3TRRA

Crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
252
structure length
252
Chain Sequence
b'MADEVLIEQRDRVLLITINRPDARNAVNRAVSQGLAAAADQLDSSADLSVAIITGAGGNFCAGMDLKAFVSGEAVLSERGLGFTNVPPRKPIIAAVEGFALAGGTELVLSCDLVVAGRSAKFGIPEVKRGLVAGAGGLLRLPNRIPYQVAMELALTGESFTAEDAAKYGFINRLVDDGQALDTALELAAKITANGPLAVAATKRIIIESASWAPEEAFAKQGEILMPIFVSEDAKEGAKAFAEKRAPVWQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable enoyl-CoA hydratase/isomerase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Isomerase
total genus 92
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3trrA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3trrA01
3I47A 4IZBA 3QREA 4EMPA 4Z0MA 3IAVA 2FZSA 2F6QA 5DUFA 4ZU2A 1PIXA 3HP0A 3R0OA 4JWVA 3FDUA 4I52A 4FNDA 3Q1TA 4QIIA 3H0QA 1WDMA 3ZW9A 1FCFA 4NNQA 3MT6A 1RJMA 5FUSA 3T88A 3GLMA 5DU6A 2Q34A 3RSTA 5E0SH 1YG6A 3TV5A 1HZDA 2VSUC 1HNOA 5MGBA 3SWXA 4ASIA 2CE3A 4Q1IA 4JCTA 3U9SB 4LK5A 5G1RA 1FC7A 4HC8A 2J5GA 3PE8A 3KTJA 3TRRA 2PPYA 3PZKA 3KTGA 3TT6A 2A7SA 3STAA 4B3JA 1Y7OA 1VRGA 2ZL2A 1ON3A 1XX4A 2WTBA 2VSSF 3R9QA 3DJAA 3T8BA 3TLFA 4L6WA 1FC6A 4FB8A 1WDKA 4KD6A 3KQFA 4OLQA 1XNWA 4ELWA 3M6MA 3R9SA 4U1AA 1HNUA 1W2XA 3R6HA 2ZQQA 5INFA 2ZL3A 3HRXA 3ZWBA 2ZL4A 3GF3A 3KTKA 2C8TA 4KWBA 3PGQA 4FNBA 4K2NA 3BPPA 1K32A 1UYTA 3QKAA 4QFEA 5INGA 2F9YA 4U0GA 2VSUE 2QQ3A 2J5GD 5JBXA 4ZDCA 4L8KA 1NZYA 1SZOA 5C9GA 4K3WA 2F9IA 4FZWC 3HLN1 4JJTA 2F6IA 3H0UA 4K29A 2ZL0A 4EMMA 4MOUA 1RJNA 3N6RB 4FN7A 3VIVA 2X24A 1UIYA 4YLHA 5DL1A 4RYFA 3U9TB 1SG4A 5DKPA 3QXZA 4ZDDA 3P2LA 2HW5A 4OMRA 4I42A 3QMJA 3ZWCA 3TZ3A 3P85A 1OD2A 2J5IB 2F9YB 3FF6A 1WZ8A 4JCRA 2CBYA 1NZYB 2Q35A 3BEZA 3T89A 3IB9A 4HNKA 3V5EA 2BZRA 3G64A 1Q51A 3K50A 3NJDA 4I4ZA 3MFMA 3SLLA 2VREA 1FC9A 1PJHA 4ELXA 4F47A 3OMEA 4U19A 3K8XA 4JSBA 4ZDEA 1N6FA 3Q0GA 3BF0A 1OD4A 3OT6A 1TG6A 4IZDA 2X58A 3KTIA 3H02A 1UYSA 2VSUA 4GM2A 3T3WA 2NP9A 5DZKA 5DTPA 5CTCA 1K39A 2FBMA 4JOTA 3KTHA 5KJPA 3ZWAA 4DI1A 2UZFA 2W3PA 3PEAA 3H0JA 4Q0GA 1UYVA 2FW2A 4NEKA 5KDRA 5DU4A 4U0HA 3QK8A 3LKEA 4U0GH 3V5IA 5E0NX 4KNPA 4B3HA 4JYLA 4MI2A 4IZCA 3MYBA 3GKBA 4JVTA 3GMAA 2Q2XA 3HINA 1ON9A 3QYRA 5FIFA 1J7XA 3RSIA 4WCZA 5JBWA 4RYFH 4WYOB 5IKLB 2D3TA 1EY3A 2PG8A 4G2RA 4FZWA 1XNYA 1DUBA 1WDLA 1N6EA 5KDRB 3QXIA 3TVWA 3ZW8A 3R9TA 1UYRA 2PBPA 1O8UA 2F9IB 5DU8A 2DUBA 2J5II 3OC7A 3WG5A 1Q52A 1EF9A 4GHNA 1X0UA 3JU1A 3GF7A 5E0SA 5DTWA 1YG8A 2ZQRA 3IBBA 3H0SA 2VX2A 4ZDFA 4U18A 2VSSA 1EF8A 3LAOA 2EJ5A 4KPKA 5DUCA 1N6DA 4MXIA 4OG1A 4B3IA 3ST9A 5G1SA 4JFCA 4ELSA 3P5MA 4RCNA 5DZKH 3L3SA 4FJWD 3HE2A 3RRVA 1XNVA 2A81A 3Q7HA 3T8AA 3DORA 3H81A 5INIA 4JCQA 4ZDBA 2VSUF 2A7KA 5C90A 2VSSE 1TYFA 2J5SA 2DEOA 4JYJA 2IEXA 5G1QA 5CTBA 3NJBA 3ISAA 3M6NA 2GTRA 3Q0JA 4EMLA 4JCSA 1DCIA 1JXZA 3TDCA 4WZ8B 4QIJA 3TT7A 1MJ3A 4FN8A 2J5IA 3QWDA 3U9RB 1XO6A 3MOYA 3TVUA
chains in the Genus database with same CATH superfamily
3I47A 4IZBA 3QREA 4EMPA 4Z0MA 3IAVA 2FZSA 2F6QA 4GEHB 5DUFA 4ZU2A 1PIXA 3HP0A 1UX4A 3R0OA 3A4MA 4JWVA 3FDUA 4I52A 3RQFA 4FNDA 3Q1TA 4QIIA 3H0QA 2YJGA 1WDMA 3ZW9A 1FCFA 4NNQA 2P63A 3MT6A 1RJMA 5FUSA 3T88A 3GLMA 5DU6A 2Q34A 3RSTA 5E0SH 1YG6A 3TV5A 1HZDA 2VSUC 1HNOA 5MGBA 3SWXA 4ASIA 2CE3A 4Q1IA 4JCTA 3U9SB 4LK5A 5G1RA 1FC7A 4HC8A 2J5GA 1Y64B 3O4XE 3KTJA 3PE8A 3TRRA 2PPYA 3PZKA 3KTGA 3TT6A 2A7SA 3STAA 4B3JA 1Y7OA 1VRGA 2ZL2A 1ON3A 1XX4A 2WTBA 2VSSF 3R9QA 3DJAA 3T8BA 3TLFA 4L6WA 1FC6A 4FB8A 1WDKA 4KD6A 3KQFA 4OLQA 1XNWA 4ELWA 3M6MA 3R9SA 3RQGA 4U1AA 1HNUA 1W2XA 3R6HA 2ZQQA 5INFA 2ZL3A 3HRXA 3ZWBA 3W8HB 2ZL4A 3GF3A 3KTKA 2C8TA 4KWBA 3PGQA 4FNBA 4K2NA 3BPPA 1K32A 1UYTA 3QKAA 4QFEA 5INGA 2F9YA 4U0GA 2VSUE 2QQ3A 2J5GD 5JBXA 4ZDCA 4L8KA 1NZYA 1SZOA 5C9GA 4K3WA 2F9IA 4FZWC 3HLN1 4JJTA 2F6IA 3H0UA 4K29A 2ZL0A 4EMMA 4MOUA 1RJNA 3N6RB 4FN7A 3VIVA 3L8JA 2X24A 3A4LA 1UIYA 4YLHA 5DL1A 4RYFA 3U9TB 1SG4A 5DKPA 3QXZA 4ZDDA 3P2LA 2HW5A 4OMRA 4I42A 3QMJA 3ZWCA 3TZ3A 3P85A 3L8IA 1OD2A 5HUQA 2J5IB 3AM1A 2F9YB 3FF6A 1WZ8A 4JCRA 2CBYA 3AJMA 1NZYB 2Q35A 3BEZA 3T89A 3IB9A 4HNKA 3V5EA 2BZRA 3G64A 1Q51A 3K50A 3NJDA 4I4ZA 3MFMA 3SLLA 2VREA 3RQEA 1FC9A 1PJHA 4ELXA 4F47A 3OMEA 4U19A 3K8XA 4JSBA 4ZDEA 1N6FA 3Q0GA 3BF0A 1OD4A 3OT6A 1TG6A 4IZDA 2X58A 3KTIA 3H02A 1UYSA 2VSUA 4GM2A 3T3WA 2NP9A 5DZKA 5DTPA 5CTCA 1K39A 2FBMA 4JOTA 3KTHA 5KJPA 3ZWAA 4DI1A 2UZFA 2W3PA 3PEAA 3H0JA 4Q0GA 1UYVA 2FW2A 4NEKA 3ADCA 5KDRA 5DU4A 4U0HA 3QK8A 3LKEA 4U0GH 3V5IA 5E0NX 4NARA 4KNPA 4B3HA 4JYLA 3W8IB 4MI2A 4IZCA 3MYBA 3GKBA 4JVTA 3GMAA 2Q2XA 3HINA 1ON9A 3QYRA 5FIFA 1J7XA 3RSIA 4WCZA 5JBWA 4RYFH 4WYOB 5IKLB 2D3TA 1EY3A 2PG8A 4G2RA 4FZWA 1XNYA 1DUBA 3A4NA 1WDLA 1N6EA 5KDRB 3QXIA 3TVWA 3ZW8A 3R9TA 3IRBA 1UYRA 2PBPA 1O8UA 2F9IB 3BPTA 5DU8A 2DUBA 2J5II 3OC7A 3WG5A 1Q52A 1UX5A 1EF9A 3ADDA 4GHNA 1X0UA 3JU1A 3GF7A 5E0SA 5DTWA 1YG8A 2ZQRA 3IBBA 3H0SA 2VX2A 4ZDFA 4U18A 2VSSA 1EF8A 3LAOA 2EJ5A 4KPKA 5DUCA 1N6DA 4MXIA 4OG1A 4B3IA 3ST9A 5G1SA 4JFCA 4ELSA 3P5MA 4RCNA 5DZKH 4J2UA 3L3SA 4FJWD 3HE2A 3RRVA 1XNVA 2A81A 3Q7HA 3T8AA 3DORA 3H81A 5INIA 4JCQA 4ZDBA 2VSUF 2A7KA 5C90A 2VSSE 1TYFA 2J5SA 2DEOA 4JYJA 2IEXA 4HDTA 5G1QA 5CTBA 3NJBA 3ISAA 3M6NA 2GTRA 3Q0JA 3ADBA 4EMLA 4JCSA 1DCIA 1JXZA 3TDCA 4WZ8B 4QIJA 3TT7A 1MJ3A 4FN8A 2J5IA 3QWDA 3U9RB 1XO6A 3MOYA 3TVUA
chains in the Genus database with same CATH topology
3I47A 4IZBA 3QREA 4EMPA 4Z0MA 3IAVA 2FZSA 2F6QA 5DUFA 4ZU2A 1PIXA 3HP0A 3R0OA 4JWVA 3FDUA 4I52A 4FNDA 3Q1TA 4QIIA 3H0QA 2YJGA 1WDMA 3ZW9A 1FCFA 4NNQA 3MT6A 1RJMA 5FUSA 3T88A 3GLMA 5DU6A 2Q34A 3RSTA 5E0SH 1YG6A 3TV5A 1HZDA 2VSUC 1HNOA 5MGBA 3SWXA 4ASIA 2CE3A 4Q1IA 4JCTA 3U9SB 4LK5A 5G1RA 1FC7A 4HC8A 2J5GA 3PE8A 3KTJA 3TRRA 2PPYA 3PZKA 3KTGA 3TT6A 2A7SA 3STAA 4B3JA 1Y7OA 1VRGA 2ZL2A 1ON3A 1XX4A 2WTBA 2VSSF 3R9QA 3DJAA 3T8BA 3TLFA 4L6WA 1FC6A 4FB8A 1WDKA 4KD6A 3KQFA 4OLQA 1XNWA 4ELWA 3M6MA 3R9SA 4U1AA 1HNUA 1W2XA 3R6HA 2ZQQA 5INFA 2ZL3A 3HRXA 3ZWBA 2ZL4A 3GF3A 3KTKA 2C8TA 4KWBA 3PGQA 4FNBA 4K2NA 3BPPA 1K32A 1UYTA 3QKAA 4QFEA 5INGA 2F9YA 4U0GA 2VSUE 2QQ3A 2J5GD 5JBXA 4ZDCA 4L8KA 1NZYA 1SZOA 5C9GA 4K3WA 2F9IA 4FZWC 3HLN1 4JJTA 2F6IA 3H0UA 4K29A 2ZL0A 4EMMA 4MOUA 1RJNA 3N6RB 4FN7A 3VIVA 2X24A 1UIYA 4YLHA 5DL1A 4RYFA 3U9TB 1SG4A 5DKPA 3QXZA 4ZDDA 3P2LA 2HW5A 4OMRA 4I42A 3QMJA 3ZWCA 3TZ3A 3P85A 1OD2A 5HUQA 2J5IB 2F9YB 3FF6A 1WZ8A 4JCRA 2CBYA 1NZYB 2Q35A 3BEZA 3T89A 3IB9A 4HNKA 3V5EA 2BZRA 3G64A 1Q51A 3K50A 3NJDA 4I4ZA 3MFMA 3SLLA 2VREA 1FC9A 1PJHA 4ELXA 4F47A 3OMEA 4U19A 3K8XA 4JSBA 4ZDEA 1N6FA 3Q0GA 3BF0A 1OD4A 3OT6A 1TG6A 4IZDA 2X58A 3KTIA 3H02A 1UYSA 2VSUA 4GM2A 3T3WA 2NP9A 5DZKA 5DTPA 5CTCA 1K39A 2FBMA 4JOTA 3KTHA 5KJPA 3ZWAA 4DI1A 2UZFA 2W3PA 3PEAA 3H0JA 4Q0GA 1UYVA 2FW2A 4NEKA 5KDRA 5DU4A 4U0HA 3QK8A 3LKEA 4U0GH 3V5IA 5E0NX 4NARA 4KNPA 4B3HA 4JYLA 4MI2A 4IZCA 3MYBA 3GKBA 4JVTA 3GMAA 2Q2XA 3HINA 1ON9A 3QYRA 5FIFA 1J7XA 3RSIA 4WCZA 5JBWA 4RYFH 4WYOB 5IKLB 2D3TA 1EY3A 2PG8A 4G2RA 4FZWA 1XNYA 1DUBA 1WDLA 1N6EA 5KDRB 3QXIA 3TVWA 3ZW8A 3R9TA 1UYRA 2PBPA 1O8UA 2F9IB 3BPTA 5DU8A 2DUBA 2J5II 3OC7A 3WG5A 1Q52A 1EF9A 4GHNA 1X0UA 3JU1A 3GF7A 5E0SA 5DTWA 1YG8A 2ZQRA 3IBBA 3H0SA 2VX2A 4ZDFA 4U18A 2VSSA 1EF8A 3LAOA 2EJ5A 4KPKA 5DUCA 1N6DA 4MXIA 4OG1A 4B3IA 3ST9A 5G1SA 4JFCA 4ELSA 3P5MA 4RCNA 5DZKH 4J2UA 3L3SA 4FJWD 3HE2A 3RRVA 1XNVA 2A81A 3Q7HA 3T8AA 3DORA 3H81A 5INIA 4JCQA 4ZDBA 2VSUF 2A7KA 5C90A 2VSSE 1TYFA 2J5SA 2DEOA 4JYJA 2IEXA 4HDTA 5G1QA 5CTBA 3NJBA 3ISAA 3M6NA 2GTRA 3Q0JA 4EMLA 4JCSA 1DCIA 1JXZA 3TDCA 4WZ8B 4QIJA 3TT7A 1MJ3A 4FN8A 2J5IA 3QWDA 3U9RB 1XO6A 3MOYA 3TVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I47 A;  4IZB A;  3QRE A;  4EMP A;  4Z0M A;  3IAV A;  2FZS A;  2F6Q A;  5DUF A;  4ZU2 A;  1PIX A;  3HP0 A;  3R0O A;  4JWV A;  3FDU A;  4I52 A;  4FND A;  3Q1T A;  4QII A;  3H0Q A;  1WDM A;  3ZW9 A;  1FCF A;  4NNQ A;  3MT6 A;  1RJM A;  5FUS A;  3T88 A;  3GLM A;  5DU6 A;  2Q34 A;  3RST A;  5E0S H;  1YG6 A;  3TV5 A;  1HZD A;  2VSU C;  1HNO A;  5MGB A;  3SWX A;  4ASI A;  2CE3 A;  4Q1I A;  4JCT A;  3U9S B;  4LK5 A;  5G1R A;  1FC7 A;  4HC8 A;  2J5G A;  3PE8 A;  3KTJ A;  3TRR A;  2PPY A;  3PZK A;  3KTG A;  3TT6 A;  2A7S A;  3STA A;  4B3J A;  1Y7O A;  1VRG A;  2ZL2 A;  1ON3 A;  1XX4 A;  2WTB A;  2VSS F;  3R9Q A;  3DJA A;  3T8B A;  3TLF A;  4L6W A;  1FC6 A;  4FB8 A;  1WDK A;  4KD6 A;  3KQF A;  4OLQ A;  1XNW A;  4ELW A;  3M6M A;  3R9S A;  4U1A A;  1HNU A;  1W2X A;  3R6H A;  2ZQQ A;  5INF A;  2ZL3 A;  3HRX A;  3ZWB A;  2ZL4 A;  3GF3 A;  3KTK A;  2C8T A;  4KWB A;  3PGQ A;  4FNB A;  4K2N A;  3BPP A;  1K32 A;  1UYT A;  3QKA A;  4QFE A;  5ING A;  2F9Y A;  4U0G A;  2VSU E;  2QQ3 A;  2J5G D;  5JBX A;  4ZDC A;  4L8K A;  1NZY A;  1SZO A;  5C9G A;  4K3W A;  2F9I A;  4FZW C;  3HLN 1;  4JJT A;  2F6I A;  3H0U A;  4K29 A;  2ZL0 A;  4EMM A;  4MOU A;  1RJN A;  3N6R B;  4FN7 A;  3VIV A;  2X24 A;  1UIY A;  4YLH A;  5DL1 A;  4RYF A;  3U9T B;  1SG4 A;  5DKP A;  3QXZ A;  4ZDD A;  3P2L A;  2HW5 A;  4OMR A;  4I42 A;  3QMJ A;  3ZWC A;  3TZ3 A;  3P85 A;  1OD2 A;  2J5I B;  2F9Y B;  3FF6 A;  1WZ8 A;  4JCR A;  2CBY A;  1NZY B;  2Q35 A;  3BEZ A;  3T89 A;  3IB9 A;  4HNK A;  3V5E A;  2BZR A;  3G64 A;  1Q51 A;  3K50 A;  3NJD A;  4I4Z A;  3MFM A;  3SLL A;  2VRE A;  1FC9 A;  1PJH A;  4ELX A;  4F47 A;  3OME A;  4U19 A;  3K8X A;  4JSB A;  4ZDE A;  1N6F A;  3Q0G A;  3BF0 A;  1OD4 A;  3OT6 A;  1TG6 A;  4IZD A;  2X58 A;  3KTI A;  3H02 A;  1UYS A;  2VSU A;  4GM2 A;  3T3W A;  2NP9 A;  5DZK A;  5DTP A;  5CTC A;  1K39 A;  2FBM A;  4JOT A;  3KTH A;  5KJP A;  3ZWA A;  4DI1 A;  2UZF A;  2W3P A;  3PEA A;  3H0J A;  4Q0G A;  1UYV A;  2FW2 A;  4NEK A;  5KDR A;  5DU4 A;  4U0H A;  3QK8 A;  3LKE A;  4U0G H;  3V5I A;  5E0N X;  4KNP A;  4B3H A;  4JYL A;  4MI2 A;  4IZC A;  3MYB A;  3GKB A;  4JVT A;  3GMA A;  2Q2X A;  3HIN A;  1ON9 A;  3QYR A;  5FIF A;  1J7X A;  3RSI A;  4WCZ A;  5JBW A;  4RYF H;  4WYO B;  5IKL B;  2D3T A;  1EY3 A;  2PG8 A;  4G2R A;  4FZW A;  1XNY A;  1DUB A;  1WDL A;  1N6E A;  5KDR B;  3QXI A;  3TVW A;  3ZW8 A;  3R9T A;  1UYR A;  2PBP A;  1O8U A;  2F9I B;  5DU8 A;  2DUB A;  2J5I I;  3OC7 A;  3WG5 A;  1Q52 A;  1EF9 A;  4GHN A;  1X0U A;  3JU1 A;  3GF7 A;  5E0S A;  5DTW A;  1YG8 A;  2ZQR A;  3IBB A;  3H0S A;  2VX2 A;  4ZDF A;  4U18 A;  2VSS A;  1EF8 A;  3LAO A;  2EJ5 A;  4KPK A;  5DUC A;  1N6D A;  4MXI A;  4OG1 A;  4B3I A;  3ST9 A;  5G1S A;  4JFC A;  4ELS A;  3P5M A;  4RCN A;  5DZK H;  3L3S A;  4FJW D;  3HE2 A;  3RRV A;  1XNV A;  2A81 A;  3Q7H A;  3T8A A;  3DOR A;  3H81 A;  5INI A;  4JCQ A;  4ZDB A;  2VSU F;  2A7K A;  5C90 A;  2VSS E;  1TYF A;  2J5S A;  2DEO A;  4JYJ A;  2IEX A;  5G1Q A;  5CTB A;  3NJB A;  3ISA A;  3M6N A;  2GTR A;  3Q0J A;  4EML A;  4JCS A;  1DCI A;  1JXZ A;  3TDC A;  4WZ8 B;  4QIJ A;  3TT7 A;  1MJ3 A;  4FN8 A;  2J5I A;  3QWD A;  3U9R B;  1XO6 A;  3MOY A;  3TVU A; 
#chains in the Genus database with same CATH topology
 3I47 A;  4IZB A;  3QRE A;  4EMP A;  4Z0M A;  3IAV A;  2FZS A;  2F6Q A;  4GEH B;  5DUF A;  4ZU2 A;  1PIX A;  3HP0 A;  1UX4 A;  3R0O A;  3A4M A;  4JWV A;  3FDU A;  4I52 A;  3RQF A;  4FND A;  3Q1T A;  4QII A;  3H0Q A;  2YJG A;  1WDM A;  3ZW9 A;  1FCF A;  4NNQ A;  2P63 A;  3MT6 A;  1RJM A;  5FUS A;  3T88 A;  3GLM A;  5DU6 A;  2Q34 A;  3RST A;  5E0S H;  1YG6 A;  3TV5 A;  1HZD A;  2VSU C;  1HNO A;  5MGB A;  3SWX A;  4ASI A;  2CE3 A;  4Q1I A;  4JCT A;  3U9S B;  4LK5 A;  5G1R A;  1FC7 A;  4HC8 A;  2J5G A;  1Y64 B;  3O4X E;  3KTJ A;  3PE8 A;  3TRR A;  2PPY A;  3PZK A;  3KTG A;  3TT6 A;  2A7S A;  3STA A;  4B3J A;  1Y7O A;  1VRG A;  2ZL2 A;  1ON3 A;  1XX4 A;  2WTB A;  2VSS F;  3R9Q A;  3DJA A;  3T8B A;  3TLF A;  4L6W A;  1FC6 A;  4FB8 A;  1WDK A;  4KD6 A;  3KQF A;  4OLQ A;  1XNW A;  4ELW A;  3M6M A;  3R9S A;  3RQG A;  4U1A A;  1HNU A;  1W2X A;  3R6H A;  2ZQQ A;  5INF A;  2ZL3 A;  3HRX A;  3ZWB A;  3W8H B;  2ZL4 A;  3GF3 A;  3KTK A;  2C8T A;  4KWB A;  3PGQ A;  4FNB A;  4K2N A;  3BPP A;  1K32 A;  1UYT A;  3QKA A;  4QFE A;  5ING A;  2F9Y A;  4U0G A;  2VSU E;  2QQ3 A;  2J5G D;  5JBX A;  4ZDC A;  4L8K A;  1NZY A;  1SZO A;  5C9G A;  4K3W A;  2F9I A;  4FZW C;  3HLN 1;  4JJT A;  2F6I A;  3H0U A;  4K29 A;  2ZL0 A;  4EMM A;  4MOU A;  1RJN A;  3N6R B;  4FN7 A;  3VIV A;  3L8J A;  2X24 A;  3A4L A;  1UIY A;  4YLH A;  5DL1 A;  4RYF A;  3U9T B;  1SG4 A;  5DKP A;  3QXZ A;  4ZDD A;  3P2L A;  2HW5 A;  4OMR A;  4I42 A;  3QMJ A;  3ZWC A;  3TZ3 A;  3P85 A;  3L8I A;  1OD2 A;  5HUQ A;  2J5I B;  3AM1 A;  2F9Y B;  3FF6 A;  1WZ8 A;  4JCR A;  2CBY A;  3AJM A;  1NZY B;  2Q35 A;  3BEZ A;  3T89 A;  3IB9 A;  4HNK A;  3V5E A;  2BZR A;  3G64 A;  1Q51 A;  3K50 A;  3NJD A;  4I4Z A;  3MFM A;  3SLL A;  2VRE A;  3RQE A;  1FC9 A;  1PJH A;  4ELX A;  4F47 A;  3OME A;  4U19 A;  3K8X A;  4JSB A;  4ZDE A;  1N6F A;  3Q0G A;  3BF0 A;  1OD4 A;  3OT6 A;  1TG6 A;  4IZD A;  2X58 A;  3KTI A;  3H02 A;  1UYS A;  2VSU A;  4GM2 A;  3T3W A;  2NP9 A;  5DZK A;  5DTP A;  5CTC A;  1K39 A;  2FBM A;  4JOT A;  3KTH A;  5KJP A;  3ZWA A;  4DI1 A;  2UZF A;  2W3P A;  3PEA A;  3H0J A;  4Q0G A;  1UYV A;  2FW2 A;  4NEK A;  3ADC A;  5KDR A;  5DU4 A;  4U0H A;  3QK8 A;  3LKE A;  4U0G H;  3V5I A;  5E0N X;  4NAR A;  4KNP A;  4B3H A;  4JYL A;  3W8I B;  4MI2 A;  4IZC A;  3MYB A;  3GKB A;  4JVT A;  3GMA A;  2Q2X A;  3HIN A;  1ON9 A;  3QYR A;  5FIF A;  1J7X A;  3RSI A;  4WCZ A;  5JBW A;  4RYF H;  4WYO B;  5IKL B;  2D3T A;  1EY3 A;  2PG8 A;  4G2R A;  4FZW A;  1XNY A;  1DUB A;  3A4N A;  1WDL A;  1N6E A;  5KDR B;  3QXI A;  3TVW A;  3ZW8 A;  3R9T A;  3IRB A;  1UYR A;  2PBP A;  1O8U A;  2F9I B;  3BPT A;  5DU8 A;  2DUB A;  2J5I I;  3OC7 A;  3WG5 A;  1Q52 A;  1UX5 A;  1EF9 A;  3ADD A;  4GHN A;  1X0U A;  3JU1 A;  3GF7 A;  5E0S A;  5DTW A;  1YG8 A;  2ZQR A;  3IBB A;  3H0S A;  2VX2 A;  4ZDF A;  4U18 A;  2VSS A;  1EF8 A;  3LAO A;  2EJ5 A;  4KPK A;  5DUC A;  1N6D A;  4MXI A;  4OG1 A;  4B3I A;  3ST9 A;  5G1S A;  4JFC A;  4ELS A;  3P5M A;  4RCN A;  5DZK H;  4J2U A;  3L3S A;  4FJW D;  3HE2 A;  3RRV A;  1XNV A;  2A81 A;  3Q7H A;  3T8A A;  3DOR A;  3H81 A;  5INI A;  4JCQ A;  4ZDB A;  2VSU F;  2A7K A;  5C90 A;  2VSS E;  1TYF A;  2J5S A;  2DEO A;  4JYJ A;  2IEX A;  4HDT A;  5G1Q A;  5CTB A;  3NJB A;  3ISA A;  3M6N A;  2GTR A;  3Q0J A;  3ADB A;  4EML A;  4JCS A;  1DCI A;  1JXZ A;  3TDC A;  4WZ8 B;  4QIJ A;  3TT7 A;  1MJ3 A;  4FN8 A;  2J5I A;  3QWD A;  3U9R B;  1XO6 A;  3MOY A;  3TVU A; 
#chains in the Genus database with same CATH homology
 3I47 A;  4IZB A;  3QRE A;  4EMP A;  4Z0M A;  3IAV A;  2FZS A;  2F6Q A;  5DUF A;  4ZU2 A;  1PIX A;  3HP0 A;  3R0O A;  4JWV A;  3FDU A;  4I52 A;  4FND A;  3Q1T A;  4QII A;  3H0Q A;  2YJG A;  1WDM A;  3ZW9 A;  1FCF A;  4NNQ A;  3MT6 A;  1RJM A;  5FUS A;  3T88 A;  3GLM A;  5DU6 A;  2Q34 A;  3RST A;  5E0S H;  1YG6 A;  3TV5 A;  1HZD A;  2VSU C;  1HNO A;  5MGB A;  3SWX A;  4ASI A;  2CE3 A;  4Q1I A;  4JCT A;  3U9S B;  4LK5 A;  5G1R A;  1FC7 A;  4HC8 A;  2J5G A;  3PE8 A;  3KTJ A;  3TRR A;  2PPY A;  3PZK A;  3KTG A;  3TT6 A;  2A7S A;  3STA A;  4B3J A;  1Y7O A;  1VRG A;  2ZL2 A;  1ON3 A;  1XX4 A;  2WTB A;  2VSS F;  3R9Q A;  3DJA A;  3T8B A;  3TLF A;  4L6W A;  1FC6 A;  4FB8 A;  1WDK A;  4KD6 A;  3KQF A;  4OLQ A;  1XNW A;  4ELW A;  3M6M A;  3R9S A;  4U1A A;  1HNU A;  1W2X A;  3R6H A;  2ZQQ A;  5INF A;  2ZL3 A;  3HRX A;  3ZWB A;  2ZL4 A;  3GF3 A;  3KTK A;  2C8T A;  4KWB A;  3PGQ A;  4FNB A;  4K2N A;  3BPP A;  1K32 A;  1UYT A;  3QKA A;  4QFE A;  5ING A;  2F9Y A;  4U0G A;  2VSU E;  2QQ3 A;  2J5G D;  5JBX A;  4ZDC A;  4L8K A;  1NZY A;  1SZO A;  5C9G A;  4K3W A;  2F9I A;  4FZW C;  3HLN 1;  4JJT A;  2F6I A;  3H0U A;  4K29 A;  2ZL0 A;  4EMM A;  4MOU A;  1RJN A;  3N6R B;  4FN7 A;  3VIV A;  2X24 A;  1UIY A;  4YLH A;  5DL1 A;  4RYF A;  3U9T B;  1SG4 A;  5DKP A;  3QXZ A;  4ZDD A;  3P2L A;  2HW5 A;  4OMR A;  4I42 A;  3QMJ A;  3ZWC A;  3TZ3 A;  3P85 A;  1OD2 A;  5HUQ A;  2J5I B;  2F9Y B;  3FF6 A;  1WZ8 A;  4JCR A;  2CBY A;  1NZY B;  2Q35 A;  3BEZ A;  3T89 A;  3IB9 A;  4HNK A;  3V5E A;  2BZR A;  3G64 A;  1Q51 A;  3K50 A;  3NJD A;  4I4Z A;  3MFM A;  3SLL A;  2VRE A;  1FC9 A;  1PJH A;  4ELX A;  4F47 A;  3OME A;  4U19 A;  3K8X A;  4JSB A;  4ZDE A;  1N6F A;  3Q0G A;  3BF0 A;  1OD4 A;  3OT6 A;  1TG6 A;  4IZD A;  2X58 A;  3KTI A;  3H02 A;  1UYS A;  2VSU A;  4GM2 A;  3T3W A;  2NP9 A;  5DZK A;  5DTP A;  5CTC A;  1K39 A;  2FBM A;  4JOT A;  3KTH A;  5KJP A;  3ZWA A;  4DI1 A;  2UZF A;  2W3P A;  3PEA A;  3H0J A;  4Q0G A;  1UYV A;  2FW2 A;  4NEK A;  5KDR A;  5DU4 A;  4U0H A;  3QK8 A;  3LKE A;  4U0G H;  3V5I A;  5E0N X;  4NAR A;  4KNP A;  4B3H A;  4JYL A;  4MI2 A;  4IZC A;  3MYB A;  3GKB A;  4JVT A;  3GMA A;  2Q2X A;  3HIN A;  1ON9 A;  3QYR A;  5FIF A;  1J7X A;  3RSI A;  4WCZ A;  5JBW A;  4RYF H;  4WYO B;  5IKL B;  2D3T A;  1EY3 A;  2PG8 A;  4G2R A;  4FZW A;  1XNY A;  1DUB A;  1WDL A;  1N6E A;  5KDR B;  3QXI A;  3TVW A;  3ZW8 A;  3R9T A;  1UYR A;  2PBP A;  1O8U A;  2F9I B;  3BPT A;  5DU8 A;  2DUB A;  2J5I I;  3OC7 A;  3WG5 A;  1Q52 A;  1EF9 A;  4GHN A;  1X0U A;  3JU1 A;  3GF7 A;  5E0S A;  5DTW A;  1YG8 A;  2ZQR A;  3IBB A;  3H0S A;  2VX2 A;  4ZDF A;  4U18 A;  2VSS A;  1EF8 A;  3LAO A;  2EJ5 A;  4KPK A;  5DUC A;  1N6D A;  4MXI A;  4OG1 A;  4B3I A;  3ST9 A;  5G1S A;  4JFC A;  4ELS A;  3P5M A;  4RCN A;  5DZK H;  4J2U A;  3L3S A;  4FJW D;  3HE2 A;  3RRV A;  1XNV A;  2A81 A;  3Q7H A;  3T8A A;  3DOR A;  3H81 A;  5INI A;  4JCQ A;  4ZDB A;  2VSU F;  2A7K A;  5C90 A;  2VSS E;  1TYF A;  2J5S A;  2DEO A;  4JYJ A;  2IEX A;  4HDT A;  5G1Q A;  5CTB A;  3NJB A;  3ISA A;  3M6N A;  2GTR A;  3Q0J A;  4EML A;  4JCS A;  1DCI A;  1JXZ A;  3TDC A;  4WZ8 B;  4QIJ A;  3TT7 A;  1MJ3 A;  4FN8 A;  2J5I A;  3QWD A;  3U9R B;  1XO6 A;  3MOY A;  3TVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...