3TRKA

Structure of the chikungunya virus nsp2 protease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
321
structure length
321
Chain Sequence
b'NAFQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPVNRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nonstructural polyprotein
publication title Structure of the Chikungunya virus nsP2 protease
rcsb
source organism Chikungunya virus
molecule tags Hydrolase
total genus 87
structure length 321
sequence length 321
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3trkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3trkA01
2P7HA 2P35A 3PFHA 1SKMA 4X1OA 3PB3A 2H00A 5FCDA 2ZULA 3DH0A 1VP9A 4PINA 3G2PA 4R8RA 5EZQA 3EVAA 3DXYA 5LQAA 2PXCA 1YFJA 3BT7A 3LBFA 2H11A 1KYWA 1ZG3A 3TR6A 3UBTA 4PGHA 4KDCA 2IH4A 3D2LA 5DX8A 4R6WA 3TM5A 3F4KA 3BWYA 4KIFA 3G2OA 4GOMD 5LQCA 5B1SA 3E8SA 1O9HA 3M6WA 3UJCA 1ORIA 3G8AA 5CVUA 1O54A 2AOUA 1JTEA 3B5IA 5FULA 5C9ZA 2JHAA 2Z6QA 4YUZA 1XCJA 2ZCJA 3MAGA 4C06A 3ANXA 1UFKA 2OYRA 2YVLA 2CKDA 2AOUB 2V7EA 1KPIA 2AOTA 3MTEA 3AWIA 5EQJB 5K03A 3VC1A 3HA5A 2ADMA 3EVCA 3FPFA 4HGYA 4C05A 1QYRA 4EKIA 2NYUA 3C3YA 2BR5A 2AOTB 1ORHA 3SVZA 1D2GA 5K0NA 1F3LA 4FGZA 4NECA 3HNRA 5DX1A 5E9JA 4X60A 1XDZA 2AN5A 1R74A 4PYJA 4RTOA 4BP1A 2GAFA 4PIMA 3M6XA 3NDIA 4KVZA 3SSMA 3G89A 2HNKA 2I7CA 3G2MA 4AZTA 1U2ZA 2Y1WA 4XUCA 2DPMA 5FHQA 5DM2A 1EIZA 3HCEA 4AZWA 3GWZA 5LQKA 2EX4A 2UYCA 4WXHA 2B25A 3OCJA 2OO3A 4RSRA 4YV0A 4QDJA 3G7UA 3K0BA 4GBED 3EEOA 2PV0A 2FK8A 3FPGA 3MB5A 2B2CA 3DMFA 5LQJA 2ORED 4BLUA 5EC8A 3SSOA 2NNWB 4RYLA 3I64A 3GJYA 2FK7A 1X19A 4P7GA 2O05A 2XVMA 5DM1A 4DZRA 5K05A 1WG8A 4O29A 1JG1A 1FBNA 1JSZA 3R3HA 3RW9A 3QV2A 9MHTA 4QVKA 4AZSA 3T7SA 3R6TA 1NW8A 1QAQA 2JHPA 1JQ3A 2YQZA 4L7VA 1PJZA 3DUWA 5C1IA 2HR1A 4RTMA 5K8VA 3MHTA 2HWKA 3FUXA 5DXAA 5LQNA 3TKAA 2HTEA 3HVJA 3P2KA 1NW6A 4E70A 3AY0A 1HNNA 3NMUF 2G1PA 4FT2A 2QRVA 3G2QA 1INLA 3CJQA 3A7DA 1FP2A 3GRVA 3CCFA 2PX8A 5DT2A 2AN4A 3EGVA 2ZW9A 4E30A 2IBSA 4CKBA 2BZGA 1VE3A 3T7RA 5M5BA 4C4AA 3LDFA 2QRVB 2P1DA 4XUDA 3UFBA 3GU3A 2G70A 3I9FA 3LCCA 3O7WA 3P9CA 2PX5A 5K0LA 1KIAA 4R6XA 3BWMA 5EMLA 3UJ8A 3UZUA 4LG1A 2NP6A 2PBFA 3PX2A 3NWEA 2QM3A 2GB4A 1RJFA 5P8WA 3P8ZA 1JTFA 4BLWA 3LHDA 3M4XA 4KIGA 2DULA 2P40A 4BY9E 2AVNA 4AX8A 3DR5A 3P2IA 3BKXA 3ERCA 2IP2A 4P7KA 1G8AA 3LECA 5HIJA 3OPNA 1JQDA 3GRYA 1YUBA 3DLIA 3IYLW 3HCDA 4E31A 2AVDA 4QTTB 3DXXA 5E1OA 4KRGA 3R9XB 5GM1A 2ZBPA 5K0GA 4FR0A 2VDVE 4MQ4A 4X63A 4OA5A 4G56A 4KW7A 4CWAA 1P1BA 2NXNA 3FUTA 1KXZA 2OY0A 3RIEA 4ER0A 2ZVJA 1BKYA 1JR4A 1XDSA 5CCXA 4H0NA 3UJ6A 1P1CA 1RI5A 1VLMA 4EMSA 3KQPA 2YXLA 1RI1A 5LQRA 5BP7A 1NW5A 4M36A 3UJAA 2I9KA 5GWXA 4DKJA 3HVHA 5E1DA 4YMGA 1ZGAA 3MGGA 2BR4A 3HA7A 4C04A 1R00A 3ID6C 3PFGA 5F2NA 3KU1A 2GH1A 4GC9A 5FA8A 3HTXA 1N2XA 3SM3A 3LKDA 3FRHA 4RTPA 2XYRA 1G38A 4X41A 2NP7A 2JHCA 3KHKA 4CKCA 1FJXA 2PWYA 2AOXA 3KQMA 5D1HA 3HVKA 1R8YA 3LKZA 5E1MA 1RJDA 4EQZA 5DX0A 3TKYA 4MHTA 1JQEA 5IKMA 1QZZA 4M38A 4F86A 2PXAA 5KQSA 2ZZMA 5T67A 2FRXA 4MWZA 3TOSA 1QAOA 1KPHA 1X1AA 4PIPA 2ZIGA 4P7JA 3TRKA 3BWCA 2P3LA 2YUIA 1L9KA 3C6MA 3OZSA 4HTFA 5EEHA 2CMHA 5EZSA 3UJBA 5K0FA 3BXOA 1KP9A 2B78A 2YR0A 5E9QA 5FA5A 2H1RA 2FYTA 3RODA 3Q87B 4E2WA 3PVCA 3NTVA 4HTFB 3NDJA 5F2KA 4RWZA 3B3GA 3HEMA 3MCTA 2XVAA 5CM2Z 5FTWA 1WS6A 3TFWA 4EK9A 3FRIA 2ZBQA 3A25A 1P91A 4OQEA 2BM8A 2FPOA 3KQVA 5GOZA 3EVEA 3FTDA 3DULA 2OZVA 3GRUA 2BH2A 2K4MA 3THRA 4YV1A 5EKXA 3SX0A 2VS1A 4YUVA 1EQAA 3KQTA 4RTSA 1WXXA 5HOQA 5EMKA 3CC8A 3GRZA 1KHHA 5DRYA 3SR4A 3VSEA 4GF5A 4FSXA 4XCXA 4XUEA 3ME5A 2IFTA 5FQNA 1H1DA 2R3SA 3FYCA 1FPQA 1I1NA 3DTNA 4JXJA 4HSGA 4P7FA 2I62A 1EAMA 1VP3A 5E9WA 1YZ3A 4OBXA 5T6BA 3X0DA 4FP9A 3EEYA 3KPVA 3CKKA 2EJTA 3LL7A 3L8DA 3HP7A 1AV6A 3KPJA 1BOOA 1O9GA 3LDUA 5EIWA 3C0KA 3I58A 1T43A 4DF3A 1NBHA 1I9GA 1RI4A 3T7TA 2ZZNA 4HRAA 2XBMA 3BWBA 3CVOA 1JSXA 4HG2A 3HM2A 3UA4A 3S68A 1EG2A 4F84A 1SG9A 3WSTA 1G60A 1WZNA 4IV0A 1UIRA 3KR0A 3IHTA 2PX4A 3B7PA 5FQOA 5HIMA 2PXXA 3P9IA 2ZTHA 3O31A 4ZTBA 3BKWA 4RV9A 1Q0SA 1R6AA 1SUSA 3LSTA 5EG5A 5EIFA 2PWPA 4E2ZA 3BGIA 2ERCA 5DTRA 5E2BA 4CKEA 1ZGJA 4B17A 3PTAA 1L3CA 2PJDA 4R8SA 3SMQA 2V74B 1VL5A 3BUSA 3OU2A 3Q7EA 4QPPA 4RTQA 3KQOA 5LSAA 2XYQA 2BM9A 1NT2A 5DSXA 1F38A 3LX6A 5EHGA 5FADA 2ZIEA 3OU6A 3THSA 4HGZA 3CJTA 2YX1A 5GIPE 2NXCA 5CD1A 3CJRA 4GUAA 2G71A 5E1BA 1DUSA 3V97A 2O0LA 3GXOA 2VDUE 3MQ2A 1JG4A 3PX3A 3PS9A 5EPEA 2NXJA 4X61A 2OPBA 5EEGA 4YV2A 1YFLA 2G8NA 4DA4A 1DL5A 3GDHA 2HMYB 2LD4A 3JWGA 4RTLA 4HC4A 2P3QA 3DMGA 3DLCA 5KS2A 3OE4A 3UWPA 5GINE 3B89A 3LCVB 4CTJA 3R24A 3TPZA 4UOEA 5BXYA 5F2OA 2PKWA 1L3BA 2VP3A 3A7EA 4LWOA 5FHRA 4AUKA 4M7RA 4QPNA 1TW3A 2IH5A 4DCMA 1D2HA 3EVZA 3OU7A 1KR5A 5EGSA 5GIOE 3KQYA 5GM2A 2UYHA 3E05A 5EMMA 1KYZA 3KR1A 4ER6A 1RI3A 4GEKA 3HVIA 4DM3A 2B9EA 2ZWAA 4RVDA 2IPXA 4C03A 1HMYA 5DM4A 2ZFUA 4GOLD 5EHIA 4WVLA 5HZMA 1XDUA 3NW9A 1M6YA 5KYGA 1NE2A 1RI2A 3EVFA 5ICCA 3FUVA 4KWCA 3M33A 2CWWA 5HIIA 4U7PB 4ER3A 4MTLA 3GRRA 5EKUA 2PY6A 4GC5A 2OB1A 5FWDA 5HILA 2IDKA 2PLWA 5DXJA 2EFJA 3QOXA 4PWYA 5ICGA 3GO4A 3P9NA 4QTUB 1IY9A 1IXKA 2PT9A 3FUUA 1PRYA 5DPMA 3EGIA 4GOOD 4LWPA 3ER9A 1VIDA 1NBIA 2BR3A 3ELUA 5LR6A 1M0EA 4YUYA 3DP7A 3FYDA 3VC2A 5DWQA 1SQFA 3KQSA 4K6MA 1XCLA 3E23A 3NWBA 1QAMA 3B3JA 3EMDA 3I53A 2F8LA 2C7PA 4POOA 2C7RA 4E32A 4PNEA 4PGGA 4ER7A 1DCTA 1XTPA 1TW2A 2C7QA 5CVEA 1L3IA 3FUWA 3FTEA 3U81A 4QDKA 3P2EA 4FSDA 4LECA 2OB2A 1NKVA 4EKGA 4FZVA 4CXMA 4ISCA 5E8JA 3C3PA 3CGGA 3ELWA 2ONYA 1IM8A 5D1NA 1KPGA 1ZHFA 2ZIFA 5K01A 1XVAA 5G02A 5HEKA 5LQUA 3FTCA 1EJ0A 3JWJA 5DLYA 3SXJA 4DCGA 4RTKA 4BP3A 5K0BA 1P39A 3UJ7A 3MTIA 4P58A 2I6GA 3OFJA 5DSTA 1R18A 3NVKI 7MHTA 4A6DA 3JWHA 5CCBA 5CVDA 5ICEA 3I5UA 1AQJA 3KR2A 4RVHA 1N7JA 3UJDA 4RVGA 2EJUA 1RJGA 1SQGA 3GNLA 5JR3A 2QY6A 1WY7A 3REOA 3UA3A 2ZZKA 5FUBA 5FWAA 3G88A 2UZ4A 2Q41A 3DOUA 3H2BA 5EOVA 2YXEA 4YUXA 3ELDA 5HIKA 3M6UA 3P9KA 2EG5A 1NW7A 1Z3CA 3LBYA 1BC5A 3FPJA 10MHA 3G5LA 4MIKA 2VZ9A 2GA9A 3NJRA 5KQRA 4PYKA 5DTQA 4YUWA 3ER8A 5CUQA 3M70A 1NV8A 5K0EA 2JG3A 3AJDA 2Y1XA 2OBFA 3EVGA 1G55A 2E5WA 1RJEA 3KQQA 3LCUA 3HCCA 2O06A 1JG2A 3AXTA 4PYNA 1L1EA 5K0JA 1BHJA 3OZTA 3QOWA 3UJ9A 2PX2A 4E2XA 2AOWA 2PVCA 2R6ZA 3LPMA 3O4FA 4PYIA 4R05A 4PYMA 5E8RA 1YF3A 3FTFA 2O07A 3OE5A 2UYQA 3EVBA 3OFKA 5E2AA 3A27A 3FPEA 5DRTA 3HCBA 4RTRA 4M37A 8MHTA 4V0QA 1B42A 4QQKA 3TMAA 3AXSA 4U7TB 3T0IA 2GS9A 1G8SA 5CIYA 4V0RA 3V8VA 1XJ5A 3ORHA 1ZKDA 3LGAA 4F85A 2VDWA 3TM4A 3PLAE 3KKZA 5GP1A 4FS8A 3DMHA 1FP1D 2GLUA 2KW5A 3FZGA 1N7IA 3VYWA 3P97A 4RTNA 2IH2A 5DTMA 3NVMB 3TQSA 1VBFA 1X1CA 1M6EX 1YZHA 2P3OA 2AN3A 5JUWA 4DQ0A 2HV9A 2UYOA 3A4TA 5EMJA 3DXZA 4HH4A 4RTJA 2YXDA 3FPHA 4PYLA 5H02A 5C0OE 3IV6A 5K0CA 2AOVA 5KVAA 2FCAA 1TPYA 3KPWA 1OR8A 1Y8CA 1X1BA 1XXLA 5ERGB 4E33A 4QVGA 3EVDA 2QYOA 3KQWA 3M6VA 3C6KA 1R8XA 1VPTA 1X1DA 3BZBA 5ICFA 4C07A 4C08A 4ATNA 4PCAA 5CVJA 3GGDA 5HFJA 4PYOA 2OXTA 4IWNA 1G6Q1 5BW4A 2JH8A 3EPPA 5IH3A 1UWVA 3P71T 3BGVA 1SVUA 2B3TA 4OQDA 1AF7A 2ZSUA 4OX9Y 3G5TA 1WXWA 2ONZA 3B3FA 4Y2HA 3R0QA 2FHPA 4FT4A 1NW3A 2AR0A 2PGXA 3ELYA 4BLVA 4E2YA 2C7OA 4ER5A 2CMGA 5BW5A 2JH9A 3HCFA 4Z2YA 1SUIA 2Z6UA 3SGLA 2N47A 3EMBA 4RVFA 2P8JA 2PT6A 1YB2A 3KPUA 4IKPA 4EVIA 4DMGA 4AZVA 3MCZA 1QANA 2NXEA 5CVVA 2XYVA 1Q0TA 1AQIA 4OA8A 4A6EA 4RX1A 4GOND 3HCAA 4Y30A 1I4WA 5DM0A 3KR9A 2ESRA 4OBWA 2P7IA 2ZWVA 3EGEA 4YMHA 2WK1A 2CL5A 4GQBA 5MHTA 5EVJA 4PYQA 2GPYA 2G72A 5T64A 4CTKA 5K09A 2Z6AA 3E7PA 1EJ6A 1D2CA 2IIPA 3PT9A 3MERA 2ZBRA 2YTZA 3GCZA 3HA3A 2A14A 2AZTA 3BGDA 3CBGA 4PONA 2O57A 1V39A 5U4XA 2AS0A 4IV8A 2P41A 3TLJA 3K6RA 2QE6A 1MJFA 2IGTA 2IDJA 3LDGA 1MHTA 2ZLBA 2PSSA 3OZRA 1ZQ9A 3G8BA 3SSNA 2JJQA 1NV9A 1JG3A 2WA1A 2WA2A 1VQ1A 3KPYA 3IEIA 2IBTA 3A26A 3GIWA 3JWIA 4KDRA 4QQNA 4PCLA 2OKCA
chains in the Genus database with same CATH superfamily
4D8WA 1NUPA 3TN7A 3QTLA 4F6CA 5EXEA 3KYCB 4RQUA 4FDTA 1SZCA 1PSZA 2FW9A 1C3OB 1NVFA 2Z2JA 3EHDA 1YU9A 2G5PA 4M54A 4E88A 4EFMA 3FSJX 1RQ2A 4HT3B 1G8HA 3G13A 4BZWA 6ADHA 2CMFA 2H11A 2FRQA 3WBFA 5FBVB 2JJ1A 4RF2A 2BONA 4RKRA 5JQWA 5H82A 5K4GA 4K6OA 4DVJA 2X5JO 4RW0A 3MWLA 2ZYSA 5FFFA 4EL5A 5KWVA 1QRRA 1VIYA 2BUAA 4FJ1A 5JNVA 4PTLA 2Z43A 4MVJD 5CMLA 2OPHA 4DUGD 1YJQA 2OVFA 3ORSA 3ZJTA 4JKYA 4DIOA 2AIRA 2Z09A 3WYCA 2OLJA 3BWEA 5ERYA 1TJPB 4BPRA 4K87A 1BWRA 5E6UB 1VMIA 1V11B 5EP1A 4JQZA 1LLFA 1G17A 4PX2A 1AGNA 1IY1A 2R6AA 4HGYA 2C5HA 3D3QA 3QXSA 4JVMA 1QYRA 5IF9A 2WIKA 2O2HA 5FBQB 2CNDA 1SXGA 2I2XB 4IV5A 4XDGA 2X7XA 2WKWA 3AF5A 4V0SA 2ZSDA 1GDHA 1HG0A 5E9JA 4UJ3A 2CJWB 4X60A 4GZLA 4XD7D 4EM6A 5C46F 1PUXA 3F1LA 1VRVA 2HPHA 4X8OA 4JI6B 2XRYA 4O25A 1QKJA 1Z4PX 4BB9A 2C77A 2BGTA 5AESA 1OXXK 3STHA 3MT7A 2GR9A 4R9VA 2HADA 2YBDA 2R7KA 4CW7A 5DN6D 1YOBA 5LU9A 5U9CA 1CW2B 1HX7A 1LV8A 2FW1A 1U8FO 4NLLA 3VVBA 1AA6A 1HLFA 3LPNA 3ZS8A 1NX6A 2PV0A 4Q4JA 5E6SB 2QL7A 1SXQA 3MB5A 4F3KA 4Q18A 3REFA 5EXTA 4E3WA 3AFMA 5KX5A 2H9AA 3DT9A 3GWGA 4R83A 4C9BA 1L6IA 2Y0DA 1EBFA 4XKJA 5AM3A 5DGDA 2XMBA 4K81B 1Z5WA 3AUUA 4MVJA 4PF1A 3HEAA 4P4GA 4UAJA 2OO5A 4Y2QA 4N5MA 5DM1A 1YR8A 4D0RA 1JG1A 2M1ZA 3S8YA 3CZCA 3RPEA 3E1GA 2YN4A 3L0YA 4B9AA 3IE1A 4OLBA 3ACBA 4NF2A 1TAUA 2C88A 3KWBX 4RU1A 3O8BA 1L4YA 4K9RA 3FUXA 2X5OA 3HKEA 1PLKA 4Q5IA 4RH1A 1M2JA 2J30A 2O7NA 3EA4A 3H2YA 4KGDA 4RELA 2EWMA 4KQ2A 5IYZB 1Y9EA 3GT0A 1KFEB 2KQUA 2JGDA 3A7DA 2REQA 2A0YA 4GG1A 1WJGA 1SG6A 2VAVA 2WKPA 4FC7A 4L5BA 2CDRA 1MOSA 4RUKA 5CJPA 5SYAA 5CDTA 2C07A 1H2HA 5KNCA 2FUG1 2R65A 1CY8A 2G70A 2ZSHA 5LOVF 3K9FC 4QQ8A 3GW8A 4DDMA 2O2YA 3BWMA 5JNTA 3MWDB 4QE3A 1C50A 2WAXA 5EJ5A 5LIPA 2PBFA 2P1ZA 1Q7TA 3SC3A 3GLHB 3PX2A 2QRKA 1V5EA 3SIWA 4EB6B 3P8ZA 3E0XA 3Q9LA 4S1OA 4Z86A 4ZT5A 2DULA 3IBGA 3QWBA 5EIBD 3WP1B 3TEFA 1L7AA 5K8IA 3OZUA 2F59A 3B1KA 1GLNA 1OLSB 3CZAA 2QXTA 1V95A 3DR5A 3JWPA 3BKXA 1HFEL 2ZB8A 2PWZA 2O19A 1XTUA 3OPNA 4M9XA 1GRRA 1OBHA 1ZP6A 2CYCA 3FPBA 4KQCA 2JGRA 1X7XA 5BNWA 8GPBA 1Y63A 1TMKA 4YAGA 4R7ZA 2QQEA 2G77B 1T9CA 2Z3WA 3INRA 1IG3A 3VR4H 2I54A 3JYNA 3F71A 1RHKA 2WTAA 4NQRA 3WRXA 4DJ5X 2W8ZA 1IE3A 4G5YA 4L51A 4KW7A 5KAMA 2HHAA 3CH7A 1XDSA 1WCYA 5MN4A 1I1QB 1OWPA 4URUR 3FWYA 1SUEA 5JQGB 2Q21A 4MB0A 5K51A 5CEJA 1C4XA 5F1KA 1WMBA 1FCJA 5CYOA 2R6JA 3AEKA 3OECA 1G3RA 4J1TC 2NQIA 1YR6A 3O95A 1Z4OA 5DMXA 4IY1A 3PW3A 1EFLA 1EA7A 2RB4A 1PNRA 4MTCA 4RH0A 4MHSA 1YI0A 1B0AA 1WVMA 4MI3A 3S3QA 2EVWX 3THXB 4I3FA 1LI4A 4IEEA 3LKDA 3CWCA 4JB3A 4MCIA 3SM3A 1N5DA 2J9XB 3E2IA 4H6VA 3GPDG 4LF8B 3FETA 4UPDA 4Q4AB 4NJEA 3GAAA 1IN5A 2WSBA 3DQQA 3GROA 2GESA 2X4GA 5JSYA 3F9RA 1MGOA 3D8SA 16PKA 1L5VA 2NAPA 4JT2A 1KHQA 1T35A 1XJWA 4IVQA 4M1SA 5CDFA 3JAKA 1ZRHA 2PUHA 1J8QA 3S70A 5BSKA 1P61B 2O7SA 2ZTUA 3JQAA 1JLLB 3LOQA 4MWZA 4QDTA 3CA8A 3EQ8A 1IOVA 3T95A 4AUNA 1BJTA 1LCIA 1TAQA 2ZSJA 1QCYA 3AJ8A 4BOSA 1L7NA 4WINA 4RESA 4ZP1A 3LLMA 1DLJA 1PDOA 2H1RA 2CLFB 2X9VA 2I1WA 4GXTA 3RODA 4B4WA 3RWOA 2RHLA 5A7GA 1Y5MA 3U9TA 3TZQA 3O8QA 2HDHA 5A7FA 5I9NA 4YCLA 4BMNA 2GF0A 3TFWA 2A9QA 3LH5A 3WNVA 6AT1A 2C7BA 4UUPA 4P34A 1Y5NA 4R2MA 4B3MB 2I2DA 3WGLA 1U2PA 3V5NA 2AL7A 2ZVPX 3OTHA 4FFLA 4D9HA 1VJDA 4IJWA 4NP6A 1OXBB 1XRLA 3VR0A 3WK6A 5CD9A 2ZUEA 1M2KA 3W3ZB 3OQVA 1USIA 1E6EA 3EDQA 4WBSA 2DTXA 1FMLA 3W4JA 5IJWA 2E4WA 2Y8EA 1MKYA 5FNVF 1NJ8A 2CHUA 4LCBA 3ZKAA 1YE8A 2ZIZA 5HPYB 4JXJA 5C8YB 1FPQA 5JDCC 1NI3A 3TG2A 5CCDA 3HL0A 1V0JA 3OQMA 2WKSA 1C14A 2IU4A 1COWD 1EUDB 2ZQYA 3I09A 4M1OA 3OISA 3OFSA 3WQRA 5CXXA 2D5BA 4PO9A 4B48A 5LJLA 2NO0A 3LLVA 1U0OC 2XTJA 1OAOC 1IHOA 4IKOA 4QGAA 2WYHA 4HNVA 2WHEA 5JATA 1SWWA 2O3QA 1VCHA 4C0LA 4E1AA 3JRWA 2RHBA 4FD2A 4MWGA 4O4JF 2NU6B 1D2AA 4EG1A 4M0EA 1W30A 2PFSA 3P4UA 5DE3A 3HM2A 1WQ1R 3QMPA 4PLHA 2YDYA 2POCA 5A5DA 5C7OO 3W5VA 4HEA1 3ZBTA 3AKDA 5HIMA 3DA8A 1V41E 3HCRA 4CMKA 2JFQA 4U8GA 4JSRA 4LX8A 3JQ8A 2WY2D 1Q0LA 3BKWA 1U4SA 4GGPA 4IDQA 4BS9A 2QLTA 3AERB 5DJ5A 3WNZA 4J2HA 4DDHA 1EK1A 1NF2A 1RYMA 2HLDA 1SOMA 5G0SA 4ZI7F 5CDFE 1IMOA 2BEWB 3AGQA 3F8SA 2F1JA 1VL5A 3BUSA 3Q7EA 3U1TA 5JMTA 3K4QA 2X8JA 4MJ3A 2EL9A 2WRZA 3TTYA 5JHGB 1F38A 2QV0A 4HGZA 4OXRA 5COAA 1WTCA 1Z0AA 4KH0A 5CD1A 4GUAA 2G0AA 5JRDS 2GDJA 1B26A 2OQRA 2WSMA 2O59A 4ZRDA 3SBOA 1D0VA 3MQ2A 2G7YA 1UJ2A 4JHXA 1I6LA 4XRGA 3KEMA 1SPXA 2NTEA 3GDHA 2CLKB 3KZCA 4BVJA 1BWQA 2M6RA 2I2CA 2WU0A 4Y6LA 3UVEA 2CUKA 2VFAA 4RABA 3USCS 4B46A 3DW1X 1WZUA 2O4CA 3V7WA 4B7ZA 3PQ2A 5AW8A 4W5WA 2P68A 2DHDA 2PKWA 4N9QA 1ND6A 1HLGA 3JQ7A 3H16A 1WULS 4FDAA 2DLNA 4D0GA 4Y6GB 4X6JA 3L3BA 3CVUA 3I9LA 2QZJA 4HYTA 5ALGA 4ABTA 4WXPA 4BGVA 1RAEA 3H5OA 4O59O 4PLFA 4GEKA 4D9MA 1TCUA 2ZE5A 4O2BF 4HNQA 5IM4A 4F5ZA 5IUKC 2ZFUA 1AQNA 2I03A 2R8EA 5ALRA 1I13A 1QIFA 2MSWA 4UMVA 1U31A 2H18A 4Q37A 1JU3A 5JSUA 1E4EA 2C2KA 4LHZA 1BMTA 1I1OA 4CCWA 4MTLA 2H48A 5KZMB 1V96A 2WPNA 5L3SA 1AHPA 3UT5A 3QW4B 3C1AA 5A02A 4ASUA 2QL9A 4F9FA 4NYMR 3KLMX 3WB0A 4RFSB 3I2IA 2G1AA 4P4LA 4HQNA 1XWFA 4JUDX 2VEDA 1NXOA 3A6HA 1GO2A 3O93A 5HWSA 3E23A 3FNQA 5HMMA 3EXAA 1YU6A 2R87A 2GBGA 5GY7A 4ESVA 2BHTA 2OZ2A 4Y8VA 1TM3E 2PA3A 3O2JA 3COWA 1HURA 1JFFA 1DC8A 1K8YB 4TMYA 1GU1A 4LJLA 3TYXA 1IUNA 4C3OB 2MSEB 4G4SO 3ZDDA 2LNDA 1UZLA 1C1XA 2GVZC 4G63A 1VC2A 1JB9A 3IV9A 4M46A 5J94A 1KKUA 4ISCA 4B0PA 4DR1B 5L8VA 1PYGA 3MG9A 3G0DA 1E94E 1VIAA 2BZ0A 3CB4A 1H1LA 2UUOA 4KNVA 3P9YA 3WHLA 3ER6A 1ZRMA 2ZPTX 3FTNA 3DF0A 4Z7QB 5AM0A 1F12A 2O2IA 4RIFA 3IV2A 4DCGA 1AKYA 1ETUA 1CZHA 1BXGB 1ISPA 1NLUA 3N6VA 4CBVA 4DCJA 5AKEA 1G8GA 4P58A 2QW1A 2RHDA 3SC2A 2QTHA 3P4YA 1C9KA 1LTKA 1J8VA 3R75A 4Y6SA 4MQEA 2PFKA 2X3YA 3RDPA 4YONB 3HFJA 3V48A 4W63A 2OAGA 4EMUA 2J46A 3ZWQA 5LWQA 4WMLA 3M4ZA 3MP2A 1JHRA 4MMYB 5IAEA 3REOA 2RBGA 1IHDA 3UA3A 3M3DA 1Z2PX 1RWQA 2Q3LA 2DBYA 3H2BA 5C52B 2CF6A 2EDAA 3IMEA 4JAVC 5C7LO 1VSNA 1MB2A 4EW3A 4P6GA 4DDUA 1Y1PA 3WXEA 1P3JA 3E22B 5SY4A 1J7KA 3G5LA 2ZRJA 3A6GA 2VZ9A 4MV5A 5B55A 4K6CA 3RF6A 4CEHA 3AJDA 5HJEA 1Z6ZA 4K9OA 1G55A 1IN1A 1N0VC 1NL6A 1GQQA 3WYBA 2WMDA 4DLWA 4CODB 1EDEA 4NS4A 1NNLA 3ZOKA 1MV8A 1YZVA 3I9OA 1Y7PA 3IHLA 4LOHA 3OZTA 3T4PA 4FIDA 5JY1A 1K0UA 3QOWA 4FQ5A 3UJ9A 4JS0A 1W9HA 2XKKA 1QQBA 2AOWA 4CTNA 4HHEA 1UZMA 2QZSA 4PYIA 5E4YA 2BN4A 2O07A 4J43A 3WLSA 4JJEA 5I8WA 3OA2A 5BMVB 3U1BA 3HXTA 4NZZA 4ZGGA 3J81k 1G8YA 3IGFA 4MKIA 2BI8A 8MHTA 2IP1A 3BB1A 1TUBA 1S4QA 4U7TB 5KWJA 1ZCMA 4ALLA 2BL4A 4D81A 1TF2A 4W7SA 4ZAFA 4URWR 2JLWA 2WVAA 4PSCA 1Y1RA 4I55F 4BWGA 3H17A 1VHTA 4YWHA 4DOMA 5EMHA 2PWAA 3HJNA 2VDWA 3HXOA 3N3KA 1QC5A 2D1SA 1UOOA 3DE6X 2QI9F 3J81A 1N5IA 2MR6A 3OUZA 4YP9A 2COUA 1SMKA 2VHYA 4FINA 3I5MA 1CK4A 4R3DA 3ZN2A 3I30X 3HNOA 4YWJA 4BV8A 2C92A 1ZR2A 4N5LA 2UYOA 3BPSA 3IALA 3ZV5A 3FPHA 3HWRA 4KO4S 2XUPA 1JQPA 3RV3A 4GI5A 2IZOA 1NPTO 1U6KA 2AXNA 2BKEA 1E58A 1ECGA 1TPYA 2DE0X 3CPHA 3O2QB 1X8JA 4OH1A 1FYEA 1RKXA 2QMZA 4ES6A 4PFJA 1NVMB 3EVDA 2GEDA 2WMYA 1N2HA 3DP9A 1OKKA 1N8TA 2I91A 4ZU3A 3A6LA 4XIFA 4MICA 3I1IA 3IUTA 2OGSA 2NW6A 2PG3A 3BXGA 1GPYA 4B6GA 2JFOA 3W9SA 3T7IA 5JAZA 1K7SN 4L27A 5IH3A 3QFCA 3TBFA 4OQDA 1AF7A 2I3AA 1U11A 1SCKA 2BFCA 1K5DA 2E55A 2UZ1A 3JSAA 2X0DA 4I1VA 4F4UA 2X8WA 2Q2VA 3KEOA 2XQFA 2P91A 3ADOA 3E7DA 3ELYA 4BQQA 4YPVA 1E5QA 3KVVA 2WF9A 2OESA 1XL0A 4CE6A 1SO8A 2X3UA 4TL9A 3AR8A 2HGZA 4O4LA 1GPLA 5G3YA 1AS3A 1BD3A 4FGSA 4QRXA 4FDUA 1L5KA 1AQIA 2OULA 3IB6A 4NOJA 3HY4A 4RCZA 2X5KO 1B8OA 1LUAA 4G41A 3FG9A 1H2RS 5DM0A 3KR9A 5KNCH 4B7CA 2HCBA 2UZJA 2X19A 2ZWVA 1L5GB 3OIGA 1ZLYA 1NWHA 2GPYA 4MVCA 4EYOA 2VNIA 4AJ2A 3P0FA 2OWDA 3WYGA 2BTQA 5KJFA 4FKBA 3BGDA 4NNOA 4FSHA 4N01A 3U2QA 1F51E 1QB7A 2PRJA 2ZDGA 4S0ZA 4HNTA 4IV8A 5FAKA 3F98A 3AEZA 4NICA 4GVXA 2FQQA 4LRYA 4JLJA 1UZAA 1ZESA 2NUPB 1UPUA 1YD7A 2ZBGA 5JROA 1QE0A 5U1PA 2WF5A 5KOHB 2O8FB 3KYCA 4LVNA 4TV9B 1TO2E 3B3QA 4XWOA 1CEEA 4L28A 2WG0A 4ZT2A 5K3CA 1OREA 2PCLA 3H3FA 3EG5A 3MRVA 3PB3A 3I9V6 4X92A 1DTEA 5KYUB 3K9HA 1WNFA 4FBGA 4J9VA 4ZJUA 2Q3HA 5L7TA 2JAPA 5EIAA 3QBVA 4AZ0B 5HYVA 1OT5A 2WR8A 3SYKA 1AOXA 1EKXA 3GGCA 1NDQA 1XU9A 2EP5A 2MSNA 3OQ1A 4YYSA 2O8VA 5C7YA 4N3BA 5FI3A 7REQB 1O5IA 3VZDA 4R6WA 4KFRA 3HRKA 4KIFA 4PNHA 1K2VN 1DU4A 1RQLA 5C31A 3GHHA 3PFBA 1P0IA 3BIWA 5A4KA 4OQMA 5JCPA 1L7OA 4JA0A 4QASA 4RMHA 3L8YA 3TSYA 4OL0A 1UZUA 5E6UA 1V11A 4H59A 1CUZA 5FL7A 1T6XA 3P5WA 3KT0A 5T4HA 4YUZA 3V4ZA 3WISA 1HZZA 1GKUB 1M34B 3MEQA 3HE3A 3STXA 4OG2A 4I8DA 4R1NA 3OTQA 5I7UA 2BEKA 3IJRA 3V55A 4GRAA 1FVXA 2IU0A 3L43A 3W1EA 1NG1A 1JBKA 1VGVA 2AD5A 2ZKIA 2O8BB 5IVKA 2JCVA 1RLMA 5ALJA 3SC6A 5DHSA 1QGZA 2NPOA 3C43A 4MVJF 3DWIA 5DM60 4QODA 5LMUB 3EH2A 2RGNC 1JLRA 3F6YA 2GAFA 3TD6A 1ZNWA 1XA4A 1YQXA 1NVVQ 1ZCBA 3NDIA 1GPAA 1PJRA 1KI7A 4MIYA 4OGLA 4UU7A 3C5EA 3GFPA 5AVJA 3V6LA 5TGDA 4ZVRA 1A4RA 1LDMA 3DDSA 3NNSA 1RADA 3NAGA 3BA1A 3WLFA 3EG9A 3TVDA 5E6SA 4AZWA 2PUWA 3OWXA 4WXHA 1SK8A 1YQEA 2BF4A 2RJOA 4OXXA 4QDJA 2QVBA 1MAWA 5EZ6B 2ZRLA 3I8OA 3DE7X 4J7AA 3IDQA 4JXKA 1OVGA 2Q62A 2Q7XA 3TR0A 2EQ5A 2C8KA 2QD4A 1T0BA 1T4GA 2HMTA 4E1BA 4YP6A 1WUHS 3AWDA 3AHFA 5KVCA 4ZAGA 2W83A 2I66A 1X13A 1WWKA 5EP4A 5M04A 3N2GB 2DLCX 3PU6A 5IXJA 1QXPA 1W36C 3STVA 1S2LA 2IY7A 3ZC3A 1G59A 4U9UA 4AZSA 3T7SA 4CZ2A 1P1HA 2JHPA 2HR1A 1N34B 4IEFB 3ZU2A 4YBRA 5IYZA 4F97A 1YE3A 2V7WA 2O8CB 3TKAA 3TNJA 2DPLA 1HNNA 4MQLA 2G1PA 3GPCA 4E14A 4G5QA 5FORA 5HS4A 1KL7A 1W5EA 4DHWA 3E61A 3T7RA 2PZ8A 3MWDA 1SBIA 1PVOA 3F46A 3SNHA 1WDKA 4AFNA 2HHJA 2XB6A 3WIBA 3LT0A 1QRUA 2QV7A 2Q99A 2ZPUA 4HSEA 4ZOQI 4I19A 1HNXB 1RM5A 3QFSA 2ZXUA 3HUFA 4Z4HA 3DAHA 3WK5A 1SD1A 1I94B 2EJCA 4DNPA 1E1LA 1NXPA 1V25A 4TSFD 4B31A 1TQDA 4GP9A 3LHDA 1YCDA 4KR9A 4DA9A 5KU7A 1LEHA 2OXCA 3E48A 3C6QA 1Z8FA 1TA0A 2GJ4A 4K1XA 4KIWA 3LDHA 1WKBA 1CZOA 4N49A 4P1ZA 1I30A 5BUZA 5CITA 1CIJA 3H1GA 1Z39A 1Q7GA 4P5PA 1MA3A 2Y99A 2XPCA 3DHWC 4QICA 3H04A 3RYHB 1W581 4LV5B 4Z4IA 1P2BA 2FWRA 4PC1A 2VDVE 3R8CA 1PPNA 3GXBA 4HZGA 4JYMA 4OK5A 4YGYA 3UATA 5JQGA 1W7AA 4V0MA 4YYQA 2YOGA 4UNRA 3FUTA 4LF7B 5FBWB 3FCEA 4HLUC 1DF0A 1L4KA 1SN7A 1MAHA 1W35A 3F4BA 2GYWA 2ZBVA 2B30A 4M87A 5JAQA 5EYPA 4K7JA 4P92A 4RHTA 2ZRMA 1JQKA 3H4VA 1N3IA 4OQPA 3C1UA 5JC8A 5JXJA 4NHOA 3V4RA 1V1MB 4OB8A 3BHNA 2WTEA 2J0EA 4K28A 4PHHA 3THXA 1F5SA 2FPGB 5AVYA 1OB5A 4Q4AA 1OLXB 3KU1A 4GC9A 1R0RE 1PQUA 2AQIA 1E3LA 2HUPA 5CYGA 3S1AB 4WKOA 2YV1A 1P77A 4GPZA 3WL4A 3ZW9A 1BX0A 2FTKE 2V9CA 3H1AA 3IH5A 3FOWA 4QM6A 3AP1A 1CUHA 1J9GA 4LIPD 2XCIA 3ZBUA 1TGVA 1Y48E 5A5GA 3LD9A 5B30A 3AKZA 4J1NA 4AS1A 2FG5A 2RHTA 3AVPA 4K9QA 1PS8A 2NU9B 4EQZA 4HUTA 1F2CA 2OM6A 1HORA 1JLLA 1YCGA 2OORC 4PIVA 3PGJA 4BU1A 4TZ6A 3QVMA 3ZU3A 3PGKA 1NW9B 3RC7A 3K1TA 5KVAA 5AKIA 4GZ5A 1GPKA 4DLUA 4ZO4A 1OBFO 2ERXA 3IAM6 4YRDA 1USWA 3MS4A 1U1GA 4LXXA 3N2IA 3UKDA 2VPXA 5B5SA 4F9EA 2O2EA 2WAYA 3M81A 4HX5A 4MV1A 1XCGB 4K6HA 5DW0A 3T1TA 4E2WA 4RHFA 4WFJA 2OGWA 4MV6A 2G1UA 1ECJA 3CZMA 5F98A 5C5CA 2QVZX 4HGOA 3QWHA 2VSXA 4QJ3A 2BGJA 1RAIA 1V4VA 1C7ZA 3R8XA 3A25A 2BGUA 1KU0A 3SBEA 4IL5A 1L1QA 5CB6A 1YB5A 2VYND 4QSHA 2DHRA 2C78A 2ET6A 3C6YA 4FE7A 2AE2A 2V5UA 5TEWA 9LDBA 4KDFA 5C8YA 1N5MA 1M3SA 2JFWA 3CH5A 3IPCA 1OW3B 3CX7A 4K88A 4KXNA 2I8LA 4I50B 4BNIA 1SCAA 1FDWA 3DFMA 3EQ6A 2OZPA 2VF4X 4JBLA 4DMLA 5KJ6A 3HMKA 1EUDA 5CB4B 4WESB 1CEYA 4V0ME 4XUGB 3T3OA 1VP3A 4LNAA 4LISA 2WBLC 1G8PA 1K9VF 5CHYA 3X0DA 4BE7B 4DV7B 5C5IA 2XNHA 4DLSA 1Y6FA 3K9QO 2DVMA 5CHVA 3GDFA 1ULTA 2HJ9A 3LL7A 1PT9A 3R3ZA 3EIWA 5BMOA 4RE6A 3KPJA 3PNBA 2FSVA 1SUFA 2NU6A 4Q02A 1T2EA 5DH9A 4TXHA 4HB3A 3CF4G 2QJTA 2ZZNA 3CY6A 4ZCPA 2ATXA 2I2FA 3MWKA 2H9IA 2P5YA 5M3BA 1LVUA 4PP1A 4RA9B 2VSYA 1J9ZA 1QS0B 4LF9B 4MW7A 1Z06A 2VEOA 2ACTA 1RIIA 1B14A 3LCRA 1GQSA 2PX4A 3VTAA 5JY6A 1Q19A 5CDSA 1OAAA 4XM1A 2BEWA 3GUCA 3GJ3A 4XRRA 1KQOA 4FIZA 5EIFA 5EP3A 1K7FB 1Y3IA 3EC1A 1V35A 2H1VA 2DHEA 4LMRA 4TMZA 5G1NA 2XQKA 4B4VA 3RRNA 4RDXA 1F2BA 1RKQA 5CXSA 4BJ3A 1T2DA 3ZHCA 3D0QA 1W9MA 3NLLA 3QFHA 3VNVA 3SQLA 5BSGA 4IDAA 4MYCA 1TCCA 4NYJR 5TT0A 5IM4F 1UBGA 1UXKA 3C6BA 1QIKA 4R9RA 2HD4A 3P9SA 2GJ8A 5CXQA 2VDUE 1A72A 3JWEA 3PEEA 3GQBA 3E3OA 4LY9A 4QGBA 2OPBA 1MDWA 3ZV7A 3SYRA 2LD4A 1VE1A 3IP6A 3U40A 4R2HA 2ZYTX 5CIWA 3T9EA 3TDMA 2DCUA 3GNQA 4EPTA 4AY3A 2D0IA 2K2QB 1RP1A 2Y1DA 4B3JA 1GGJA 1PBNA 4UOEA 5JT1A 4OJMX 3HU1A 5FHRA 2QGFA 2B1MA 3K30A 2XMRA 1RTTA 3ZY3A 3Q2IA 5TVGA 2G1KA 3AEUB 4MOWA 4RFLA 3R23A 1E5VA 2IUUA 3H8CA 4UHFA 4P3OA 3K9NA 4O2RA 1JFVA 4IQFA 3PTZA 3ZCSA 1MTOA 1TD1A 3HVIA 1E92A 4NU8X 1IN7A 4OHXA 4EO4A 4C4SA 1T8RA 1ZQ1A 3OEEA 2HA7A 1CR1A 5EHIA 1TK2A 1X7YB 3RWMB 3KX1A 4ZYWA 3BVPA 4LXQA 1R16A 1E5DA 2YMMA 4MX8A 4JP8A 2VP9A 4KYTA 1A9XA 1DKOA 2EFCB 2Y1GA 2PY6A 4RFSA 3PX7A 3MLAA 2GERA 3S55A 3TPFA 1FNMA 3OE7D 4HN9A 3W2EA 2PT9A 3NP9A 1BKSB 5I7AA 1RQRA 3WO0A 3EGIA 4GOOD 1EUYA 1Z6QA 1VIDA 2ZRNA 1YBVA 1CNEA 3FYDA 1N2EA 2BCGY 3LY9A 1EP1B 2GN4A 1XCLA 3T7EA 3RSLA 1KAEA 5IULC 1SU8A 2B1RA 5IDXA 5FI5A 4ER7A 4UXJA 5EPUA 2JKYA 2GK7A 3FKJA 4MYRA 1J2UA 3Q72A 4G1UC 4RENA 3Q6IA 2Q29A 2B0JA 4NV0A 3D0RA 4ZRNA 1PBTA 1WB4A 1BMDA 2UZIR 2FSFA 3Q2OA 4XXHA 3RAGA 4MJLA 5BR7A 4LOIA 5F7XA 3H7DA 1WUKS 3OO1A 3ONWA 1LX7A 1LNQA 2OB2A 2AG0A 2HRZA 2MYPA 3GVPA 3AM5A 3K2IA 1NKVA 3AHJA 1GG2A 2XNJA 3LP8A 4GSLA 2FMKA 1O6GA 1NUAA 1S01A 3OPMA 4BLPA 1RJ9B 2G0TA 1DUIA 1A5SB 4Y7CA 1FMTA 5K01A 4BTVA 1FFHA 2X0JA 4HZIA 3RTCA 3ZXIA 5JSQA 1VJVA 1D7OA 3JQDA 4HJXA 3FVRA 3MPUA 3QA3E 2IYSA 4KAAA 3WNCA 3D5EA 4JHLA 2VJMB 4Q0MA 1Y1LA 4HMOA 5K0BA 2UZ3A 3MTIA 1SP4B 1VFPA 3QJYA 3DTVB 1C2TA 1WU8A 1W0JD 2Q46A 3U5ZB 3IEXA 1RYFA 7PCKA 1AKNA 4JROA 1AQJA 1C3EA 2A1UB 2HPAA 3MCVA 4EZBA 3DE3X 2DC1A 3HB7A 1ZIDA 3B2NA 3G88A 3L8FA 4I5IA 4BOPA 4YUXA 2AI3A 3E22A 4MYDA 1JDSA 1VKOA 3FMOB 2GAIA 3L8EA 4JT9A 1CUAA 2EG5A 4E0BA 1BX1A 2EATA 3QM1A 3GGPA 2AUXA 1XZDA 3AOEC 3DVLA 1RT9A 3A8TA 2CN1A 2VHXA 2QDXA 2I7XA 3D8BA 1HDGO 3WLHA 4LMPA 4U2BA 5JAUA 3A9TA 2B8JA 4R7GA 3W77A 2H6EA 1AM4D 1JG2A 1Y6QA 3BRCA 1R88A 3BYZA 2FR8A 3PWKA 4CKWB 1PQWA 3KSRA 1ENYA 3L7OA 1O6ZA 3QHAA 3VO8A 4G36A 3C9EA 5BMVA 1DIBA 1DV2A 2PVCA 5I3CA 3RRYA 1LH0A 2DOKA 3OLZA 3FIUA 4YTEA 2X6RA 3LX5A 3OE5A 3X1DA 5K0TA 4U7HA 4D82A 3KVRA 5EKTA 1VYHA 4GYJA 5E6JA 2C5AA 2W0SA 3R6LA 2X9LA 1P74A 3GJ4A 1UKZA 2FHSA 5TXGA 2Y1KA 2FDRA 3AV3A 5AVXA 2QXUA 1KMCA 4WOCA 3U49A 5F2EA 4C6HA 5EQTA 1VPLA 4IIDA 4CF3A 5ERXA 4JYCA 4BWVA 2WNIA 3LBHA 5JRZA 1MRZA 1O1YA 3CW8X 4JENA 3MJHA 2IH2A 1XEWY 2D2EA 3SG0A 1JYFA 2R9VA 2RKBA 4DWWA 2XMCA 5AJZA 3LNCA 3HYRA 4IIJB 1D6MA 1B00A 3L41A 5BSHA 1XZFA 2YNMD 3DXZA 2X9NA 2GZ1A 2NOAA 2QMYA 4PYLA 4EUSA 5C1BA 3IV6A 3PQ4A 3N2LA 2P2ZA 2WM2A 4IDEA 4ZCRA 2W2XA 3H9EO 3L1UA 3WK7A 5DN9A 1K97A 3NOQA 4GDFA 1O87A 4IM7A 4J0FA 4O4LF 4ERXA 1X9IA 2HWUA 3FBGA 1PJQA 4E33A 5CLJA 4HAWA 3OF5A 1QE3A 2P62A 1QRSA 1LBTA 4AXLA 4RKQA 3RFXA 1ONPA 3CPEA 4LFAB 1VPTA 3BQMB 1EK0A 2X0EA 5AI8A 4PYOA 2O3JA 3ABSB 5CM9C 3A6ZA 3HPQA 5KYWB 3O1LA 4LWQA 2DERA 1Q50A 1U8EA 2NVWA 3CR7A 2B3TA 3A4IA 3K6KA 4H7DA 3JQ9A 2IIBA 2WUGA 1W0KD 3QUCA 5I6DA 2QMHA 4DUYB 1ZUNB 2B0CA 1X7GA 2QVCA 2CT8A 2JRIA 1Q1GA 4K2AA 4L78A 2E00A 1NW3A 1DX9A 3N8HA 1U2RA 4IYJA 3HCFA 1E62A 1WZEA 3R0JA 1A9ZA 5GJVC 1G66A 5L6MB 1K92A 1H85A 3B6KA 3D4OA 4AMGA 3IMAA 1WY5A 4JLDA 1EVJA 2IYVA 2QGNA 4EH1A 1THTA 2N0SA 3L5KA 2F3QA 3LF1A 2JLBA 2ZG6A 3RRBA 3IILA 1MP0A 1ULUA 1OXKB 3M5DA 4I9UA 1D09A 1O94A 2JAXA 3ERVA 1NRJB 2ZREA 4LHWA 4X6UA 3DOFA 4CKXA 4DLRA 4PFKA 4BO2A 1U02A 4E6EA 5EVJA 4N4ZA 4G84A 2R7LA 2NPFA 3GUHA 2YNMA 1KTVA 4G5HA 4A73A 3HA3A 5B3LA 5B12A 2AU1A 2BMWA 3G0GA 4O0LA 2NUPA 3TLJA 1E2NA 4B3RB 3K6RA 3F3SA 3LDGA 4NZ9A 4TV9A 5BR4A 2X8AA 1DWPA 2JJQA 2X1HA 1YNOA 4I0WB 4AG3A 4ARVA 4ML3A 5JTTA 3J80A 2D2XA 4JI5B 2BGLA 1AXEA 1TYZA 2I3DA 3IEIA 3OZBA 3GVCA 4BFWA 1KP3A 4H17A 2JJMA 5DISB 5KYUA 2Y4NA 4TQAA 2QKYA 1ZK3A 2P35A 1LU9A 4AZ0A 2YOHA 4EABA 2W6JA 3HCWA 2DQZA 1TU6A 4GWKA 4PZDA 4RKXA 4M99A 1JZTA 3P45A 1H69A 3M0EA 3M6AA 1K5PA 3L0OA 4LKRA 3EWSA 3DV0A 1P5HA 4Q1BA 1QV9A 3WWZA 4YRGA 3IVXA 4HAYA 3W04A 4LTMA 2KBFA 4XA8A 5EJ7A 2YYAA 5NLLA 4BFUA 4GOMD 4CHTA 3PNQA 5T3UA 1ETHA 3WGNA 2YY7A 2GXUA 2AI1A 1HWYA 1PWYE 4D3YA 1VCNA 4NEGA 3HUTA 1M34A 4N40A 2GEJA 4UTXA 2Q4TA 4L72A 4Z8YA 2B8WA 4N1AA 4YB8A 2OYRA 4C0HA 4L6CA 1K2WA 2H4YA 4MQ6A 2X5XA 3DLBA 2EHDA 1RLOA 5IARA 4AP5A 2O8BA 1JLMA 3AJRA 4D43A 1R5BA 4FXOA 2CBZA 2NO6A 3FWNA 1S02A 3IAEA 3C3YA 3G9XA 4JU8A 4PG6A 5A6SB 3IAAA 3VJMA 3WLKX 2A4KA 3G8YA 1NW4A 1QMPA 2OAQ1 3TB6A 1AU4A 5IASA 3PQEA 4TKUB 4XIGS 5CLIA 3QFRA 5DW3A 3R7LA 3HLTA 3NWPA 4XDYA 3TIXB 1U63A 4RD0A 3C7DB 4KI0A 3SEZA 3LXSA 3MUEA 4RHYA 2LKCA 1BDBA 1OYYA 3FSGD 4CGYA 5IYZF 1FRVA 5FEMA 4GGMX 1T34A 4UREA 1RZRD 4TTPA 2C2GA 3KNZA 4F4DA 1B0PA 4NS1A 1C30B 2YJGA 5DK4A 3TCXB 3IFSA 1ZWLA 2AYXA 1E3QA 1VKNA 2D0DA 2GFHA 2VPQA 3SDZA 1LTHR 5IBCA 3P9XA 3EEOA 1PDVA 4OHUA 4YAFA 4CV3A 5I7EA 4MR9B 3NOVA 2OK7A 1YIOA 2FK7A 3H8BA 1NVKA 2NZWA 2BEVB 1HBJA 2ZU0C 3H7IA 2ZQ5A 3R77A 4I4CA 5DTEA 1IQRA 2PUAA 3E35A 3I9NA 2WEKA 2BHLA 2E6UX 3PJFA 4Y6RA 4G9BA 5L3RA 1U81A 2O8CA 1EYZA 1QAQA 4L7VA 1PJZA 3H2JA 3RIYA 3W2HA 3DAYA 1FFGA 2CXOA 1RVV1 2QIOA 3WIOA 5K6AA 2QD2A 1KARA 4OY3A 3FI9A 1PR3A 221PA 4B3FX 4OAOA 2WPDD 2B3DA 4TTAA 3CGWA 1A2QA 1EFVA 2LIPA 3G2QA 2AE1A 3NFRA 3U39A 3F3MA 4V1CI 1GTG1 1Z8NA 3SBXA 3TLCA 1BVUA 5M5BA 1VE3A 3NNDA 4LVUA 5BQPA 4XUDA 4BNZA 4I99A 3M9WA 4M9ZA 5HFNA 2FRDC 1YZKA 3RTGA 4QFMA 2H1CA 5AW9A 1XALA 1Y4AE 1J0DA 1M34E 2VA9A 2VR1A 1QBKC 1EVZA 1DGQA 1GDDA 4HQ6A 3HR8A 2EKQA 4HLCA 3FOZA 3GEGA 4UAUA 4G5RA 3GG9A 3ACCA 3TW0A 2F67A 4BY9E 1Y5RA 3BL6A 2VSQA 1RIFA 3OQIA 5TX7A 3GI1A 2QS9A 3EYWA 1ZUD1 1BXZA 5BN1A 2ISQA 4JBYA 1IPEA 4M83A 2ZJAA 4MJ7A 3RROA 1I9CA 2QAJA 4A8JC 4FK5A 2MWMA 3DLIA 2JFVA 5ELXA 3AR7A 1CQWA 2YHAA 1ZNXA 4N7MA 4EY4A 1C9MA 3QXCA 5LZ7A 2Q0SA 3N8KA 3ZZNA 3ZUAA 4KXWA 5FBKA 4TM7A 5B58T 5JMPA 3HEBA 1DQPA 2JHFA 2NN3C 4WK4B 2F1OA 2IQ5A 4B0OA 4Y1FA 2D3TA 4IOKA 5AUQA 3D3JA 2WUDA 1DBRA 1RNLA 2JCGA 3IIEA 5AM2A 2OAP1 3K0CC 1OIWA 1W2WB 3HYCA 4JLVA 1BKYA 1DIHA 1U7PA 3QUSA 4ZCIA 5TPZA 3KLPX 3EGOA 2GPTA 5BWOA 4D99A 1P1CA 5BT8A 5JLAA 1V1MA 1N0HA 3G17A 3PGXA 3F5DA 3SHVA 1LPMA 2A7QA 1HQDA 1TLTA 2JJ8A 2FPPB 1H6CA 1OLXA 3C97A 4FZ5A 4EA9A 3HJBA 1ZNYA 4M86A 2YIDA 1JDTA 2R6DA 3A9SA 2K7FA 4P4SB 3S1AA 4KVFA 4QNNA 4JA2A 1U5IA 1GFWA 4U6QA 4O0MA 3D0OA 3H5WA 4PVCA 2GSDA 2A4MA 4WEQA 1SRRA 3FJYA 1WF3A 3OKAA 2NADA 2JHCA 1H66A 2NU9A 3PIIA 3EODA 2GUWA 5FIUA 1QMYA 3CLUD 4JMPA 2EYQA 3CE6A 2YV5A 1DJQA 3UC9A 4HXFB 4LI0A 4E7OA 4EHJA 4FNGA 1CJCA 1ZI8A 3TLGB 2NZUG 4FFSA 4NABA 2ZM6B 2FZCA 5HRCA 3PE4A 1ZD3A 1Z18A 1NN0A 3TRIA 1RBYA 2YIVX 3K9CA 2VDQB 2VRCD 5J63A 3H19A 3SAJA 3ZPXA 1BS1A 4B4UA 2X2FA 3RK0A 4DUZB 2PM8A 1KPHA 1SXJB 1EXVA 3R3SA 3H1PA 3L7DA 2DOSA 5KAPA 3BWCA 4OFWA 1BD4A 1W5SA 1ZISA 1P60A 2FQXA 1FQJA 1XZQA 2XD4A 4WLNA 4ZXPA 2FYTA 3OJFA 1NQCA 1LC0A 4MH0R 1A9RA 1XZIA 1GGFA 1N3LA 2RG1A 5CFQA 3E3LA 3Q8KA 3HEMA 1KS2A 3LK7A 5JO9A 3KV3O 3Q7IA 1P72A 1RM3A 4B6EA 2QNIA 2H59A 4JI7B 2GEVA 1BA3A 4P98A 2OZVA 3CX3A 4I50A 5A62A 1B6SA 1L5QA 4IIYA 2FNAA 2ZJ4A 2A5LA 3R20A 1S8FA 5CB4A 4WESA 4F46A 2D1QA 1LXCA 1I6MA 5HJ2A 3TXYA 3MTNA 3MUNA 5DRYA 3E8MA 1M66A 3Q9NA 4Z6KA 5KJEA 2F43B 3ZNHA 2W43A 3FYCA 4ZOAA 4HSGA 1O4WA 4TVSA 2FWMX 1FTSA 1YQDA 4BFVA 1J2TA 2P0AA 4K46A 3ZGZA 4HGNA 3WGHA 3AILA 3MOIA 2NZJA 5G41A 2GA8A 2NLOA 4MB2A 3KTFA 3KOWA 4DCNA 5HM8A 2W2PA 3GLKA 4IQ8A 4JUBA 3IUMA 4QULA 4NDZA 1TVKB 4QG7A 3DT6A 1KMNA 4OSPA 5FLKA 5CLGA 4RA9A 4FYWA 3SNKA 4LFCB 3UMBA 3TQHA 1HYGA 1NBHA 2ARYA 3QJGA 1N0IA 4GX1A 4R5MA 2QK4A 4RF3A 4QRDA 3A6PC 1VZ3A 6ABPA 3KIPA 1CZUA 4G0QA 3NHZA 3H0EA 1ADCA 5FQOA 4OKSA 4BCDA 4EB0A 1JHYA 1TLFA 4QOJA 5SV2A 1NLZA 3AM4A 4GVPA 3MMXA 3A3PA 4TYNA 4KK3A 4MIEA 2HB6A 1C9DB 4BBJA 1ZGJA 5AW3A 2L42A 4R1LA 1TZKA 2VAWA 2AZDA 4UEKA 2WT8A 3PUVA 4M9QA 4BJ1A 3KQOA 4Z9YA 1EVQA 1OHHD 1UMDA 3EGXB 5H3CA 3RKRA 3GYGA 2PSEA 3T3DA 5K8CA 1XQ9A 2PYDA 3HDVA 1LQTA 2HU8A 3WGOA 1QNLA 2CLIB 3NXKA 2V96A 3AT1A 4N3GA 2IELA 2W6IA 3C3MA 4L76A 2J6CA 1E1MA 2Z4TA 1IWBB 1QP4A 5MN5A 2G8NA 5GGXA 4XFKA 4YRQA 3W7VA 1HK7A 1P2UA 5IT5A 2PBRA 3H99A 2FEXA 1DBWA 3ZCPA 3PF8A 4I4TF 1XZLA 3U3ZA 1SCJA 3RVKA 3IVMA 3N2EA 2C4TA 4MW2A 1UUFA 4MGHA 3ROFA 3V7UA 1UAYA 2HV8A 5FEUA 3NDPA 4C5CA 3LG2A 4ZI3A 5BUSA 3FRJA 2B5WA 2ZRAA 1J1IA 3MTVA 2HCRA 3A11A 3NIFB 3QVTA 1RKVA 5DCYA 1HTWA 5SZHB 1SR8A 1VJCA 1I2ZA 2XA2A 2UYHA 1X7YA 2ERYA 4Q24A 3L7IA 3GZTB 4CDFB 2WTMA 4KQEA 2GPWA 5TS3A 3ZQJA 4ISBA 3GFQA 1CJLA 1DEUA 5LKRA 1K6XA 4IXMA 2BISA 3O91A 4WVLA 1YQTA 1XKQA 3NW9A 5KYGA 2IZZA 3GOQA 3OM0A 5KREA 1T3HA 3DKPA 3JY6A 1XQYA 3AIOA 3BICA 2E4ZA 4H4DA 1OGIA 5F4ZA 5CW2A 4HI0E 4AVYA 3LK6A 5JZVA 4V3BA 2GHQA 4LHVA 4CMEA 1H6DA 3PK0A 4QXRA 1WF6A 2BKVA 2C3YA 3BSWA 1GA1A 5IDWA 4LWPA 2J3LA 4NZMA 4L4XA 3IR5A 1Z56C 1VPWA 4AMUA 421PA 4L8YA 5B6PA 3R5KA 3AFNA 2J48A 3I53A 2AG1A 3ZCRA 1Z6GA 5AOCA 1WE2A 2W2VA 4ECEA 5F35A 1F48A 3FD8A 1WMEA 4PGGA 3I42A 2G7ZA 4TS1A 2DCBA 3PHBE 4B6FA 4OLHA 1RMQA 2I55A 2HT1A 1CPYA 4OL9A 4KXXA 3TVTA 4WGGA 2JHGA 2V6JA 1RJ9A 4UNPA 3BFVA 3BIFA 4KLAA 5DCWA 3KJIA 5JEEA 4CL3A 1KO8A 4RIIA 3F9CA 3NVDA 5KKCA 1JIIA 4JD5A 5FOSA 3ZGYA 3FOEC 1A5AB 2Y2UA 3IC5A 1CY0A 2PLAA 2XCUA 2ZIFA 2IA5A 2VJMA 2ODTX 4YXWA 4FU0A 5JWRA 3FAKA 4L6AA 4QSMA 3FFAA 2CLLB 4G65A 3DTVA 4AIRA 3CF6R 4UVHA 1ZFNA 2I1QA 4RKFA 3IUSA 1Y34E 1TYBE 2VNSA 1PQ4A 3VR3D 3E18A 2JVKA 2YOFA 1UMCB 3W8FA 3FCXA 2IOHA 2CXTA 3K7EA 4D9CA 3VR6A 2A1UA 4DS3A 1JDVA 4F6RB 1IWOA 1T8YA 3QMVA 2D7CA 5CVDA 5ISMA 4GLJA 5UKDA 2ZIXB 2J45A 3JD3A 121PA 5DGHA 5JZ9A 2J7QA 2FG7C 2GF2A 4B8WA 3B3AA 2J7KA 3L7BA 3HU2A 2I6UA 4ZVPA 1U98A 3B38A 1JKXA 1XZEA 4YMLA 3ZE8A 2JRLA 4KXFB 3QE9Y 3O5AA 4Y7DA 4JDUA 2XWQA 3SMVA 3GRPA 5HF5A 4LZPA 5LP6A 10MHA 2C1ZA 3AETA 2P77A 4WA7A 5GONB 2GA9A 4RY2A 2E87A 3T7CA 1BMFD 5E95A 4M1TA 5CUQA 2YCLA 4P0PB 4BBAA 4H1TA 2OBFA 1ISSA 2MHCA 1F5NA 4LGVA 1XU7A 3AESA 3BMCA 2O06A 3WYNA 2AHOA 3V1YA 4ND3A 2WJPA 5KYKA 4JC4A 1BHJA 1BCSB 4MGYR 3AR6A 1RTKA 1W19A 1S8NA 3AFIA 3FTFA 4XR9A 1U3VA 2G5TA 2K7ZA 2Q3DA 1P44A 3DL7A 1HPLA 1PR5A 4JEUA 5H81A 4ZEVA 4I07A 4ENRA 5FOQA 4GX5A 4MUIA 4KFUA 3HCBA 4WL0A 3U16A 1NMZA 1XAIA 4F60A 1FLDA 2AW5A 2ZIVB 2UVDA 1Q5PA 1IIRA 1OIVA 4N47A 3SICE 2CXNA 3PXGA 3HL4A 2ILTA 5YASA 4HDKB 5B3JA 2Z2ZA 5JD4A 2FEAA 3PSAA 5JEDA 4ARBA 4CKEB 1JHOA 3KKZA 1I7PA 1UBEA 1Z36A 2CHVA 3DV9A 3BRSA 4I4IA 4EZEA 3HADA 2ZDHA 3ETGA 1ZJWA 5IT4A 2EKLA 4DEVA 4UU0A 1EG7A 2P9CA 3H4IA 3RUDA 3GL9A 2L2QA 3H5TA 2Z84A 3PDWA 2ATOA 4S1WA 2Q6OA 4D02A 1QUEA 2Q07A 3PZBA 2IODA 4TSRA 2ZIWB 4BQPA 3P5XA 3C5CA 3D7LA 5A71A 1BMFA 1DIGA 1OSNA 2QTTA 1QH8A 2X2EA 1DC6A 2XQVA 3H1BA 3K35A 1KH1A 4OXKA 2V65A 2GHRA 1SUAA 3KQHA 4L5JA 3CH3X 1P4RA 3CH6A 3TBKA 1UOEA 4CNQA 5K2OA 1UWCA 2G67A 4F5WA 1FRFS 1V43A 5IMBA 5KYWA 1GXSA 2V1UA 2V3CC 4YMUA 4D4JA 3IRVA 5B4VA 3RVVA 1JE0A 2HQRA 1ZUNA 1GEEA 1KU6A 2JH8A 1WSBA 2VDKB 1QCDA 4Q4HB 3CR8A 3TLXA 1ZMOA 3ADDA 4O5AA 3GFVA 1B8VA 1IY2A 1NXQA 3DZIA 4J3FA 4OQQA 3SJ7A 1P7ZA 1U2SA 2AJLI 4KX3A 2Y0PA 5LD2B 5K6RA 2WSSA 5H16A 1CP3A 1CR2A 1N6LA 3ENNA 4TV9F 3UMGA 3W6PA 2Z6UA 1KK1A 4IYRA 5KI6A 5DYIA 4DMGA 2NZ8A 4IPTA 4H1VA 2OD2A 3OAAD 4C7XA 2IEZA 1N9KA 4GECA 4A6EA 5HG0A 4RX1A 3N7AA 4EYSA 1L7DA 5H83A 1Z45A 3D6TB 1O2DA 4HZUB 2CF5A 2P1RA 1U9XA 4GQBA 2FOXA 2Q2QA 4LNHA 2ODWA 3MOGA 1Q17A 3S2GA 3GGOA 4LS3A 2DBZA 1VYTA 3DGEC 3HLKA 3UXEA 2R6NA 1QJ4A 3DHNA 1SHLA 3QVGA 1QWSA 5B7QA 3EPKA 5E2IA 3TW8B 1CUBA 2H07A 2JI7A 2H51A 2W5UA 4IIGA 1SHKA 4FFPA 1W1WA 5THQA 3C7CB 1SELA 1ODIA 1WL8A 2ZE6A 3WIEA 1QRTA 3HBJA 4A8PA 4F04A 5F51A 1IAVA 1NP3A 3OC6A 1J1UA 2WAAA 4UUBA 4JIGA 1Y9AA 1QX3A 1ZNZA 2BF7A 1ISFA 2Z30A 3ML1A 2HBYA 2A1IA 2UAGA 1OFTA 1NVWQ 4WD3A 1JHDA 3L1KA 5TQ2B 2V0NA 4LRTB 2H1HA 4X1OA 3BEDA 3ZV4A 1PG0A 1TEZA 1UC9A 3R5SA 4ZCSA 4YP5A 1EGMB 1XQ1A 3REQA 1M5UA 3DMYA 3HWX1 5CFZA 3KKOA 3R1IA 1AO0A 2RHJA 2PKCA 2Q9CA 3C1TA 3DNMA 4M0LA 3SJAA 3QSDA 4NPHA 4G86A 2CUNA 2YN0A 3V42A 4A15A 5KC9A 4KO1S 1FUUA 2ZVDA 4NYJQ 4MQBA 4ANFA 4XQGA 2P9FA 4KQ1A 1YTUA 3TXXA 1CIVA 3UJCA 4L3OA 1BHQ1 2YWRA 5DKFA 5AVZA 4AU1A 6PFKA 2NU7B 4GE0A 1LPAB 4LJKA 5JCOC 3L1IA 1Q3TA 1XCJA 2G5CA 1J4AA 2P78A 3GV0A 4RK4A 4LDRA 5T7BA 2HU2A 4UHCA 3M1YA 3R4VA 4US0R 4YLYA 1KPIA 1K08A 5JE8A 1DEOA 1GARA 4L74A 2ZR0A 1L5HB 5A6SA 1C8LA 1F4PA 1U2TA 5DXFA 4AS2A 1Z4LA 1LSOA 1ODLA 1E69A 1UKVY 2Z1DA 5I5GA 3OPYI 4TKUA 4K2HA 1R27A 1YQQA 3EMKA 3RVDA 1ECFA 4LY3A 2N75A 2P4SA 3DOJA 5HK8A 3QFFA 4MK4A 2C29D 4ALNA 3ZYZA 2UXCB 1VGRA 1WTAA 3H97A 3QRWA 4PZAA 3H84A 1RLIA 1VE6A 3HR7A 3L6RA 4AMBA 4G5XA 2CD7A 3V6MA 3C15C 2HNKA 3IQDB 3V1TC 1J5PA 1C30A 1U2ZA 1NQAO 3KWLA 4B2IA 2PFGA 1PNQA 1EIZA 5DM2A 3WNDA 4TYMA 2EX4A 4RD3A 5LQKA 1ADJA 3QEBZ 1OBOA 2F48A 3AP3A 1CQPA 2NTYC 4MR9A 4OAPA 2B4KA 4Y2VA 3VPFA 5LL6P 1ZIVA 2HF2A 5DLEA 4HY3A 2BEVA 2ODAA 2B2CA 3JQ6A 3F7MA 3J7TA 3I2HA 2BDZA 2F1GA 4LFBB 1U1CA 1GWNA 3LZDA 4WFIA 1EVLA 1U3TA 5AHKA 4OHOA 4A5OA 5GZ1A 4MW4A 1E1RA 4D26A 1FBNA 1JSZA 3STTA 2CSUA 9MHTA 1R3DA 1TE2A 4EW2A 1Z26A 3VTKA 1NW8A 4RMGA 5KINB 3H6SA 3QKUA 5CNKA 1HC7A 1WXQA 2FEKA 2HY7A 1G5RA 5BYKA 1XD9A 4I7EA 4E70A 1ZOLA 2VNJA 1RCTE 4JLPA 1AECA 2IVFA 3CJQA 2DQSA 1GNPA 4MV9A 1T0JB 1MIOB 2CE7A 4BV3A 4DKXA 1QNFA 5I9BA 3HXKA 3HBAA 1VYUA 3HZZA 1AHIA 2PVSA 1G2OA 1X39A 3I9FA 3U4GA 1UMKA 1C1YA 3IEPA 2YIMA 1FPMA 3FPCA 3JZIA 3BJZA 1XCBA 3LMKA 4LG1A 4TTJA 4ZQBA 3SP1A 2PO5A 2YRXA 4U0JA 3F73A 4UE6A 4E46A 2UUAB 3U3JA 1G8FA 2JLRA 3E2MA 1YUMA 5IEJA 3WB1A 3T5AA 2J3QA 3GZJA 2IW3A 5JAMA 3LYHA 1ATZA 5LDGA 1IEVA 2WIFA 4BP8A 3O8OB 5FOUA 1HRDA 2ECQA 3I3SR 3U17A 3WJAA 4LSWA 4D9GA 5HM6A 2DZYA 3T5BA 4UMDA 1EB9A 2AVDA 1OMOA 1BE1A 2DMRA 4WASA 1PJCA 3OIUA 2QJWA 2R6FA 2B82A 4BATA 1ZO8A 1AKEA 1I3CA 3GFGA 5CJ2A 4IR7A 2F9MA 1E7YA 2FPKA 3FGPA 3PT2A 3DWGA 3MJ4A 2V3WA 1XYVA 4A2CA 2DU8A 1RWNA 1SVIA 2FPPA 2PYZA 3JATB 1DX6A 4H2DA 4O4IB 3UJ6A 3DPIA 4GQIA 1E4OA 1GAWA 4IX9A 4P4SA 2A84A 2C4KA 4ZVSA 1HZJA 3DEFA 5EFZA 3UM9A 3BWKA 1E2KA 4RLQA 1UJ5A 1P9RA 1L9XA 1SU4A 5K0ZA 2YL2A 2OCPA 1Z47A 3PFGA 4K0RA 5FB3A 3ZZUA 5F2NA 2AVWA 4WFKA 2ZCUA 5EN4A 1EM6A 3ZE7A 4DPLA 1UMBA 1KQFA 2J59A 1VL0A 4H27A 4EUEA 4U7DA 1I4EB 1AB6A 2PWYA 1BW9A 3GFFA 3IIMA 3CNNA 3IHWA 3JRNA 4PAMA 3LBAA 5AOAA 2EIHA 1ULBA 4XFDA 2PZMA 3NOXA 2D5CA 2JIBA 3OHMA 2AK2A 4UFOA 3TKYA 3JVDA 1T9HA 2OHFA 1BTOA 1SXJA 2J1LA 3ADPA 1RMYA 3FNRA 3QUBA 5SZJA 3ZJ4A 2PUCA 4INAA 4Q4LA 4F86A 4L0CA 1HT3A 5CB4F 1ECPA 1GAQA 1QAOA 4O2LA 4A27A 1PO7A 3GH3A 4B75A 2IS4A 4HDAA 3MW8A 2EQBA 2VWPA 1FXUA 1PFWA 1N6RA 1YVDA 1J2YA 5KBYA 4IDDA 3QE2A 3FYSA 4NC9A 4F71A 3BGOS 4AF6A 1P2DA 2VT2A 3NJ8A 1I2AA 1FXWA 4V03A 2QRPA 1E1KA 3BFJA 4WZZA 2H65A 4NNJA 1T9BA 5IXSA 2RHRA 4EK9A 1ESEA 5TRTA 3RG2A 1Z8DA 4RNDB 5TB5A 4FS3A 1PEYA 3T3GA 4CFSA 5AI4A 1MGPA 4XTRA 1F29A 5F5XA 2QRQA 1HO3A 3BGSA 5BOVA 3GRUA 4QNRA 1ISHA 1FDUA 4D9NA 4I6GA 1EQAA 3WSWA 2IPAB 3CV3A 4FCWA 2CLCX 4MUYA 4MUHA 2ONJA 2CLSA 2KYRA 2QJOA 3O3OB 1G18A 1Q7CA 3FA2A 4GD3Q 3DW3X 3PICA 3DTNA 5TQ0A 1U3FA 3MINB 3GEIA 1MX5A 4KX5A 5IAJA 4A8HA 4EGSA 2W6OA 1SBNE 1TVKA 3C7TA 4PCVA 1M2GA 3CCBA 5JMOA 2R4QA 3E27A 1ZC3A 2GNAA 3VR6H 4IFTA 1JEOA 4NZNA 4DF3A 4V39A 1VGQA 1XIVA 1GCGA 1P19A 3KL4A 4TS9A 3RT7A 5DTJA 3SVTA 2N3ZA 5BVHB 2XUOA 1J9EA 2C9DA 2PMKA 2GM9A 4GMDA 4AF8A 2A78A 3PRJA 4Q6BA 3MS2A 3WRYC 1ITZA 4HDRB 4Z4QA 1YE5A 2V8OA 2DM6A 3WE7A 4WLFA 4MYUA 1XTTA 3O47A 4YAOA 3OC0A 5BSWA 4EJ6A 5HE9A 3EGXA 5DTRA 1SXJE 1ICFA 3KTDA 4WLVA 3P96A 3DUFB 4B17A 3ETDA 1KE1A 3O1GA 2YFKA 3WS7A 1Q7EA 1G21B 1HLPA 3O8RA 5LSAA 3OKCA 5K3SA 3HG7A 2IX3A 4ZDWA 1W88B 1FQKA 4RNAA 1FTNA 2EQAA 2DF8A 3FLBA 2OLEA 2IXAA 2JLCA 2ZIEA 3B6JA 3O0TA 3OU6A 4LI3X 4N0PA 2HI0A 2ZSFA 2G07A 3PPYA 4KPUB 4EKEA 5DM70 2BBOA 1OZAA 1VHLA 1JE1A 1W5AA 2ECKA 5L40A 3IP3A 1ZONA 1TM7E 1BAPA 1RFGE 2J8ZA 3S27A 1U9ZA 3DKVA 2QNRA 2HJSA 3NBYC 4IJ5A 4ZYTA 5LJIA 3I1YA 5G0UA 4L0QA 5EHQA 3IRUA 1S3SA 3O82A 3O84A 4KACA 4WBXC 3UWPA 3WG9A 1Q15A 2ZYIA 2O5VA 3OM1A 4Z9FA 1RLJA 2N9UA 4KQKA 3I9JA 2YIJA 2CFIA 1D9ZA 5AUNB 4MUAA 3OZGA 1U5CA 5DI3B 3JD1A 2TMGA 1UQRA 1PJSA 1NNEA 1DVRA 1NL3A 2G09A 2W6CX 4LVOA 1J2EA 4RKWA 3MYRA 4GNRA 4EAAA 2B4AA 3KR1A 2AMLA 4EEKA 1XELA 4R1UA 4ENTA 2ZWAA 4NCIA 4D97A 3EQ2A 1SQ0A 3RS9A 4F92B 2W9XA 3I5YA 5EHZA 3T4XA 1LLQA 4UVIA 4HDMB 2RKOA 1IM5A 1U8ZA 1T5IA 4Q1CA 5JH7B 1J70A 1W6UA 4GC5A 3TDNA 3HWNA 3HN7A 4PRLA 4L0DA 4BX9A 1Z7GA 3LUFA 4HQFA 4GVLA 4TMKA 5AXAA 4TQGA 4KQJA 3TQCA 3S2EA 1ZD1A 1RYYA 1OB2A 1VYVA 3MBOA 3O1JC 3DE5X 2NO9A 3IOYA 4CG2A 3I45A 1ZBDA 1JXAA 1WRBA 4ESOA 5FLXA 4NG4A 5DYWA 4PBRA 1A0OA 4E12A 4X3CA 3L2OB 5CVEA 1F2DA 2XDQB 2ZRFA 3N2KB 3LQQA 3KKKA 2AKEA 3FWKA 4OX9B 5JC1A 3NHLA 4LECA 2YXPX 3GJ5A 2XMZA 1QIDA 3GD5A 3W9UA 4DV2B 4NVRA 4PZYA 4GZ6A 2ONYA 3SEAA 1KPGA 3GEEA 1Q91A 1BYUA 1KEEB 2CVPA 1QQAA 5HEKA 3D02A 4AX4A 5K99A 1UMCA 1Z6TA 1WDLA 4YAEA 5LP6F 4MUBA 1D1SA 4M9RA 1S0UA 4HOYA 1HF3A 3FKQA 4F6RA 4G1FA 5DZSA 3M5PA 3U4DA 1KFBB 1JSCA 2FMHA 2ZIXA 3F5FA 1ZD8A 2R0QC 3BWDD 2X3FA 3R74A 3HYNA 1VLZA 1W29A 1XZNA 2D59A 4N9WA 3TLGA 5CCBA 5THXA 4HQ0A 1SBQA 1G98A 1PZNA 1YK8A 1IQUA 4M76B 4LJ5A 4BL5A 1ZC4A 3L8CA 1IEQA 3I4FA 2AG8A 4YJFA 3B13B 1MPTA 4XJSA 2PMFA 5EZYB 3PBKA 3IAS6 1GPJA 5F73A 5KYTA 3UJ3X 1YHYA 3EXIA 4CL0A 4AY6A 1S6YA 4BQRA 5D7BA 3U9LA 4RWEA 3IMCA 1NRWA 4QUDA 4S1PA 1N33B 1LZKA 4MIKA 3UW3A 1N3BA 2GZHA 4JLSA 3DZDA 4E5NA 3TZCA 1W4AA 3CBJA 1P9NA 3G0OA 1H4VB 2VK2A 4TZTA 3OX4A 2C97A 4MI6A 1I0LA 2QPOA 3IVAA 1L1EA 2JFXA 1THZA 1K27A 1VDMA 2F17A 3ZI4A 1M6WA 1PSWA 1Q0HA 5EJ2A 1J23A 2DJGB 2V7XA 1H2BA 2JFYA 3N3BC 2FWNA 3BA6A 2BCJQ 4DSAA 3HP1A 2F1KA 1Y7HA 3GBPA 4DY4A 1CNFA 2XXBA 3A27A 3NYWA 3G1UA 1MIHA 4ENWA 1NQTA 2PWBA 4HNRA 4D57A 1U90A 3E1SA 4LDNA 2INGX 4BE9A 5KHOC 4XQEA 5CVCA 2V55B 4YBZA 4BUJA 3BF8A 3I3TA 1R6DA 1QIJA 1CG6A 3UB3A 3GIDA 4F4CA 4UM9D 5CR9A 3L7LA 5AXDA 5CIYA 1KSHA 1XJ5A 1NR5A 1AD2A 2FW0A 1JMVA 3I9V1 1HSOA 4FFDA 3UUFA 1KYYA 4NZPA 3F67A 3RU9A 5JLJA 5KYYB 4DR2B 3NIBA 1PXVA 3M99A 1FP1D 1XZMA 1U3DA 4D9EA 1SVSA 2OCKA 4RSHA 3LC7O 1X1CA 2VQDA 4FDMA 1YRHA 4Q7QA 3BTSA 3BULA 5AI5A 2ZSKA 4TROA 4F3TA 3IOQA 1KBZA 1F8UA 1GTVA 5AK5A 2WD9A 4L3VA 3ORFA 5FDFA 3VA7A 4FHGA 4BP9A 1E7MA 3U3MA 3HFGA 5EY5B 3TECE 2GZMA 2JFZA 5A1JA 2B98A 3OICA 4DA6A 3QV1A 1RP7A 4PR3A 5FTJA 5LU8A 2NM0A 1MABB 1JLHA 1SQ6A 2XA1A 3WLLA 1TO1E 2J4FA 3VRHA 4PG4A 1ZOIA 4IWNA 1G6Q1 3G0CA 1FYDA 4PPQA 2N42A 1W4CA 3Q9UA 4GFDA 4Q4HA 5HUJA 5T5QA 3WGMA 1PWEA 2ZSUA 4RMJA 1PR4A 2Q1WA 2VPWA 1BQ3A 1DAEA 4FNMA 4QUGA 3JZDA 2PGXA 5EJFA 1JKMA 2C4NA 5D5PA 3V4SA 4DRZA 2C7OA 1GKYA 1JFTA 1OZHA 2QJRA 3QSYA 5HUHA 2PT6A 3V1UA 3QVVA 3WRVA 3KD2A 3G1WA 1JSLA 4Z8XA 3BGWA 3SN6A 3CEHA 2BFEB 1DBPA 2X9QA 3MFYA 4G0XA 4HZUA 2XEXA 1FJHA 3A3YA 3LX8A 1B16A 5I9TA 4XQCA 4XB1A 2XRMA 3U3RA 5JBIA 1SC6A 4OXQA 2EBWA 1TT5B 3E82A 4C4YA 5IJZA 1GHTA 5ECGC 3TW8A 4CUKA 2Q50A 3LT1A 3U1VA 4C6TB 4B33A 2OXRA 4G5SA 2ZBRA 3EXG1 3LVFO 2AZTA 1H8EA 1TM4E 4JX8A 1PL6A 4HQRA 4RY8A 3NRJA 4JASB 4PONA 1C8KA 1I7NA 3PKJA 2AS0A 4U63A 5LYJA 4UTOA 5D51S 3AUFA 4BMYA 1NBOA 2ZYAA 3PNMA 3V1NA 1ZXBA 2IGTA 2V98A 1PLJA 1BG6A 3M6LA 4WE3A 3RVPA 4CMIB 4E5VA 4LQ4A 5EERA 3STYA 2RGEA 3MTJA 2Q1UA 4M1KA 1KZGB 1NRXA 3JQBA 3QKTA 1U6JA 3A26A 3WKEA 4GW3A 4W9NC 3UANA 2PGIA 3Q98A 3DCJA 5TLSA 2G80A 4Q47A 4J6FA 1R0YA 2O6LA 3DH0A 4R51A 1NFFA 4GP6A 4LXYA 1C9EA 4AMZA 4FR2A 3RVNA 5EZQA 5LQAA 3I23A 5F77A 2GBLA 3LBFA 1ZI9A 3HDTA 2I65A 3AGPA 4PYRA 4Z99A 3QOFA 4W5RA 1FL9A 4KPEC 5JSFA 1YUNA 2NU7A 3F4KA 1DWQA 4YASA 5AR1A 1P7VA 3E8SA 4H7KA 4A1OA 3D3EA 3QVLA 3UKOA 1REQB 3EAQA 2NO1A 3E4DA 4OHRA 4MCAA 2EEPA 3M4YA 2FH5B 4R54A 3VYTB 1RCUA 5IP5A 3C6XA 5IEBA 1AYUA 2Z6QA 3VYUB 2YY5A 3MAGA 5AKLA 3ANXA 1KAOA 1TZ2A 4R2LA 2XT9A 1ZY2A 3MGBA 4ZVOA 2E0IA 1RYNA 4HFNA 2ZWMA 3VBCA 1CZLA 1WW3A 3IO5A 4A4DA 3DE0X 4M1QA 2C9ZA 3E8XA 4IF6A 1DQSA 4UDNA 3FKSA 2PMBA 5F21A 4K3VA 3RT9A 3MUFA 1AZTA 1K0FA 3AF0A 3HNRA 1YZTA 2L82A 1L4MA 4JNCA 1MG5A 4PQEA 3D8RA 4IMRA 4QXPA 3DMTC 1C7JA 2P6UA 3F5MA 5E3JA 1A9XB 4HNAB 2RC5A 3NTRA 3HKBA 4Q3OA 4U2CA 3FVTA 4D9IA 1ZVVA 3LQ2A 1NBMA 5JJLA 3ASUA 4M0DA 2OXEA 3VGPA 1UBUS 2CJFA 3HCNA 3JQ9C 3OCJA 3ICCA 2VJLA 1L7PA 3RYCB 2FE4A 4RSRA 3ZU4A 2GCEA 1WIWA 1VJGA 4HP8A 4N7BA 2GBIA 4D9FA 5CFPA 2D6FA 9ATCA 3MMZA 4YYVA 2ORED 5BR1A 4RGBA 1F7UA 4MRVA 2J7PA 2G7MC 3U09A 1G7TA 1KRWA 1E8DA 2TSYB 2BEUB 1DSSG 4YMSA 4ZO8A 2O05A 2QL5A 1A7KA 1HOXA 1WG8A 2VH1A 3JTEA 4UNIA 3DOIA 1MMFB 3PYXA 2KLHA 4IIFA 4HYQA 3A10A 4YJKA 4QVKA 4P8RA 4DNOA 1O94C 2IEAA 4KUEA 3KTAA 1RM4A 3MXOA 3E81A 2V0GA 3K92A 3IAM1 1NZJA 3IBFA 3PUZA 3QA9A 4PQYA 1QDEA 5TQVA 5CA0B 1MIOA 3BD7A 2YHBA 1YBHA 4YJDA 3WP0A 4XOUA 2HXSA 4I5EA 2C8VA 3OLCX 4J0IA 4AWAA 1Y5IA 3Q10A 4X1IB 4A8TA 4BRZA 1WSDA 2QBYB 4YAUA 5JYDA 1GGNA 3TTXA 2P1DA 4OOEA 2W6MA 2E85A 2JDID 2WWRA 2I0FA 3QPVA 4JH0A 4Y0NA 4ROSA 4CETA 1N92A 4D0SA 3BXEA 2IVZA 1JEJA 3GA5A 4OK6A 2PNSA 2GYUA 4L9AA 1IJKA 3Q0EA 1UK7A 2HREA 1CV2A 2Q2OA 2QN7A 1G0OA 1DKPA 1RJFA 1UT8A 3QLUA 4II3A 4L8FA 1G2PA 1XT6A 2ISSD 3O8OA 3LO5A 3TRDA 5JS7A 2ZTSA 1C0EA 2XRZA 4G81A 1YRQA 1WSWA 4D2IA 1CDOA 2IDZA 3N58A 1EUCB 2DX7A 3RJ5A 2PH3A 4WN3A 4CF5A 3DHEA 1N5LA 4OP1A 4ZHQA 5E7MA 3NTXA 2GHUA 3HCDA 2O0HA 1B15A 3VR5A 4R2JA 1DAGA 4KCGA 1J5EB 2RG7A 1PT5A 1ZD9A 3JATA 4JZKA 3W79A 1SUBA 4O4IA 4ON9A 3K6JA 3UMVA 1DINA 3AZQA 1NBME 1QGED 4CWAA 4PS1A 4NK4A 3W31A 3KYJB 1FVFA 4AP6A 1NU8A 4P9NA 1F06A 3JTMA 1VLMA 4OI4A 3ZHQA 4BC0A 4UTNA 4ZCTA 4RE5A 5TJHA 1W85B 1VCMA 1VM6A 5KIAA 3IIJA 1Q57A 2FPIB 3CPSA 3ESYA 3O3NB 2I9KA 1GLGA 4AYXA 4QLOA 5E3HA 4EG4A 4KFCA 1NJ6A 4G1CA 3WC4A 2BR4A 2V4ZA 4RXMA