3TRRA

Crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
252
structure length
252
Chain Sequence
MADEVLIEQRDRVLLITINRPDARNAVNRAVSQGLAAAADQLDSSADLSVAIITGAGGNFCAGMDLKAFVSGEAVLSERGLGFTNVPPRKPIIAAVEGFALAGGTELVLSCDLVVAGRSAKFGIPEVKRGLVAGAGGLLRLPNRIPYQVAMELALTGESFTAEDAAKYGFINRLVDDGQALDTALELAAKITANGPLAVAATKRIIIESASWAPEEAFAKQGEILMPIFVSEDAKEGAKAFAEKRAPVWQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Isomerase
molecule keywords Probable enoyl-CoA hydratase/isomerase
total genus 92
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3trrA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3trrA01
1W2XA 4MXIA 4KWBA 1FC9A 3P2LA 3GKBA 4IZBA 1WDLA 3HRXA 1XNVA 4WYOB 4ELXA 5DZKA 5DKPA 2ZL2A 4KPKA 3OC7A 1OD4A 2PG8A 4FZWC 5DTPA 1Y7OA 3N6RB 4ASIA 1WZ8A 4U0GH 1K39A 3P85A 3DJAA 1MJ3A 4K2NA 2J5GA 3ZWBA 2ZL3A 3ST9A 1FC7A 1O8UA 2VSSA 3KQFA 3LAOA 3IB9A 3KTHA 4JOTA 4JCSA 2CE3A 4OLQA 5CTCA 5DUFA 1OD2A 4QIIA 2HW5A 1UYVA 3ZWCA 2F9YA 4NEKA 4Q0GA 2Q35A 2A81A 2DUBA 3TVWA 3BEZA 4U0HA 2VSSE 3L3SA 4ELSA 1SG4A 4OMRA 2IEXA 1HZDA 3TT7A 1EY3A 4JYJA 3HE2A 5DL1A 1NZYA 3GLMA 4U1AA 3T3WA 4F47A 4OG1A 4G2RA 5C90A 1XO6A 3H0JA 2PPYA 3KTGA 4I52A 2J5GD 3GF3A 3PGQA 2VSSF 1X0UA 2J5IA 4QIJA 3HP0A 4FJWD 3T8AA 3ISAA 3MFMA 3PE8A 4FZWA 5E0SH 3IAVA 2W3PA 4HNKA 4KD6A 3BF0A 2VREA 2D3TA 4JYLA 4K29A 5JBXA 3T89A 1ON3A 2QQ3A 4MI2A 4B3JA 1RJNA 1EF9A 5DZKH 3Q7HA 2ZL0A 3KTJA 3G64A 4DI1A 1JXZA 3MYBA 1NZYB 2F9YB 5INFA 1N6EA 3SLLA 3PEAA 5KDRA 1WDKA 4L6WA 4JCQA 3TRRA 3T88A 3R9QA 3P5MA 3Q1TA 1UYSA 2ZQQA 4NNQA 4JVTA 1XNYA 2J5SA 3QK8A 1N6DA 4FN7A 3OT6A 3ZW8A 1XX4A 5KDRB 3LKEA 3QXZA 5C9GA 5INIA 4I42A 5DU4A 4ZDDA 3TVUA 2FBMA 5MGBA 3RSTA 4EMLA 3U9TB 3OMEA 2BZRA 5JBWA 1TYFA 4B3IA 1J7XA 5KJPA 2FW2A 4FN8A 1RJMA 4IZDA 3R6HA 4RYFA 4ZDEA 4ZDBA 4RYFH 5E0SA 5E0NX 2J5IB 1HNUA 3R0OA 1HNOA 3RSIA 1XNWA 4Z0MA 2FZSA 3Q0JA 3IBBA 5DTWA 3I47A 4FNDA 5IKLB 4QFEA 4ELWA 2F6IA 1FCFA 3QYRA 2F9IA 4EMMA 3JU1A 3U9SB 5CTBA 3H81A 3R9TA 5FIFA 2VSUE 2F6QA 4ZDFA 2PBPA 2J5II 1DUBA 1VRGA 3QWDA 3BPPA 4JCRA 2F9IB 4ZU2A 1TG6A 2VSUA 3T8BA 4LK5A 4KNPA 3FF6A 5DUCA 4WZ8B 3U9RB 2VX2A 3RRVA 2EJ5A 3NJBA 4MOUA 4GHNA 5G1RA 3HLN1 2DEOA 4L8KA 4GM2A 3ZW9A 3QREA 3ZWAA 3HINA 3M6NA 4Q1IA 1WDMA 3TDCA 2VSUF 4ZDCA 1PIXA 4JJTA 3R9SA 3KTIA 4JSBA 4IZCA 2ZQRA 4I4ZA 3QKAA 3QXIA 4FNBA 2Q34A 2X58A 1YG6A 4HC8A 4JWVA 4EMPA 1UYRA 3TLFA 3GF7A 2VSUC 1Q52A 3M6MA 1EF8A 2C8TA 5G1QA 1N6FA 2GTRA 2NP9A 3H0SA 3V5EA 2CBYA 3H02A 3MT6A 3QMJA 4WCZA 3KTKA 4FB8A 4B3HA 3TZ3A 3VIVA 3K8XA 3GMAA 1UYTA 3DORA 2A7KA 3H0QA 3K50A 3NJDA 2Q2XA 4JCTA 3TV5A 1DCIA 4U19A 3Q0GA 1PJHA 3SWXA 3V5IA 2X24A 4YLHA 3TT6A 4JFCA 5FUSA 3WG5A 3PZKA 1Q51A 2A7SA 4K3WA 1UIYA 1K32A 5DU6A 1FC6A 3H0UA 3MOYA 4RCNA 3STAA 2UZFA 5DU8A 3FDUA 1SZOA 2ZL4A 4U18A 5G1SA 4U0GA 5INGA 1YG8A 2WTBA 1ON9A
chains in the Genus database with same CATH superfamily
1W2XA 4MXIA 4KWBA 1FC9A 3P2LA 3GKBA 4IZBA 1WDLA 3HRXA 1XNVA 4WYOB 4ELXA 5DZKA 5DKPA 2ZL2A 4KPKA 3OC7A 1OD4A 2PG8A 4FZWC 5DTPA 1Y7OA 3O4XE 3N6RB 3RQFA 4ASIA 1WZ8A 4U0GH 1K39A 3P85A 3DJAA 1MJ3A 4K2NA 2J5GA 2ZL3A 3ST9A 3ZWBA 1FC7A 3AM1A 1O8UA 2VSSA 3KQFA 3LAOA 3IB9A 3KTHA 4JOTA 4JCSA 2CE3A 5HUQA 4OLQA 5CTCA 5DUFA 1OD2A 4QIIA 2HW5A 1UYVA 3ZWCA 2F9YA 4NEKA 4Q0GA 2Q35A 2A81A 2DUBA 3TVWA 3AJMA 3BEZA 4U0HA 2VSSE 3L3SA 2P63A 4ELSA 1SG4A 4OMRA 2IEXA 1HZDA 3TT7A 1EY3A 4JYJA 3HE2A 5DL1A 1NZYA 3GLMA 4U1AA 3T3WA 4F47A 4OG1A 4G2RA 5C90A 1XO6A 3H0JA 3RQEA 2PPYA 3KTGA 4I52A 2J5GD 3GF3A 2YJGA 3PGQA 2VSSF 1X0UA 2J5IA 4QIJA 3HP0A 4FJWD 3T8AA 3ISAA 3MFMA 3PE8A 4FZWA 5E0SH 3IAVA 2W3PA 4HNKA 4KD6A 3ADBA 4GEHB 3BF0A 2VREA 2D3TA 4JYLA 4K29A 3A4NA 5JBXA 3T89A 1ON3A 2QQ3A 4MI2A 1RJNA 4B3JA 1EF9A 5DZKH 3Q7HA 2ZL0A 3KTJA 3G64A 4DI1A 4J2UA 1JXZA 3MYBA 1NZYB 2F9YB 5INFA 1N6EA 3A4LA 3SLLA 3PEAA 5KDRA 1WDKA 4L6WA 4JCQA 3TRRA 3BPTA 3T88A 3R9QA 3P5MA 3Q1TA 1UYSA 2ZQQA 4NNQA 4JVTA 1XNYA 2J5SA 3QK8A 1N6DA 4HDTA 4FN7A 3OT6A 3ZW8A 1XX4A 5KDRB 3LKEA 3QXZA 5C9GA 5INIA 4I42A 5DU4A 4ZDDA 3TVUA 2FBMA 5MGBA 3RSTA 4EMLA 3U9TB 3OMEA 3A4MA 2BZRA 5JBWA 1TYFA 4B3IA 1J7XA 5KJPA 2FW2A 4FN8A 1RJMA 4IZDA 3R6HA 4ZDEA 4RYFA 4ZDBA 4RYFH 5E0SA 5E0NX 2J5IB 1HNUA 3ADDA 3R0OA 1HNOA 3RSIA 1XNWA 4Z0MA 2FZSA 3Q0JA 3IBBA 3ADCA 5DTWA 3I47A 4FNDA 5IKLB 4QFEA 4ELWA 2F6IA 1FCFA 3QYRA 2F9IA 4EMMA 3JU1A 3U9SB 5CTBA 3H81A 3R9TA 5FIFA 2VSUE 2F6QA 4ZDFA 2PBPA 2J5II 1DUBA 1VRGA 3QWDA 3BPPA 4JCRA 2F9IB 4ZU2A 1UX5A 3W8HB 1TG6A 2VSUA 3T8BA 4LK5A 4KNPA 3FF6A 3IRBA 5DUCA 4WZ8B 3U9RB 3W8IB 2VX2A 3RRVA 2EJ5A 3NJBA 4MOUA 4GHNA 5G1RA 3HLN1 2DEOA 4L8KA 4GM2A 3ZW9A 3QREA 3ZWAA 3HINA 3M6NA 4Q1IA 1WDMA 3TDCA 2VSUF 4ZDCA 1PIXA 4JJTA 3R9SA 3KTIA 4JSBA 4IZCA 2ZQRA 4I4ZA 3QKAA 3QXIA 4FNBA 2Q34A 2X58A 1YG6A 1Y64B 4HC8A 4JWVA 4EMPA 1UYRA 3TLFA 3GF7A 2VSUC 1Q52A 3M6MA 1EF8A 2C8TA 5G1QA 1N6FA 2GTRA 2NP9A 3H0SA 3V5EA 2CBYA 3H02A 3MT6A 3QMJA 4WCZA 3KTKA 4FB8A 4B3HA 3TZ3A 3VIVA 3K8XA 3GMAA 1UYTA 3DORA 2A7KA 3H0QA 3K50A 3NJDA 2Q2XA 3RQGA 4NARA 4JCTA 3TV5A 1DCIA 4U19A 3Q0GA 1PJHA 3SWXA 3V5IA 2X24A 4YLHA 3L8JA 3TT6A 4JFCA 5FUSA 3WG5A 3PZKA 1Q51A 2A7SA 4K3WA 1UIYA 1K32A 5DU6A 1FC6A 3H0UA 3MOYA 1UX4A 4RCNA 3STAA 2UZFA 3L8IA 5DU8A 3FDUA 1SZOA 2ZL4A 4U18A 5G1SA 4U0GA 5INGA 1YG8A 2WTBA 1ON9A
chains in the Genus database with same CATH topology
1W2XA 4MXIA 4KWBA 1FC9A 3P2LA 3GKBA 4IZBA 1WDLA 3HRXA 1XNVA 4WYOB 4ELXA 5DZKA 5DKPA 2ZL2A 4KPKA 3OC7A 1OD4A 2PG8A 4FZWC 5DTPA 1Y7OA 3N6RB 4ASIA 1WZ8A 4U0GH 1K39A 3P85A 3DJAA 1MJ3A 4K2NA 2J5GA 3ZWBA 2ZL3A 3ST9A 1FC7A 1O8UA 2VSSA 3KQFA 3LAOA 3IB9A 3KTHA 4JOTA 4JCSA 2CE3A 5HUQA 4OLQA 5CTCA 5DUFA 1OD2A 4QIIA 2HW5A 1UYVA 3ZWCA 2F9YA 4NEKA 4Q0GA 2Q35A 2A81A 2DUBA 3TVWA 3BEZA 4U0HA 2VSSE 3L3SA 4ELSA 1SG4A 4OMRA 2IEXA 1HZDA 3TT7A 1EY3A 4JYJA 3HE2A 5DL1A 1NZYA 3GLMA 4U1AA 3T3WA 4F47A 4OG1A 4G2RA 5C90A 1XO6A 3H0JA 2PPYA 3KTGA 4I52A 2J5GD 3GF3A 2YJGA 3PGQA 2VSSF 1X0UA 2J5IA 4QIJA 3HP0A 4FJWD 3T8AA 3ISAA 3MFMA 3PE8A 4FZWA 5E0SH 3IAVA 2W3PA 4HNKA 4KD6A 3BF0A 2VREA 2D3TA 4JYLA 4K29A 5JBXA 3T89A 1ON3A 2QQ3A 4MI2A 4B3JA 1RJNA 1EF9A 5DZKH 3Q7HA 2ZL0A 3KTJA 3G64A 4DI1A 4J2UA 1JXZA 3MYBA 1NZYB 2F9YB 5INFA 1N6EA 3SLLA 3PEAA 5KDRA 1WDKA 4L6WA 4JCQA 3TRRA 3BPTA 3T88A 3R9QA 3P5MA 3Q1TA 1UYSA 2ZQQA 4NNQA 4JVTA 1XNYA 2J5SA 3QK8A 1N6DA 4HDTA 4FN7A 3OT6A 3ZW8A 1XX4A 5KDRB 3LKEA 3QXZA 5C9GA 5INIA 4I42A 5DU4A 4ZDDA 3TVUA 2FBMA 5MGBA 3RSTA 4EMLA 3U9TB 3OMEA 2BZRA 5JBWA 1TYFA 4B3IA 1J7XA 5KJPA 2FW2A 4FN8A 1RJMA 4IZDA 3R6HA 4RYFA 4ZDEA 4ZDBA 4RYFH 5E0SA 5E0NX 2J5IB 1HNUA 3R0OA 1HNOA 3RSIA 1XNWA 4Z0MA 2FZSA 3Q0JA 3IBBA 5DTWA 3I47A 4FNDA 5IKLB 4QFEA 4ELWA 2F6IA 1FCFA 3QYRA 2F9IA 4EMMA 3JU1A 3U9SB 5CTBA 3H81A 3R9TA 5FIFA 2VSUE 2F6QA 4ZDFA 2PBPA 2J5II 1DUBA 1VRGA 3QWDA 3BPPA 4JCRA 2F9IB 4ZU2A 1TG6A 2VSUA 3T8BA 4LK5A 4KNPA 3FF6A 5DUCA 4WZ8B 3U9RB 2VX2A 3RRVA 2EJ5A 3NJBA 4MOUA 4GHNA 5G1RA 3HLN1 2DEOA 4L8KA 4GM2A 3ZW9A 3QREA 3ZWAA 3HINA 3M6NA 4Q1IA 1WDMA 3TDCA 2VSUF 4ZDCA 1PIXA 4JJTA 3R9SA 3KTIA 4JSBA 4IZCA 2ZQRA 4I4ZA 3QKAA 3QXIA 4FNBA 2Q34A 2X58A 1YG6A 4HC8A 4JWVA 4EMPA 1UYRA 3TLFA 3GF7A 2VSUC 1Q52A 3M6MA 1EF8A 2C8TA 5G1QA 1N6FA 2GTRA 2NP9A 3H0SA 3V5EA 2CBYA 3H02A 3MT6A 3QMJA 4WCZA 3KTKA 4FB8A 4B3HA 3TZ3A 3VIVA 3K8XA 3GMAA 1UYTA 3DORA 2A7KA 3H0QA 3K50A 3NJDA 2Q2XA 4NARA 4JCTA 3TV5A 1DCIA 4U19A 3Q0GA 1PJHA 3SWXA 3V5IA 2X24A 4YLHA 3TT6A 4JFCA 5FUSA 3WG5A 3PZKA 1Q51A 2A7SA 4K3WA 1UIYA 1K32A 5DU6A 1FC6A 3H0UA 3MOYA 4RCNA 3STAA 2UZFA 5DU8A 3FDUA 1SZOA 2ZL4A 4U18A 5G1SA 4U0GA 5INGA 1YG8A 2WTBA 1ON9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2X A;  4MXI A;  4KWB A;  1FC9 A;  3P2L A;  3GKB A;  4IZB A;  1WDL A;  3HRX A;  1XNV A;  4WYO B;  4ELX A;  5DZK A;  5DKP A;  2ZL2 A;  4KPK A;  3OC7 A;  1OD4 A;  2PG8 A;  4FZW C;  5DTP A;  1Y7O A;  3N6R B;  4ASI A;  1WZ8 A;  4U0G H;  1K39 A;  3P85 A;  3DJA A;  1MJ3 A;  4K2N A;  2J5G A;  3ZWB A;  2ZL3 A;  3ST9 A;  1FC7 A;  1O8U A;  2VSS A;  3KQF A;  3LAO A;  3IB9 A;  3KTH A;  4JOT A;  4JCS A;  2CE3 A;  4OLQ A;  5CTC A;  5DUF A;  1OD2 A;  4QII A;  2HW5 A;  1UYV A;  3ZWC A;  2F9Y A;  4NEK A;  4Q0G A;  2Q35 A;  2A81 A;  2DUB A;  3TVW A;  3BEZ A;  4U0H A;  2VSS E;  3L3S A;  4ELS A;  1SG4 A;  4OMR A;  2IEX A;  1HZD A;  3TT7 A;  1EY3 A;  4JYJ A;  3HE2 A;  5DL1 A;  1NZY A;  3GLM A;  4U1A A;  3T3W A;  4F47 A;  4OG1 A;  4G2R A;  5C90 A;  1XO6 A;  3H0J A;  2PPY A;  3KTG A;  4I52 A;  2J5G D;  3GF3 A;  3PGQ A;  2VSS F;  1X0U A;  2J5I A;  4QIJ A;  3HP0 A;  4FJW D;  3T8A A;  3ISA A;  3MFM A;  3PE8 A;  4FZW A;  5E0S H;  3IAV A;  2W3P A;  4HNK A;  4KD6 A;  3BF0 A;  2VRE A;  2D3T A;  4JYL A;  4K29 A;  5JBX A;  3T89 A;  1ON3 A;  2QQ3 A;  4MI2 A;  4B3J A;  1RJN A;  1EF9 A;  5DZK H;  3Q7H A;  2ZL0 A;  3KTJ A;  3G64 A;  4DI1 A;  1JXZ A;  3MYB A;  1NZY B;  2F9Y B;  5INF A;  1N6E A;  3SLL A;  3PEA A;  5KDR A;  1WDK A;  4L6W A;  4JCQ A;  3TRR A;  3T88 A;  3R9Q A;  3P5M A;  3Q1T A;  1UYS A;  2ZQQ A;  4NNQ A;  4JVT A;  1XNY A;  2J5S A;  3QK8 A;  1N6D A;  4FN7 A;  3OT6 A;  3ZW8 A;  1XX4 A;  5KDR B;  3LKE A;  3QXZ A;  5C9G A;  5INI A;  4I42 A;  5DU4 A;  4ZDD A;  3TVU A;  2FBM A;  5MGB A;  3RST A;  4EML A;  3U9T B;  3OME A;  2BZR A;  5JBW A;  1TYF A;  4B3I A;  1J7X A;  5KJP A;  2FW2 A;  4FN8 A;  1RJM A;  4IZD A;  3R6H A;  4RYF A;  4ZDE A;  4ZDB A;  4RYF H;  5E0S A;  5E0N X;  2J5I B;  1HNU A;  3R0O A;  1HNO A;  3RSI A;  1XNW A;  4Z0M A;  2FZS A;  3Q0J A;  3IBB A;  5DTW A;  3I47 A;  4FND A;  5IKL B;  4QFE A;  4ELW A;  2F6I A;  1FCF A;  3QYR A;  2F9I A;  4EMM A;  3JU1 A;  3U9S B;  5CTB A;  3H81 A;  3R9T A;  5FIF A;  2VSU E;  2F6Q A;  4ZDF A;  2PBP A;  2J5I I;  1DUB A;  1VRG A;  3QWD A;  3BPP A;  4JCR A;  2F9I B;  4ZU2 A;  1TG6 A;  2VSU A;  3T8B A;  4LK5 A;  4KNP A;  3FF6 A;  5DUC A;  4WZ8 B;  3U9R B;  2VX2 A;  3RRV A;  2EJ5 A;  3NJB A;  4MOU A;  4GHN A;  5G1R A;  3HLN 1;  2DEO A;  4L8K A;  4GM2 A;  3ZW9 A;  3QRE A;  3ZWA A;  3HIN A;  3M6N A;  4Q1I A;  1WDM A;  3TDC A;  2VSU F;  4ZDC A;  1PIX A;  4JJT A;  3R9S A;  3KTI A;  4JSB A;  4IZC A;  2ZQR A;  4I4Z A;  3QKA A;  3QXI A;  4FNB A;  2Q34 A;  2X58 A;  1YG6 A;  4HC8 A;  4JWV A;  4EMP A;  1UYR A;  3TLF A;  3GF7 A;  2VSU C;  1Q52 A;  3M6M A;  1EF8 A;  2C8T A;  5G1Q A;  1N6F A;  2GTR A;  2NP9 A;  3H0S A;  3V5E A;  2CBY A;  3H02 A;  3MT6 A;  3QMJ A;  4WCZ A;  3KTK A;  4FB8 A;  4B3H A;  3TZ3 A;  3VIV A;  3K8X A;  3GMA A;  1UYT A;  3DOR A;  2A7K A;  3H0Q A;  3K50 A;  3NJD A;  2Q2X A;  4JCT A;  3TV5 A;  1DCI A;  4U19 A;  3Q0G A;  1PJH A;  3SWX A;  3V5I A;  2X24 A;  4YLH A;  3TT6 A;  4JFC A;  5FUS A;  3WG5 A;  3PZK A;  1Q51 A;  2A7S A;  4K3W A;  1UIY A;  1K32 A;  5DU6 A;  1FC6 A;  3H0U A;  3MOY A;  4RCN A;  3STA A;  2UZF A;  5DU8 A;  3FDU A;  1SZO A;  2ZL4 A;  4U18 A;  5G1S A;  4U0G A;  5ING A;  1YG8 A;  2WTB A;  1ON9 A; 
#chains in the Genus database with same CATH topology
 1W2X A;  4MXI A;  4KWB A;  1FC9 A;  3P2L A;  3GKB A;  4IZB A;  1WDL A;  3HRX A;  1XNV A;  4WYO B;  4ELX A;  5DZK A;  5DKP A;  2ZL2 A;  4KPK A;  3OC7 A;  1OD4 A;  2PG8 A;  4FZW C;  5DTP A;  1Y7O A;  3O4X E;  3N6R B;  3RQF A;  4ASI A;  1WZ8 A;  4U0G H;  1K39 A;  3P85 A;  3DJA A;  1MJ3 A;  4K2N A;  2J5G A;  2ZL3 A;  3ST9 A;  3ZWB A;  1FC7 A;  3AM1 A;  1O8U A;  2VSS A;  3KQF A;  3LAO A;  3IB9 A;  3KTH A;  4JOT A;  4JCS A;  2CE3 A;  5HUQ A;  4OLQ A;  5CTC A;  5DUF A;  1OD2 A;  4QII A;  2HW5 A;  1UYV A;  3ZWC A;  2F9Y A;  4NEK A;  4Q0G A;  2Q35 A;  2A81 A;  2DUB A;  3TVW A;  3AJM A;  3BEZ A;  4U0H A;  2VSS E;  3L3S A;  2P63 A;  4ELS A;  1SG4 A;  4OMR A;  2IEX A;  1HZD A;  3TT7 A;  1EY3 A;  4JYJ A;  3HE2 A;  5DL1 A;  1NZY A;  3GLM A;  4U1A A;  3T3W A;  4F47 A;  4OG1 A;  4G2R A;  5C90 A;  1XO6 A;  3H0J A;  3RQE A;  2PPY A;  3KTG A;  4I52 A;  2J5G D;  3GF3 A;  2YJG A;  3PGQ A;  2VSS F;  1X0U A;  2J5I A;  4QIJ A;  3HP0 A;  4FJW D;  3T8A A;  3ISA A;  3MFM A;  3PE8 A;  4FZW A;  5E0S H;  3IAV A;  2W3P A;  4HNK A;  4KD6 A;  3ADB A;  4GEH B;  3BF0 A;  2VRE A;  2D3T A;  4JYL A;  4K29 A;  3A4N A;  5JBX A;  3T89 A;  1ON3 A;  2QQ3 A;  4MI2 A;  1RJN A;  4B3J A;  1EF9 A;  5DZK H;  3Q7H A;  2ZL0 A;  3KTJ A;  3G64 A;  4DI1 A;  4J2U A;  1JXZ A;  3MYB A;  1NZY B;  2F9Y B;  5INF A;  1N6E A;  3A4L A;  3SLL A;  3PEA A;  5KDR A;  1WDK A;  4L6W A;  4JCQ A;  3TRR A;  3BPT A;  3T88 A;  3R9Q A;  3P5M A;  3Q1T A;  1UYS A;  2ZQQ A;  4NNQ A;  4JVT A;  1XNY A;  2J5S A;  3QK8 A;  1N6D A;  4HDT A;  4FN7 A;  3OT6 A;  3ZW8 A;  1XX4 A;  5KDR B;  3LKE A;  3QXZ A;  5C9G A;  5INI A;  4I42 A;  5DU4 A;  4ZDD A;  3TVU A;  2FBM A;  5MGB A;  3RST A;  4EML A;  3U9T B;  3OME A;  3A4M A;  2BZR A;  5JBW A;  1TYF A;  4B3I A;  1J7X A;  5KJP A;  2FW2 A;  4FN8 A;  1RJM A;  4IZD A;  3R6H A;  4ZDE A;  4RYF A;  4ZDB A;  4RYF H;  5E0S A;  5E0N X;  2J5I B;  1HNU A;  3ADD A;  3R0O A;  1HNO A;  3RSI A;  1XNW A;  4Z0M A;  2FZS A;  3Q0J A;  3IBB A;  3ADC A;  5DTW A;  3I47 A;  4FND A;  5IKL B;  4QFE A;  4ELW A;  2F6I A;  1FCF A;  3QYR A;  2F9I A;  4EMM A;  3JU1 A;  3U9S B;  5CTB A;  3H81 A;  3R9T A;  5FIF A;  2VSU E;  2F6Q A;  4ZDF A;  2PBP A;  2J5I I;  1DUB A;  1VRG A;  3QWD A;  3BPP A;  4JCR A;  2F9I B;  4ZU2 A;  1UX5 A;  3W8H B;  1TG6 A;  2VSU A;  3T8B A;  4LK5 A;  4KNP A;  3FF6 A;  3IRB A;  5DUC A;  4WZ8 B;  3U9R B;  3W8I B;  2VX2 A;  3RRV A;  2EJ5 A;  3NJB A;  4MOU A;  4GHN A;  5G1R A;  3HLN 1;  2DEO A;  4L8K A;  4GM2 A;  3ZW9 A;  3QRE A;  3ZWA A;  3HIN A;  3M6N A;  4Q1I A;  1WDM A;  3TDC A;  2VSU F;  4ZDC A;  1PIX A;  4JJT A;  3R9S A;  3KTI A;  4JSB A;  4IZC A;  2ZQR A;  4I4Z A;  3QKA A;  3QXI A;  4FNB A;  2Q34 A;  2X58 A;  1YG6 A;  1Y64 B;  4HC8 A;  4JWV A;  4EMP A;  1UYR A;  3TLF A;  3GF7 A;  2VSU C;  1Q52 A;  3M6M A;  1EF8 A;  2C8T A;  5G1Q A;  1N6F A;  2GTR A;  2NP9 A;  3H0S A;  3V5E A;  2CBY A;  3H02 A;  3MT6 A;  3QMJ A;  4WCZ A;  3KTK A;  4FB8 A;  4B3H A;  3TZ3 A;  3VIV A;  3K8X A;  3GMA A;  1UYT A;  3DOR A;  2A7K A;  3H0Q A;  3K50 A;  3NJD A;  2Q2X A;  3RQG A;  4NAR A;  4JCT A;  3TV5 A;  1DCI A;  4U19 A;  3Q0G A;  1PJH A;  3SWX A;  3V5I A;  2X24 A;  4YLH A;  3L8J A;  3TT6 A;  4JFC A;  5FUS A;  3WG5 A;  3PZK A;  1Q51 A;  2A7S A;  4K3W A;  1UIY A;  1K32 A;  5DU6 A;  1FC6 A;  3H0U A;  3MOY A;  1UX4 A;  4RCN A;  3STA A;  2UZF A;  3L8I A;  5DU8 A;  3FDU A;  1SZO A;  2ZL4 A;  4U18 A;  5G1S A;  4U0G A;  5ING A;  1YG8 A;  2WTB A;  1ON9 A; 
#chains in the Genus database with same CATH homology
 1W2X A;  4MXI A;  4KWB A;  1FC9 A;  3P2L A;  3GKB A;  4IZB A;  1WDL A;  3HRX A;  1XNV A;  4WYO B;  4ELX A;  5DZK A;  5DKP A;  2ZL2 A;  4KPK A;  3OC7 A;  1OD4 A;  2PG8 A;  4FZW C;  5DTP A;  1Y7O A;  3N6R B;  4ASI A;  1WZ8 A;  4U0G H;  1K39 A;  3P85 A;  3DJA A;  1MJ3 A;  4K2N A;  2J5G A;  3ZWB A;  2ZL3 A;  3ST9 A;  1FC7 A;  1O8U A;  2VSS A;  3KQF A;  3LAO A;  3IB9 A;  3KTH A;  4JOT A;  4JCS A;  2CE3 A;  5HUQ A;  4OLQ A;  5CTC A;  5DUF A;  1OD2 A;  4QII A;  2HW5 A;  1UYV A;  3ZWC A;  2F9Y A;  4NEK A;  4Q0G A;  2Q35 A;  2A81 A;  2DUB A;  3TVW A;  3BEZ A;  4U0H A;  2VSS E;  3L3S A;  4ELS A;  1SG4 A;  4OMR A;  2IEX A;  1HZD A;  3TT7 A;  1EY3 A;  4JYJ A;  3HE2 A;  5DL1 A;  1NZY A;  3GLM A;  4U1A A;  3T3W A;  4F47 A;  4OG1 A;  4G2R A;  5C90 A;  1XO6 A;  3H0J A;  2PPY A;  3KTG A;  4I52 A;  2J5G D;  3GF3 A;  2YJG A;  3PGQ A;  2VSS F;  1X0U A;  2J5I A;  4QIJ A;  3HP0 A;  4FJW D;  3T8A A;  3ISA A;  3MFM A;  3PE8 A;  4FZW A;  5E0S H;  3IAV A;  2W3P A;  4HNK A;  4KD6 A;  3BF0 A;  2VRE A;  2D3T A;  4JYL A;  4K29 A;  5JBX A;  3T89 A;  1ON3 A;  2QQ3 A;  4MI2 A;  4B3J A;  1RJN A;  1EF9 A;  5DZK H;  3Q7H A;  2ZL0 A;  3KTJ A;  3G64 A;  4DI1 A;  4J2U A;  1JXZ A;  3MYB A;  1NZY B;  2F9Y B;  5INF A;  1N6E A;  3SLL A;  3PEA A;  5KDR A;  1WDK A;  4L6W A;  4JCQ A;  3TRR A;  3BPT A;  3T88 A;  3R9Q A;  3P5M A;  3Q1T A;  1UYS A;  2ZQQ A;  4NNQ A;  4JVT A;  1XNY A;  2J5S A;  3QK8 A;  1N6D A;  4HDT A;  4FN7 A;  3OT6 A;  3ZW8 A;  1XX4 A;  5KDR B;  3LKE A;  3QXZ A;  5C9G A;  5INI A;  4I42 A;  5DU4 A;  4ZDD A;  3TVU A;  2FBM A;  5MGB A;  3RST A;  4EML A;  3U9T B;  3OME A;  2BZR A;  5JBW A;  1TYF A;  4B3I A;  1J7X A;  5KJP A;  2FW2 A;  4FN8 A;  1RJM A;  4IZD A;  3R6H A;  4RYF A;  4ZDE A;  4ZDB A;  4RYF H;  5E0S A;  5E0N X;  2J5I B;  1HNU A;  3R0O A;  1HNO A;  3RSI A;  1XNW A;  4Z0M A;  2FZS A;  3Q0J A;  3IBB A;  5DTW A;  3I47 A;  4FND A;  5IKL B;  4QFE A;  4ELW A;  2F6I A;  1FCF A;  3QYR A;  2F9I A;  4EMM A;  3JU1 A;  3U9S B;  5CTB A;  3H81 A;  3R9T A;  5FIF A;  2VSU E;  2F6Q A;  4ZDF A;  2PBP A;  2J5I I;  1DUB A;  1VRG A;  3QWD A;  3BPP A;  4JCR A;  2F9I B;  4ZU2 A;  1TG6 A;  2VSU A;  3T8B A;  4LK5 A;  4KNP A;  3FF6 A;  5DUC A;  4WZ8 B;  3U9R B;  2VX2 A;  3RRV A;  2EJ5 A;  3NJB A;  4MOU A;  4GHN A;  5G1R A;  3HLN 1;  2DEO A;  4L8K A;  4GM2 A;  3ZW9 A;  3QRE A;  3ZWA A;  3HIN A;  3M6N A;  4Q1I A;  1WDM A;  3TDC A;  2VSU F;  4ZDC A;  1PIX A;  4JJT A;  3R9S A;  3KTI A;  4JSB A;  4IZC A;  2ZQR A;  4I4Z A;  3QKA A;  3QXI A;  4FNB A;  2Q34 A;  2X58 A;  1YG6 A;  4HC8 A;  4JWV A;  4EMP A;  1UYR A;  3TLF A;  3GF7 A;  2VSU C;  1Q52 A;  3M6M A;  1EF8 A;  2C8T A;  5G1Q A;  1N6F A;  2GTR A;  2NP9 A;  3H0S A;  3V5E A;  2CBY A;  3H02 A;  3MT6 A;  3QMJ A;  4WCZ A;  3KTK A;  4FB8 A;  4B3H A;  3TZ3 A;  3VIV A;  3K8X A;  3GMA A;  1UYT A;  3DOR A;  2A7K A;  3H0Q A;  3K50 A;  3NJD A;  2Q2X A;  4NAR A;  4JCT A;  3TV5 A;  1DCI A;  4U19 A;  3Q0G A;  1PJH A;  3SWX A;  3V5I A;  2X24 A;  4YLH A;  3TT6 A;  4JFC A;  5FUS A;  3WG5 A;  3PZK A;  1Q51 A;  2A7S A;  4K3W A;  1UIY A;  1K32 A;  5DU6 A;  1FC6 A;  3H0U A;  3MOY A;  4RCN A;  3STA A;  2UZF A;  5DU8 A;  3FDU A;  1SZO A;  2ZL4 A;  4U18 A;  5G1S A;  4U0G A;  5ING A;  1YG8 A;  2WTB A;  1ON9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...