3TRKA

Structure of the chikungunya virus nsp2 protease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
321
structure length
321
Chain Sequence
NAFQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPVNRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Chikungunya virus nsP2 protease
rcsb
source organism Chikungunya virus
molecule tags Hydrolase
molecule keywords Nonstructural polyprotein
total genus 87
structure length 321
sequence length 321
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3trkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3trkA01
3PX2A 3VC2A 3LGAA 3HNRA 4YV2A 2R3SA 2B78A 1NT2A 4NECA 4C04A 5EKXA 3VC1A 5K0BA 3KPWA 2I6GA 2P35A 3FPGA 3OZRA 4EVIA 4PIMA 2ZWAA 5HFJA 2C7QA 3NWBA 4PGHA 2KW5A 3BT7A 3NDJA 2FRXA 3K6RA 1FP2A 5E9JA 4CXMA 2GA9A 5F2OA 4A6DA 1NBHA 1SUIA 4RVDA 2C7PA 4MIKA 3BGIA 2ONZA 5E9WA 2AOVA 3T7TA 4C08A 1JR4A 5DWQA 3KQOA 4C03A 1JTEA 5ICGA 3A7DA 2PBFA 2ZBPA 3KPYA 3QV2A 5CVUA 5KQRA 3B3JA 2UZ4A 4FSDA 3KQQA 2P3OA 1IY9A 4EQZA 4E33A 3P9IA 2E5WA 1XCLA 3HVKA 5LQKA 4Y2HA 2VDVE 2I7CA 3R6TA 4ISCA 4CKCA 5CVDA 2B9EA 5FQOA 4DCMA 1R6AA 5E1DA 5EMKA 4DKJA 2AN3A 1DCTA 2YXLA 2NP6A 3BWMA 1KXZA 4RTNA 3HCAA 5E8RA 3FYDA 4RYLA 2WA2A 3ER9A 1DUSA 3FUVA 1WY7A 4M36A 5E2BA 2HR1A 3UJ9A 3CBGA 1WS6A 2PXXA 4R8RA 3V8VA 3B89A 1NW5A 2H11A 3ANXA 4GUAA 4KDRA 3DR5A 3KPVA 1AQIA 4RTRA 5EVJA 1D2HA 4HSGA 5IH3A 2NXJA 5DM4A 2HV9A 2QRVA 3TKAA 3I9FA 3FTCA 4KW7A 5E1OA 1RI1A 3KQMA 4JXJA 2O0LA 5HOQA 2FK7A 3E8SA 3MQ2A 1G6Q1 3KPUA 4ATNA 1YFJA 1JQEA 3CJQA 3HCBA 4E31A 1X1CA 1HNNA 1KPIA 5HIMA 1FBNA 2FK8A 2P41A 1N2XA 3P9NA 3X0DA 3MHTA 4P7JA 4H0NA 1WXWA 3CJRA 4ER0A 2JG3A 4AZSA 1XCJA 4RTKA 4IKPA 1L3IA 2IP2A 3NMUF 1RI3A 2G8NA 1Z3CA 4M37A 2BR5A 3KR9A 3DMHA 3ER8A 3M70A 5DTMA 5EC8A 2OB1A 1VQ1A 3KQTA 4FT4A 1TW2A 1UWVA 4X41A 3TPZA 1NW7A 1M0EA 5LSAA 3Q7EA 3UJCA 2Z6QA 1TW3A 1O54A 3FTFA 1VLMA 4MQ4A 4HGYA 4QQNA 3UJ6A 1JG4A 1R00A 5G02A 2ZTHA 4YUWA 2O07A 3B3FA 3HCFA 2P1DA 1RI4A 2AR0A 5LR6A 5DLYA 3EPPA 1XTPA 2DULA 3BKWA 4OQDA 5DM1A 4Z2YA 4E2YA 5CCXA 2UYQA 3FUTA 1PJZA 5H02A 4C06A 4ER3A 2IBSA 5P8WA 2Z6AA 5T64A 1PRYA 3TLJA 2VZ9A 2ZZNA 5BP7A 2CMGA 2YXEA 5EIFA 4GC5A 2JH9A 2PT9A 1ORIA 1RJEA 5GP1A 3SM3A 4QDJA 2ORED 3V97A 4PNEA 1FJXA 3DXZA 2BR4A 2H00A 2PT6A 3M6VA 4YUXA 5BW5A 3M33A 1MHTA 3D2LA 3HCDA 3HEMA 2YXDA 3LCVB 5E2AA 3GGDA 2G1PA 4RX1A 5DM0A 3TMAA 3T7RA 1KHHA 4LWOA 3G8AA 2G72A 1VE3A 3PS9A 4AZWA 4E32A 3MTEA 3OFJA 4P7GA 4PWYA 5HIJA 3UJAA 2NXEA 1VP3A 2PX8A 3OZTA 3LL7A 2ZVJA 3M6XA 5CIYA 1YB2A 5EMLA 2XYRA 2YTZA 4WXHA 1Q0SA 1NW3A 1RJDA 1YFLA 3HVJA 3HA5A 3I53A 4P7FA 4BP1A 3ELYA 3GIWA 3GRZA 5DXJA 2BM8A 3ELDA 1X1DA 1SQGA 2AOTB 2BR3A 3CGGA 4B17A 4RTPA 1XDUA 1Q0TA 4CTJA 3GDHA 3GNLA 2PWPA 2IDKA 2IFTA 2OB2A 3IEIA 4FT2A 4YUYA 2VDWA 3JWHA 2VS1A 4IV8A 3DH0A 1WXXA 3BGDA 3EVFA 3LSTA 2AN5A 4PGGA 3CKKA 4RVGA 4LG1A 5EMMA 5U4XA 3A4TA 3TM4A 4BLWA 3CCFA 2YQZA 2UYCA 1RI2A 3B3GA 3EVGA 2V7EA 3GRUA 5EHIA 1JTFA 5LQRA 3K0BA 5HILA 4PYOA 2DPMA 3C6KA 1X19A 1N7IA 3FUWA 4PYKA 3LCUA 4L7VA 1O9GA 4PYMA 1N7JA 5GOZA 4BY9E 3ERCA 2QRVB 3DMFA 2XBMA 1VBFA 2EX4A 2P7IA 2AVDA 4EMSA 3AXTA 1AQJA 1VP9A 3C0KA 4GBED 3NVMB 3LBYA 4DMGA 3R24A 5CVEA 1KP9A 2XVAA 3HVHA 1T43A 3MCZA 3P2IA 1ZKDA 2P3QA 3ME5A 4ER6A 5K8VA 2UYHA 1YF3A 2AOUA 2QY6A 3G5TA 3OE4A 1NW8A 1P1CA 1SG9A 1I9GA 1YZ3A 3BUSA 1KPGA 3GCZA 3EMBA 3P71T 4HC4A 4R6WA 5EZSA 2G71A 2O06A 3E05A 3LPMA 3PFHA 5FULA 3SMQA 3U81A 4PYLA 1KYWA 2GLUA 3ID6C 1U2ZA 2IIPA 5ICEA 3B7PA 10MHA 4OA8A 4AZVA 1SKMA 5MHTA 3PTAA 2N47A 5FA8A 1NW6A 4CTKA 2ZFUA 3EMDA 3P9CA 2CWWA 3LKDA 5K0EA 4PYQA 3C6MA 5BW4A 5K03A 3IYLW 3FUXA 5B1SA 5DRYA 1P1BA 3HCEA 3I5UA 3MAGA 5DPMA 5ERGB 3OU6A 5GM2A 3Q87B 2GH1A 1KR5A 3C3PA 3SSMA 3P9KA 2IBTA 2XYQA 2CMHA 2AVNA 3A27A 2C7RA 4F85A 2C7OA 2PSSA 5EMJA 3LCCA 2ZWVA 2PV0A 4RVFA 3BXOA 2P8JA 3NVKI 5E9QA 3SXJA 4ER7A 1R8XA 2YUIA 3FRIA 1G8SA 4X1OA 1ZGAA 2Y1WA 1ZGJA 4FSXA 1SUSA 4HG2A 4U7PB 1EAMA 2XYVA 3PFGA 5FADA 1RI5A 2HWKA 1L3CA 1AF7A 2FCAA 3ELWA 3EVZA 2YR0A 5GINE 2Y1XA 1VPTA 1L3BA 5K0LA 4DQ0A 4GOMD 5HIIA 1RJFA 5EGSA 3HA3A 3UA4A 2ZBRA 1G8AA 2QE6A 1R74A 4E2ZA 1QAOA 3KQSA 1ORHA 3KU1A 4BLVA 3KHKA 3PB3A 5CM2Z 5LQCA 3FUUA 3GWZA 1QYRA 2NXNA 2PKWA 5GM1A 2NNWB 2CL5A 3QOXA 3UJBA 8MHTA 3DP7A 3EGIA 2OKCA 4X61A 1P91A 7MHTA 4QPNA 3PT9A 4DA4A 3AJDA 2QM3A 4RVHA 5FTWA 5DX8A 2BM9A 5IKMA 2XVMA 2I9KA 1X1AA 3P2KA 4RV9A 3TQSA 4MWZA 5HIKA 1VIDA 4GEKA 2P3LA 5DM2A 5D1HA 4CKBA 1M6EX 3EEOA 2PY6A 4BLUA 1M6YA 1EJ6A 4PYNA 2LD4A 3SVZA 4R8SA 2FPOA 5KS2A 1EJ0A 1V39A 3VSEA 4KIGA 2B3TA 4RTSA 3GXOA 2P7HA 3GO4A 4YMHA 5DT2A 4CKEA 4HRAA 4F86A 4QQKA 2YVLA 3EVDA 2AN4A 3KQWA 3MGGA 1HMYA 3HA7A 3G5LA 5T6BA 4FP9A 2OXTA 5CCBA 2GS9A 2ZBQA 3FPJA 2I62A 4QTTB 2ZCJA 1JG1A 2ZZKA 3A7EA 2EJTA 3FRHA 4OBXA 4AX8A 5C0OE 2HNKA 5DX0A 3UA3A 5T67A 1D2GA 2IPXA 4AZTA 4YUZA 4G56A 3O4FA 3AXSA 4QPPA 2ONYA 5K01A 4XUDA 5DSXA 4C07A 4POOA 1NV9A 2JJQA 3SSOA 4EKIA 3KR1A 3BGVA 3EGVA 4RTQA 5GIOE 2AS0A 2R6ZA 3EVEA 2FYTA 3EVCA 4E2XA 3TFWA 4YV1A 3UBTA 4WVLA 5K09A 2PX4A 3OPNA 3TM5A 2AOXA 3EGEA 1EG2A 2VP3A 3PVCA 4OA5A 3O31A 5EEHA 3SSNA 2NXCA 5LQUA 4C4AA 1G55A 1WG8A 3I58A 4E2WA 4RTJA 3E23A 3OZSA 3JWGA 1ZQ9A 3MCTA 1OR8A 3C3YA 3EEYA 5EG5A 5GWXA 5LQJA 3DULA 3M4XA 3MTIA 3THRA 3LHDA 3UJDA 4O29A 5FA5A 1NE2A 3SR4A 2PVCA 3GU3A 3AY0A 1B42A 4XUCA 3NDIA 4R05A 1ZHFA 4QVGA 2EJUA 9MHTA 1L9KA 1NKVA 2OZVA 2P40A 3ELUA 2ADMA 1DL5A 1QAQA 3P97A 2JHPA 1TPYA 3OU2A 3FTDA 4RTOA 2ZIFA 2PX2A 3NW9A 5DTQA 3FPHA 4M38A 4KIFA 4M7RA 2H1RA 4RTLA 3E7PA 4YMGA 3KQPA 2PWYA 2YX1A 4V0RA 2IGTA 3O7WA 3LECA 3KQVA 3P2EA 4FZVA 1EIZA 2GAFA 3DXXA 2ZZMA 3M6WA 1JG2A 2EFJA 2OY0A 2GPYA 3IV6A 3NTVA 2QYOA 3DMGA 3MERA 4PCLA 4KWCA 5EHGA 3HCCA 3RODA 3HP7A 5JUWA 4PCAA 4PONA 3CVOA 3H2BA 3HTXA 4HGZA 3R0QA 3SGLA 3FTEA 2AOWA 4GOND 5FWAA 4LWPA 1JSXA 2IH2A 4OX9Y 3A26A 2O05A 4Y30A 3FPFA 5DRTA 5K0JA 3G89A 5C1IA 5KVAA 5K0FA 3UZUA 4RWZA 4DCGA 5FUBA 2JHCA 3OU7A 2V74B 3LDUA 1R8YA 4E30A 1XXLA 4PYJA 1G60A 2OO3A 3KR0A 1QZZA 1D2CA 4X60A 2K4MA 4R6XA 5K0GA 3UFBA 5M5BA 2Q41A 4QDKA 1IM8A 2G70A 2OBFA 2IH5A 4HH4A 5LQNA 3TR6A 3VYWA 5BXYA 3G88A 1O9HA 4E70A 4CWAA 3ORHA 1BOOA 2ESRA 3EVAA 3G2QA 2PGXA 3MB5A 1FP1D 1IXKA 3UJ8A 4PINA 4F84A 1EQAA 5DX1A 4A6EA 2AOUB 2ZIEA 4GQBA 4OQEA 1AV6A 2AZTA 2WA1A 3KKZA 3I64A 3S68A 3GRRA 2NP7A 2ERCA 3B5IA 3T7SA 5CD1A 3F4KA 2JHAA 5EOVA 5EPEA 5EKUA 3NJRA 5JR3A 5KYGA 2EG5A 1BC5A 4FR0A 3L8DA 3FPEA 1RJGA 5E1MA 3UWPA 1G38A 1ZG3A 5K0CA 1WZNA 5DTRA 4P58A 5E1BA 1F38A 2UYOA 2WK1A 3OFKA 3G7UA 2A14A 2VDUE 1I4WA 2PJDA 3LDFA 1JSZA 1JQ3A 2IDJA 2ZLBA 3JWIA 3TOSA 3LKZA 5ICCA 1Y8CA 4DM3A 5HZMA 1INLA 3EVBA 4KVZA 3BWCA 5EQJB 4FGZA 4KDCA 3GJYA 4C05A 1FPQA 1NV8A 4ER5A 2B2CA 3THSA 1BHJA 5F2KA 3LBFA 3GRVA 5EZQA 3GRYA 5EIWA 3FYCA 3JWJA 4MHTA 3PX3A 5DSTA 3REOA 3P8ZA 3OE5A 4EKGA 2OYRA 3T0IA 4XCXA 2ZW9A 3BZBA 1XJ5A 2O57A 1VL5A 4RTMA 3DXYA 5C9ZA 1JG3A 2JH8A 2ZULA 5FHRA 5CVVA 2CKDA 5F2NA 1L1EA 2AOTA 4RSRA 3OCJA 4QTUB 1KIAA 3BWYA 2BH2A 5FQNA 5D1NA 2ZIGA 4ZTBA 5LQAA 3BWBA 3R9XB 4P7KA 2FHPA 1JQDA 2PXCA 3DLCA 4YUVA 3TKYA 4IWNA 3LDGA 4PIPA 4XUEA 3DUWA 3G8BA 4YV0A 1R18A 3M6UA 3RIEA 3UJ7A 5DXAA 2NYUA 3TRKA 2IH4A 3LX6A 4PYIA 3FZGA 4QVKA 1YZHA 1XDZA 3KPJA 2B25A 5GIPE 1BKYA 3G2PA 4LECA 5FWDA 5EEGA 4EK9A 4DF3A 4UOEA 4GC9A 3DOUA 3HM2A 2Z6UA 5KQSA 1UIRA 2HMYB 2HTEA 3DLIA 5E8JA 1YUBA 4OBWA 1MJFA 2PLWA 5CVJA 3BKXA 4HTFB 1XVAA 4GOLD 4MTLA 3G2OA 3HVIA 3KQYA 1SQFA 4U7TB 3AWIA 1NBIA 1X1BA 5ICFA 4HTFA 5K05A 3CJTA 3R3HA 1QAMA 4V0QA 5FHQA 4AUKA 4K6MA 1KYZA 1UFKA 3KR2A 2PXAA 4KRGA 3DTNA 1I1NA 3A25A 2F8LA 1P39A 5FCDA 3SX0A 4DZRA 4GOOD 2GB4A 1F3LA 2PX5A 3WSTA 1KPHA 1QANA 3PLAE 3RW9A 2BZGA 4IV0A 4GF5A 5HEKA 4FS8A 3G2MA 1H1DA 3QOWA 3IHTA 1XDSA 2ZSUA 5CUQA 4BP3A 5K0NA 1SVUA 3NWEA 4X63A 3CC8A 2OPBA
chains in the Genus database with same CATH superfamily
2E9SA 1YB6A 2IW1A 4HVAA 4LXQA 5G0UA 3SHWA 2X6QA 4CN9A 4A0HA 3ZY2A 4YRCA 4BECA 2O2GA 1YK8A 1JDSA 2X4DA 1XHFA 1QGZA 3RARA 1KSJA 1HNZB 1DOHA 2UVPB 2FQYA 3NWBA 3OEWA 4A5UA 4I5FA 4YYQA 3TOCA 6REQA 2PGDA 2Y0CA 1VRWA 2PH3A 1EFVA 3IOMA 5E6UA 4A6DA 1CNMA 2EEZA 2H4HA 3MXOA 1IUNA 3O4JA 1QC5B 2YFHA 2AOVA 4H7DA 2ZBEA 1SFRA 4D9FA 1YOVB 1D8TA 3NIFB 1VIMA 3BMQA 3HSKA 4PZPA 1ZS9A 5ICGA 1VG8A 4BBAA 1AKRA 1HOXA 4C0AC 2PBFA 1WPXA 3QV2A 3KXLA 2GZDA 4ZO6A 1TMOA 2ZUVA 3B1YA 2AFHE 4FYIA 1KE2A 3ZGNA 4YK7A 8ABPA 1FLVA 3LA6A 4QWMA 3H9UA 3MILA 2RONA 3QUBA 4LOIA 2G6DA 1SB9A 1M34A 2BFCA 4KE7A 4G4GA 3BORA 2OG1A 4TM7A 5AVJA 3ZXSA 2DXIA 1B8PA 1NN5A 4INJA 2C1XA 1QWOA 5HQ3B 3Q1LA 3FDZB 1WCIB 5DMHA 5E2BA 3PWSA 4DCNA 2VSOA 4RA6A 4GH5A 5PNTA 2HCRA 3A1TA 4GUAA 2OK8A 1J07A 1EQ2A 4F0JA 5IEBA 5CXQA 1P7ZA 4MX8A 5P21A 1YE5A 3FMIA 5JNSA 2WMYA 2Q9AA 2VRCD 1TYAE 3IT0A 4R2XA 1JYEA 4FGSA 2Z57A 3E3OA 3C48A 5D3KA 3O8RA 2E02A 1SUBA 3KP1A 3FDXA 2R8XA 3BXZA 3C3DA 3OPQA 2PMWB 5TMPA 1XYVA 4IINA 3AEKA 4Y6OA 1VPLA 1XELA 4BDTA 2FK7A 3V8NA 2XE7A 4GWGA 3KPUA 2AYOA 1X7ZA 4QU0A 1D2AA 2OHXA 4OU4A 2CHEA 1Y1KE 2QX8A 2E37A 4WZAE 1N2CA 4YP6A 2BH9A 2J09A 3AC0A 2CL0X 3C3CA 4I1YA 3SS9X 3H6SA 4BLRA 2PZBA 4ZTZB 2JG3A 4DDKA 3SNHA 1MW9X 4EAQA 3I76A 3KTDA 5CLFA 4P7BA 4BRZA 1DRWA 3HKEA 5DN6D 4ITUA 2Q8NA 2CXHA 2BR5A 4MQBA 5IZCC 1Y7PA 1GPMA 1SXIA 2CVQA 1V1JA 2GZSA 4HNUA 5DTMA 1UJMA 5EC8A 2BI7A 1YZVA 3ECSA 3M2PA 5I3CA 1HDIA 1N1DA 1VYUA 2QZSA 5AI6A 1AECA 2RAVA 1UPAA 1W75A 2ZJ2A 1DBVO 3N3KA 2ZJYA 4MV3A 2PLNA 1ZIXA 3R1IA 4OQYA 2CLFB 5DOZA 4EY4A 3SYNA 2VJBA 3DQZA 3MD0A 5KOYA 1EM6A 4BLTA 1P4RA 1XTKA 1U0OC 1JR3A 2JCSA 2R1TA 3AJEA 1W46A 2FKNA 4FNAA 4L51A 3S44A 3TLJA 4KP7A 1S1CA 4V02A 3PXGA 2ZAMA 1Z7BA 2ORED 3IALA 3L0ZA 4QDJA 2ZT5A 1DGQA 2DCAA 1U0RA 4CFYA 5E2AA 1MHTA 3VR2D 4Z9FA 4TQ9A 1B8OA 3GGDA 3VNVA 1A96A 3IL2A 3H9QA 3AHEA 3ACCA 1CQIA 4LWOA 3AF6A 3HLYA 4MDHA 1Q1NA 2XQGA 1W49A 4YRPA 3GL9A 1SKUA 5JH7B 3RK1A 4A1FA 2NSDA 1NMYA 1Y9JA 4J03A 2IPMA 3S28A 1U0NA 1E7MA 1Q74A 2OXRA 3M6XA 2B1IA 4E5DA 3H4MA 1NNEA 2V7PA 3D3NA 4L9AA 2P4UA 4NZYA 1ZN2A 2A84A 3TKLA 5IKPA 3VVLA 1Z37A 5CEJA 4J9UE 3HB1A 1I3KA 2LIPA 2RHRA 13PKA 1E4YA 1QU3A 1FC0A 4NV0A 1UADA 4PNPA 3Q8LA 3MS2A 2ORWA 4D9IA 2A1TR 5JSQA 5EMMA 2DH6A 3KJHA 1T9DA 4KQGA 4YWHA 4C5CA 5BNWA 2WW8A 1A8UA 3GRUA 1T29A 3MT9A 3GJTA 4H27A 4C9BA 4PG8A 2E3JA 1N7IA 3I1YA 3IEXA 3NHBA 1R1DA 4JLSA 3UK2A 3JY6A 3OVXA 1ZJJA 1IQRA 5KSZA 2H5IA 4G1CA 4YRKA 3DMFA 1X42A 4ZALA 4RKEA 1Z4KA 3ILYA 4ONEA 1RM0A 3U3JA 3WXMA 4KE8A 5FUWA 3QKRA 1P44A 2ODBA 3B9BA 4HS4A 4WOJA 1EE1A 4TVSA 3CO5A 2IHKA 1TKCA 1P9WA 1WQ4A 3OE4A 5THQA 3TGWA 4BQVA 1EEHA 4IZIA 4DY6A 4M1EA 2GFOA 1DIAA 1X38A 1NUPA 4RFSB 5EJFA 1ILEA 2P6PA 3EY9A 1YE3A 3ROZA 4IJMA 4P6EA 1I4LD 2Q6IA 3H2IA 3ZWWA 1UMDB 5FV7A 5KVVA 1QTQA 1LJLA 3ZQ4A 4RL6A 3U4DA 1HM5A 2BN4A 3D0OA 1V8FA 3BB4A 4QU9A 4TUYF 5ICMA 2VK1A 2OBMA 2W70A 3WK8A 4AY2A 2ZFUA 3A9VA 1NVVR 4ND5A 3R7BA 3ZJUA 3C6MA 4HQRA 1CT9A 4MJXA 1ZJ4A 1JJFA 3I2HA 4LHZA 5HR5A 3KFXA 5HS6A 3AR4A 1BVYF 3O38A 3GLFB 1U94A 1H42A 1UXIA 4AY6A 4XGRA 4MDFA 3Q87B 3NYRA 4FEYA 4KR7A 2X1VA 1YS2X 4LDZA 2QUIA 3ZXXA 4UTPA 1Z4LA 1P4HA 3BL6A 1WUTA 5EUCA 1GTRA 2C7OA 5I3ZA 2PSSA 3CUSA 1VI5A 2DKOA 2HK6A 1GPH1 4WDQA 2A5YB 1ONSA 1LPBB 4EY6A 4CMBA 1XZQA 1FMCA 4U3JB 3A1DA 2R1ZA 1C7IA 3D8TA 4BJHB 1UQTA 1XTVA 3H0EA 3WSWA 4B45A 1EAMA 4BX3A 1ZAKA 3FBTA 3WRXA 3UCEA 1XDGA 3H8JA 4BX2A 4WTOA 2CJPA 4JBGA 1XXHE 2CBXA 3BF7A 1KF0A 3GB9A 3JQDA 2XKJE 1RACA 4LXHA 3ZV6A 4FUTA 4BE7B 2XIJA 3FYSA 2ZRLA 3O2SB 1G3QA 3B60A 4ZCLA 1ORHA 2OXCA 2GF9A 3CSUA 3K31A 4Z1MA 1VE1A 2QJWA 4CF3A 2QRPA 3IFUA 3I62A 1KMHB 1KEZA 2IE0A 2Q6VA 2HWWA 3DP7A 3QKIA 1P91A 3MYRA 2P62A 1G4AE 1DEOA 4IRMA 2BONA 2FWIA 3GUCA 1DOZA 5IMSA 5FTWA 4OP3A 2I34A 3N76A 3VR4H 4GVXA 4WCDA 3REFA 1KRXA 3LC1O 3A4YA 4HMPA 5ECYA 3F4BA 3OLCX 4W7HA 5D1HA 1Z5ZA 2ZU6A 1DUIA 3ONFA 1M6YA 3GVHA 4K28A 2LD4A 1CVLA 4BLUA 5IYZA 1WP4A 5KS2A 2VUHB 4DSTA 3L8FA 3MPOA 1Q95A 1EVEA 3H6HA 4PQEA 5AO9A 1Y3FE 3AVUA 3VU3A 1D2NA 1Q6YA 2HK7A 3UOAB 1ZSVA 3FY4A 4IYJA 5BV8A 2Q3JA 5CYGA 2YVLA 4LCBA 3LUHA 2OLKA 4AJOA 3WLTA 5CCBA 2O5CA 3TNYA 2IDZA 1XXHA 2BDEA 1SIOA 3KXDA 1KZ9A 4KBFA 2CJFA 3A37A 4KJXA 5EJ2A 1N0UA 3S2UA 3ZV5A 2PL5A 3IXQA 4DE5A 2R6AA 5B7NA 2UUAB 4NI5A 1L5SA 1D2GA 4JI3B 4D0NA 1YJQA 2CEKA 1NU8A 1M0WA 3GJ8A 3H2GA 2V6MA 3MRXA 4XUDA 3KWZA 3EN0A 3HWNA 3QA3E 2V55B 1R9MA 2WIKA 2XXAA 4XM1A 2XMDA 3UBTA 1CP2A 1HYEA 5T4HA 3ZXYA 5KINB 1EWMA 4HQ0A 5DK4A 1UZUA 4WIAA 3TM5A 4JEIA 4GR5A 4BOUA 1T9BA 2FEWB 1FYEA 2Y76A 2Q0HA 3C3YA 2QRUA 1V2HE 3GUYA 1S8FA 3NRBA 3C87A 5SZHB 4BO3A 3LQ4A 4WI1A 1AO3A 3HCWA 4JC0A 2RBEA 3AFIA 4CDEB 1ZHFA 4D96A 1QDQA 1RIIA 2O8NA 3FCCA 4YUWA 3KUCA 2W2PA 1Z4PX 4UXHA 4YBZA 2JAUA 4U2FA 1SPXA 4FOLA 5ECWA 4EY5A 3FJOA 2G4CA 2PJUA 3Q5EA 4K81B 5DTQA 4J0EA 5GJCA 4K8OA 2MMGA 4YQYA 1ZO8A 3DLPX 3QG1A 3N0TA 3VR6A 2V3WA 2H7YA 2J5KA 1V5EA 1BGWA 2B36A 3EISA 3HJUA 3IB3A 3KEGA 2BEWB 4JBYA 5NLLA 1JG2A 1MB2A 1MDFA 2GPYA 3AL2A 3OZFA 3UPDA 4RJ2A 1QIDA 2IZOA 2FSFA 4NV3A 5KDLA 4Z4CA 2R9NA 3ASYA 2C07A 1CCWA 3F71A 3S2IA 1ISFA 2XA1A 3VTFA 1EXNA 1BWPA 2IHZA 2G9VA 1NJ6A 3D6VA 4U00A 3DBLB 3G82C 5IABA 3IPCA 2JFGA 2O05A 2HHAA 4K9KA 4LYYA 4FK5A 2Y1DA 2GF2A 4WFJA 5TY0A 3T34A 2P2SA 2GFQA 2JJ2D 3KJXA 2Z5GA 3LF1A 3OQJA 3PPVA 2K7FA 1YQQA 2AHRA 3KKPA 2V65A 4D9CA 1U7UA 3SVLA 3P4UA 1DTEA 2P86A 2OV1A 2QTRA 1ZVJA 4Y1EA 1LH0A 3GOHA 3VJLA 4YCMA 4IGEA 2B5WA 3HRKA 1MS6A 1PR4A 4J16C 2Q5CA 3PLRA 4G5GA 5C5CA 1KQGA 5HZKA 2FWBA 1EWRA 3CF2A 3PCTA 2V45A 1QMGA 2FUEA 3CPEA 4OJQA 4HZIA 4BFYA 2WZBA 2VTDA 3O03A 1E3WA 1QHSA 1TUBA 2GR9A 2L42A 4OMDA 1BS2A 1DX4A 2IT1A 3ORHA 3U8EA 3G2QA 2DHRA 3COVA 4K26A 5SV2A 4FXOA 1I7NA 4OQEA 1AZLA 1SVKA 2J59A 1JDTA 3MTVA 5CNJA 1Z5WA 3U61B 1DO8A 4MPDA 3ZHRA 3ZZMA 3OA0A 4UW9A 2GVZC 3QKRB 1ABFA 1LWNA 3QMMA 2GEJA 5H81A 1U2TA 1G20E 3FN4A 3HDJA 1UF9A 2JFNA 3RC3A 4G97A 2Q9UA 2F1IA 1Z8NA 2XB9A 3LVFO 5IZCA 1JWLA 1YKSA 3TNXA 2J9RA 1RAGA 5TC4A 1RWMA 1IXRC 2X77A 3HBJA 3LBNA 1XD2B 2XZTA 3LCJA 4Q8GA 3NKLA 2D00A 2XCIA 3R09A 1S7CA 3PA8A 4G1VA 4TS9A 2PJDA 2QWXA 3LDFA 1MRNA 3WKCA 1K2WA 1NP7A 3EIHA 3DVLA 2X0EA 4GI5A 3HH8A 1AQNA 1HEIA 3D8SA 1H0RA 2WWTA 3HD3A 2ZRJA 4WNAA 1KRHA 4KDCA 1U98A 4UUMA 1VFPA 721PA 5F33A 4D56A 2R96A 1NIJA 2FW1A 2CN1A 3THSA 5JSFA 3WGHA 3ICQB 2FPWA 2PNSA 5KO3A 4KXUA 3SD7A 4AY4A 2J5BA 5EIWA 1K9SA 5D84A 3VSDA 1ACMA 2AUZA 4K2HA 3CT6A 2JCVA 1ODIA 4RWEA 4OP2A 2C2KA 2NVOA 1Y0BA 2VP2A 3KYDB 2P5UA 2AJ8A 3OT1A 2FQQA 3UFXA 1GTZA 3EZNA 4D45A 4YYRA 3HJTA 2CKDA 3NATA 4YTEA 2W2NA 1QH1B 4M9RA 3RSQA 4BNMA 3AVPA 4ZVMA 3AYXB 2RI6A 1W19A 2G77B 5DEIA 1X7YA 2GWHA 5ER6A 3I0ZA 3O4VA 5LQAA 2GD6A 2QV7A 1C7ZA 3FSGA 3JTMA 1OZ0A 4P7KA 3ZWNA 1BWRA 4DREA 3S81A 4OHZA 3DLCA 3ZOZA 3C3BA 4IWNA 1SQ6A 1ZOPA 1AMNA 4YRZA 3GWGA 1VLVA 2NYVA 5DW3A 1H22A 4QC2A 4YRTA 3ZGOA 4KZKA 3MWEA 2AX3A 2I6SA 3LG2A 2V5VA 3ESCA 1NJ1A 4K8RB 4EO9A 3H5OA 5JNUA 4UZFA 1PHPA 4JSTA 1X80B 1U9IA 3VA7A 3RJ5A 4Z7QB 4HVLA 1GECE 3S8EA 4BKMA 1P5JA 1YA4A 4NZNA 3L7OA 5DGHA 1ISRA 4PIVA 3HN2A 3TLMA 2JCBA 4YRSA 3ONEA 4RK1A 2NUTA 3QQ5A 4BNGA 4RL4A 1WXHA 2ERXA 1FTYA 2I7XA 1CK4A 3PDUA 1I3LA 3HR4A 4FDVA 1OTXA 2OKGA 4Y7CA 3NEYA 1A5ZA 4JL8A 5H7XA 5ICFA 2O5VA 2R5NA 4LWZA 3I12A 2M1ZA 1LV7A 3VU9A 1OASA 1OUMA 3ZH2A 4BHTA 4YY3B 5CH5A 3E2PA 4NYJQ 4UJ5A 3FF1A 3DTNA 2FZLA 4QICA 1CJSA 1W4ZA 2WF7A 1MO3A 5ADWA 3X1ZA 3AFGA 4GOOD 2HUPA 1SCKA 1CYEA 3GYGA 2FFBA 3AO0B 3DDCA 4BOPA 1A7AA 3RW9A 2F55A 3WGMA 5I9BA 1JILA 1HPLA 2PL9A 5CJJA 3WBFA 2Z6VA 4CI0B 3C8ZA 1UBGA 4LNUB 2XQKA 1H0KA 3OY2A 1UDWA 4M0WA 2IDMA 3SJBA 1W36C 5K51A 2I4LA 3MWYW 3LOPA 2BHRA 1OXVA 1EX6A 5CDUA 3WGKA 1P74A 4NECA 1S2IA 3KYCA 1BXRB 3KOXA 9ATCA 4DQXA 1QZXA 2OOKA 3IAFA 4MROA 5BRJA 5J94A 3E4CA 2ZWAA 1XEXB 2Z3WA 3H6KA 4Q9HA 3WXFA 2XUAA 1CJUC 1KY4A 4OOEA 4N0DA 5FL3A 1BRTA 3N6XA 1UMBB 3DJFA 2JKYA 4CUKA 1KQNA 3JVVA 5AW1A 1MC1A 1SUIA 3F6RA 4YXFA 1ULHA 1WTAA 2QQ0A 4L0CA 1KU6A 4U39A 5LKAA 1GQFA 4CMAA 4IIDA 5C53B 3O65A 4FOOA 5CTJA 4WCVA 1PVVA 2RHTA 3I92A 3SBDA 4V03A 3DNFA 3ANLA 2J9GA 1OT5A 2EJBA 2DU8A 1BGXT 1E1KA 4ZYTA 1ZUHA 1L5OA 1QHHB 2MSLA 1ATZA 2VAWA 5EIBD 4MZDA 1IY0A 5B1DA 4E4RA 3L8YA 1DKLA 4J0KA 1TM1E 4CHGA 1VG1A 4R3UC 3KG2A 4EGAA 1QRAA 5EA2A 1W9HA 2CD7A 1ABEA 3IQIX 4B7UA 2EKZA 3QY9A 1AUOA 5DNUA 4FKBA 4EF4A 4FONA 4MIEA 4JJIA 2AN3A 1B93A 5I6DA 4DSUA 1RABA 3IIMA 2RAUA 4IXDA 2JQFR 4C0LA 3OI7A 4RCYA 4L4YA 2ZQYA 4EFLA 1ZL2A 4QXPA 1H2ZA 3I0NA 2B0CA 2DE0X 2V4ZA 4R8RA 4TZKA 2H11A 2EZUA 4E4TA 3GNQA 3GROA 1QLJA 3GLKA 3KAQA 4KN8A 4GX1A 4DA7A 2Q2VA 2VK2A 4EKYA 2A9QA 1JXQA 1ULAA 4KR0A 2NO0A 4PX5A 3AYZB 1Z7GA 4JXJA 4UNSA 5BSEA 1SEPA 2RAPA 3E8SA 3CG0A 4YPFA 1ZY2A 1TM4E 1EWLA 2Y5BA 2O23A 3O0TA 5FB3A 3EF1A 3JZFA 2QU7A 2V6IA 2C2BA 1KPIA 2H4WA 2P41A 2R97A 3ZHZA 1XMQB 1Z2PX 4YJFA 4BCBA 3WBBA 4G9BA 3NXKA 1UBJS 4PTYA 3UH1A 1VIVA 3F90A 3SC4A 3LBIA 1MJ5A 1WXIA 3GEMA 4RJKA 4I5DA 4JT8A 1DXQA 4M37A 2G40A 1EUCA 2FJPA 4NMXB 1IWBB 1K75A 3E9NA 4MVJI 2EGGA 5U9CA 5AHRA 3U09A 1CUFA 3NALA 2PCJA 5DISB 4V1CA 5IBCA 2GEFA 1B0ZA 5EVCA 2WWHA 4EW2A 3FSRA 3BICA 3TPZA 1AHPA 1NW7A 4B74A 4U2CA 1O54A 2JAOA 1YJXA 2O2EA 3AIOA 3C7TA 3WNVA 1OAAA 1B6SA 2DYKA 3GMTA 3ZDXB 1W5TA 4MRSA 4N0QA 1MHWA 3H9GA 2Z2JA 1NVAA 3RT1A 4C7OB 2ISQA 1FSFA 3HKCA 1V9SA 4YGXB 3UENA 4PANA 3BOSA 1PV4A 1IAQA 2O1WA 3B1WA 3DS8A 3WGQA 5BY2A 2H7JA 5JYCA 1IY8A 4V24A 3W3AD 3ADKA 5EPOA 2PT9A 1SGWA 3CNBA 5C8YA 3HWX1 4EG1A 3K9BA 5KO2A 4IH1A 2YV1A 3UEOA 2OBXA 4UZSA 3RV4A 3ZCPA 1CF4A 1LX6A 2V9PA 1W76A 2YXDA 3ILXA 2ZR8A 3OCXA 1NULA 4MICA 5JIBA 3OMLA 3N39C 3L1VA 3L41A 4PLWA 3VOBA 4Q47A 4E1AA 2CXPA 1A9PA 4ZYXA 1K6IA 3L0CA 1JA0A 1MV8A 4P7GA 4M1QA 4N5HX 1VP3A 3I4CA 3N53A 1BMTA 3DYBA 3IUTA 2J3HA 1TEHA 2QP3A 4PFQA 4XTRA 1RJDA 4AWAA 2BGRA 2DY1A 3I53A 3JYPA 5DZSA 1CF9A 5DH9A 1YVUA 4V2IA 3UFXB 3MMNA 3QWHA 4MIYA 4Y2PA 1G59A 4CDGA 3EA0A 4LV6A 4DCVA 1GGFA 2VFAA 5DXJA 4B79A 1X1DA 3C85A 3TSYA 1Z5OA 3JQ8A 3A9SA 5B2EA 1ORWA 3DQQA 3Q7TA 3TRDA 4WESA 3ET4A 2AYYA 3SC2A 3W2EA 2SKEA 1VHJA 1WV1A 4XI9A 4Z0NA 3KHUA 2R62A 4IV8A 2YOHA 3GAZA 4XIGS 1ZEMA 3OZCA 1BD3A 4MV8A 2Y1KA 3AG6A 4YH1A 4QUBA 5B7GA 2M98A 2QLBA 3DBIA 4B2IA 4DPKA 4N7JA 1BU8A 4UHJA 3W6PA 2QAIA 5EHIA 1G291 4O02B 2YKGA 4CDFB 4AP9A 4KITB 1T1SA 5IVIA 3ZDDA 3QI2A 4P3OA 2X9GA 3U56A 2ZE5A 2ZB3A 4N1AA 3LCUA 2EZ4A 2PUVA 3GMIA 1IK4A 4CZ2A 1RWBA 2F59A 3E9YA 5BN4B 4JMPA 1QHEA 3HM9A 2FV8A 3O9ZA 1WNTA 4QLOA 2H4YA 2VF4X 2AVDA 3RAPR 1BVRA 3KSDO 2AEMA 1KYVA 1N2JA 5TRTA 4BMDA 4H3SA 4Z2AA 3HO6A 5B3AA 1L5FA 1TUEA 1YQ9A 2P3QA 4D9BA 2VJOA 2A9VA 2AOUA 3I23A 4G41A 4JUIA 4PLZA 3U26A 5JWRA 1N2GA 1YZ3A 3FWPA 4AMGA 1PWZA 2WYIA 2PZMA 3LPMA 3GPLA 4IXWA 4KC0A 1K89A 1KJ9A 3SMQA 3UIEA 1YB1A 1KYWA 2M32A 3PDWA 3UJHA 3LHIA 1JIVA 3VZRA 1V3QE 2LDXA 3PHHA 1GFSA 2QMYA 4QBKA 4B3TB 3W31A 2RKBA 4PAQA 4DQDA 1SC3A 1YXMA 1E3EA 1R7RA 1E3WB 1U5BB 5LYJA 2GBFA 2F43B 3SQLA 4AZVA 2BGTA 3QSDA 1E1RD 3Q88A 4IDPA 3DTYA 2OUIA 2C03A 2Q7XA 2C94A 2E4AA 5C8YB 3O6VA 5FA8A 1CQJA 3PPXA 4ZAFA 2PAFA 1IUKA 2P2NA 5BRAA 1FJGB 2FWAA 2XGMA 1NLFA 2IUSA 3R0ZA 1MZVA 4W9NC 1SBQA 5DPMA 1KFCB 1AXGA 2QP4A 2Q5FA 2R8BA 3FVTA 3QVMA 2J6CA 4FCTA 3SSMA 1DDOA 2IBTA 1MEEA 2XYQA 1KYYA 1EPUA 1Z06A 4I9HA 1CZKA 5E2IA 2FOIA 3VBEA 3VX3A 3A36A 3TIXB 5E3IA 2FPUA 1PCIA 4B82A 1Z25A 1QP8A 1JLKA 1VKJA 1G6KA 3GNTA 4YDHB 2AQIA 4F21A 3QWFA 3JQCA 2HRBA 1A8PA 1OIVA 3BGWA 3M49A 4JOCA 5AM1A 1C3XA 4ZVOA 1VGVA 5G4KB 2WJZB 3I5XA 3NTXA 2UUOA 1ZCBA 1ZGJA 4HG2A 3RFTA 5KSYA 1CPJA 1RI5A 2DPYA 4YCDA 1TVKB 4YYWA 2YBEA 1A7JA 1YKFA 4OFBA 4Q9IA 2P7UA 5F51A 2Y6VA 1WSAA 4QECA 4HVCA 4FHGA 5EPUA 3IAM1 1PQYA 3OJWA 5EGSA 4CBVA 4M9QA 3O2QB 2JGLA 3ZX5A 3NG1A 5JY6A 3E0QA 2Q6LA 4FFBA 3AJ9A 1TU0A 4LXUA 3UM9A 3O0UA 1XF9A 1G66A 2ZROA 1IBRA 1SBIA 1CUXA 3L0SA 1GPAA 5IM4A 2J08A 1LK7A 3FIJA 1DF0A 4X61A 4EJ0A 2CHUA 1N0HA 3IE0A 5B2ZA 3CN7A 1N6RA 2A9FA 4DLTA 4YYEA 1U63A 3H8BA 2XZLA 2XVMA 5EERA 3R7AA 1QO9A 2XB6A 4L02A 2RH8A 3VYTB 2QE7A 3DKKA 4Y9TA 3GFTA 4RJTA 4XVCA 2QYTA 1V95A 4XE5A 2CNNA 1YZYA 4GWLA 1RBZA 1PK9A 2WD7B 1GQRA 4H4EA 5DCYA 4JP5A 4C2BA 1PUXA 1DBWA 4YP0A 2VSNA 1CJMA 4UU0A 4KHPB 1I3CA 1LC0A 3QUAA 2H31A 1F2TA 1DWQA 5ESRA 4BASA 3S3TA 2EDAA 5T6BA 4CETA 2GS9A 3KV3O 4Q01A 5FTNA 4ROTA 1YCGA 3EZ6A 3OO1A 3TVYA 1Z18A 4JJ7A 5F1KA 2IV2X 2OQRA 2F9LA 4HUTA 2YICA 1A4UA 1VLHA 1BE6A 4N82A 3JQPA 5A4IS 3R74A 2HBQA 1EE2A 1RKQA 3M9WA 3PYMA 2WI8A 1FTSA 2IS1A 3AHCA 1KQFA 3FAKA 4DT1B 3MJCA 1FW6A 2AS0A 2C1EA 3OPMA 4E2XA 4V1CB 3RSLA 3JVDA 3DZJA 5KNCH 2FQ1A 1BEZA 3IRVA 4I19A 4XPZA 2AOXA 5CH3A 3CRRA 3I04A 1JXOA 3SCZA 1VIYA 2NXCA 1J06A 2WZDA 4A0SA 2GSDA 4LJRA 2WTXA 5BYKA 1CSBB 3E3MA 3C5EA 1L5QA 3JWGA 3WKDA 3H4IA 3UXHA 4X7RA 3EFEA 4L8VA 1PJBA 3K35A 3NNSA 2D6FA 3SR4A 4BRSA 3L6UA 5AI9A 3VPCA 2NPIA 4OXKA 3PDFA 1TJNA 1B42A 4L3OA 1Z5PA 4BCDA 5ADHA 4R05A 1JZQA 3BL8A 1XZJA 1Z6ZA 5JQWA 2D1RA 2YOFA 3ADOA 4ZT4A 3EZYA 1GRRA 1RRFA 2WHQA 3CKYA 4CMKA 1JPNA 4GR4A 3A1NA 1JHPA 3P97A 3RS5A 2RGEA 3CZQA 4H7EA 1FUEA 2O8BB 3B9QA 3O1JC 5CM8B 4UPEA 2NPOA 4RV5A 3WJ1A 2MYNA 4IOJA 2FMTA 4A0QA 1RPAA 1ZPDA 2PWYA 4R7ZA 4V0SA 1PUJA 4NEGA 5AHKA 3KFQA 3KQVA 4QNNA 3U16A 1H6CA 5JCXA 5EJGA 1CRPA 2PK3A 3VR5H 2FSUA 2YVAA 2HH9A 4HGPA 1J21A 5GY7A 4P31A 4K7JA 5EHGA 4YAKA 1BY8A 4BU1A 2Q0XA 4CIAA 3C39A 4HDSB 4DRXB 4FWTA 3FTEA 3WQHA 3CVYA 2KB0A 1DAOA 3A26A 4KDEA 2WYOA 4OI4A 4BP9A 5LLDA 3DCJA 2OGSA 4W1QA 3S2ZA 2F8MA 1GZUA 4XCVA 4HDAA 3RIYA 2V74B 3V9AA 3KOUA 5SY6A 3IQXA 4C6HA 3THXA 1NP6A 1F9AA 2X22A 3BZWA 3KKQA 3EULA 1C1HA 2K4MA 4UUPA 1DS6A 4RPIA 4IL5A 4RLFA 3WGNA 1K8YB 7GPBA 4DV5B 4B6OA 2I1WA 1JT2A 2GBLC 3E1GA 3H86A 3QIVA 4JDUA 1PJQA 4KO4S 1NI3A 4Q9NA 3HJRA 3SZ3A 1UBCA 3DWFA 3JWPA 5IBQA 5IN4A 4F93B 3G88A 4EG8A 2O1SA 1GGEA 2WD7A 5ERYA 4LKRA 5K1ZA 3TPFA 2VBGA 4A6EA 1L8OA 1TQ4A 2OBYA 3OIWA 1SXPA 4GLLA 5MN4A 4HX9A 5KHOC 3CPHA 1CRZA 2F3PA 3DLAA 4H2DA 2V7UA 4MQEA 1M2GA 3S68A 3T7SA 4CR6A 4TL6A 2VHTA 2X4IA 4P0PB 5F3DA 1PKEA 3NJRA 4DY4A 3IAM6 3GJ3A 3QSYA 4WY5A 1GPDG 3W8NA 1U2SA 3RYCB 4CMJA 3GC6A 3BCNA 4X8LA 1DQYA 2QAJA 4YYUA 1A9XA 1TOAA 1OX6A 2ID8A 2Q9BA 4KLZA 4FEAA 4ZV9A 1NR5A 3FPBA 5BQ3A 5HF9A 3FZYA 3IPXA 2H1FA 1XC7A 3WO1A 1RZUA 3AEZA 4GVLA 3GGCA 4QDTA 3N7TA 4DA0A 1SU7A 4FQ5A 4MYCA 3BY4A 2GRJA 2G80A 3DL4A 1QUEA 4CI9A 4LY3A 5FO1A 3RJMA 1PQPA 1RCFA 3L7CA 3O26A 2OO5A 5LMUB 2A5JA 2H4XA 4CIYA 2JASA 1Y8CA 3OZAA 1Z22A 3D3KA 1XJWA 4MUMA 1M6NA 3CEHA 5BWOA 4NCAA 4POAA 2L19A 5B6JA 1CU1A 2FUNB 4RK5A 2BZ1A 1VRCA 2VNKA 2D5BA 3W7AA 1P9RA 1GOTA 4QRVA 4X94A 4PO1A 3SS7X 1AX9A 1A95A 3OIFA 4QE3A 2ACKA 1EZ4A 2QE7D 1KHTA 3EUAA 2PS3A 5I8WA 4MLPA 2H8KA 5LXTF 3PKZA 3BJZA 1X9YA 2DZZA 2E82A 1MIOB 1XJ5A 3FBGA 1UXOA 2PGLA 3FOWA 5FHRA 4ZI2A 2OD9A 5JATA 1JWBB 4DA8A 1C8LA 1OYWA 3JPYA 4MI7A 4JD5A 2GEKA 1FYXA 1V7PC 3ZWDA 1ZA1A 1U1IA 3GDWA 5FQNA 1O94D 1QCZA 2C4NA 4D74A 4LWQA 4TUYB 2P69A 2VDMB 4YN3A 1U7DA 2PXCA 2ZI9A 4IJVA 4MB2A 3V3KA 3ZXIA 1CY8A 3G9ZA 4FR2A 2C82A 4WOPA 3M83A 3VPFA 2PR7A 5JS6A 4TXMA 5JDCA 3KPJA 5E6SA 3GAMA 3SQXA 2CNBA 4UE6A 2BU3A 3CWQA 4B3XA 3I37X 1XQ9A 4R51A 1XR3A 1MLDA 2V97A 3EZLA 4MAFA 4PZ9A 4UM5A 5ILGA 1FTNA 2JFXA 3W9SA 5JAZA 1D6SA 3VNQA 4LY6A 5CVJA 1X7DA 2IXAA 4HTFB 4YJGB 4B87A 4F3YA 5J47A 4KYIB 4YCCA 3TD9A 3BH6A 3FB1A 3L6BA 4JX8A 3EJWA 2I7DA 4UMEA 5HOEA 2J3KA 3RIHA 1OAOC 1L8AA 3UG6A 1OXUA 2HMVA 1RQRA 1WKBA 4L28A 4WN9A 2DFVA 1M2VB 5TGTA 4AXMA 4JP8A 3HWRA 1WMAA 3CX7A 4R2HA 4BEWA 4ARZB 4EB0A 1M72A 1M1YB 1TZKA 2GPSA 1QPZA 1QR6A 3MB8A 4OQMA 2CUZA 5AJYA 4M1KA 5IXYA 4N0MA 1N8KA 4EVRA 5CURA 4WN3A 1X74A 1Z39A 4H0FA 3ZD6A 5JZ9A 1T1JA 3HYRA 1OLXB 5DYNA 2JIBA 2BZGA 1XJ0A 3I9JA 4R40A 1LW7A 1UK7A 3R9KA 1NONA 4XFKA 1ULTA 3UK7A 2WJ4A 5L3VA 1H2HA 3SM9A 1P1IA 3ZVNA 1U0FA 1IIBA 1NF3A 5AI5A 3ZCUA 3KUXA 3CSDA 4JJEA 5CLLA 5J3JA 1A2QA 3DZGA 3S5UA 5HBRA 5HUJA 1ZVVA 1AF4A 3WVNA 4C04A 2I67A 4OYLA 4CKWB 5JMOA 5L4SA 4ES6A 5E7QA 4KQ1A 1J20A 4P32A 3A1SA 4Y2JA 1CS0B 4LE0A 5HFJA 2VEOA 3F4LA 4B4WA 1OBCA 2P5SA 4O0LA 1FP2A 1GADO 4CXMA 1GCGA 1XN1A 1H6BA 2QLMA 5CMLA 2HSZA 1XCGB 1H8HD 4MIKA 4IDAA 4AZ0A 1T5IA 4RESA 1K63A 1VKHA 2WAYA 2Z8YM 4X1IB 4C03A 1JFSA 3GJ7A 5DNAA 3W9UA 2Q9CA 4OH7A 2QUZA 3U7JA 1VBKA 3A7DA 4U2DA 3GLFA 1X1QA 3I1JA 3ZWCA 4JC8A 1HBJA 2P3OA 4FYMA 1Z4JA 4RM2A 5L7TA 2B3DA 2J31A 1A27A 4YVAA 4FGKA 1HQDA 3PW3A 4FFLA 1XO1A 3QPWA 1UBHS 2VJMB 2XQJA 1H9BA 1L4BA 1RQPA 2ZVDA 4NBUA 5LLSA 1E2BA 1A6RA 4M9ZA 3T7IA 1ENPA 5CVDA 5DNDA 4MP6A 1QMPA 2X86A 2IZ7A 2I3AA 4UAVA 4DCOA 1MOPA 5ENDA 1ULBA 4ZAWA 2AS8A 4TTRA 3VV2A 3AZPA 2C2ZA 4X84A 3FYDA 2FR8A 1COWA 1QQTA 1FYVA 2HXZA 4JLKA 1SCUB 4FJCA 3L06A 2PMKA 1CFZA 3EGDB 3HLTA 2O59A 4MS1A 5JRDS 1FFBA 5BSWA 1RFGE 4FIDA 3GBSA 4JLUA 5ELXA 1C1XA 4O4HF 1A71A 5C4GB 5EJAA 4ENPA 3BMNA 4O4HB 1MB9A 1IE3A 1SA0B 3DWIA 2ZR9A 5LIRA 4AD8A 1IQ0A 3CV3A 2J48A 5TSDA 3ZHSA 1TZ2A 4N6GA 4RK4A 2WVGA 1HKUA 2X1MA 4P7JA 5C4IA 4TN1A 3OQ1A 1QFSA 4CFZA 4HCJA 1RYYA 3MT0A 3RFUA 1JHAA 2I29A 4CQLA 5BN3B 1I3MA 1N9KA 5IZ4A 3RFCA 4UQPA 3N5KA 1G98A 1L3IA 2VF8A 1R0WA 3BQNB 3BXPA 4LRWA 4CCWA 4QBBA 3IDQA 3W3AH 2XE4A 1B3BA 4GKBA 2Q46A 3X3HA 5C7OO 4GPBA 4MVJA 1W34A 4DV0B 1FSGA 3WRWA 4BGDA 3KQTA 1Z34A 3WL5A 1ZI6A 5CVCA 2BTEA 1JPUA 2VXOA 1U3TA 1K2VN 2KS6A 5FBRB 5FTMA 3DSRA 4GZLA 3JRNA 4YDQA 1Z45A 2OAP1 3NH6A 3KJQA 3JARA 3OPYA 2AF4C 2JIMA 3LRXA 4I36A 3ZD9A 3AETB 3KWLA 3TL2A 1JMYA 2KLBA 3L05A 1ZRMA 1FU8A 3C6BA 1ML4A 3OLYA 1DSSG 4AJ4A 1XVUA 3KWBX 1I5OA 2DFPA 4WK4B 1NUAA 4V0NA 2E2WA 4BP8A 4C7OA 4GC5A 4I1OA 1X1EA 1I7PA 1ODCA 2B8TA 3JASA 4FGLA 1YE8A 2WFAA 3V97A 4PNEA 1Z5GA 2BR4A 4HDSA 3S8MA 3VDNB 2FWNA 2JK1A 4DRXA 2XITA 4UFOA 3G0DA 3WR5A 3FX2A 4AJIA 2PS1A 3DTTA 3T7RA 4GNKA 2APJA 4ZI7B 4U2GA 5EGWA 2G72A 3LP5A 4JT4A 3R3UA 3EHDA 2YRWA 3BRWD 1K3UB 5HIJA 3TDMA 4FE3A 2AI3A 1QRDA 3LV8A 4DV6B 1JF8A 3W6UA 4D9MA 5CFMA 3DBOB 3GDOA 5A04A 1IZYA 1ZBDA 2HLDA 1Q0SA 1KMHA 5AVOA 1JHDA 1MHPA 3HVJA 5JXWA 3GLGA 4M83A 2CHQA 2FW0A 2OMEA 1POPA 2P9JA 2D2VA 3Q0EA 2FXVA 4FFBB 3TTVA 4ZC8A 3PQ6A 3E1ZB 3RSZA 3HY3A 1LVGA 4KFCA 4LPSA 3UMCA 3GRKA 4M55A 1U1EA 2DWPA 3T7AA 1TCVA 3X1XA 1SNKA 1RBMA 4J2OA 3LPAA 3G8YA 1Z6AA 3H97A 3EVFA 4L0QA 4LF5B 5A03A 2C96A 1YZNA 1KJQA 1QKIA 3A4TA 4O4IF 1D0VA 1QV7A 4QSHA 1V37A 4WCFC 1KY5A 4J1QA 4REQA 1M1XB 1CXZA 1WCWA 2Q28A 3CONA 3AJAA 4Q12A 2CYBA 4HAIA 5MN5A 4O2LA 4MXDA 2IZZA 4O5OA 3W1VA 2FLKA 3PT2A 1Y8QB 3VVBA 4BO1A 1FA9A 2QN7A 4IICA 2GCPA 5CYFA 5CYOA 4S1WA 3AVYA 2B69A 4ZRNA 4D4MA 2AE2A 3WFZA 1QR2A 1P5HA 5ITZA 3C0KA 2H7VA 2D1TA 3I4FA 4UNNA 1YR1A 2VT3A 4QYWA 4N47A 4OQXA 3UXMA 4BQEA 2IXBA 1ZX1A 4CV0A 4HO1X 5DIFA 4X1YB 2O1XA 3Q9SA 4D3FA 4RMNA 1LU9A 2IPPB 5GV7A 3CMMA 2IEIA 1TEVA 5EIHA 1XMOB 1QG0A 3SQNA 4HBZA 1YK1A 1YMVA 3C3WA 1U3VA 1YQTA 3BRCA 4IYRA 3U7EB 2Z56A 3MGKA 4TQGA 5ALRA 4H59A 5ICEA 4P6GA 2A88A 3C74A 3DL2A 4V0ME 10MHA 4ZHSA 1RQNA 4MUHA 1VG0B 1IVNA 1YFZA 2CVPA 1Z2AA 3PGXA 3N3AC 1O0BA 1OLUA 3B48A 3TSWA 3EDMA 5BXQC 1EFCA 1U7OA 1YDEA 2YJ5A 5IK2A 4E15A 5EJMA 3P2YA 3HHIA 1JLMA 2AYXA 3BMXA 3LK6A 4YJ3A 4R68A 1SRQA 3ZIAD 3FLAA 2OV3A 4F6RA 4DDWA 3I9V1 3I5UA 3SXPA 1IRIA 1QE5A 1QX3A 2BI4A 1A4XA 1U99A 3H3XA 3D7RA 4J7AA 3E2MA 3JAWA 4ZDWA 4BIMA 2B4RO 2PRJA 2ZRMA 3L84A 3GJSA 2C7RA 3Q6MA 2W7TA 4EG4A 3U4MA 1ZH6A 1P3Y1 2HNBA 2JC3A 2UZAA 3NVKI 1SHKA 4PFJA 3E1KA 4ER7A 3T12A 5DGXA 5BSMA 5FI1B 1C3EA 4QYIA 1VDMA 2HEGA 1C5KA 2CF6A 3AT1A 2GN0A 1QCYA 1YR9A 3KOWA 4I5IA 3QEMB 1QVAA 2XYVA 1L4FA 2X7XA 3AR7A 2ANCA 2HWKA 1KK2A 1CUUA 1ZD2P 3FDZA 1M33A 3NBUA 4RPCA 3A1FA 3WLLA 4PHHA 1FMLA 2YS7A 3HN6A 4LJAA 3TECE 4A4DA 2O7QA 4G8CA 3WK5A 3ILHA 1N2SA 1RJFA 1UINA 4UEWA 3NM6B 2D06A 2CCJA 1G8AA 1G17A 1Q7BA 1AGRA 2VP6A 4YJ2B 2X8AA 1U1CA 1NXWA 3U3XA 2NO9A 2VRBA 4PAMA 3R76A 5KOHA 1SPBS 1E1QD 5B55A 1Q11A 3EEQA 2IPLA 1TJ4A 4U4AA 3ZV4A 3JU3A 4KAAA 4D3DA 4N41A 5CTAA 3RRJA 3AJDA 3HXKA 3LI2A 1PIPA 1ZVMA 2WUDA 4ETNA 2I9KA 2DJ5A 2I1VB 5IS2A 1DOAA 1O97D 1YI1A 2QZPA 4ZJUA 5A05A 2QZ4A 2ZE7A 3HCOA 1R0RE 4KQHA 5LMZA 1IWPB 5DGCA 4L4UA 3IX7A 3W4IA 2QHXA 3HDYA 3BAFA 4FDAA 2NQIA 2I7TA 4GI3A 1E0AA 2B3TA 5JW6A 1CUCA 1WZIA 5FLXA 3A6DA 3EHEA 3A0UA 4AUNA 3P5BA 3NPAA 1Z9BA 1DAFA 5F2EA 1DIOB 4EBBA 1U5AA 2YBDA 4Y9DA 1NVFA 5DCUA 3T9BA 5HCIA 2BBSA 2FDXA 2PFKA 2ZZKA 4LXXA 5ICSA 3COJA 1U7XA 4AX8A 4TTPA 1GN9A 2DBZA 1Q83A 5HMMA 5IX8A 3UA3A 3EQ9A 3GOQA 5ALDA 3ZE7A 2O2CA 5A9RA 4J4HA 2WHEA 4TX1A 1SM4A 4QGHA 4PC6A 5BWCA 3VR4A 4ENTA 1NPZA 1KI9A 2R6ZA 3URKA 3FG9A 1UMCA 3U7QB 1VBMA 3OQIB 2PX4A 1E99A 2JCYA 2XAUA 1FSPA 4IP3A 2EFEB 2VP3A 4C6TA 5IUNC 2J0SA 4RTJA 4QJIA 2RHBA 3HZRA 1P5RA 1QB8A 3E5NA 4IG9A 4NBKA 4O63O 5IFKA 4GPZA 1QOZA 3NAQA 2QROA 1F7VA 1T0IA 1R6VA 4KFRA 2ODNA 4Z9XA 4F1KA 3LBHA 3ONVA 4BFZA 1SXJC 4MYDA 4YB8A 1A1SA 1NLMA 3LH5A 5EZ5A 4D9NA 4GLBA 2FT2A 3VPDA 1BG6A 4V3BA 1H4VB 1IHYA 4YP1A 1G1MA 2QT1A 4P8RA 1JVBA 1P19A 1SUAA 4ZO4A 1XLVA 1VB5A 2G17A 5DXFA 3UKJA 4OFZA 4OL9A 1A50B 2J0EA 5K6AC 2HT6A 2INGX 3FJ1A 3CRVA 4KIFA 4R3WA 5H9VA 4JNCA 1SKYB 2PO7A 2YZMA 3SIRA 1KTVA 3I09A 2CVHA 1QONA 4HAWA 3EA4A 1J8MF 4I99A 4JGGA 1UPFA 3KUUA 3L7MA 4LQLA 2EFGA 4UHEA 5GPBA 4Z49A 4Q37A 2JI4A 3NWPA 3CW9A 1NWHA 2FB9A 3LUBA 3BHMA 1TKRA 2EXXA 3EAGA 1MU0A 3HCCA 1E62A 1ZZEA 2YMPA 2PKQP 3COZA 4OBEA 3R5XA 1QG6A 4PCAA 4AIIA 1PNOA 4BZWA 4ZCIA 1O03A 2WHPB 3DDSA 3EWSA 3RIXA 2YXNA 3WYCA 2PS0A 3MGAA 4FSHA 4WFQA 4JLVA 2HCJB 3UZUA 4MUBA 5JBNA 5KVAA 4IUMA 5C1PA 3GVCA 1TXGA 1P60A 1REQA 3RS9A 4HNVA 1VSUA 3K1ZA 3L7JA 1XXLA 3OM1A 3ZW8A 4G0PA 2K6GA 4IJWA 4K9LA 4Q19A 1GNVA 2PU7A 2Q21A 1S1MA 1PNRA 1QK3A 4Y67A 1NXVA 1OBVA 1OBOA 2F90A 2R68A 3L02A 4Y8VA 4YRBA 1Q0LA 1MX3A 3G49A 3VR6H 4AF7A 3KJGA 3ZZNA 3TI9A 2O2IA 3LE8A 4B84A 621PA 5H83A 3M99A 3PJGA 4CWAA 1H4SA 1JEOA 4PC1A 2RK6A 1H5UA 1CEQA 1W73A 2W00A 3K9WA 4TT3A 5KWEA 2R0QC 4YAJA 1D7AA 1HTWA 1OZHA 4R54A 5KWVA 3LWNA 3FM9A 2DQSA 2PXHA 4RY9A 1S9DA 5TF0A 4DG9A 4UVDA 2B30A 2GBCA 3DTVD 4FQ8A 5JR3A 3OJFA 1R8SA 1XNJA 1BC5A 2VOEA 4LZPA 3UKOA 2OAGA 3UWPA 3R6GA 2N1MA 3CU5A 3T9EA 4JVMA 2FOXA 2VJQA 2X8JB 4YRRA 5BOVA 3SQMA 3RIMA 1LSSA 2FUG1 2WIJA 2W83A 3T38A 1LBSA 4D1YA 4NDAA 1M0EA 1S96A 4XR4A 4GDFA 1E4VA 1A2BA 1I13A 3FZQA 2DFNA 3NGLA 2VHFA 3ULKA 3KL4A 3TXAA 4LFAB 2WSIA 1JSZA 5AVYA 1TFUA 1FXSA 3JWIA 2F3RA 2GPNA 3VH2A 4R16A 1IUPA 1LTQA 3K1AA 1ZINA 4B3IA 3CWZA 3OM0A 1OLUB 3ICWA 4XJTA 2BD0A 4BEJA 4Q3AA 2BUCA 4WSOA 1KTIA 3PC3A 2AR9A 4I2NA 1GV1A 1D07A 2LCIA 1V8BA 1R4AA 3DC7A 2AEEA 3ITDA 3CMCO 1NNUA 2O4CA 1BHJA 3GH3A 4LZZA 4WOCA 5BQFA 1AZTA 3C43A 3PD0A 1Y3AA 1WBBA 2Q4EA 5LD2B 4YMLA 3JWJA 3JQ7A 1UPTA 1QH1A 3RVJA 3T1HB 2VI5A 2Y71A 2Z04A 4LF7B 2QNRA 3NIBA 3ZU5A 4DN6A 3I6BA 5CA1B 3GA7A 2ZULA 2ZB8A 3MD9A 1O6BA 5SZIA 2I4RA 3EZ7A 4DJEC 1LJUA 2QZZA 3ZDZB 5MFPA 3ASZA 4MRNA 3UICA 4ARUA 3HXMA 3HY4A 2OFWA 3X1YA 1TGVA 3L1JA 5E4TA 4YRJA 1J2TA 1N1EA 1E3IA 2O0KA 2QZ9A 4UBJA 4WKCA 4OHFA 2ZRHA 5AICA 1RZ3A 4CEHB 3NRJA 3MTDA 2JD1A 3AVVA 1R18A 3NHLA 1E66A 1TQ6A 1NVTA 3MOGA 2P9EA 4I1PA 2ADFA 3NNDA 4P08A 2PJRA 5IKEA 2HU8A 2O50A 1BKYA 2DBQA 3GAFA 1LPOA 4JLNA 5BMVA 2VQEB 3UJ6A 1T4CA 4D3XA 1XA3A 4PN3A 3OQMA 3K70C 3AEYA 5CFNA 4O0MA 4CL0A 4UCFA 3NT4A 3D7MA 4QPJC 2XCUA 3SC3A 1QB7A 2WNHA 3L4EA 4EX7A 3ETEA 3GMSA 2HRDA 3ENWA 1BA3A 1NBIA 1E58A 3CS3A 4I4NA 2GYWA 4YGYA 2OSBA 4HTFA 5AI4A 3CJTA 4G8JA 3OISA 1I24A 1UFKA 1LTKA 4IDCA 3RS3A 4BV8A 1D6JA 1S4VA 1HORA 4HB0A 3WYGA 4GI2A 2PZAA 1IL0A 2PUHA 1FDTA 4EJ6A 1RLIA 3WK4A 5A4MS 4GZ6A 4MR7B 2ZDHA 1OH6A 1P9LA 2P9HA 3H05A 4I5EA 4KRYA 3WL3A 4HB3A 3F7MA 1ZM3A 2AL7A 3B1ZA 1MTOA 3IJ5A 4DDVA 5D6NA 4BP3A 3FR8A 4HDNB 5KMGB 2XHEA 1U0EA 2CYAA 1CY2A 4OHRA 3QPUA 3SBXA 1EUQA 5M04A 1XVTA 3KZXA 4BB6A 2BMDA 4OUKX 4HQNA 1HETA 4N0EA 1XXHB 5DBIA 1NYTA 3L49A 3LBAA 4EVIA 3SQOA 5IXJA 4KPYA 1W44A 2ZVQX 1OF1A 2G25A 3R41A 4A8HA 5LZ4A 3NDJA 3EQZA 1M66A 3FCYA 4KLRA 3W6NA 2FSGA 3PEUA 5I51A 2VK4A 4ZZ0A 2ONZA 3KD2A 3H1FA 2FF7A 5TF4A 4C08A 3PUJA 4GG1A 4BV9A 1Y4UA 1ME4A 1NBOA 1XQ1A 1Q3KA 3KQKA 4PHFA 1FZTA 4FLEA 2FZVA 1LSOA 2QF7A 3SNKA 5BUQA 2ZXUA 4LXYA 1Y1SA 5IJXA 3KQQA 3K4QA 5A06A 4EQZA 3T3OA 1Z5VA 4YASA 2X13A 2O0HA 3Q10A 3P9IA 1I0ZA 2E5WA 3LW8A 3O9MA 4OHPA 4X97A 4PAGA 2F9FA 1USWA 4EW3A 3ROPA 5B7PA 3L82B 1LKZA 4CDNA 1YACA 5FJIA 3QJ3A 3D6MA 3GVXA 3W8EA 5BVHA 3TNDA 2NP6A 3EMKA 1GD1O 3AEQB 4Y3UA 2PMEA 4XQ9A 3IPAA 2ZTLA 5T3UA 4DIDA 4RXTA 2WJYA 3W4JA 1GITA 1WS6A 3CBGA 4MH0R 4UMFA 4WA8A 3AKYA 4XIYA 2JBHA 1A7UA 5HUQA 2EATA 2V7VA 1R4ZA 2X5NA 3ITKA 5DHPA 1VZ2A 3GLIE 1LQTA 3RRNA 2RGAA 1N6PA 3PYXA 2QTVA 4OFWA 3TTYA 4DIBA 1EK2A 5CW1A 4FGWA 1Z36A 5EHNA 3KQMA 4EEZA 5LUBA 2PMCA 3VRHA 5HOQA 2E48A 4TMFA 1DBRA 1KOGA 1ZNWA 3I2GA 5CIQA 2O2SA 2NAPA 5D3ZA 2IHVA 4K05A 4W8HA 1I6LA 1GSAA 4RNCA 1JR3D 2QAGC 1YR8A 1PS0A 2AV6A 3PFFA 4KIUA 4RSGA 4UTZA 4ZXFA 4UM7A 4N3CA 2W6PA 3ZUPA 2OENG 4OAPA 1VLJA 2BRUC 4AJ2A 5KMGA 4IVNA 1EVIA 4X6XA 3R4VA 3WA7A 5B1YA 2Q4TA 3CX8A 3PDCA 4QBIA 1Y5LA 3HSSA 4DRYA 1Z83A 4M22A 2Q2WA 1HLPA 4CRWB 4MQ4A 4KR6A 1YZUA 2R79A 5IJZA 1P0QA 1DEXA 1CE8A 5AW6A 1APBA 1ECPA 4JBWA 1AA9A 3QW2A 2DG2A 2R47A 4L22A 1X1SA 2N42A 3F7NA 3FUTA 3WXGA 1E3JA 1OFUX 4P4NA 4Y2VA 4OY3A 2E5FA 4ENRA 4AMBA 5AK5A 3T9CA 1T35A 1YUNA 3KZKA 4DWVA 2W8BA 3PR3A 1X87A 1FRNA 2FNAA 4OV6B 2P9YA 1SP4B 2DJGB 2PT6A 2Z4SA 4G01B 1YS4A 5FP0A 4CDMA 2WD9A 5AOVA 2QPTA 2ZPTX 1OXBB 3DD5A 2I6TA 3HCDA 3OG9A 3OP4A 4QUIA 4E3ZA 1GKUB 1V48A 3I2JA 2E21A 3IDZA 4N3AA 1US8B 1KHHA 2G67A 2VC2B 2Z9CA 3G8AA 5JDIC 1TTPB 1XMXA 1SCBA 1G5QA 1T3GA 2Y0EA 3ZU2A 4AJPA 2CK3A 2ZJ5A 2BP7A 1T25A 3ROMA 3UUFA 3GLFE 2F8SA 1MO2A 2RGUA 2ODQA 2J3DA 3LC2O 3M5PA 3P4XA 2XYRA 2FKAA 4NL4H 4UVIA 4CYMA 2AXQA 5I8ZA 4YDSA 2QGNA 2GK3A 2O8FB 1GILA 3K9QO 4XDGA 4X93A 2VJYA 1ICEA 2YW2A 4RZSA 1G21E 3U62A 4P93A 4YRDA 4JI1B 5KZMB 2XSZA 3KOOA 4KO1S 2HN9A 5J2UB 2BR3A 2GEUA 2Z2KA 4HXGA 3RS4A 4YUYA 3B5EA 3F3KA 2OB2A 4IEEA 4JI7B 2GAOA 5IKOA 3LW7A 3QFCA 4CUJA 4XGQA 2R60A 3Q8MA 2X41A 3CGWA 1QH9A 4QELA 1PR2A 5IDYA 2XUQA 5HWSA 4OEMA 4YAEA 2HPZA 4GGOA 4D8XA 4I9NA 3FDJA 1UC8A 4RA6B 3CX3A 2X58A 4MCJA 2OZLA 2QQEA 1H1LA 1F2TB 3EJ6A 3KTAB 1AKMA 1E1QA 1JLHA 1TM3E 1RM3A 4FIZA 3MHPA 2O8CB 3H7IA 3TUJC 3I01A 2XR1A 2FSPA 3NRCA 3QLVC 3BK2A 1N7JA 3NGXA 3LLSA 5EIOA 5IBPA 4MV6A 3TLAA 3ENKA 4I50F 5CDTA 1G8PA 2CFOA 2YS6A 3IR6A 3W5BA 2E89A 4R9NA 3RREA 1P18A 5TPZD 3VUEA 3PF9A 4LI3X 3HVHA 3QEJA 3MCZA 1CVIA 3R40A 4TSFD 4WADA 1GY8A 4C4TA 2PADA 4RHTA 4NDNE 1SG9A 2QUAA 1K08A 3N74A 1GL6A 3O1LA 2O7SA 1M7HA 4GYKA 1E3TA 3CW2A 4MKIA 2BPOA 3BDAA 3JW8A 1RXSA 2IYFA 2LRHA 3H2ZA 3MOSA 2GLUA 1IH8A 5I4BA 3D3WA 3GT7A 1P31A 2A0KA 1NM5A 2GO7A 2ZB7A 1PFUA 2IIPA 1J39A 5DYWA 4LF9B 5BW6B 3PLNA 4B73A 2IYZA 1W94A 1YU9A 3FGOA 4ZD6A 3C3AA 3SEAA 1Y8RB 3PUWA 3A3YA 3R7WB 5KYKA 2DTDA 4MSUA 2B7CA 3F96A 4HI0E 5CK4A 5J5VA 3RK0A 4ZTUB 2R9OA 4O33A 2H85A 4B7ZA 5AHXA 3IYLW 3MLEA 4RY2A 3SDZA 3NZEA 4X44A 5B1SA 1GZ3A 1KEPA 1P1BA 1T2VA 2FTKE 2JL1A 3BIOA 3HCEA 4V3CA 5DRYA 3WB9A 3PEWA 5FI0B 2DQ4A 2BHSA 3EBLA 1Z2DA 1HUCB 3I45A 4ICIA 3AI8A 2VXYA 3TW8A 3MJSA 3HL0A 3ZV7A 2CMHA 2ECQA 4AC9A 1SVIA 5HQJA 2D7JA 2L69A 2DCMA 3JAKA 2A3RA 2AFRA 2DY0A 4JYMA 4RQTA 2GUGA 5AUOB 4ILKA 3FHCB 4RHFA 5C8YF 2BUBA 4RK0A 4BZZA 2O8EA 5BMVB 3HXTA 2IY7A 3VO1A 4LSMA 2MYTA 1VHTA 1W87A 3MJDA 3LPDA 1BROA 1X9HA 2LXNA 3IMEA 5C3UA 4KFSA 4UEOA 2OILA 1XBTA 1WOMA 3E58A 1C0LA 4G37A 4R2LA 2JKVA 5IU6A 5JSYA 4CKCB 4QODA 4Q3BA 1TCBA 4BQFA 5KKNB 4EKDA 2UZ1A 2OA0A 4DNOA 3GLQA 1MQAA 3IPRA 4LA4A 3KZMA 1SQ5A 4JEHA 3AJRA 3PHGA 3JS5A 5BUZA 1DCMA 3H11A 1CS8A 2B4YA 4AF8A 4H9GA 1YDMA 1G8KA 2NU7A 1Q16A 4LQDA 4PLFA 3RC2A 3ZWOA 2FN7A 4EUSA 2UDPA 1SUEA 2RG1A 3UV7A 2Q1UA 2GNOA 1N2OA 3JQ8B 3V55A 3VBCA 3COPA 1M6EX 4QEZA 3CNHA 4Q3DA 1HFEL 4AROA 3MP2A 2GLTA 4AZ3A 5C37A 3O8OB 4Q82A 4DB2A 2NTNA 4KIGA 1MQ8B 2GXAA 1XRLA 2IF0A 3BCSA 3ASVA 4YDRA 4OP1A 2IOHA 4LHVA 5DT2A 4Q9AA 4QQKA 4ZT6A 2FG7C 5LB4A 1Z8HA 2RC6A 3FNHA 4PPFA 2PFGA 1PN3A 1ECBA 4XASA 1TI7A 4J1NA 4QTTB 2QN2A 2WWIA 3SK0A 3EXHB 3U49A 4BLQA 1E6EA 4CL8A 4CEJA 2OZ2A 4DCSA 4YJHB 4BVGA 1AQUA 3QHPA 4W99A 2XCQA 2QD1A 2MSEB 4G56A 4R1UA 3T5TA 3VPGA 2RK3A 4X95A 2VPYA 1K4KA 1ZN8A 4J0FA 2X1LA 1R12A 2JJQA 5FI3A 3ZCRA 4OCZA 5HF5A 1DB3A 5GIOE 2I2WA 2HZ7A 4EYKA 4RE5A 2CDNA 1P2GA 1FQWA 3HBNA 3Q9LA 2AFIA 3DB1A 4JWTA 5KBYA 4AS2A 5TIIA 3O8QB 4LZNA 2CZGA 1SBCA 1SY7A 3EZ2A 4Q7EA 3JYOA 4C4AA 1GMYA 1OB2A 3VFDA 2IE8A 3QF4B 4LHYA 5AKJA 1AYUA 4B35A 3EEYA 2RHHA 2V58A 4RD3A 3T94A 2ILTA 3L4SO 4U2BA 4QJ3A 2JA2A 2AZMA 2J5RA 4O29A 3IEJA 2H4ZA 3RC9A 3K5PA 5FPQA 2RHMA 1AKYA 1DC8A 2BEUA 2G0AA 1XRPA 1YQWA 1OWLA 3GGPA 2ZTUA 3EIXA 3LHKA 1WVGA 2Z9DA 1KMMA 2IBMA 2J6HA 3DDNA 4FN4A 1LRKA 1YJAA 3MUNA 4BRWA 1L7EA 3JQFC 4JP1A 4LN1A 4YMUA 5BSKA 2PSEA 2P40A 3L92A 5C2JB 4WERA 4CM7A 4A15A 1G3UA 2FN4A 2ZRIA 5D00A 3K72B 1TPYA 5BQOA 2NXWA 3RT9A 3ZHBA 2HV8A 4FTWA 1LDGA 4BVLA 4RKXA 2WWFA 4M38A 4ZQCB 1HV8A 1T9ZA 3KQPA 3G9TA 4EDFA 1T2UA 1ZICA 2O8EB 1PZXA 3MK31 4XFDA 5KOHB 1JQAA 2R5FA 1NJ2A 2AN1A 1KI3A 1QF6A 3P9ZA 1XPOA 2IHTA 1YWGO 3LXUX 1NFRA 1ZH8A 1ZNQO 1T8TA 1FP6A 3MERA 3UWKA 1DAKA 2JD0A 1IXYA 1FF9A 3HP7A 2QBYB 1L4MA 1MFPA 1USIA 4YEDA 2C0QA 2Z1MA 2IXEA 1CB0A 3OLZA 4BZXA 1GZHB 4BATA 1RAFA 2F4NA 2PD3A 4KV7A 1ULSA 3E8XA 2XDAA 4CQMB 4K0RA 3MMZA 1H69A 3NOOA 1RYFA 5K0FA 4DCGA 4LFCB 4EI8A 2PHZA 3HPRA 4IIUA 5AVVA 5G4LA 1MV5A 3LDUA 1ZK2A 9GPBA 3BSYA 1SCUA 1I33A 3STVA 1C4WA 5KTSA 2GTPA 2HHCA 2JAPA 4GPEA 3SQWA 1QIMA 1Z8FA 1ZEJA 1VMEA 1AH2A 4R6XA 1VA5A 2C5SA 2O3QA 2BWJA 3IP7A 3EDRA 3NBFA 4NJEB 3TNFA 3WQBA 5AJVB 4WKBA 4HH4A 1GXSB 4YLEA 1U0JA 2ZWMA 1T9AA 5LQNA 3A1VA 4EB6A 3ZEAA 2AT1A 4KREA 2RJNA 4X6HA 1WULS 3CNOA 4QQ8A 3T06B 2IYAA 4N48A 1NF8A 5IG2A 3MB5A 4YHBA 2IY8A 5JXIA 3ND8A 4GPIB 5DX1A 2XLBA 1Z0ZA 1S6YA 1UM9A 4AXXA 1GGVA 1HRKA 2O20A 4LMRA 1KHPA 2WB4A 4LOAA 4QL3A 3B38A 4KXNA 1I14A 1JNYA 2JHAA 2HDWA 3PWTA 1LNQA 5FWYB 3UG7A 1N5IA 2GCOB 2MSKA 1SBZA 1XCPA 1G2IA 3DCNA 1RJGA 2XU1A 1C3OA 2Q50A 2XJ9A 4CTNA 3QW4B 5DTRA 3AP2A 1YRQA 3OE7A 1US8A 4BJ3A 3BULA 1V16B 3K09A 1XEXA 1V4VA 2PSFA 3PNYA 3TD6A 4M60A 1O94A 1ZCJA 2I4TA 7YASA 1P33A 3B2NA 2VDUE 1JKJB 5DBFA 1PEDA 4OI1A 3ANNA 1PZHA 3C98A 4DLNA 5FBVB 2BZ0A 2W8BB 4OSEA 2PD6A 1TMGE 3V1LA 4EGCB 1A2OA 3OQ6A 3DV2A 1Y1LA 2G28A 3WKBA 4FNMA 1FYFA 1QQAA 3AI3A 1SXJE 4PU0A 2UZJA 3KVRA 5SYAA 2GBPA 3HRHA 4BMSA 4E21A 2MDTA 2GN2A 3QVGB 1Y6FA 4S3MA 1ZI8A 2RJOA 4MVJG 1YR2A 2G1JA 1CE8B 1NQVA 3RIGA 3OEYA 4RHCA 1NUTA 3QTTA 2A1UB 2ONJA 3SEZA 2AJBA 2PSDA 5KJEA 1SD2A 3W8RA 2RC5A 1ZLXA 4XD7A 1SOUA 4XR7A 1JFVA 1JU3A 1TUIA 4M87A 1Z56C 4OQPA 1XDDA 2OHOA 4TV8B 3GARA 4RTMA 2PUWA 3DE4X 3LCMA 4RZXA 3FHJA 3PDJA 1JIQA 1CUHA 2H7CA 2IRWA 3FUCA 5AKEA 3TZBA 1CUAA 2RH5A 2YZ2A 4QTUB 1MIOA 2W6NA 5KTTA 1POXA 1IPHA 1JE1A 2Z2ZA 2XOXA 1OREA 4LX0A 4NHOA 3UJPA 4ZDKA 3CXUA 4YJ2A 1Q1QA 2ZJ1A 2WMDA 5CVNB 5C31A 1ZUIA 4UMDA 3KLPX 2XU5A 5IT4A 4BVJA 2AWNA 2VF2A 2HSEA 2P2LA 3KZVA 4LTMA 2QVYX 3F5MA 2H5LA 2ZJFA 4PC7A 1QK4A 5JZMA 2BM0A 3O3CA 3TRKA 3U3DA 1I1QB 1XDZA 3DDOA 3QUSA 4EHDA 5HZGA 4MTCA 4ALLA 1F06A 1HXHA 2DECA 5FNVA 4NWIA 3BX1A 3NM5A 4UOEA 3CVUA 1M2OB 1TLFA 2YVKA 4MI1A 1YQGA 2X19A 4IUYA 5T8KA 2HGSA 1FFHA 1Y5NA 2XVYA 3WK6A 1NN3A 4A82A 3BKXA 3PRJA 1GNPA 4DBLE 4DJTA 2X2OA 4IFEA 4LTNA 4MTLA 4WN9B 4X8MA 5CLQA 3GLHB 3HVIA 4Q3CA 4EMBA 3GCDA 3NDRA 4Q4DA 3MJTA 2HJRA 1IHOA 2ZUCA 3OKPA 4MCHA 2OWEA 1EDOA 1UCFA 2AJLI 3AR6A 3FNFA 4XOUA 4L76A 5G0WA 1KWKA 1RRGA 5K16A 3N4CA 3R3HA 5IJ0A 2HHLA 4TXJA 5HDBB 5LBTA 3KJEA 2NPFA 2D8MA 1T26A 1CZRA 1E61A 1D04A 1L4GA 3BERA 1SZDA 1NQTA 3T54A 1JQLB 1C2YA 3DZFA 1ZIYA 3TRJA 3DE3X 2PZ8A 3I42A 5ITSA 1LNSA 2ZYHA 4LS3A 2WWVD 1N1MA 3T5GA 3W78A 3KT8A 1A0OA 1V1RA 1UXGA 3P5WA 4FHFA 4GF5A 1ZBQA 2C42A 2IKQA 2DFTA 2JLCA 4N39A 4URWR 1FS4A 1MPXA 1BJRE 2FPGA 3CEPB 4FBMA 5REQA 3GPCA 1CS0A 3H5IA 5EL0A 2XJ4A 3A9CA 4DCJA 3JALA 2I3DA 5JSUA 1TAGA 1FNNA 5CFOA 4KKXB 2XDYA 16PKA 3OZRA 2OQVA 3TQRA 5ALGA 1E1LA 2FX5A 1G9TA 1T0UA 1AHNA 4ZQEA 3I04M 5BQPA 4D97A 4TYNA 1I7DA 2FRXA 3H1PA 1WB6A 3FIUA 1A8SA 1FDVA 1G1AA 3UT5A 4Z1MD 1NBHA 2ES4A 2UKDA 4P53A 4QDXA 1RWNA 1OGIA 1X0VA 4HT3B 2HRCA 2DFDA 4N79A 2OV6A 1KE1A 4YAIA 5H8WA 4QBHA 4B6PA 4EB6B 2H18A 1JTEA 3ZS9A 2AUTA 3FNEA 1WPGA 3SKYA 1T1GA 1ZMBA 1W7AA 4RAQA 4OAQA 5ERXA 1XLUA 3L7DA 2UUCB 1IC6A 1O6CA 3OT1B 3PHLA 2FEPA 3KOMA 5FIUA 3WG9A 1PNVA 3ENZA 2G7YA 5CXUA 2X0IA 4FX2A 1THMA 2KSQA 3LYHA 4YA6A 3IAHA 3QNWA 4HATA 4G1EB 2YMLA 1IWOA 2J0VA 1DX6A 3RC1A 3RHTA 4MUKA 2IQIA 5JO9A 1DHTA 2FSSA 4O2AF 1EH5A 1B0AA 3UAYA 1QKJA 4RPLA 1WKVA 4E5SA 3KX2A 1WUIS 2HR1A 3R8CA 5DEOA 4MS4B 2FRQA 2O5EA 4Q7KA 4DLWA 2B8JA 1OOEA 2VAVA 3OJOA 4MQEB 3WA6A 1IOWA 4S1NA 2QRGA 3LOQA 5KYUA 2QZJA 2XUKA 3LHFA 1WSDA 5HCNA 4E7PA 4KRXA 5CITA 1AS2A 1QWSA 2HV9A 2VDOB 4QGBA 3TMYA 4DMXA 3LX5A 1ECGA 1NC1A 3MCUA 4NRDA 1TU6A 1RC0A 4ZJPA 2XUFA 2R65A 3BTUA 1ZMOA 2ALJA 5IYZF 3DDZX 1X1CA 4AJKA 4OLFA 1UL1X 1W47A 3E61A 3P9NA 3V32A 4XWWA 2ZCUA 3MHTA 4BQIA 1GZ4A 2V1XA 4A0GA 3CJRA 1H65A 4DMLA 3U4QA 3DEYX 3GGSA 4IFBA 2YRFA 2IP2A 1P6XA 1JALA 2A9RA 2VL7A 2VF7A 3I83A 3KKLA 2ZQZA 1MT0A 1NTRA 3IKJA 3VI4B 3WFIA 4JH0A 4QX6A 3IQGX 3EAQA 4YCJA 3EPLA 3JALB 1SOVA 2OB1A 3I05A 1JJAA 4HRXA 5EIAA 5I48A 4YUAA 3FTFA 4I1VA 3ND6A 2GCNA 3ETDA 4BFXA 4EEKA 4EL5A 1R00A 5KVSA 3V8BA 1L4UA 2LGJA 4QGSA 2ZRCA 4R3NA 3N2ZB 1PO7A 3GN1A 4WLEA 5F4ZA 2WTBA 5AW9A 1GHTA 1CFJA 5CCXA 4JS0A 4Q03A 2XV1A 3SS8A 4HDRB 2XCLA 3TL3A 2C97A 2QQ5A 4CT0A 3VQTA 5ALZA 4YCBA 4KB5A 4GXTA 3LUPA 4C0XA 2W2LA 5KAPA 1CX9B 2I4MA 2NVUB 3H1BA 3OQBA 1YZLA 2PKEA 4E13A 1J5PA 4FS3A 2R44A 3KT0A 2IEAA 3JYLA 2E18A 2KBFA 2RIPA 2OXEA 4H1UA 1V4NA 1J33A