYA 5IH3A 4AZWA 2P1DA 1AV6A 4QDKA 3SM3A 2BR5A 3UA4A 5BW4A 3CJQA 4QTUB 4KDRA 1U2ZA 4EQZA 2AOXA 1UFKA 2K4MA 3Q7EA 2ZWAA 5KQRA 2PBFA 3FUVA 1L3BA 3EMBA 3SSOA 4M7RA 2AOUB 3CJTA 3NWEA 3G8AA 1EQAA 3BWBA 4MTLA 3LCCA 2ZSUA 3KQWA 3EVZA 4M37A 2LD4A 5EOVA 5G02A 1JR4A 3LBYA 5LR6A 3BXOA 3IYLW 4GOOD 5DM0A 3LKDA 5B1SA 3HA5A 5K0CA 3LHDA 3UJCA 5E1BA 2AN5A 2JHCA 5E1DA 5F2OA 2XVAA 4P7KA 3ER9A 3DH0A 5EEGA 5HIJA 5K0NA 5EC8A 5E1MA 1X1CA 5K0LA 4K6MA 5ICEA 2O57A 1KPIA 5K01A 2UYCA 5LQAA 4OX9Y 3PT9A 4FT4A 1FP2A 3E7PA 1WG8A 3BGIA 4OA8A 4RVFA 3UWPA 4GEKA 1X1AA 3HCFA 2YXLA 5D1HA 2FHPA 1RI5A 3NDIA 3UJDA 4RV9A 1FP1D 5K0JA 1VL5A 4E2XA 3ELWA 3KHKA 5FWDA 1G38A 3P97A 5CVUA 3TM5A 3O4FA 5HEKA 3JWGA 3B5IA 3PX3A 2I6GA 1XDUA 4OBXA 2BM9A 3MGGA 2ESRA 5EEHA 5DX8A 2JHAA 3R6TA 2OB1A 3TOSA 5LQNA 3R9XB 3EPPA 4F84A 3KPYA 2HR1A 1M0EA 5GWXA 4PCAA 2WA2A 2PY6A 1X1DA 2H11A 3C0KA 4PYJA 2IBSA 2PX5A 4PIMA 1VIDA 1XCJA 4IKPA 3T7TA 4C4AA 4CXMA 5BXYA 5F2NA 5IKMA 2AS0A 4ER6A 3GRVA 4FP9A 3FPEA 4BLWA 1ORIA 3GNLA 2A14A 4RVGA 2EG5A 1R6AA 1QAQA 2NYUA 1JG4A 4LECA 4X63A 5DTQA 1RJDA 5DX1A 5LQJA 1YFLA 5C1IA 4PONA 4RVDA 5FCDA 4RTPA 5EZSA 1AQJA 3E8SA 3G7UA 4KIFA 2P7HA 3G2QA 1YUBA 5DWQA 5EQJB 2ZBRA 3F4KA 4ER3A 5HOQA 3VSEA 4YUVA 3E05A 4L7VA 3KQYA 4BLVA 5H02A 4C06A 3MTIA 5ICFA 3UJ8A 4HTFA 9MHTA 1KR5A 2QM3A 3EVFA 5HZMA 5E8JA 3ME5A 3LGAA 3TRKA 4E2WA 3U81A 5KVAA 3FUUA 3HP7A 5M5BA 3FUTA 1RI1A 2PWYA 3KR9A 3P9IA 4HRAA 1B42A 1DUSA 2IDJA 2P7IA 1ZGJA 4KW7A 3ORHA 4HGYA 4KWCA 5C0OE 2VP3A 2OY0A 3ER8A 3ANXA 3IHTA 2VDVE 1JQDA 1P91A 4RTNA 3CCFA 3JWIA 1Y8CA 2CMGA 3EVCA 1BKYA 3LSTA 1WY7A 3LDUA 5HFJA 4KVZA 3ELYA 4GQBA 3HNRA 5EHIA 3DULA 2B78A 2C7PA 4YUZA 3P2KA 2H00A 1N7JA 2ADMA 1P1BA 3G88A 2PT6A 2UYQA 2Z6UA 1G60A 1TPYA 2EJUA 1KYWA 2YUIA 5EPEA 4XUDA 3EEOA 3BGVA 2O07A 2PV0A 4RTOA 2P40A 3Q87B 4GF5A 3UJ7A 4EKGA 2GAFA 3FPHA 2QYOA 3ERCA 3MB5A 3D2LA 1HMYA 4AX8A 2JG3A 3UJ6A 1KXZA 4ISCA 4F85A 4Y30A 3ELUA 3EVGA 4X1OA 2AOWA 3G5TA 5E8RA 4PYLA 1EAMA 5JR3A 3OU7A 1SKMA 1XJ5A 1SUIA 3MCZA 3C6MA 2ZZNA 1UWVA 3FRIA 4ER7A 3TKAA 1T43A 3FPGA 4GBED 5ICGA 4P7FA 3KKZA 5EIWA 2BH2A 3UZUA 3REOA 3PX2A 4FR0A 2ZBPA 4QQNA 2PT9A 3UJBA 4QPPA 1QAOA 4KIGA 1VQ1A 4PCLA 3R0QA 3PS9A 2CWWA 2G1PA 3EGVA 2ZWVA 4FSDA 2QRVA 2ZCJA 3BKWA 2DPMA 3BWMA 2IFTA 3FPFA 2GA9A 4YV1A 3BT7A 3VC2A 4V0RA 5GIPE 1JTFA 4AUKA 2B2CA 3DTNA 4HH4A 1R8YA 3AXSA 3QV2A 4U7PB 5EVJA 3SX0A 5K0GA 4RVHA 3EMDA 5LQRA 4HG2A 5E9WA 3EVEA 3SSMA 5T6BA 3B89A 4EKIA 1DCTA 2B3TA 1MHTA 3DOUA 3P9CA 2YR0A 5GM1A 3TM4A 4AZVA 1G8AA 1QAMA 1R18A 4FSXA 4RTJA 2FYTA 4LWPA 3OU6A 4BY9E 5EMMA 3DLCA 1KP9A 3FTCA 2UYHA 3P8ZA 2ONZA 1NBIA 4RTSA 3HCBA 2JHPA 1D2CA 3OZSA 5EZQA 1FPQA 2HMYB 3NMUF 1RI2A 4H0NA 4E70A 1JG1A 3CBGA 2NNWB 3CC8A 3IEIA 4PWYA 4B17A 3KPVA 5LQCA 2UZ4A 2QRVB 3GRYA 1XDZA 4E32A 4QPNA 4IWNA 3LCVB 1L9KA 2YTZA 2GB4A 3A7EA 5EMJA 4P58A 2GS9A 4RTKA 3G8BA 1I1NA 2G72A 3GRRA 3MTEA 4XUEA 4YUWA 4DF3A 1V39A 3ID6C 1H1DA 3OZTA 4GUAA 4QQKA 1Q0TA 1EJ0A 4GC9A 2G8NA 2VDWA 3B3GA 1KYZA 4C07A 3SXJA 1NW3A 3WSTA 2H1RA 4DCGA 1NW7A 3EVAA 1QYRA 5FUBA 5DPMA 5T67A 5GINE 1L1EA 4WVLA 4MWZA 3SMQA 2O06A 3C6KA 5FULA 3KPJA 3FTFA 5KYGA 2IIPA 5CD1A 3OPNA 3DMGA 1JQEA 2AN3A 4HGZA 4R6WA 2ZULA 3KR2A 1BHJA 5T64A 3LX6A 1XDSA 2IH5A 2NP7A 3EGIA 3TMAA 5DM2A 2BR4A 1AQIA 3PFHA 4Z2YA 2CMHA 4C05A 3TLJA 2I7CA 3HCAA 3E23A 2WA1A 5GIOE 5EKXA 3G2PA 4AZTA 1NV9A 3B3JA 4HC4A 5K8VA 2Z6AA 2N47A 3SVZA 5FHQA 2EJTA 3CKKA 3KQQA 3MCTA 4RTQA 5LSAA 3P71T 3B7PA 1O9HA 1X1BA 5HILA 2PJDA 3ELDA 1SUSA 2PX2A 4R6XA 1RI4A 3THSA 4UOEA 5DTMA 2AVDA 3OE4A 3RW9A 1EIZA 4PINA 2VZ9A 3JWHA 3FUXA 3K6RA 2PX8A 2EFJA 2JJQA 4CTJA 2HNKA 1PJZA 5LQUA 1SQFA 3HCEA 5DXAA 10MHA 4LG1A 1TW2A 5GP1A 5DM4A 1VP3A 3OE5A 5K0BA 2PXCA 3H2BA 3SSNA 1YB2A 3X0DA 3DXXA 4CKEA 5DRTA 1VP9A 2NXNA 3NDJA 2BM8A 3M4XA 1D2GA 3O7WA 5DT2A 3LDGA 3AY0A 4GC5A 3LECA 1D2HA 3G2MA 4RYLA 3TQSA 3VYWA 4BP1A 4E33A 4E2YA 4JXJA 4PGHA 1M6YA 3KQPA 4ATNA 1SQGA 3NVMB 3R24A 2JH9A 2GH1A 4HSGA 3EVBA 1EG2A 5D1NA 3KQMA 3P2IA 2OXTA 2IBTA 3EVDA 2ZLBA 4E31A 1XXLA 2NXEA 1DL5A 1KPGA 2GPYA 5DSXA 3KQVA 4OBWA 4CKBA 5E9QA 5U4XA 3GRZA 4E30A 1ZG3A 3MAGA 5LQKA 3FYDA 2HWKA 2PLWA 3RODA 5DXJA 2XYVA 5FADA 1KPHA 3T7RA 2C7RA 1RJGA 2IDKA 1FBNA 4FGZA 1IM8A 5C9ZA 3OCJA 3MHTA 5FA8A 3I64A 2E5WA 4PYKA 4F86A 1Q0SA 1KHHA 3RIEA 1L3CA 4CWAA 3M6XA 2CL5A 3C3PA 3KQSA 2NXJA 1PRYA 4POOA 2IH4A 1NW6A 3NWBA 3UA3A 3DP7A 5EIFA 1WS6A 3HVKA 3M6VA 5CVDA 3GGDA 1WXWA 4QDJA 1NW8A 2ZW9A 2PVCA 2PX4A 4DMGA 2C7QA 4MIKA 2Q41A 3A25A 1R74A 3LBFA 4OA5A 2P3QA 2P8JA 4G56A 2QY6A 3HVJA 3QOWA 4KRGA 4M38A 1N2XA 4C08A 4RX1A 2VS1A 3KU1A 1YFJA 5E2AA 3A7DA 5BW5A 4X41A 4ZTBA 4OQDA 1F3LA 3AWIA 5EHGA 4C03A 2Z6QA 4GOMD 3DMHA 5EMLA 1M6EX 2IP2A 2VDUE 4YUYA 2QE6A 4OQEA 2OPBA 2ZVJA 2UYOA 5E9JA 3OFKA 2YX1A 3IV6A 1G8SA 4DZRA 4FZVA 3HM2A 1KIAA 1N7IA 4YMGA 4EMSA 4PYOA 3EGEA 3KPUA 5HIIA 3OFJA 5DTRA 4E2ZA 3V8VA 4IV0A 2FK7A 3G5LA 2AOVA 4EK9A 5ICCA 3GO4A 4PGGA 3P9KA 2FPOA 4DA4A 2IPXA 4DCMA 3UBTA 3HCCA 3GU3A 3L8DA 2XBMA 5DSTA 1SVUA 3I9FA 1INLA 5K0FA 3LL7A 4MQ4A 4XCXA 4RTLA 2NP6A 2XVMA 3UJAA 4PIPA 2KW5A 3AJDA 2OB2A 3FRHA 3NTVA 3HEMA 3MERA 3M70A 4IV8A 2YXDA 3R3HA 4P7JA 1BOOA 5FHRA 3T0IA 3CGGA 3LCUA 2XYQA 1JG3A 3A26A 3P9NA 5EGSA 3DUWA 4MHTA 2ZZMA 3SGLA 1JTEA 3MQ2A 5HIMA 2O0LA 5EMKA 2YVLA 2AOTA 1JSZA 3PB3A 2R3SA 4R8RA 5GM2A 3O31A 1UIRA 3GDHA 4A6DA 4C04A 2V7EA 3SR4A 2P3OA 3HA7A 3BKXA 1F38A 3GRUA 5CUQA 4XUCA 1NT2A 1VBFA 3KR0A 3THRA 1JG2A 1EJ6A 4O29A 1XCLA 4P7GA 2ONYA 3FYCA 3KQTA 5JUWA 4BLUA 5FQOA 3G89A 1P1CA 1ZHFA 3I5UA 4DM3A 1R00A 3OZRA 3PVCA 3NW9A 3DMFA 1NW5A 4DQ0A 2PXAA 1TW3A 3HVHA 4PNEA 2OO3A 1G6Q1 5CVEA 3GIWA 2CKDA 2BZGA 3AXTA 3LPMA 5K05A 3FZGA 1JQ3A 3KPWA 2O05A 3G2OA 3BGDA 2YQZA 3CVOA 3BWCA 1BC5A 2AOTB 2ERCA 2ZIGA 2JH8A 5CCXA 3LKZA 3UFBA 4QVKA 2OBFA 1O9GA 1HNNA 1VE3A 2P35A 2AN4A 7MHTA 2I62A 3V97A 5CM2Z 4BP3A 4X60A 2ZIEA 1AF7A 2PSSA 5DLYA 3C3YA 1VPTA 3EEYA 3TR6A 2HTEA 1I9GA 3BWYA 2OZVA 3I53A 2G71A 4YV2A 1NKVA 5K0EA 2GLUA
chains in the Genus database with same CATH superfamily
3HHEA 2WRZA 1ZGAA 2HV9A 3EZGA 3ROZA 1J0XO 1GYPA 4IS3A 1QVWA 2B20A 3MQ4A 1G2PA 1TVEA 3QFHA 3TFOA 4DOMA 3HWNA 5JA7A 4JLUA 1VLZA 3VKVA 5IJAA 3MA0A 2G0AA 4Q00A 3ADKA 4YWHA 5BP7A 3KKQA 3NYRA 3RNLA 1C7QA 3CZRA 4DA7A 3CZ5A 3BS4A 3VZSA 4EGCB 2VKTA 3G7NA 1GPDG 4FOOA 1Y6QA 3C24A 3T4UA 4B5KA 2DPGA 3NC4A 2YZ2A 4E07A 2QAGA 3PD7A 3H84A 3N8IA 3ZDYB 2CF6A 2X58A 1GCAA 5JOQA 3K9BA 3CX7A 1NQVA 3ILHA 3NIDB 3QEAZ 1ME3A 5JQGB 1PD0A 3AHDA 4FMPA 1BAPA 4C5BA 1W59A 1KVSA 5IG2A 3LT2A 4NR0A 1I3MA 1JIXA 4RD1A 4RLSA 4ZTZB 1IQUA 4UE3S 1OW3B 3HKCA 5BYKA 3H6KA 3INRA 3L2OB 1A8QA 1DUIA 1II8A 2LWIA 2GJ4A 2OD9A 2RKOA 2WVGA 1FDOA 3CX6A 4DV7B 2O2JA 1G20E 1PGJA 3AI2A 5KQSA 3DR5A 2QOEA 3CG0A 3GJ8A 1V1RB 2QMZA 4PHFA 2FWPA 2C7OA 4TXLA 1HX7A 2IE8A 1QHFA 2FVYA 4MUBA 3M6AA 5F02A 1IFXA 4LYAA 3WLSA 3A6FA 4AQ7A 3W2HA 1C8BA 4GR4A 2ZJ6A 3RGGA 3WKCA 2WOOA 3L0IB 4YUXA 3DXYA 4IEFB 1I2AA 4YCDA 3T12A 2WR8A 2GVDC 5KINB 3CTPA 4E5NA 3BG5A 2CT8A 3VNQA 4CNQA 3QJYA 1EMDA 5L95A 2ZIWB 3SZLA 2EEZA 1M34B 1S5PA 3HYCA 3IDFA 1K7SN 1N6IA 4H3HB 4AJ2A 3M49A 2J4DA 2ZZKA 3W8FA 3P2EA 1DIOB 1ZQ9A 1HT0A 4Z1MA 1WB5A 1XF1A 4EG7A 2Q4EA 4PLHA 4B3IA 4D41A 4MNTA 4CF4A 3MJFA 3HR8A 1JI3A 3FJ1A 5A7HA 2ID8A 3BL6A 3GFQA 3I1FA 3C8MA 3RSHA 4B7XA 3G5AA 1NX6A 1PFKA 5BYBA 4EQZA 2CBXA 1JR3A 2K4MA 3CFYA 3G2JA 4Q05A 5KAMA 2Z56A 1EESA 2FOLA 1WOMA 3EBOA 1K08A 3PVZA 4IIDA 4RD3A 1PT6A 5IAJA 1K1EA 1LBSA 1NLMA 3IUJA 3OO0A 2CDBA 4HCJA 4JGIA 1L4LA 2VQDA 1KIFA 3KQWA 4N5LA 4Y6RA 2ZTSA 4JI6B 3WZ2A 3R9XA 3EUWA 5FWXB 1EDDA 5FWNA 5LOVF 2C61A 3IMGA 1D1SA 4WKOA 4UM5A 1SQ0A 1RHKA 5H68A 3E15A 3H13A 2F4VB 1B0AA 2JFVA 4HEJA 1OAKA 2FUKA 1H2ZA 2V4UA 4TLBA 3SJ7A 4XWGA 5K0NA 4D45A 3HV0A 1X1CA 4IAOA 2JFQA 4JNCA 1JAYA 1P7PA 4G1MB 3I12A 1X38A 1AUVA 2H18A 2BKAA 2NQDB 5ESDA 1S2OA 2HGSA 3RUHA 4ALJA 1Y8QB 2X2FA 2N1MA 3CX3A 4HGOA 4DV3B 4N3BA 4H7KA 1PG0A 2I4IA 3SHQA 4B8WA 4YP9A 2JIPA 1K8ZB 4JROA 1CYDA 1XU9A 3C4QA 1RIFA 2XUIA 1C4XA 1NXQA 4U9UA 3S8YA 5HEKA 3JWGA 4WACA 4A0QA 3H2YA 1Q21A 1UAYA 3A6GA 1ZUNA 1RADA 4WXPA 5B3LA 3O7MA 2HEGA 3EPPA 4YRLA 4F60A 1PBNA 2ZRGA 4F2HA 4ALLA 3ZK7A 4LDPA 5CDYA 1M74A 4M4SA 2QUHA 2FPIB 4G97A 2WMDA 4BFYA 3W5BA 4B5LA 4JLAA 1W2HA 1OH6A 4JS0A 3MORA 4EM6A 1WAMA 1K6JA 4JLSA 1B8VA 1R0XA 3LF1A 3NKVA 5MFZA 4ENQA 2P11A 5DHQA 3BSYA 2QLMA 5C7IO 4BFLA 3FTPA 3R4CA 4BVFA 4CEHB 2WG0A 1UH5A 1Z0SA 4HYEA 4XDZA 3D8NA 2DWUA 2ZE6A 4Q4LA 5K16A 1KAMA 5EYPA 1ZI6A 3Q7TA 2FR8C 2G1JA 3L06A 1I5OA 1W76A 4Y0NA 4WZBA 5JSQA 3WMGA 2IYEA 3Q7IA 5M29A 1F2DA 1YUBA 3SE0A 2X4LA 5EQJB 3WLAA 2E01A 3F4KA 5M7EA 4HO1X 4PRYA 5TLSA 3GNQA 2EV9A 5CURA 5DH9A 2J0SA 1NF8A 3RFUA 1ZDMA 3IT3A 4FSHA 4L4ZA 1RWQA 2K2QB 2CXUA 2YYAA 3ROEA 3ZQUA 3UKJA 1MNQA 1W2GA 2AH5A 4P81A 3TW8B 2I2FA 2XZTA 2YZMA 4LBZA 5EGNA 4K7JA 4P32A 1R3UA 2KQUA 1Q16A 1RWMA 3NI2A 4XYMA 3AFIA 2RH8A 3QW4B 4BTEA 4PADA 1L5QA 1A7JA 1V7QA 1ZGGA 2B4RO 3AEUA 5DULA 2GBCA 2AV6A 5HRCA 1AV7A 2GFHA 3FDXA 2OM6A 3AF3A 4KWCA 4MA5A 1H1LA 5C0OE 1GSAA 1XA4A 4WN3A 5J2TF 2XUOA 1ZWLA 4UCQA 1XAHA 4EA7A 1PJAA 2WU4A 3ANXA 5EKSA 1RWOA 5ISMA 1M5RA 3VX4A 3PSHA 3H5IA 5D3QA 4BYMA 5IK2D 3VOSA 1NYQA 1MUUA 4CV0A 4F04A 4PFKA 4JJAA 3C3MA 5CNKA 5IM4A 1XN4A 3N2KA 2HRBA 4OJTA 3W77A 4YUZA 3MC1A 4COOA 1EUDA 2EX0A 4PZDA 3ZH2A 1TPYA 2CJXA 5C5CA 1OT5A 4EHDA 1PJSA 3RC2A 5TPWB 4IRMA 1IDN1 4KOAA 2VWHA 4MUJA 3TI9A 4XXHA 4ZJPA 4R8LA 3NU1A 3NGLA 2PCJA 3ITEA 3MS7A 4UE2A 4ZAVA 3UENA 4DMFA 3R6WA 5LOVB 4ISCA 1ZHOA 1HLPA 4WXEA 4TZTA 1LZKA 4I3HA 1J8DA 4BNDA 2EF0A 4TMKA 1NURA 1V5IA 4JQSA 4U7DA 3PW3A 4EI9A 2WNSA 4OHFA 3D8BA 5CH8A 4EA9A 3TG8A 2VEDA 1PV4A 4NFHA 5BN4B 1TA0A 2RG7A 1VSBA 4HB3A 2IYWA 1X7WA 1JPJA 3EUEA 3KJZA 4L74A 1SXGA 4GPBA 4FMBB 4PCLA 3BFPA 4KITB 5AVYA 4PAMA 1DHTA 1IPEA 1R0ZA 1TCUA 3B1FA 4DA0A 4P3YA 4ZHQF 1LDEA 3BT7A 4K2AA 4MGZR 4ZDJA 1AQLA 4HWTA 2QJTA 4AZ0B 3MRTA 1DJPA 1UXIA 2BJHA 4R7TA 2B2CA 2QB5A 1OZFA 3DL4A 3N05A 3HMQA 3B7WA 1HT1E 2JFPA 1A8IA 3LUKA 3FOEC 4TZ6A 2O8EB 1OLXA 4G25A 3B89A 4KI7A 2GLXA 4FEGA 5CD9A 1GNPA 1XZFA 2BZSA 4Z1MD 2YWDA 1GNQA 1XQ6A 3P0FA 1QIDA 421PA 1KQGA 1QQBA 4Z4FA 1WXFA 1J8FA 1XRPA 4P16A 4QLAA 3ONVA 3KDSE 1G0NA 1MMFB 4NAHA 4XWTA 4FFSA 3L6CA 4JASB 4L0QA 1JEJA 1QNFA 3SIPA 4U6NA 3EHDA 1XTQA 1Y7PA 1M6HA 4ENVA 2QUIA 4TMZA 3OLCX 1WR8A 2W6ZA 1UKZA 2BLLA 2GM5A 1E2EA 4PZEA 2AEJA 3CB4A 4HLNA 3ZJYA 1D4OA 1IM2A 1OYYA 1Y80A 3KJXA 1NUSA 1ULSA 2I80A 2J59A 2JK1A 3PICA 5EXPA 3VR2A 4BE7B 1R6UA 2VF4X 3E82A 2C98A 2ZYTX 3EGXB 2Q1WA 3AP2A 3WMFA 3PBKA 3VOBA 1L9XA 3NORA 3OT1B 1IBCA 1IATA 2DC8A 4LNUB 3GVXA 4YQFA 3GFVA 1CZNA 1N92A 1QUEA 1YFZA 3L5OA 1JEDA 4TL7A 3L6BA 4ZCIA 2FEPA 3UMVA 1FLVA 1ZNXA 3C7TA 4I55B 4TL9A 1ZUWA 3WB0A 1E2FA 5D84A 2AUXA 4RO0A 1JFLA 4ITRC 3OP1A 1PT7A 1VM6A 3F6CA 1G8PA 1LLFA 2CWDA 2WWWA 4GYKA 4NZYA 3SYNA 4X64B 4DIEA 1R9MA 1V1JA 3OPNA 4IEIA 4W5HA 1NL3A 2OXEA 5KYYA 4PN7A 5CYOA 2JCGA 1K0FA 4PV7A 5J2TB 2B8EA 3PD1A 1UXHA 3JW8A 4JCOA 3EGIA 1JAXA 4DQUA 4V0LA 1N2JA 4JFAA 2XF8A 3QVXA 4X3OA 3DEYX 4FEYA 1UR5A 1O97C 1OJ7A 4R4JA 2FXVA 3QNMA 1C29B 3RV3A 2C95A 5E6SA 1UQTA 4R0NA 3V8NA 4UOEA 1GADO 3CWZA 3PIRA 4KL8S 3U4DA 5C1DA 3U7HB 3JQBC 1C0EA 2EYUA 3RFTA 1TYDE 3W6NA 3DAGA 3ONNA 4UTXA 5KNBA 4O3MA 3UF0A 2MSNA 3RB8A 1LNQA 4ZK2A 5A5VA 5CFLA 3X1YA 821PA 2Z0MA 2ZJYA 4Z4HA 2R4QA 3NDJA 2FP4A 2R84A 1N8KA 2RGNC 4Z99A 5H4GA 1Y4AE 3A2KA 1SN7A 5COBA 4INJA 4LRYA 4O08A 4DUPA 3ZHUA 3NUZA 3SJAA 1T6BY 4PGHA 1M6YA 3WKEA 1U1CA 2F9MA 2R5WA 3HU1A 3EWIA 2VXCA 1PX0A 1ULZA 1QYIA 4MW1A 3NGXA 5BSRA 1H5QA 3TN7A 2ZTVA 3SYTA 5GADl 4PO3X 3R7BA 3ZD7A 3I30X 4KV9A 2XUQA 4RMHA 4D74A 2A94A 1EX1A 5EMHA 3TQCA 3E3AA 4YRQA 1XEFA 3MAGA 1YRYE 2D0DA 1ODFA 1JDVA 1Y1QA 3HY4A 5TEWA 2APJA 4WUVA 2X9NA 1PS9A 1XL1A 2PZFA 1QCDA 5IULC 2ETXA 3FIJA 5K3OA 2B4AA 2E5WA 4NFLA 1PEYA 2QTBA 2JAHA 4QXPA 5FWYB 1D4ZA 3ZHSA 3V8EA 5CEEA 2A84A 2FX2A 3EGCA 3DLBA 2LKCA 3QKTA 4AMBA 2RGXA 2FFQA 1E4OA 2EQBA 4B75A 1PRYA 5ALEA 4J0CA 1E3WA 1DX9A 1YB1A 3EIOA 4GZ5A 2AA3A 3S81A 1MBZA 3O75A 4C4TA 1K98A 3HYRA 3LYHA 5CVDA 1P5ZB 4OJNA 1S8FA 3LYUA 3N2GA 1E1YA 4UEQA 3U9TA 3VYVA 4DMGA 1H2AS 5JALA 2P3SA 4NICA 4PTLA 2KM1A 4KRGA 1GSHA 1E2NA 4ALMA 6REQA 1PADA 3IQDB 4DCSA 5FJIA 3ZXXA 3GJXC 4LGMA 5HVNA 2F7DA 4ZJZA 2Q8QA 2B37A 2C0CA 5I7AA 2Z2IA 4IUBS 2XWQA 3L8MA 3LVRE 3NEYA 2QM8A 1XE3A 2HFJA 4MVJG 4RY8A 5JVDF 3M2TA 3GUUA 2HA2A 2UYOA 3QLVA 3VVLA 4EJ2A 3PDCA 1WU7A 4NYIQ 4EVQA 1G4UR 5AOBA 3HM2A 3KJGA 3TL3A 3DE4X 2P9CA 3P27A 1U9IC 4IGFA 4DRXA 2GF0A 3ERVA 2ZB8A 2Q3EA 2IDMA 3ACCA 3IBTA 4QHSA 4ZCRA 1MDFA 1UDCA 1RHQA 2W8BA 2JPDA 3ZXIA 4YJ2A 3M9XA 5TB5A 2R5FA 1QCZA 4HH3C 1XTRA 3T5AA 3HCCA 1BDBA 1HYBA 2ZJOA 4ONEA 5CDHA 4GPZA 5HBGA 2VRCA 4LWZA 3C8ZA 4Z5XA 2XVMA 3TNJA 2XF2A 3NYQA 4J03A 1L7NA 1W2WB 4PBSA 3MJHA 2Q5CA 3MERA 4P36A 1JYFA 3A9VA 3B2NA 1H9CA 3N1UA 3VTZA 2J31A 4RLFA 1KZ4A 4HRYA 5BSHA 3MTAA 3R9IA 3L7NA 1FEZA 3AP1A 4XB6B 1QIMA 5EGSA 1T8YA 1E1RD 2NO6A 4HFJA 4AXBA 1NVVQ 5B64A 4BB6A 5C4MA 1RKBA 2I8CA 1ACLA 1L5WA 1BE6A 2WMOB 4HLUC 3TLCA 3UMJA 3GAZA 3NRCA 1T2AA 2OP0A 2W2MA 1M2GA 3NBAA 1JHVA 5AVSA 1JEAA 3Q3EA 3D1VA 3QEBZ 3IQWA 3IUPA 3BRWA 2O3JA 3THRA 3P5WA 3JQPA 5EXXA 2PS9A 3ESCA 4P0TA 2YJ9A 3RS5A 4JEMA 3Q7SA 3W31A 1XQWA 3QW2A 1WMEA 2ZSEA 1RP1A 1YI8A 4FWIB 4KJXA 2H1LA 2GYWA 3QLJA 1KDZA 3CF4G 3IOMA 1GLOA 2IDZA 3HBLA 1H8EA 4BGUA 1AMUA 3CCCA 3HVHA 3O4GA 1GTZA 1R0YA 2ACVA 4ZV9A 1TZBA 3SLGA 2Q0HA 3OX1A 4L8WB 4DADA 3FNBA 2PQ0A 1C8LA 2IXDA 1G98A 3OPYA 1L4EA 5TMEA 3QIVA 1XMPA 2ERCA 2YDYA 4HXEB 3U4AA 4RQBA 2EKBA 4DMKA 3AG5A 2IPOA 3CTMA 4EY3A 2WHPB 3LKZA 4QM7A 4QRVA 1F12A 3INYA 3G8YA 1E1NA 2H7YA 1PPOA 5B7GA 1F9AA 1M7HA 4X1YB 3T1VA 3GRAA 1JT9A 1JEYB 4WH0A 1W1UA 4EUFA 4G3XA 3THYA 1Q3HA 2QVGA 3OQ1A 2GBIA 1RAAA 1RE0A 1WHTA 1QH8A 1YVEI 3FM9A 4Q8GA 2FNAA 2UUPA 2QL7A 3SI7A 4CF5A 3EWSA 3R3JA 2O14A 3P5UA 4JELA 4NECA 4R31A 1DPFA 3SZ3A 1STOA 1FFDA 4RF4A 3QQPA 3AUUA 1CT9A 2OC9A 2JIZA 1PDOA 1YQWA 3H7IA 4V3BA 1OFHA 3K7EA 4GX0A 5KNBD 5CU7A 3FNGA 4QXQA 3EJ6A 1XXHB 3OZDA 3FWHA 3BMOA 2BFNA 4HDQB 3T52A 4NMLA 3W4KA 1K9SA 1DGQA 3A70A 1NMXA 3CVJA 4KWIA 5JVDB 5SICE 4EEKA 5K0SA 1E5DA 4CLRA 3W9BA 2WSBA 4PHHA 3PFGA 1FFSA 1TL9A 1N6OA 1TTHA 4A6EA 1NN1A 3A3PA 3DHNA 2NAFA 2GN2A 2DGDA 4B76A 1JXMA 1KARA 3AR6A 1EVKA 2EBHX 4C0JA 4NY1A 1USUA 3CS3A 3ABQB 1MA3A 2MYPA 8ATCA 4M36A 3TBHA 1NNUA 4PWZA 4B3SB 3BB7A 2C4KA 3ESQA 2ZUCA 3U6KA 3KRTA 2CVPA 4IILA 5JROA 3HI6A 2HHCA 5AUPB 2QNRA 3H4MA 3Q4GA 4FE4A 5FQNA 2NAPA 4MWGA 1NXOA 4GMDA 5I9IA 1O4WA 3GIDA 4NPCA 1O7JA 4G5XA 4CKCA 1P3JA 4WERA 1O08A 3E1ZB 1XTTA 3KSDO 5ALNA 4N9QA 4FJCA 2HI0A 1XTBA 3JASB 4K03A 2HDNB 1IPHA 1TNDA 1XAIA 4KDCA 5ENZA 4I5FA 2VRNA 3TSOA 4DT1B 3U5TA 2GHTA 3R5TA 2XRMA 3T35A 2BR3A 4AMVA 5BMVF 3DMTC 4LDRA 3K15A 3OQMA 4ZEVA 2OAEA 3IHKA 2AUMA 4QDKA 1NKTA 1GPKA 1ADBA 1LI7A 1WXEA 1ZHHA 2W22A 1G5QA 5CM9C 4MS4B 4N47A 4PRLA 4ETMA 1A6RA 2MINA 4B48A 3N5CA 1C2YA 1EM6A 1PYGA 1QIKA 3KU4A 4NBSA 3D02A 5F5XA 2H9IA 3H2KA 1DKUA 1RKUA 3K96A 1PAUA 3MLEA 2ZSUA 2JBAB 4G65A 4CCYB 3HDTA 4JJGA 1SXJD 4H77A 5FOXA 1DJQA 2PUTA 2ZUWA 3MWDB 3VX3A 2NTVA 5KPJA 5FB3A 5H16A 3SQNA 1WP9A 3AI3A 3H5RA 2MIIA 2ZPTX 3W8RA 2JLZA 5AD1A 1UEIA 1BVRA 4OHZA 2WSSA 2XVAA 5A2GA 2BRUA 2JAOA 4NI5A 3OMLA 5HKAA 4YI5A 5E1MA 5FI1B 3RC1A 2HH5A 4TV9A 1KPIA 1CQIA 4AJ4A 1Z4MA 3M1AA 1JFRA 2C8KA 3WIVA 1GA1A 3K6SA 2XUJA 2ZETA 4PX3A 4CM7A 4NQRA 4YV8A 4GEKA 1Z8NA 3WKBA 4CG0A 1YB4A 3PNMA 4YALA 4URVR 1TK2A 3VPCA 1K5GA 1VL5A 2P9ZA 2ZRKA 4MAFA 3VR5H 1Z3IX 2B0CA 2R44A 1DT5A 2Y93A 1DOHA 1ESZA 4MS1A 3RU3A 3TRFA 2GZRA 4XM1A 3TM5A 3AF5A 2WUFA 5C8YA 5HOEA 3DG9A 4GNKA 1P9RA 2Q5JA 2YHAA 1U28C 5G1NA 4CRWB 1L4HA 3VXKA 1N2CA 5MN6A 4TMTA 3KQUA 4D9JA 1JHAA 4U0JA 5LYJF 1N0IA 4MJ3A 1AKWA 3ZI7A 3PU6A 4IIYA 4EUKA 2BONA 5FR2A 3TNFA 5CT4A 1P8AA 4ZQEA 3MWKA 2RAPA 4NAVA 3BWVA 5FPKA 4Q3NA 2DFVA 1NKSA 5FL3A 1EINA 4ZYUA 1NBMA 2J3DA 3B9RA 1OV4A 4JBWA 1A3CA 4FCWA 2QTCA 2VL7A 4IKPA 1H94A 1Y7TA 1Y1SA 4NL4H 3BMQA 3K1ZA 1HY3A 4ITVA 5C4IA 4W6QA 3OLVA 1H8ED 1Z6TA 3EPRA 2NVOA 2PLFA 3EQZA 3L0SA 4WKNA 4UVEA 3PSEA 4X63A 2PMBA 2J30A 1YFLA 2HL6A 3IUBA 1NR7A 3E18A 3IB3A 1Z4JA 4HYTA 5FTJA 4CF7A 1ADYA 4DR4B 3I62A 4IOLA 4C01A 2WJVA 1O6BA 2ZJZA 3DEZA 1QNLA 2VPWA 1HT3A 5J23A 4CIXA 5EWJA 5I3ZA 4EUSA 4BNWA 1A2KC 3E05A 2AUNA 3H18A 1GHTA 3F7TA 2DR3A 3B1JA 4EGSA 5DGDA 3UJ8A 1DQPA 4AO7A 1AKVA 1GQYA 1YB6A 4ZIRA 1BGOA 1DPGA 1Y4UA 2FPPB 3QPBA 4KQXA 4CEJA 4IKOA 1T2NA 4MVCA 3LGAA 4LC1A 4M55A 2XU1A 4P34A 1KJJA 3K8OE 2WM9B 4XJTA 3GL9A 3SZUA 1G2IA 3BXZA 4JAVC 3RBXA 1JQAA 3TE7A 5GZ3A 3IKJA 4K40A 2JLBA 3GH1A 1Y7IA 4KN6A 4QSHA 5D51S 2UKDA 1XUOA 1M2OA 2Q2QA 3L0DA 2AIMA 2ZP1A 5EMNA 2X2EA 1W34A 2XJ4A 5A5FA 5BUZA 2NVWA 2XZLA 2ZT5A 3KCQA 2X0DA 1A8SA 1NULA 1TMKA 3ICOA 3ZDQA 5KOHB 4Y1EA 3W2FA 2PNJA 3CCFA 2VAXA 2EGGA 3DOEA 4PBTA 1WVGA 4E2FA 1M76A 2AE2A 4ZVRA 3PX7A 1BDMA 1S2LA 4FX2A 3ZU5A 3VDMA 1C0LA 2MHCA 3OWXA 1JQ5A 4ETNA 1YNOA 4FJ1A 4WEOA 2PT6A 3ND9A 1L7XA 1SVOA 3LQYA 4N39A 2ARKA 3WFZA 5A4DA 3HDHA 3PEWA 4P3PA 2W2LA 4CDDB 3U4QB 3VO2A 1KJWA 3JTMA 1RWKA 4J1NA 3UJ7A 3JQCA 2IVFA 1YGYA 2QSUA 5C8VA 3FPHA 4WAUA 1FTGA 4BLSA 3ICEA 2IS1A 1CEYA 1PXVA 4EB6B 2I91A 2AD5A 4LFCB 3F47A 3CH3X 4EPVA 1IZYA 1EI9A 1TAHA 2BFDA 1ZJ5A 5EL0A 1MW9X 3WTBA 4ER7A 4L27A 1LX6A 2ZI7A 3U3MA 4ZJUA 1LPSA 1W36D 2OM2A 4O8CA 1FU7A 1HUQA 1THZA 1BXGA 1E6LA 1SPXA 3GRPA 1QC5B 5DYTA 5TX7A 4IIHA 2EKZA 4M49A 4OHXA 3SY8A 1QHIA 4BJ3A 3RTEA 2ZYDA 3CBKA 2GM3A 1SD2A 3EFHA 3I28A 4KIGA 4RY9A 3S29A 4CMIA 4GSKA 3VISA 3CNHA 3FMIA 3FKQA 2YWGA 3HPQA 3LSYA 1NRIA 4B3DA 5L4LA 1M2HA 3FPFA 3L8FA 3C7AA 5A4JA 1J7KA 1YK0A 1H2EA 4J16A 4Y6OA 1ISIA 3WOVA 2X86A 3H65A 5IKOA 1E6MA 1TZKA 3H6HA 2FMFA 1FW8A 3PHIA 4O33A 4R69A 4U63A 2FB9A 5JRDS 2FXIA 5IANA 3ZBPA 1C4KA 2O8CA 1XIVA 3NHJA 3QMMA 4M22A 1Y82A 4BXOA 2N0SA 2NLOA 2QIPA 1TFUA 2HIAA 3ZDDA 2XE7A 3OU6A 1ATZA 3ZWQA 5K4HA 2ATVA 5A02A 4PO8A 4Q93A 3N8NA 2BEKA 4Q4AA 4K28A 1DEOA 2FFAA 4KE9A 3UWSA 1C7ZA 3OZSA 5FPHA 3WLEA 3CZCA 1QB7A 3JZMA 1DBRA 4DWWA 4Z4QA 4CG3A 1WXQA 4D5GA 3ANSA 2HJVA 1BMTA 3DWEX 3MILA 1OA0A 2AMVA 1T9GR 3PPXA 3N74A 3CH2X 2CB0A 3PE6A 2TSYB 2DFKB 3PC4A 3F3MA 2WSSD 1E64A 3K0KA 4HAXA 4TN5A 4UE6A 4IZIA 5H3LA 4EB8A 1I1NA 4ZI7F 3DLHA 2O8BB 1ABEA 2UZ0A 3ID6C 4K9SA 4Q7EA 4JI3B 3E9QA 5KVQA 1WDWB 2F2TA 3VPAA 1KEZA 3ACDA 4IINA 4NCBA 1KYZA 5DHAA 4C07A 3J81A 2J87A 4OP1A 2C4TA 5LZ4A 1WBJB 5AW9A 2QTTA 3FCEA 3W2IA 1YMQA 3G2HA 4ED9A 3MIIA 3O1IC 1KRHA 1V5EA 4Y2UA 1QP7A 3FTFA 2AF4C 4Q34A 2NVUB 2VBIA 1DXOA 3VH1A 1CG6A 3W5VA 1TT5B 1Y1TA 3AV3A 3LUFA 4RADA 5T64A 1PFUA 1FFGA 3BN3A 4YFYA 1JNXX 3HZZA 3KYDA 5KB3A 4LV6A 2O3RA 2QMOA 3A6HA 4B3MB 1IOZA 3E23A 4XIGS 3GLHE 2XDQA 4JA2A 4YJGB 4CIAA 1N6NA 3GJ7A 4XWOA 1P5FA 4OJKA 2EJTA 2ZBFA 5FWAA 2GWHA 5EUQB 2JGKA 4CQMA 3C5EA 3QU7A 2WF5A 1XG5A 4Z9FA 5GVRA 3K2QA 4PINA 3FJOA 4U6QA 4K6CA 2XTAA 3JAKA 3ONWA 5DOZA 1A5ZA 1CVIA 1HSZA 4LRTB 3BBAA 2FZKA 4HB2A 5G41A 3OEYA 3K72B 4LG1A 4IHKA 3L84A 1N1MA 4IHQA 1YC2A 3F5DA 2QUKA 4L9WA 4RNCA 3B1VA 2WYVA 4JQCA 4V0MA 5EHXA 1KI6A 3DXXA 2QZPA 2FWJA 2IV2X 1VP9A 3PF9A 4DLWA 3EPLA 1GL7A 1L6IA 1TLOA 2BOVA 1T0PA 2ZYRA 3VZCA 3V6EA 3WV5A 3KVVA 1L5HA 2REQA 2PD3A 2BP7A 3CCBA 3PG5A 2EXXA 1MHWA 4EJ6A 4OSEA 4B85A 4GU5A 4XLLA 5E4YA 4JBLA 3U0BA 5CLQA 2I29A 1HTWA 3H3FA 1KQFA 2HH9A 3MXTA 1PZHA 4UVIA 2P5SA 2R1TB 4BMYA 3WWCA 4C4PA 3FSGD 2ZAYA 3NETA 4MUGA 3THXB 5IDXA 3NBFA 1BJKA 5AVRA 5U4XA 2IYRA 1FDRA 4RVOA 4E30A 2VHFA 1DFGA 2OXIA 1KS9A 4YMWA 1L7DA 1B15A 5BVGA 4YQEA 1QZUA 1NOIA 1YZQA 4P5DA 5DF1A 2XXJA 2YL2A 5C9ZA 3OCJA 4PLPA 4QRIA 3E9MA 3PC2A 4TQ9A 4KQFA 2OZKA 3OIDA 5A5GA 5KOIA 3EQ6A 3UT5B 4DIOA 2Q6IA 2C2YA 1A97A 1J8YF 1UL1X 2VEOA 1BFDA 3KSZO 1QDQA 3DP7A 3WYDA 5EE1A 2PTGA 4W5JA 1JHXA 2VDLB 3PZRA 2XADA 1IC6A 3H2GA 3EARA 4QDJA 5C31A 2PVCA 1MTOA 2A92A 4I9HA 5GPBA 5AVTA 3RNOA 4TGLA 1WPXA 5L3RA 1PT5A 2CJWA 4C08A 3C1TA 1QYXA 1GZDA 3KU1A 2XI4A 3TZQA 3WYNA 5BUSA 2BMDA 1RBZA 4LF9B 3HA2A 1R50A 3UJHA 4YH1A 3DONA 4MA0A 5EHGA 4PPYA 2CZCA 3DKRA 4LOHA 4C03A 5EMLA 1Y9AA 3UBMA 1CULC 2A1TR 3ZWMA 4UHDA 3FLMA 4ITUA 4B3HA 1P0MA 2WFZA 5JU6A 2V6BA 4N7RA 4H3VA 5D5PA 1HFEL 4KV7A 4YASA 3OFKA 4ZVTA 3GLIE 3V1TC 3HRHA 3OP4A 1IN1A 1ZICA 3DHEA 4A0HA 1B23P 1SVLA 2WKWA 2LV8A 3K5IA 3UEOA 4BQNA 5CA1A 2YY7A 3ETJA 3Q5GA 2ZU6A 4A8TA 3WGVA 1WPGA 1U1GA 1ABFA 4HAOA 1YQ9A 1R0KA 2AOVA 2EWVA 3IP5A 3C3KA 1U0NA 1W85A 4FINA 4LJ6A 4Q0MA 3P9KA 4C4OA 3STVA 1AO0A 4GKKB 5M2QA 4RIIA 1NAHA 1H2HA 4REQB 5I7WA 1DO2A 2QD5A 4BOUA 1VYTA 2IHZA 4YMSA 1WO8A 4ZOLB 3RROA 3UGKA 2OA0A 1Q0QA 3UJAA 1NBEA 4YHBA 1V11A 1IVNA 4G85A 2WKRA 1L5GB 3AUXA 2HO5A 4K0KB 1WUTA 5F3DA 4GMFA 5I9NA 2WUWE 3O83A 1PF7E 1J1ZA 1IXZA 4MKZA 3ZWWA 3AK4A 1NQUA 2RGBA 1FP6A 4KLRA 2CV2A 4WKGA 4LUCA 5TPZA 3H1PA 4YRFA 5HKKA 3AETA 4KNWA 4Q16A 2VH1A 3NAZA 3I8SA 1KU6A 4KRYA 4KQMA 1QWOA 1FNBA 3PZBA 3F2VA 3T1QA 1JXOA 3MJTA 1U0JA 1NT2A 5LQCA 1VBFA 2G83A 3PFIA 4JI4B 1QE0A 3LLCA 4LOAA 4YJFA 5HQ3A 3OTGA 4O29A 5DLPA 5T4FA 3WIEA 4B3TB 3R41A 4BB9A 4F0JA 3PHXA 5FQOA 3UATA 1ZHFA 4DM3A 4R3NA 4XKJA 1IK6A 1IWBB 4E5KA 2WV9A 1NDQA 2WZDA 1YBFA 3HYTA 1FK8A 2ZKLA 3OSUA 4L4YA 5GQSA 1TW3A 3S2EA 3PA6A 4YMUA 3O26A 4N65A 5TQ2A 4PG8A 4CM9D 4UATA 1XTKA 3MOIA 1DIRA 1UPBA 1NVAA 4EG1A 1G8FA 3LPMA 2WBFX 5ETJA 3OQ6A 4N0MA 2BHTA 3BK2A 3NJ4A 4KDFA 4DCVA 5JQWA 4U39A 3AVWA 1OX5A 4LY9A 4GD3Q 2OP1A 4MV7A 1Z2NX 1BQ4A 3KKPA 5EERA 1J7JA 4MINA 1BO6A 3EG9A 4IQFA 2FR0A 2Z83A 4O4LA 2ES4A 3AEKB 1GAEO 4A7PA 1Y33E 1N7GA 4UNPA 4H1HA 3W1WA 2COUA 1GNVA 1ZCAA 2FMHA 4ZYLA 2OGWA 4BS6A 4X20B 5CDTA 3W8NA 5U9CA 8ABPA 2ZUFA 3W5UA 4D3DA 1GTRA 1BRMA 1Z35A 3ABRB 3ISTA 2G71A 4HZGA 2RARA 1AHHA 1M2VA 4UXIA 2OCIA 1U4SA 4O4JF 3SFTA 3X1JA 4B6QA 1VL8A 5K0EA 2WG2A 4QREA 1KSGA 1YF3A 5F98A 3QUQA 4C1NA 3EFOB 1K6IA 1TU3A 4CW7A 3BQMB 3CIOA 3PQ6A 5KQPA 4BX9A 4DNPA 3MGAA 2OHOA 3GEBA 5G3YA 2V45A 3ZXUB 5JH7A 5G0WA 4EYSA 2YQ4A 3IMEA 3NT5A 1PV2A 1JKXA 2VUIB 1ZM9A 1GP2A 1VTKA 2P79A 4NESA 4XYEA 3NBUA 5ILGA 3OCVA 1X0XA 4P82A 4Y2RA 4UTPA 2QD4A 2YN4A 4MRMB 4C0AC 2J48A 4R05A 1A95A 3VU8A 3H7DA 1I33A 2ENUA 3DXZA 2GHQA 3ZY2A 5E0KB 1R0WA 4X66B 4XQEA 1LSUA 4X94A 3B52X 3DMNA 3MK31 1EAYA 4GGOA 4RHTA 4AJNA 1YH3A 2WWTA 4UOQA 1Z34A 2EJBA 4MVJF 1IUPA 1GGJA 2YJ5A 3E9CA 3OMWA 4YDRA 4AKSA 2FW8A 3NHMA 2G5PA 1C30B 1X87A 1UUFA 4ZMBA 1JP7A 2Q5IA 3RABA 1Q92A 2AXQA 4J0JA 4AS3A 2CNKA 1PHPA 3E84A 1YS9A 1QZZA 3DKVA 4KE8A 3V4VB 1XVAA 5BQXA 4O0LA 2Z2KA 1XQXA 3NASA 1G5HA 2DSNA 4FS8A 4ETIA 1CSBB 1BYUA 1RACA 5P8WA 1KEVA 3K0FB 2YMQA 3U16A 2VXBA 4FZ3A 5JAOA 2F1JA 5E1OA 1FL9A 4YP1A 5C8XA 1I32A 3AF6A 4GE0A 2DTXA 4MRSA 4DKJA 1GNRA 1ZKDA 2LDXA 1SK9A 4MVXA 3UWOA 4D3XA 1H6CA 3IB6A 3ITDA 4ZEXA 4NJMA 3OVZA 1T4CA 3DAOA 2OLJA 2WYHA 2LUOA 3E70C 1H0KA 4HGPA 4O02B 5CHVA 2WWVD 1PEDA 3F98A 3WIUA 5F2KA 2W6NA 4ER0A 5DIZA 4F6RB 3Q10A 5CBPA 1QOLA 3DTVA 5MFPA 1W0KD 4ZREA 1EB9A 3VPDA 1JA1A 2BSXA 3HJBA 2C88A 1FDSA 2BR5A 4X00A 4CM4A 3K5HA 4C3UA 1K5HA 1ZUD1 1SM4A 2MJLA 4MKFA 4DC9A 5BW4A 1TU6A 3FVRA 3QF7A 3IEKA 3S1AB 2PYZA 4P83A 1XDDA 3RYHB 1WE2A 2UZ3A 3EXFB 3CJTA 5FBLB 1ADJA 2B35A 3R09A 2WAMA 5A71A 3UW1A 1DADA 4GP6A 3VU3A 3D1LA 1L4UA 2HRZA 4LXUA 3S5UA 2W2VA 2UZ1B 2ACWA 3BXOA 4KQHA 4TRRA 4ZAWA 4G01B 3CX8A 3TUZC 1JLHA 4NIMA 1FUEA 1YZFA 3DHYA 5KPDA 5L3SA 4YCNA 4UBOA 2OORC 4B4WA 1PR4A 1CQPA 4CF3A 1B1CA 1U8EA 2B4QA 4WADA 4C4ZA 2W11A 4QH6A 2KE5A 1QHNA 2CZQA 1VGQA 1ZK4A 2C2HA 5GMOA 2B8TA 4RVFA 2XWJI 4CE6A 2GTIA 4HDSA 2GAOA 1VJDA 4D6PA 5KU7A 4RKXA 1T2CA 4Y9DA 1JE1A 3JQAA 1KWGA 1NVMB 3JQGB 4GRDA 4YRAA 4MR8A 3CN7A 3D7NA 1C1DB 5EUBA 3GCBA 2GGSA 1VHWA 2GK6A 1X15A 4C3VA 4JXXA 1O9BA 2DF8A 2M1XA 2OE2A 2WTBA 4QDUA 3SR0A 3SQLA 3WGJA 5HKKD 1E2GA 4N01A 4DPKA 4Q1DA 4K9NA 5DX8A 5PGMA 3IV7A 1TKCA 1EFHA 1K89A 4QAJA 1UMBB 2E6KA 2A0UA 2R87A 3ESRA 4PG7A 3W5DA 4CIBA 1FFCA 2JFWA 4MHSA 1KMMA 2PG3A 4G5QA 3RC8A 4PYJA 5JPDA 1LVHA 4PIMA 1N1GA 4MQFA 4IUDS 4IH9A 3T7TA 3LQKA 1Q91A 2JANA 1JDTA 1YL6A 5K3FB 4M9UA 5BXYA 5IDYA 1XEXA 4GUDA 1ZVQA 5BSGA 3FPEA 1E1MA 2B61A 2CMFA 2CLEB 2Q7DA 1RC1A 4XWYA 5EP3A 4CCWA 4ARUA 3D8TA 3ZE0B 5AM4A 4Y2TA 1WV0A 1RYZA 2DWCA 3I04A 4DIFA 1VJGA 3AL3A 5FCDA 4URUR 2HJWA 2Q5HA 3R7DA 4I8DA 5DWQA 2QT0A 4PS1A 3TOXA 1VL0A 2G0NA 3Q9UA 3SFVA 1E94E 1UAAA 3G0BA 1YOVA 1S2MA 3NCTA 1XRQA 4Z49A 3OZXA 3R3UA 1JS1X 1W4CA 2YJ4A 1U04A 3V8MA 5TRTA 4CYMA 3PGXA 3IA2A 5SZJA 5I7FA 2C2KA 4XGRA 4DR1B 4DUZB 1JAHA 4CVNA 3FBGA 2BEVB 5KVAA 1XFDA 2Y6VA 3C3BA 1Q5PA 3L1UA 2Y71A 4HQNA 4R1UA 4UTRA 1ENYA 3RTCA 4TOIA 2G63A 1WKVA 2R2AA 2XB9A 2DBQA 3QXGA 1AU9A 4KJZA 4NBWA 3OQHA 4RMNA 3CZAA 5ER6A 3VNAA 1IN6A 4GWKA 2FE8A 1O0BA 2WAYA 1N5JA 2FN8A 3JZIA 4BO7A 3AJ9A 4FKZA 1E2DA 4IP0A 4NYMR 1O57A 4WJKB 4Q9DA 4DUYB 1QDUA 4CJXA 4L8VA 3L6DA 4LTMA 1AGYA 2BGGA 3CEHA 3OCUA 1EWOA 2W9XA 1Y1PA 3OTOB 3F78A 2WU3A 1KVUA 2A1IA 2QN1A 4FU0A 2GZHA 3BJIC 4OQ4A 1ODIA 5K3SA 1R88A 3EOAI 1FJ2A 1V4NA 4NOLA 1CB7A 4RVUA 2EJUA 1LC3A 2I76A 2PD6A 1MORA 2E85A 3OBIA 4XUDA 1AH2A 3EOBI 5JAZA 3OUTA 1RXYA 4OL9A 3V32A 3DJYA 2FMKA 1R1DA 4FFRA 2VK8A 5CB4A 1UMDA 4AAYA 1C7RA 1TECE 1VSVA 1HSOA 1Z06A 1E32A 2FG7C 2E5LB 1GMYA 3ELUA 3AKZA 1YU6A 1WF3A 3NT4A 5DI9A 1M2JA 3TKAA 3T5PA 1VBKA 3FPGA 2ZI6A 4UNQA 4UUBA 1H3FA 1YBMA 5E7JA 1T1SA 2EW2A 2RK4A 1JDZA 2HK8A 4J4HA 4ZRDA 4ZZ3A 3AONB 3BL5A 4LXHA 1KFXL 2Z5VA 2ZBPA 3IULA 1YALA 2PT9A 5H0IA 4RE5A 3UJBA 2GILA 7MDHA 1IIRA 5KMGA 1E62A 4D46A 1LU9A 2JW5A 4MGYR 1II9A 1ISGA 2HGZA 4YQYA 2M2IA 4BZWA 2VHZA 4PRKA 5FUXA 2XQJA 1XA3A 2GNAA 1JHRA 2XHEA 3E3MA 1K8XB 2DVMA 3CUKA 1JIQA 1EVEA 5CNIA 3W2TA 2FJUA 1JLKA 2RG1A 4GYYA 4MWOA 5KHLB 4HH4A 1G0OA 3BRSA 4AD8A 1Z2DA 2ZEJA 1RRCA 4BV3A 1HFWA 1L4GA 2OCBA 1IRXA 3NTOA 5E9WA 4B43A 4DJTA 1N36B 4B7AA 1DCTA 2OAGA 4MDYA 1HLFA 3EGDA 4J9UE 3ZS9A 3PGJA 3DEAA 3P9CA 4O2AF 2XA2A 2JGLA 3LUBA 5D85A 1Q83A 1UBUS 1Z16A 4UZEA 4ZV4A 2OVFA 2G4LA 3J7TA 3LTEA 4N0QA 4RTJA 4J0IA 2P86A 5KBYA 2HBRA 4Y0VA 5JNTA 1OLSB 1CJCA 1ZZGA 4OFZA 4AECA 1GU0A 1MB3A 4LE0A 2FR1A 4KQCA 1M8FA 1EWTA 2Y27A 4A1OA 3FHTA 3QXJA 4A8HA 5KIAA 4KRXA 3Q3VA 4D6YA 1D6MA 1UJNA 3JR7A 4RYDA 4LSZA 1DIBA 3TL2A 2DMRA 4G8CA 1EHCA 4JL6A 2OFPA 1U0EA 4L9RA 2BE7A 3WRYC 1L9KA 1O95A 1RKXA 2GN0A 2VP5A 3BHMA 3IP3A 2B82A 4KQ1A 4OQPA 1JHZA 1MJGM 4HRVA 3UMCA 5KJCA 3DZJA 1C4WA 1MVOA 4X24A 1KH2A 1SC1A 4D1YA 1XK6A 4WHMA 4ZCSA 1Q0TA 3HL4A 4BOYA 4L8YA 4K87A 4ZAXA 3RIXA 1CDZA 5DHTA 1V8BA 3AFNA 1VBNA 1SA0A 5FBQB 1PEAA 2FN3A 1K6EA 4G1CA 1GRRA 3CRRA 1V3TA 1MQ9A 2ZR7A 4DJJA 3PLNA 4YR9A 1P0IA 3JQAD 5H4HA 4QOEA 2IUYA 3CO5A 4QUAA 3T0GA 1TYCA 5H8WA 5AVVA 4HI0E 1ZCZA 4ZDKA 4PLTA 1QF6A 3RJMA 2AN3A 2IYFA 4R6WA 4WZ6A 1ATIA 2RH5A 4RCYA 4O1IA 5AXBA 5B1HA 3CN9A 4U7HA 3OJCA 3GFPA 5DM2A 2QLLA 2OAQ1 1RAHA 1X13A 3ZHTA 2R4UA 2WJZB 1SD1A 4LHZA 3VR6A 3RUAA 2PVPA 2VTKA 2Z4TA 1FX0B 5LWQA 3K2BA 3G2NA 4XCVA 1E1CB 1FQWA 1XAGA 1DXQA 2CV0A 1O9HA 4BQPA 1NTOA 2JEOA 2ZSHA 1V9CA 3U4IA 2PX2A 5A0FA 1RXWA 4Z4GA 1IULA 1P1RA 3DF7A 1DE0A 4QG3A 5A4IS 4HBZA 2WU0A 3K6RA 3U44B 2CYCA 4NEGA 3CRQA 2HNKA 5EPUA 3U60B 2AI2A 2DC9A 2F00A 2FZ5A 1KBOA 2FSPA 2VTVA 3H2BA 4RF5A 3WY9A 1YS2X 5AKIA 2OO5C 3OTHA 5DT2A 3CNNA 3PE3A 1JIUA 4KACA 2WBLC 2FG6C 2Q3BA 2NSLA 1TVKA 3G17A 4M8KA 4MLCA 1BCRB 3UCEA 3P9XA 3PNRA 1BTOA 4A92A 2FOIA 2I4TA 1C7JA 3E9YA 2RK6A 3OZUA 4B2PA 1O6FA 3GP5A 3PKIA 5IJXA 4D98A 3A9TA 2QXTA 4RSMA 1W6UA 2HMWA 1CUWA 2ZLBA 3JQ7B 4R41A 2VXOA 3EWNA 3VDQA 3AQIA 3VHRA 2R9CA 4M54A 3A1FA 5IP5A 1W75A 5F52A 1Z45A 2Q29A 4RPKA 2HWKA 3GC6A 4UVDA 1MFPA 5CX1B 5HM8A 2XYVA 5D00A 5BNZA 3PNKA 5A9TA 1OH8A 5AHRA 1QJCA 5CAEB 1AGPA 4E22A 4KUGA 1JU9A 3TBFA 5AHKA 5HW0A 1NM5C 4Z4CA 4IMIB 2B8JA 4RSHA 2PYDA 4XVQA 5KHAA 1CNMA 1Q0SA 2X9VA 3LH5A 3D54D 3M6XA 2JLSA 4KG7A 1YV9A 1FP7A 4O2AB 4OK5A 3OESA 1U9CA 4D8WA 4WN9B 4ZHSA 1T9ZA 3ZDFA 2XVZA 4YI3A 4R9SA 5CYFA 1Q11A 2FPLA 3TAHA 2BGLA 3DFFA 3QWFA 5CK4A 3L0PA 4PO1A 4TZ0A 1FNMA 1UM9B 3K4HA 3GGDA 2BFEB 2BEUA 2H17A 2QUBA 2E48A 3V48A 3NNNA 2IOQA 3UYKA 3WBKA 4C2AA 4BQOA 3AZPA 1G5RA 1EHIA 2DPYA 4R5MA 1ZXLA 4C7OB 3Q12A 3EASA 2VS1A 4IM7A 3RSGA 2DTEA 2WM3A 1E3LA 5F64A 1NU8A 6YASA 4JJ7A 4DDUA 4AIIA 2NT4A 5E4TA 4QELA 1BGWA 1E9CA 3TLYA 4UUOA 1QIEA 2OPBA 4GXRA 3JVDA 1J99A 3WB2A 1XZQA 4KPUA 4GPAA 1OXSC 4ZO7A 4CZ2A 1H42A 5IAOA 3H8BA 3HSKA 4EFNA 1KIAA 3JZAA 4URHA 2PUAA 1Y8RA 3LU1A 4OB8A 5L40A 4OHRA 3PGVA 1DB3A 3G5LA 1JKMA 3BX1A 1CUVA 3OEHA 4GI1A 4BRUA 4D0NA 3DFIA 3H8SA 1T3GA 8OHMA 1XF9A 3DVAA 3L8DA 1SHLA 2BTQB 2HU7A 2XCUA 1ZGZA 1VLHA 3WK4A 1GNTA 2XNJA 3NB0A 3P5XA 1B6TA 1CVRA 4WNIA 1D9XA 3FRHA 2HMAA 3RTAA 1VL6A 2O2HA 1BOOA 1T0UA 3KTOA 4S35A 3SQWA 3EHEA 1OROA 1PR3A 6Q21A 1I24A 1ZEJA 3LKBA 4BQIA 3QF4B 2XE4A 1AQYA 2O0LA 1P1HA 2V8BA 2HSEA 3QLEA 3OY2A 4ZZ2A 4A6DA 3LW8A 3GNTA 1NI4B 4YDHB 3HCOA 5JTUA 3I5YA 3IUNA 2XQIA 5AUNB 5INTA 1NYTA 1OXBB 3HDGA 5T3YA 3RLIA 1S3SA 3PFCA 4RJLA 1RQPA 3CSSA 2WY2D 4MW5A 4ZO8A 2DBRA 1QPGA 3EDQA 4KXWA 4OMCA 1A5SB 5IM4F 1C0KA 1PWHA 2IXEA 1TEHA 2O1EA 1CRQA 1P1CA 1THTA 1C9JA 5BV0A 2NZXA 4MWEA 2C5SA 3DT9A 1PZFA 1CUDA 1O95D 5K6RA 3A9CA 1IU9A 2PN1A 2Q4BA 4MUNA 2PXAA 3DBHB 4FC7A 2AYOA 2J08A 3I0ZA 3KEMA 4RC9A 2W6MA 5BQOA 1OTXA 3AXTA 5LKAA 3NHUA 1M10A 3AP3A 4DDMA 3BD8A 4NP6A 4F3KA 4IGKA 1BC5A 2H65A 5CJJA 1TYBE 4Y67A 3DP9A 2C1EA 3NAMA 5CCEA 1GTMA 2P9BA 2IODA 3E7XA 5CPFA 4ZVQA 3BDAA 4EATA 5F9FA 3UJNA 3F5QA 2YC4C 1XFAA 5G4LA 5TGDA 4EX6A 3C2QA 4R9UC 1GQSA 4W1SA 5TY0A 7ADHA 2AUZA 3H2ZA 5J40A 1KI3A 2A33A 2GCIA 4BLQA 4BV2A 4P6GA 3S1LA 4W5BA 4GFDA 1GFIA 1K68A 4TKLA 1AG9A 1C1XB 2XT6A 3DMRA 2VJOA 4W7HA 3HBMA 4ZPXA 3VUFA 4YYEA 5AFSA 3WDKA 1PHRA 5HF6A 3ESXA 1MRZA 4WA7A 1ZJ6A 2OL4A 2FYEA 3KQOA 2HJGA 4JB2A 4DBLE 3R6LA 1GAXA 1WP4A 2WPDA 5U4QA 3BAFA 3RVRA 1PZMA 1QX3A 3I09A 2VJPA 3U3XA 3NIWA 3ELBA 4AROA 1U3DA 2IF2A 2PPLA 1ZSNA 4BFWA 3KC2A 4AVYA 4OXNA 1NASA 1G55A 1QQ5A 4P3XA 4GOND 1FDIA 4HNGA 5JMWA 3KWBX 3F73A 3FPCA 3EEBA 4G67A 1AB5A 1SZDA 2ZREA 2Q4RA 3AKYA 1QFZA 5DBFA 3T7SA 5EYPB 1DO0A 5G4KB 3MTGA 3U7JA 2IS2A 1XVVA 1JIIA 1ND5A 2RHGB 1THEA 4O1HA 3U8EA 1DLJA 4FGWA 2ZK7A 5EE5B 2Y76A 3KVOA 4XIIA 3LT0A 1X3LA 1B73A 4XVUA 5HYVA 2P62A 1MKYA 4F5DA 4D4GA 1QQTA 3D6AA 2A5YB 4OHMA 1B2LA 5ALFA 4A4DA 4MAMA 4AF8A 3ECAA 1UC5B 3B5JA 5CGZA 9ATCA 1DKLA 2MT9A 2VPQA 1R9GA 1CLEA 4TUYA 5HK8A 4DG5A 2O5CA 1T6ZA 1IWPB 3EGOA 1E3EA 3OPXA 1I4LD 1XRMA 3D3QA 3QV1A 2P41A 5LMNB 1JFFA 3EXHA 3OU2A 2E4AA 5KAPA 2R85A 1RMTA 1JQKA 1QX4A 2AJBA 5FA5A 4P5PA 2C96A 4KO8A 1H1LB 4YXWA 4LWQA 1G21E 4QBIA 3V6MA 3I9V6 2RGGA 3V7NA 3L49A 3LGXA 1AK1A 1EP1B 2W4MA 1PK7A 3MT0A 3OJ0A 4FMDB 3T9EA 3UC5A 1JFVA 4BNTA 5IBPA 8GPBA 2AK3A 1XLWA 4B09A 2QTVB 3BORA 4BX2A 1A1VA 4YJHA 7GPBA 4NATA 4QTUB 3M4NA 1ONNA 1QE3A 1UANA 1QG0A 3B6IA 2K7ZA 2PBFA 1MIRA 1E66A 2BGNA 3BF8A 1C7EA 4MTLA 3M5CA 1TKRA 3O8LA 1MABA 2WIGA 5AO9A 3ZIUA 1PDWA 2VNSA 2VJCA 1I3OA 1V5FA 3H11B 3KZOA 3LBYA 5HG0A 1Z28A 4KBYA 5B1SA 3SJCA 1ZESA 1WLSA 2MR6A 1N5MA 2IKSA 4BNDB 1B93A 4JB3A 4PLGA 3G9TA 3ZVLA 5T8KC 3OEHD 1VLVA 3USZA 1SXJC 1CF9A 4IXDA 3PUKA 5C7YA 1SD5A 4L6AA 1O94A 2BGJA 4L75A 4LF7B 1UAGA 1BA3A 2JBHA 4OUDB 4UNSA 5AKEA 4H08A 1OU4A 4C2BA 1XXHE 2FZGA 3W5IA 4BN0A 2V0GA 1MT3A 5HA5A 3TTWA 3DBLA 2HEIA 3VYRB 1XKGA 1X80B 3ELWA 4INPA 3NKLA 4MV3A 1VDMA 1EM8A 3I0NA 4JBGA 4TRJA 1MEMA 2P9QA 3A9UA 3B5IA 3BCSA 3WMRA 3DHVA 4EECA 1XPRA 4ENRA 1EFRA 4K46A 2BM9A 4IP3A 5B37A 1P2SA 3CMMA 3KLOA 5K3EA 3O2JA 1U0FA 1R4MA 5KUTA 4K5QA 4JC8A 4FE7A 2WTEA 2UUBB 3BJEA 2JD1A 5HCNA 1AUXA 1WPRA 1T26A 4I1UA 4CPDA 5A5DA 1D5CA 4XPIA 3AFOA 4MW6A 4TYWA 4RW0A 1XCJA 2DAPA 2BPOA 2HWXA 2QX7A 3KHUA 5DBOA 4BAUA 1FW6A 4YYQA 1MPTA 3QSGA 1O96A 1PGOA 2AS0A 2CVFA 2OCYC 1VG8A 4MKIA 4PLYA 2XRFA 2ZBUA 2NYAA 1U8CB 3FN4A 1YR8A 4M2LA 2B2NA 1JAIA 3RU7A 3RVNA 4BFVA 4XWWA 1PL8A 5CH5A 1ACMA 5F33A 3ZD9A 4AZ3A 4D8XA 4EYKA 4XIJA 1U94A 4G5GA 4C43A 2DQZA 3T7EA 4OU5A 5I01A 3I45A 1EK2A 1GDTA 3TSCA 2GZ1A 1E2LA 4WK4B 4QJIA 1BCSA 4G6ZA 1JLMA 2GZDA 1CDEA 1CUEA 1CR1A 2XEXA 3FPSA 4DFDA 4MW9A 4ER3A 1LK7A 2R8BA 2BCJQ 3Q9SA 5A3VA 3VSEA 4DDHA 2GD2A 1KY3A 4EMBA 3KX1A 3VAZA 4BEJA 3MTIA 2YYSA 4HTFA 2QM3A 3UMYA 1QFYA 1SVSA 4JLBA 1TJ3A 1UKVY 3PUXA 4LHSA 5HFNA 3T1OA 3W6UA 1JI0A 4AWAA 3TMPA 1EWVA 3ME5A 1PJ3A 5JS7A 2VF5X 2H63A 2NGRA 2L17A 4TXJA 1CJTC 4UD6A 1N6HA 3SJZA 3ETLA 4YJ2F 1TIKA 5JEDA 2J46A 3QKRB 2MR5A 3AR4A 3IUEA 4ROTA 3KKKA 4AK9A 1OE0A 4RVSA 4BBAA 5CDGA 1UXGA 3O90A 5D7NA 2ZJ8A 1P19A 2FLWA 4UULA 3ER8A 4LGVA 4EFKA 4NE9A 1U9XA 2ECQA 1JMYA 4JOSA 1DKPA 3JD0A 2NZVG 1PJRA 4YJKA 3AIIA 2LP4Y 1WKCA 3LDAA 2HF8A 3LDUA 4JDUA 2XEDA 4L3WA 3PCRB 1ID1A 3QVWA 1FUIA 4MKRA 4L8LA 1F5SA 4XRGA 4R1OA 1OXTA 5E6SB 3S3QA 1GCOA 2O6HA 3GAFA 2R68A 5HUHA 1W9MA 2CVHA 4FOTA 4C22A 1R15A 1P77A 3AHEA 3KFVA 2V97A 2VJMB 3IQXA 4G5RA 5C4GB 2FE4A 4DVJA 3BOWA 1D07A 1WMAA 3H9QA 3R5KA 1QU2A 1SUFA 4AC9A 2D4AA 4QUEA 2X4DA 4US1R 1IY1A 3H9UA 4G36A 4IZOA 3DV2A 5I7SA 2XCTB 1Y0BA 2QW1A 1LTQA 3RS3A 1FDTA 3G5UA 4EJFA 3FH0A 1G59A 4PSKA 4I5IA 4KFUA 1XJ5A 5JZOA 3C6MA 2LBPA 2XNKA 3MAJA 1AQUA 2RDMA 4LVNA 1I3NA 3QU4A 5IX8A 5CVTA 5JJLA 2DHRA 2IY9A 3V9AA 4CEIA 3DVSX 1U02A 4RXMA 4Y9SA 4BMCA 4CDFB 1JDNA 5AOAA 4H6XA 3DOCA 2GYYA 4QQNA 3MYRA 3VR4D 1KSJA 3F75A 1NXTA 4LWPA 4Q4DA 4DIMA 2V9PA 5D6NA 4Q7QA 1W36C 3NRJA 3EW9A 1WXIA 1FUYB 4KDEA 1U2DC 1ESMA 3H5OA 1KSFX 1I0ZA 1V4VA 3DL7A 4PY2A 1XDWA 4LV5B 4BVHA 1G7SA 1JILA 3WHIA 2OCAA 2IQIA 3RC9A 4AY5A 5EHQA 1Z75A 1SGWA 5EVCA 3LJKA 4Y2QA 4Z7OB 2G9VA 2WFLB 4I36A 5IEJA 4HG2A 5EIOA 3W79A 5DZSA 4S05A 2AJDA 4JOBA 1E0KA 2PJZA 2Q8NA 1NIPA 3A3KA 3ZV4A 4DWJA 4JLKA 1LTHR 4H2DA 2FEMA 4O2BB 1G8YA 2OVBA 3QWAA 4HDRA 1IZ9A 1R4ZA 1QO0A 1FUKA 3EQ8A 3ISJA 4NF2A 4UD2A 4UREA 4DEYA 5LMCA 1YULA 4H4DA 1GPNA 3N9IA 1T3SA 3U19A 2D1SA 2ZI5A 3N2GB 1JLRA 2M6LA 4GVLA 2BI7A 4UVGA 1NBIA 1KVTA 1MO5A 4RTSA 1XJCA 1D2CA 4JT8A 3ZU4A 4ARSA 2DH5A 4G9BA 1N8SA 1NQAO 1Z0ZA 3II6X 4ZVLA 5KNDA 1A9ZA 3CBGA 3GLIA 2NW6A 5LD2C 3ORFA 2PS0A 1F06A 3UH1A 1ZMBA 2X41A 4E15A 3OIWA 3REQA 1EDBA 1KL7A 1V47A 2AXPA 3A7EA 5AM1A 2O54A 4MHOA 2O3SA 2MYTA 1ISSA 1F0PA 2VC2B 4XDHA 2OHJA 1HF3A 5FPQA 3UC9A 3ODPA 4LYEA 4DF3A 4GUAA 1SXJB 1O94D 4FNAA 4M9ZA 3RAGA 4UQOA 2NX2A 1PL6A 3FBTA 3ORQA 4IS2A 1D04A 1GFWA 4RPIA 4RABA 5EJ6A 1JQPA 5I8PA 4UFPA 4D42A 3C3WA 1L1QA 1HYEA 4HH0A 1GPLA 2O06A 2YBEA 5EJAA 5LM3A 2YCBA 1Z0JA 5AM5A 1H2RS 3TK1A 5BSTA 3ZKAA 5CFMA 3PIIA 2GKOA 5IVPA 1NZJA 4AS2A 1BHJA 3NEAA 4B6PA 4ZUXU 4OQXA 1AUQA 1LQTA 5JJKA 3PJGA 3DAPA 1YT7A 3AG6A 2EFHB 1S8NA 2O4CA 3CWQA 2JA2A 5FRDA 2VPZA 2YCLA 2E4ZA 3JWPA 4KKVA 3MCTA 3L9XA 3SOPA 2VUUA 2WJ4A 1H23A 5T4BA 4BP8A 1XD9A 1HMPA 1SIUA 3RHFA 4BVKA 3H6GA 4RJIA 1UPTA 2GM9A 5HE8A 1MAAA 4F1WA 4DLLA 1C8VB 1CDOA 4ZGWA 1Q50A 1RFGE 4I5DA 2SECE 5K3DA 1JEQB 1PUIA 1GUFA 2OKGA 3H4VA 1VA4A 4O6VA 1UOOA 1VP3A 3TD2A 1EU1A 1ORDA 2X8WA 4QYIA 4G89A 5LZ5A 2POQX 3CNLA 3RFXA 4D8UA 5K0BA 2J07A 1C9DB 2GHIA 4RF3A 4CKEA 1I3KA 1NNLA 1WSDA 4JJIA 1RT9A 4FHEA 4GC5A 3L8EA 2R79A 2ZBGA 4LN1A 5JAHA 3T3IA 4RY2A 1HTTA 4G4JA 2SCUA 4OXIA 2WE8A 4TV8F 1FLDA 3FOFC 2O5VA 4WOKA 1KY5A 5H7XA 3ZZ1A 1FVFA 5TEVA 4E4YA 1SQGA 2QZJA 1WD5A 2P0RA 1PWYE 1JIJA 4JYPA 1AZLA 3EVBA 3FAZA 3W78A 2BVNA 3EVDA 3I9KA 1C1YA 4RL4A 4RLQA 5TR9A 1GNSA 1OASA 3QUAA 3KOWA 4A03A 2Z84A 2OLKA 3BGWA 2CK3A 2WW8A 1CEQA 2VVTA 2J5KA 3FR8A 3MJRA 3N0TA 2WWGA 1HYGA 2F1HA 1O5IA 1RQNA 2ECKA 2QORA 1I4DD 4LE1A 4TV9F 4ZP1A 2WJGA 5AR1A 4HN2A 4TT3D 2Q50A 4QXOA 5JSKA 4Y7DA 5DHPA 4AO6A 1TJYA 1NVTA 3HFSA 1RJGA 1FBNA 1B1AA 4LOLA 2D0OB 1SC6A 3QWIA 4JVSB 3PT2A 1MAHA 2XNHA 2IU4A 3GGGA 4RH0A 2HF9A 1EUZA 3HO6A 3L7BA 3RIEA 3RS7A 3M2PA 1GZUA 1G3RA 1L5FA 1LVUA 2C4MA 2FWAA 1CETA 3I0MA 3ND8A 5IVHA 1U2QA 3ZWAA 3OI7A 1IL0A 1SOAA 5DN6A 4UAJA 2GASA 3GZNA 4QNMA 2HD4A 2DKNA 4ENPA 3ENZA 1Z08A 1CB0A 2CB9A 3AJ8A 3JWEA 2B7BA 3N2IA 4KYIB 2WF7A 1KDRA 1KO5A 3D0RA 4LYHA 3VAAA 4ALKA 1HKUA 2M9MA 4J90A 2DX7A 5F3WB 2QY6A 3OVXA 1EZZA 2O2XA 3G13A 3AVPA 3I9OA 1EBBA 4MKXA 4JWKA 4YUAA 1TJPB 2BTOA 1JR2A 1XV5A 4WFJA 3KVNA 4X41A 3VZQA 3WL5A 4AB1A 4HEA1 1EVJA 3CLTD 4HQKA 1V6SA 2O7VA 1XDGA 2XKBA 4UAUA 4V03A 3TZKA 3ZNOA 5CBKA 3HN6A 4QM6A 4MCAA 2J6CA 3ZW9A 3TJZA 1SWVA 5JLJA 3LUPA 1TEZA 1GCIA 5KKCA 2FA9A 2HY7A 1KFEB 4XD2A 4D0LB 3TIIA 3DFZA 3C7CB 4KMMA 3A31A 4X93A 1SG0A 4LV8B 4CR8A 3VZPA 4F21A 2JRCA 1XYVA 3P0JA 4UNIA 1A9TA 1Q3TA 2FPGA 2JJMA 1YUNA 3I2JA 3HJCA 1W36B 5AJZA 1XDBA 4OL0A 1PEKE 1ZINA 5IDWA 2XU3A 1MO6A 2VOJA 2E00A 2X9LA 2MSKA 1IJBA 1JJ7A 1ZXBA 3D59A 2NP6A 4RQUA 1U98A 1JHQA 2VQ6A 4GHWA 2G5GX 1JGTA 1OYVA 1TPZA 2YXBA 3PWSA 3ENVA 4NMWA 4U1RA 2HK9A 3OCYA 2PKRA 1LWNA 4FYIA 1GNLA 4P0PB 3IDZA 3KOYA 1NBAA 4A73A 3IXLA 3LUAA 5FXMA 3NHRA 1P0PA 4PG4A 5EJ9A 3H1TA 3RAFC 3EMVA 1F2TA 4QU5A 1IOVA 1YB7A 2XGGA 4L5JA 4TWRA 4O63O 4AMUA 5JHGB 4OEMA 1QH1B 2WAXA 2JIQA 4DG8A 1YCGA 3GWGA 3ICCA 3OBBA 4RPJA 1JR6A 2BFPA 4KXMA 4WK6A 5B5SA 2PIAA 3AR5A 4F4JA 1GGMA 6PFKA 2AFHE 3RTBA 4FWTA 4KWTA 1SOVA 3K0EA 3ZDXB 1XCLA 2OYSA 4QGSA 1FFWA 4HQOA 4UAVA 2B7CA 3PQ2A 221PA 2MINB 5AKZA 2PU5A 3PVCA 5NULA 5LD2B 2BU3A 2VAVA 3HN7A 3K0CC 1DO8A 3BH7A 4UDOA 1GCBA 1KZ6A 5BWCA 5B4TA 2YIDA 4IVQA 4LY0A 4TV8B 1RRPA 4II7A 4AXMA 1ZP6A 3OJXA 3FSEA 2BZGA 5CLGA 1JL3A 4M0WA 4BU0A 1IM5A 5ADHA 3CLKA 2AHRA 5KTNA 1W5EA 4IZ6A 3OETA 1HO3A 3PPVA 1ZVVA 5AESA 2GM4A 2PX0A 3KD3A 2GPTA 3JZDA 4HF7A 5ALVA 1ZVKA 4FFVA 1AUPA 1ZJZA 2JI9A 4NJOA 2Q6LA 2OBFA 3WQQA 5AW7A 5HZKA 4W9MC 1HG1A 3V2IA 3K6SB 4DZTA 2P27A 2VYVD 1RXVA 3O8RA 4YIKA 4UUQA 4U9HS 3HJFA 5JQGA 1AGRA 2ZWIA 4F91B 2L18A 4AJ9A 4B87A 4HVAA 2NXWA 3BJRA 1KYIA 1DWPA 2BDLA 5T3UA 3IJ5A 1XZ8A 3BZBA 1E1QA 1YJAA 2DRIA 3DLIA 2G5CA 2V96A 3KXIA 1RI3A 3LVBA 3NATA 2CFRA 2I3GA 2WWHA 3R0JA 2FETA 4KQIA 3PDHA 5EIBD 3HDVA 2LCIA 4RAQA 1OUMA 3S2SA 4B4OA 4F72A 3OHPA 2JKVA 4C0XA 5CA0B 1N6KA 2OLEA 2HHNA 3DM5A 4H3SA 1JVNA 1XALA 3K9GA 1V1RA 1VKHA 1GGHA 2C29D 2HZBA 3E2MA 4DDTA 3UUFA 3E4DA 4A6PA 2JCYA 3R3XA 2OP3A 3C3CA 4PYIA 3SMVA 4LJ4A 1FOEB 5FBRB 1O0SA 1JQBA 4INZA 2NZYA 2XYHA 4X45A 4DMRA 2WJIA 5J63A 1DTWB 3GUVA 4FW9A 1TAUA 3QYJA 4FLMA 3TWOA 4P6EA 3WGUA 4DCUA 5B2EA 2UXCB 5CVNB 1JE0A 1E6KA 1XZHA 1M34A 2Q6TA 2DZYA 3LI2A 2CUTA 3B9BA 4PHCA 3DB2A 4IHAA 3K4QA 5KQLA 3HBNA 3T3OA 2CK3D 2PWAA 4AKIA 4UBLA 3PNQA 5IC5A 2ORED 3WL8A 1LX7A 4YLEA 5IBQA 4ZIRB 4WA8A 3DAHA 3RF7A 4X44A 1AX9A 5LQDA 5HWSA 1LBTA 3K4PA 1A77A 1A72A 3GLGB 5FOUA 2CLFB 3VOAA 1I80A 1XD8A 4GP9A 3PYLA 5FWXA 1N2BA 3HMKA 2JA1A 1BN6A 1M2OB 2QL9A 5CM8B 3EIFA 4F38A 3C6BA 2Z9DA 5DN6D 2C5FA 2K87A 3D9QX 4TVBA 2HPAA 3GNSA 3K0BA 3PC6A 3RPEA 4OB7A 4FGJA 1KI9A 1ZK1A 1Z4PX 4WX2B 2X5JO 1TE2A 5DNWA 4RMGA 1M1ZA 4BJ6A 4AZWA 3RVMA 1M6WA 1FNSA 2FX3A 5FR1A 3KQKA 4ACAA 3EE6A 4BGVA 3F6BX 3IPYA 4A15A 1AKEA 2QZZA 4LKRA 4W1QA 1CU1A 1TOAA 2HRQA 5H9WA 5KQRA 3WJ1A 3IVAA 4EKYA 1DBQA 2AOUB 4QYWA 1E99A 4NCAA 1NT4A 3QP9A 1ADFA 4IJUA 4EOGA 2XA1A 5KNCH 4M37A 4V2IA 4MITA 5DNDA 2QRUA 3I4CA 4AUNA 4DRYA 2B94A 2C9MA 2W37A 2Y0BA 5TQVA 1QRDA 4IFBA 2AN5A 3V1MA 3TQQA 1Z83A 4P7KA 3UHFA 1I2MA 5EEGA 1CY8A 1EYZA 1RSZA 2DUMA 4MKHA 1AMNA 4Y1RB 3SKVA 1E2QA 2JIRA 4CLXA 2O57A 4NNPA 1U8XX 1YDMA 1SOMA 1EDZA 2I6TA 3N86A 3T6KA 3KXPA 1UDBA 1BU5A 4R2LA 1GLVA 3A2LA 4XTCS 1TAQA 3F7NA 3GZJA 1BW9B 1P4GA 1SK8A 4CEHA 2Z2XA 4EG4A 3WRXC 3IAEA 1AKNA 4FN4A 5E2IA 2NMVA 2UZAA 1J1UA 1ITZA 1VJVA 1AECA 4LAFA 1QPBA 4HDMA 3V7UA 1Z38A 3IIIA 3O4FA 1TXGA 4IH4A 1MC5A 3PDFA 3NFRA 1N77A 2C59A 3OEED 4E7PA 1U0BB 4OBXA 2VO1A 1B0ZA 4I1VA 1OFTA 1R8QA 3E35A 3FYSA 4OH1A 3GCWA 4V1CI 2ZRCA 3D6HA 3SZOA 4Q02A 3L46A 3AB7A 3TW8A 4DBVO 1OB5A 2PMEA 3IT0A 1EUCB 3DLTA 2A1UB 4C6TA 1Z2EA 2BDZA 1IHDA 5F3RA 3NRBA 2AYYA 4RDXA 4BNIA 1Z6GA 4KVAA 4Q3BA 2I1WA 2X1MA 3LHFA 2Q5EA 4M1EA 5AK0A 1KJQA