3TRSB

The crystal structure of aspergilloglutamic peptidase from aspergillus niger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
171
structure length
171
Chain Sequence
b'EEYCASAWVGIDGDTCETAILQTGVDFCYEDGQTSYDAWYEWYPDYAYDFSDITISEGDSIKVTVEATSKSSGSATVENLTTGQSVTHTFSGNVEGDLCETNAEWIVEDFESGDSLVAFADFGSVTFTNAEATSGGSTVGPSDATVMDIEQDGSVLTETSVSGDSVTVTYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspergillopepsin-2 light chain
publication title The crystal structure of an intermediate dimer of aspergilloglutamic peptidase that mimics the enzyme-activation product complex produced upon autoproteolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 21
structure length 171
sequence length 171
chains with identical sequence D
ec nomenclature ec 3.4.23.19: Aspergillopepsin II.
pdb deposition date 2011-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3trsB00
1Y43B 1S2BA 2IFRA 1S2KA 2IFWA 3TRSB
chains in the Genus database with same CATH superfamily
3JD71 5FPUA 4JTOA 4BZ4A 2WZR1 4IXLA 1A3KA 2XWBB 4XMAA 2XGXA 1FNZA 3RI8A 1T2XA 4CZSA 4D8MA 2PA7A 1GOFA 4GKXA 5L19A 1DLCA 3FLRA 3W5NA 1IS6A 4LIUA 1SG3A 2TNFA 3BB6A 4YPJA 5LY2A 5D1IA 5BNPC 4XJUA 5AC92 2QE3A 2VO5A 1UIKA 3OOXA 5G05L 2GAUA 2YG0A 4AQ2A 3VLBB 3VKMA 5K0UA 1V9U1 2WABA 2CGPA 4QX5A 4BPZA 5FTTC 1RUF3 1SLIA 1S2EA 3JBG1 5EXOA 3WNLA 1WCUA 1QKQA 4GMP3 2R041 2VTFA 3NL1A 1DU3D 3WP6A 5JSRA 1SLAA 1H4HA 3LA7A 4P5HA 4ZU7A 3TN92 1DZTA 3DL3A 2JDHA 1XNAA 3T1MA 2DFBA 5FOBB 4PI0A 2Q8DA 3KM5A 1OI6A 4AEDA 3I59B 1MS0A 4CEYB 3BIEA 4DUXA 4MGZE 4QDSA 3V0BB 5C6CA 3PL0A 5DMYA 1B35C 5F5IA 4MGYE 1AR71 4GQ7A 4A41A 3HOBA 2X5IA 4CPBA 1IKPA 4NWWA 1ENSA 3C7FA 3WG4A 4Y20B 2Y6JA 3CJIB 1HB1A 2ES3A 2WSVA 2YZ4A 5FQ0B 4UBGA 3NJZA 4PT6A 1PGL2 2P5BA 2RVAA 2G19A 1BBT3 3HPNA 1FPN3 5J98B 4CP9B 1VBE1 1TMF1 4WM7A 3OPWA 1EV13 5LA1A 2J22A 1RVF1 5C8CA 2BP6A 1GV9A 2AEYA 4DFSA 4NROA 5JMOA 3JD72 3MIBA 1RUG1 4W6YA 2WZR2 4SLIA 3ZO0B 1VB4A 4JKKA 4NIDA 4GAZA 2L9LA 3GJAA 4N43C 2C26A 1RMU1 3CHXA 1I6XA 2ETEA 1LJ7A 1FOD3 1UU4A 3P6BA 4IEQA 5KHGA 2JDZA 3QLQA 3VBHC 5CYYA 5C3RA 1TZOA 3U1XA 1AVBA 1OQEA 4CCCA 5LRRA 1V9U2 1MS1A 1AR93 1XB9A 2ZGTA 3BU7A 1OXCA 3JBG2 5EZWA 1CGPA 1QGLA 2XUEA 1H6XA 2MPFA 5DUVA 1U5IA 1GICA 2VUJA 4D0QA 2PHRA 2YPDA 3B94A 2YC2A 1HN0A 1NCQB 2PMWB 1EPZA 1URXA 3BTZA 4FQ4A 4RL7A 4AE2A 4CE8A 4PQQA 4QPYA 1W3XA 2VZ1A 4FFFA 4KL1A 4AQ6A 4BIOA 4CCOA 4D3WA 3AM2A 3RZZA 4FAGA 4XFGA 2OUJA 1W99A 3FWEA 4CDUB 1AR72 2QZ2A 4H2AA 5JIAA 2EIBA 4IEVA 1NLRA 4F7ZA 4QQ2A 1A78A 1U5YA 1FXZA 1UMIA 3AZWA 4CCMA 3A21A 4GWMA 1V6IA 4OUSA 4OHXA 2JEMA 1JN2P 1XNDA 3GALA 3KT1A 1VBE2 1UU6A 3PDQA 3O1MA 3OG2A 1POV1 1WLTA 4CCLA 1RVF2 1R1A1 3T3YA 2E53A 4LEJA 1VAMA 2D97A 1S0JA 4GKYA 4K21A 4ZS2A 1RUH1 4CTEA 2Z42A 1QY4A 4B4QA 1AX2A 1XNTA 1I5PA 4UW3A 1RUG2 2EIEA 3HVDA 1SPPB 3FE5A 3S5QA 1RMU2 3SH5A 1PK6A 3QACA 1A8MA 4U2AA 3DEMA 4OHWA 2R16A 4CCDA 4A6SA 1NLQA 4QDQA 3CKHA 2GU9A 3FN9A 4KU8A 3UKNA 3URFA 4DO0A 2W1QA 1X50A 2FBEA 4YW4A 3N7JA 3KVAA 1HB3A 4NIHA 4P14A 4QGNA 1GZ9A 2DU0A 2NZ9A 2FMDA 1DYPA 3GZEA 3I2FA 4TLGA 3UJOA 1VMJA 4AXOA 4YNIA 1Y4WA 2Y6FA 4CEWC 2B46X 3WUDA 4TYSA 3WDYA 3K75B 4OZXA 1HQLA 3O1PA 3B9IA 1VBD3 4JQTA 4JHZA 3A0NA 3ZDSA 5EHDA 4Q0SA 3AYCA 1LGCA 4QKNA 1T6GC 2XVLA 4YW1A 3E6CC 4HPKB 2ZGUA 3RVHA 5FZ4A 1CJPA 5B2GB 2XUMA 3MW3A 3DN7A 2ARCA 4LULA 3IM0A 2E7TA 2J1TA 2JJ6A 3P3PA 5J7MA 3AZYA 2AC1A 5FZHA 4EQVA 3BI3A 1GP6A 5IWFA 2WA3A 2HEYF 4QKFA 1LEMA 5A7OA 1RUH2 5CKQA 2JX9A 1GU3A 1WWYA 4GJYA 5H9SA 1OOPB 1NYWA 1W8TA 3ETPA 4LLFA 3OPZA 4FFHA 4O61A 1XU1A 3AKQA 4D69A 5F3GA 4CDWC 3IMMA 5KR7A 2W1WA 2GC2A 3K3OA 1VBB3 2J1SA 1OUSA 1WLWA 2D6PA 4CP2A 2ID4A 2H6CA 1XXNA 2BJSA 2RDQA 1PGW1 3EB7A 1YQ6A 4K40A 3ZYIB 3R0RA 1BCXA 1O5UA 3HQXA 5IK8A 1KD7A 4XFBA 4XF3A 1LODA 2ORZA 4XQ4A 5FMBA 1FX5A 2WNUA 4ISQA 1KFUL 1S0FA 4Z07A 2WAAA 5I93A 1N3PA 3LOIA 1W6NA 5F32A 5C4WC 1XYNA 1G9CA 3MBWA 1PIV1 4E4SA 1F35A 1WCSA 3BKZA 3NQHA 2GDFA 4UYBA 4DINB 1D4M2 5DDJ1 4UFMA 4WM8A 4MGIE 3WHTA 3FBMA 1N3OA 3POJA 1NT0A 2K46A 1QH7A 2GN3A 2Q1FA 2UYBA 3IZOA 4XJ8A 4ZU4A 1YFUA 2YGMA 3W58A 4AVVA 5DUWA 1C5HA 1CAUA 2Y6HA 1LHNA 2KXLA 3ALQA 3DECA 4OHYA 5L7OC 1UY2A 1W06A 3C3VA 3WXPA 2YUEA 4YZ4A 1IPKA 3NV4A 3KD4A 4QHZA 1DGWA 4RS5B 4IEYA 1YIPA 2ZXQA 3C2UA 3H7JA 1JHNA 2VVEA 2VMHA 3FLPA 1WLCA 3NSTA 3WQBA 1W8NA 3PVBB 1W2OA 5D8AA 3VBFB 4EN6B 1XE7A 2VCCA 3WX5A 5KHKA 2P2KA 3H8RA 4QMAA 4MZUA 1AYM3 4Y5TA 4D6SA 1EUUA 1JZ4A 1UOFA 5FWEA 4C1WA 4FPJA 1RUF1 5CIRA 1YUDA 1ZRIA 2ZKLA 3KWVA 5FY9A 2WO1A 4LO5B 4MO3M 1ZBE2 2VOKA 4GMP1 3V0AA 3WDWA 5HV0A 1RJ8A 4BDVB 5I0UA 1JYCA 1PGW2 4D7TA 3HNBM 4C0BA 2G9ZA 3PIJA 2W0XA 4YVSC 5CFCB 1H2LA 2O0OA 2RDNA 3RRDA 1GMMA 3VBRA 1JHJA 5KHIA 3D3AA 1YHFA 2D6NA 1DDLA 1GANA 1Y9MA 4DY5A 5FYYA 2JENA 2LRPA 3AX4A 1UY1A 4QHBA 5GLTA 3WP4A 4AHYA 3WF4A 1PIV2 3AFGA 4C90A 4QXBA 2J42A 4KGQA 1JOBA 4MV2A 2DVBA 3ZN6B 4AI0A 4JDNA 4LPLA 3ZSEA 3WY6A 5C3OA 3N35A 5DDJ2 1LECA 3L9JT 4CCNA 1PNFA 3PLQA 1BBT1 4BQ2A 2E7AA 2OYZA 5FDBA 5JUVA 1EV11 4XEZA 3DKQA 2FQPA 2WN2A 4OCTA 3LEKA 3H8UA 2Q8CA 2R49A 1NKGA 5LCWL 3GZTB 4DMIA 5FY4A 2NMOA 3N9MA 5A3OA 1BVVA 3PMSA 3GBGA 3OBRA 3AJYA 4J1WA 2DVAA 2HYKA 5CADA 5CFDC 2XJRA 4EN9B 3SKJE 1S55A 1LOFC 4LA3A 1W0OA 1BQPA 1FOD1 4Q0UA 4K8RB 3NV2A 3O7OA 4E4ZA 2CDOA 5AVAA 4IQPA 3U07A 1G9BA 3ZFFC 5CG8A 5SV5A 2ZAHA 4JGZA 2JDPA 2PTMA 4BB3A 1RUF2 1W2TA 4DY3A 4QKBA 1PVC3 4A3ZA 5LASA 2W91A 1VJ2A 4YSFA 3OD0A 1GYKA 1H9WA 1H2NA 1TNRA 3LDKA 2ENRA 2QCSB 1O7FA 3G7DA 1JXNA 1IS3A 1ZRFA 1VIWB 4HFSA 1YQ8A 5FYVA 5T5OA 4HONA 5FBJA 3KV6A 4EWAA 3A22A 4UI9L 1UZ0A 3OGVA 1OPMA 1SQ4A 3NNFA 4YWAA 1W9TA 4HXCA 2JDAA 4QPIA 4AAXA 1W6PA 4IE5A 1ZZCA 3IPVB 4GH4B 3WOGA 4AI8A 3NW4A 3FC0A 5K4LA 4FAHA 2GNBA 3WDVA 4YZ2A 2AENA 2VOXA 2DCYA 1JW6A 1F9KA 1BBT2 3B00A 4K6BA 1FPN2 3VD4A 2W52A 1EV12 2NMNA 2JG8B 4IV3B 4Y22B 3MZHA 4Q4X3 3ZFGA 2WUHA 4B29A 2I07B 3DXUA 4NJ4A 5FP3A 3D82A 3KGLA 3HR9A 5EYXA 4QB2A 3RDIA 5A7SA 2WNVA 4XZUG 2AR6A 1P8JA 3TNQA 1W0NA 4XYXA 4NUBA 1HJGA 5D2AA 3ZIXA 1OQ1A 3MI8A 1SMVA 4MH0E 2OW4A 3M4FA 4OI4A 3VKLA 3ME2A 2KR2A 4BK5A 3I3DA 3ZDVA 2E31A 4UFHA 3WVJA 5BNNA 5C9AB 1UOBA 1FOD2 1RXGA 5L73A 2ZX1A 4JV4A 4Q27A 4D6QA 3WG2A 5DAPA 3H0OA 3NWKA 4KWKA 4QX2A 4SBVA 1H4GA 1BJQA 1AR92 4WV8A 2XJUA 3POWA 1UN1A 3NV1A 3HNYM 2WO3A 2C9KA 3LIGA 2VE1A 4ZKTB 2NYYA 4FT8A 4GJZA 2A6WA 2VMGA 2V73A 2BVBA 2RS32 4Z2WA 2ZHNA 4FFGA 1K5MB 5KHHA 1DCSA 1ULDA 4RN5A 3T2TA 4D7YA 4ARYA 2BNNA 3K4ZA 1VBD1 1TEIA 4H55A 4IUGA 2H0BA 4I3GA 4QPGB 3WP3A 5T5LA 5CKNA 1UYYA 3N7MA 3O1SA 3R4DB 1UW8A 1JODA 3M3CA 2TUNA 3J9SA 1AYN3 3MFCA 2YU2A 5FZ3A 1U12A 4MGSA 1A34A 5FYHA 3C7HA 1FI2A 1JZ3A 5HCHA 1VAVA 5IVYA 1NXD1 4AVSA 3TAYA 1QWRA 4BQ5A 1F8VA 3VBRC 4LBKA 1NCRC 5FMOL 3WT3A 1O4TA 1X8EA 2P6HA 1Y9GA 4N53A 4CCEA 1WMFA 2WC2A 2WSUA 4AQSA 5HCAA 2CYFA 3LEGA 5FPAA 5F7UA 2GALA 4FPFA 3B3QE 4YGBA 5A80A 2J1RA 3ON7A 2E9QA 3WQ1A 4PDWA 1X33A 2JG9B 4KBBA 4M01A 4PQ9A 3KHBA 4IE6A 1J84A 1RITA 2P6CA 3RI9A 1JOPA 3JQXA 2R062 2HLEA 3M7AA 4ES9A 3T4VA 1ZX5A 3VBOB 3LFIA 1GBGA 2PAMA 2CHHA 2JB4A 3TWIA 5LK5A 3L2HA 4M0NA 5FZIA 2QQJA 3OPTA 1CQ9A 3ZSLA 3AP9A 4CUAA 5A3LA 4IGOA 3W59A 4BH9A 2PXJA 1PO13 4UFIA 5CNAA 5FZBA 4BJ0A 3NJVA 1E5IA 2X05A 1DQ2A 4J25A 2Y26A 1VBD2 4CU7A 5FXWA 1SBFA 2XKPA 4R8HA 1DQ5A 4GZ9A 5FZOA 2A75A 2IXLA 1VRH3 3CEWA 1MQTA 2BU9A 3KV4A 4FOQA 4JGZC 3ZXDA 4X6RB 2OT7A 5FZFA 2VTXJ 1Q8OA 1S0IA 1E5RA 4YM0A 3USUA 1YFXA 4DEVA 3UT0A 2SLIA 4DOUA 4PIYA 2GH8A 2O8OA 3ZYJB 2FDJA 3K2OA 4ASMB 1MS3A 3ZYFA 3I2KA 4YG3A 3I3BA 2UU8A 4KWLA 3UNPA 1OA3A 3RNSA 3NKGA 1QJZA 4Y3OA 4WVWA 2J1EA 1QOTA 1JU4A 3OGJA 1YNAA 1MZEA 4FP2A 4Y4YA 1RXFA 2WBKA 5DG2A 4J6GA 3LA3A 5FZ1A 1EAH3 4CVUA 3B01A 2EAAA 2GNDA 1QJU3 1XNCA 2JE8A 1AYM1 3GDBA 3J7MA 5FRAA 5FY8A 1WKYA 2ZHKA 3P1IA 4UOJA 5BNPB 1W28A 3PUSA 3RYRA 1VBB2 1SBEA 3S7IA 1WW7A 3ZMOA 4BK4A 3H8OA 1ND3C 2A5ZA 4GXLA 4KQ7A 3VZOA 1OA2A 1RB8G 3MEPA 3RPQA 3HNMA 3ST7A 1FV3A 1IHMA 1NG0A 3J26N 5DZGA 2YU1A 4H7MA 4Y5SA 1Q8VA 5CVRA 5FAXA 3WF0A 2RDRA 2RG4A 4LBMA 2BFUS 4IE0A 4LT5A 1GLHA 1AL0G 1VALA 2WT0A 3VL8A 2ZMKA 4RQPC 2WT1A 2QDRA 4PIXA 2R7EB 3MLKA 1MZ6A 1IG0A 2ZGRA 5T55A 3AP7A 1GQGA 3I7DA 1ZA7A 4L11A 4XFCA 1B35B 1CPMA 3UGFA 2XHKA 1UO9A 4OMCA 4ISRA 5E1RA 3IAQA 4CU9A 3GCWA 3AZVA 5CB7A 2D6LX 1UZVA 3PTYA 1YFWA 3LGRA 2GNTA 5LY1A 1ULGA 5H9PA 1IZ3A 3TYJA 3EQEA 2J1AA 1STMA 3S57A 3K51A 1AX0A 4C8DA 2BBVA 4CA9A 3ZM8A 3VD7A 1XSRA 5J37A 1ENXA 4X8PA 5A33B 1VMFA 2WA4A 1KDMA 3FHQA 1H8TB 4BXSV 3H3LA 1WGPA 2VVDA 3NO8A 4I02A 5LK7B 3IDCB 4RYDA 5A1FA 1PM4A 1UNBA 3SEPA 4NRPA 5AVPA 5A6XA 3U10A 3Q8AA 4N43B 4YW7A 4RR3C 5F5QA 5JXGA 3FJSA 2IC1A 1MZFA 1KXGA 2XLFA 1RUD3 1SLLA 4QM8A 1AYM2 1WA4A 1N1VA 3VBHB 5BNOC 5J1XA 1O59A 1V6OA 2VQTA 4CDXC 2ARAA 5ABJC 2Q30A 4JC1A 1PVC1 3VBUC 1JH5A 2WNEA 2HBTA 1U0AA 3GZUC 2HKXA 2QZ3A 1C1LA 5DZFA 1JYVA 2WINB 4XUPA 2GP3A 4AG4A 5GLZA 1PNGA 4CXXA 2RHPA 4M3CF 4UAPA 5FZ9A 3RWKX 1DQ0A 2WFF3 4UFLA 5FK7A 2C9AA 2H6BA 1DYKA 1H1IA 3LQCA 3KF3A 2VC9A 2RS53 5F6LB 4XMIA 4IETA 1R093 3MYXA 5A1AA 3MW4A 2X29A 5T5JA 1DLLA 1C4RA 2WO7A 4HK9A 1C57A 3DV8A 2VH9A 3O1OA 1SCRA 1LOCA 1LB2A 3BCWA 4Q8LA 4EWDA 1ND2C 2W94A 4JKLA 5L9VA 4Q4X1 5GLWA 5FZEA 3FFZA 3ZLIA 3LA2A 4AI1A 1O5LA 3OUHA 4EZ4A 5JMCA 1S0DA 1L7RA 1W6MA 2GH2A 2CNAA 3UETA 4YM3A 4YM2A 2HWD3 2G4IA 2UWCA 2R1BA 5FFOC 2VZQA 2D5FA 1RUJ3 3IN9A 5LA0A 4AOCA 4XABA 2PHTA 1KJLA 2R30A 1W9FA 5DUXA 3W5MA 3PVEA 3FHIB 3KT4A 1WD4A 4HN0A 4AVTA 4TWTA 4P9YA 4EZHA 4IV1C 3IDAA 1H2MA 3E97A 2VAUA 3W9AA 3ZXEA 5DG1A 1PVC2 5EWSA 5J48A 1WCKA 2JXAA 1TVGA 1YI9A 4R4XA 4NWVA 4JQRA 3VKOA 5B4NA 3SITA 4CCKA 2WIIB 4GULA 2PN5A 4Y24A 4FOWA 4FSJA 3OBZA 2CU5A 1OH3A 2ARBA 4M3CE 5FMDA 4CEWB 3LDBA 3IIIA 4FI9A 1UYXA 3B02A 4P9LA 4U36A 5LBCA 3CL1A 1AYN1 1FNYA 1OQDA 4Q1RA 3VZKA 4CDQC 4KH9A 3AB0A 3BYWA 1V6MA 3UGGA 4BM8A 1NQJA 5BPXA 1ODMA 3J7LA 1G86A 4HKWA 4DZGA 4RGKA 3TRSB 4B3NA 1ONAA 2WN3A 1C8M3 1WW4A 2VY0A 3RYPA 4Q4X2 5FBZA 3VL9A 2IXCA 2Z2SB 1QEXA 1V6KA 4LOSA 3C7EA 5F3IA 4QX0A 5FLHA 3IMNA 3AYEA 1XBFA 1GQHA 4ARXA 2ATFA 3ZYGA 1AF9A 5FY5A 5JZGC 4BQXA 3I59A 4CEYA 1NY72 3V0BA 3SCFA 1JZ5A 4R9DA 2CSGA 1GOHA 5A7WB 1H8TC 4CDWB 4MVTA 2ZEZA 4COWA 3ZXKA 4Y20A 3UL2A 3SISA 3CJIA 4LKSA 2ERFA 1NX9A 2BFUL 2HWF3 2VMDA 3VB9A 5C8CB 5FQ0A 2W87A 2AH2A 5A3MA 2BPA2 2Z69A 4IW3A 3SCHA 4DXRA 3KCCA 2OXBA 4CP9A 1PO11 4TXWA 4V2VA 3LDRA 3TOJA 3U4SA 3JQWA 2MEV3 1YCIA 3JXSA 4ITCA 1W8HA 1MS5A 2YYOA 4FOYA 2J7MA 4PF1A 4AEMA 5GZEA 5C4WB 1D2SA 1VRH1 4CUGA 4AW7A 4HG6B 3AKPA 1PMIA 1AYN2 4FPLA 2B5HA 3ORJA 1W8OA 3PU3A 4BQ1A 2RS33 1ZYBA 2FZ2A 2A73B 3WNMA 2VM9A 2OQ7A 5FXVA 3M3OA 3WNOA 3MF9A 1GNYA 2PELA 3M3EA 2C4XA 1NA1C 5L7OB 3W21A 2VMCA 3JUUA 2XH6A 4Q26A 4FPHA 4AVAA 2D43A 4PLNA 3OGSA 4D7SA 3WF3A 3NNGA 2A6XA 1NCQA 2GC3A 3POGA 1ZZ8A 4NPMA 2DV9A 1SLTA 1EAH1 1HLCA 5L36A 2DYCA 1QJU1 5JPNB 4S2GA 1OMIA 3OYWB 4P08A 3OY8B 1PM7A 1U5XA 4OI0A 4P9GA 3WV6A 4YZ5A 2WZPP 4CDUA 2ZX2A 4FXGB 4DXTA 4Q29A 1F2NA 4BQ4A 2DF7A 2BGCA 5EQUA 1L7QA 4NIIA 3N7LA 4FPGA 4RD7A 3DPRC 4FOVA 3IKWA 1F31A 3MIDA 4OZOA 3RMYA 2XDVA 3SH3A 1TNFA 1PO12 4O9EA 4Y1ZA 3PUIA 4QDRA 3LOBA 4YVSB 1TE1B 1VBA3 2VQ0A 2WWSA 4P9XA 2Q8EA 1LU2A 4CU8A 2R063 1XE0A 2UYAA 2VECA 5I8YA 1PK6B 1M06G 1OVPA 2F4PA 1GR3A 3T1LA 1UY0A 2ZGQA 1VRH2 1WCQA 2V5DA 5A7QA 2EA7A 1GWLA 3RMXA 1RUOA 2ZGLA 3UKVA 4HT1T 1W8UA 4KBZA 4HVQA 1OVSA 2GMMA 3VD5A 1UPIA 4KWJA 4FPYA 3LEMA 1J3RA 2G1MA 3OJBA 5FZDA 4CUBA 1BHGA 5T50A 3S5AA 5FY7A 4FO9A 4EN0A 4BWOA 3N9NA 4IL7A 1QH6A 1W6OB 5K0UC 1HKDA 3SC7X 1D4M1 1ODNA 1UAIA 2C1FA 3ACFA 4CUCA 5C8WA 3AXDA 3AP6A 4GWIA 4BIFA 1I9RA 4V2WA 1O3TA 2ZX0A 4TLFA 4NIGA 2VOWA 4AYUA 1APNA 3VKNA 2LTNA 2P3YA 5CFDB 4MG2A 1JBCA 1EAH2 2X09A 1RUD1 1QJU2 2E33A 1LESA 5J3UA 1Y9QA 4LBOA 4DRRA 4AEDC 2LW8A 4P00B 1W03A 3WNXA 3WQ7A 4MXWA 2IXHA 5KC6A 3ZFFB 1GUIA 3HQRA 4QQHA 1QOOA 3VZJA 1GZCA 3K77A 4D6RA 2X5IC 4HPKA 5CKMA 4BQ3A 2BVVA 1NE6A 1H8VA 4MADA 2VUDA 3UV9A 3FHAA 3NAPA 4LO7A 4Y1YA 3SXWA 4G9SB 3ZSJA 1CWPA 1DHKB 1LU1A 3JU9A 2BUKA 1OKOA 4QPWA 5FZ7A 4M0HA 3T30A 5FWJA 2FDFA 5A7NA 1BMV1 2WFF1 4CU6A 4WM7C 1H1AA 2VNGA 3PUQA 1ULCA 1VP6A 4FPCA 3T2PA 3VD3A 3WR0A 1ZBE1 5C8CC 2RS51 4Q4W3 4Q1PA 1R091 2DVDA 2VOTA 3OGRA 1ACCA 2GNMA 4LO8A 3Q8EA 3ZSMA 1OOPA 3ZXAC 4TZDA 2IVIB 4NOTA 1IQAA 1FAYA 4BMBA 3E5UA 1LR5A 1PZ9A 1XYOA 2IVJA 1UZWA 1LHVA 2NLRA 3MLLA 5LBFA 5HI0A 2BBAA 3D5OA 4JKMA 5AFBA 3KHCA 4XFFA 2Z4FA 1KQRA 1JZ2A 1H1MA 1UX7A 4IEXA 5FZ6A 2YHJA 3LD8A 5F2SA 5F5AA 3U75A 5C3PA 3ROUA 1UYZA 5JLVA 5DAXA 1G9AA 2WJSA 1X36A 5L9RA 2PHLA 3WW3A 3AXEA 2BOJA 2HEWF 1OF3A 4QX8A 5E8AA 3ZOIA 1QMJA 5LRSA 2VW2A 1SLBA 2HWD1 5FPBA 2BNOA 4OLLA 2OKXA 5BNQA 2O14A 1RUJ1 2VD7A 2JDMA 1YYNA 3MIEA 1X8MA 2WL1A 1CR7A 1XJAA 1RUD2 4I01A 2ZPXA 3VZNA 1POQA 4HLTA 2D3SA 4DXSA 3WQ0A 1PZ7A 3S7EA 3CMGA 2DVFA 2CTVA 5EJZB 4BQYA 4XXPA 2OIIA 1OH4A 3H1YA 1GFF2 1UQXA 2Q1MA 2VBPA 3CIHA 4Y26A 2HH9A 3CDZB 3AMNA 1ALYA 1MVEA 2QJVA 2WDBA 2ZAAA 2DBIA 1DZQA 4AFAA 5A70A 2VNVA 3AMHA 3VDAA 1ULOA 3NNMA 4INDA 2ZGMA 1W6QB 1BXHA 4HVRA 5FO9B 3MF6A 1BMV2 2WFF2 2VQAA 1UCXA 4RS5A 2VCBA 1XU2A 3E1F1 5BV6A 2RS52 1R092 2BRTA 5F9TA 3DYMA 2FCTA 1PHMA 5IFTA 4LITA 3V0AB 2A6VA 2IZWA 4JGYA 3VBFA 3ILFA 4ASKA 2E51A 2Q0AA 4M3CB 5IUQA 1PK6C 5SV8A 1C8M1 4IEZA 5JSPA 1OHFA 1X9PA 4MHUA 4B7KA 2R0HA 1K42A 2B9UA 4LE4A 3VBRB 1GWMA 2QQKA 1AJOA 1NCRB 5FXZA 3PUHA 3H42B 2WT2A 3T2QA 1QNWA 2AYHA 5JXHA 2OZ6A 2W1UA 2VXJA 1BK1A 3HD8B 3HT1A 5CFCA 4ZHNA 1LKNA 3J8F3 3ZN5A 1PMHX 2HWD2 1FPN1 2UWAA 3O1VA 1V6JA 4A44A 3ZX7A 2VR4A 1RUJ2 3L2YA 2YY1A 2OPWA 2LS6A 1GKBA 1GOGA 4JDOA 2W08A 4QD2A 5C7GA 2Z5WA 3OD4A 5A32B 3ZN6A 4AI9A 4BLJA 1AR83 4RHV3 4MHRA 1HRV2 1SHWB 5JOZA 1YWKA 1HB2A 4LLOA 2QVSB 1RUE3 3POIA 1YI7A 1D0GA 2B8MA 2O8QA 2MEV1 2EIDA 1WA6X 3FZ3A 5ERLA 4B4PA 1UY4A 5J36A 3ZYBA 1JMUB 1YEWA 4LXLA 5F1RA 2NM1A 5IYYA 4K9SA 3N9PA 2D3RA 4PLMA 2CDPA 1AR91 2FHRA 3WCRA 2WQ4A 4KMQA 3ZXFA 3H7YA 1JS9A 4HSJA 1LTEA 4JGZB 1BZWA 4DUVA 2RS31 1XC6A 3VDDA 1CAWA 5A3NA 4DB5A 5JCTA 1N47A 3B9CA 2VULA 1UL9A 3NAPC 5T54A 4CP1A 4COVA 3AYDA 1AJKA 3X29B 1C8M2 3RZJA 4EROA 4IGQA 3ZSKA 2ADEA 3N3HA 2YB7A 4YZ3A 2D6MA 2OA2A 3ENRA 3ECQA 4XQDA 3K4DA 5BXXA 5LA2A 2JD9A 3TNPB 4YYOA 2VOVA 4FPEA 3THDA 3AP4A 4PLOA 4AHZA 5LZ6A 4LKFA 4XJAA 5EJ3A 3AMPA 2UY8A 4UXAA 2XQXA 3LE0A 4XUTA 5FY0A 3NJYA 2EXHA 2IWGB 4NN0A 3GGLA 2ZGSA 1ASJ3 1VRBA 2WNUC 3V64A 2XPJA 3KB5A 3GCXA 2VCMA 3PJYA 3RFRA 1RHI3 4WVMB 1TG7A 4LBQB 5IVEA 1O3RA 4GH4A 1H9PA 2YXSA 3CBNA 2HWF2 4XILA 2VMEA 2CWSA 1PMJX 3QBQA 1ND3B 1O4ZA 1S4CA 4CYDA 2GMPA 4WM8C 2JDYA 4XIOA 1J59A 2JKXA 2G9FA 5FKBA 4QQOA 5FYUA 3PNAA 3DXTA 4QXCA 3S30A 3VBSB 4IV3A 4OULA 4Y22A 1VBA1 2MEV2 1HB4A 4A6OA 1YXWA 1ZRRA 4AWDA 2R061 2WWUA 3HMYA 2WZ8A 4Q5OA 3VHNA 4RQPB 1ZA4A 5T52A 2XLAA 1CONA 2IFWA 4LK7A 5LBBA 4J1XA 3I2DA 1MPXA 3RZGA 4GALA 2HWE3 4LIVA 4B8EA 3K4AA 3N9OA 1J1TA 2VL4A 4YVWA 1QJX3 1NZCA 4AEJA 5I0DA 1QNYA 4IE7A 2BNMA 1SACA 4FPKA 5C9AA 1DGLA 2OQ6A 4PHZA 1HV0A 3BUCA 2KA3A 1HQWA 3GNEA 5D8AC 2WQ8A 2VZUA 3ZPOA 1HIXA 4O65A 5BY5A 2E6VA 3MDPA 5DZEA 3AMMA 2YFUA 5E16A 2A3XA 4AL9A 3KCYA 1SDDB 4F8AA 3PVOA 2AGSA 5A6YA 3WINE 2VMIA 1LULA 3KCXA 2NN8A 2P4EA 5HV4A 3U0ZA 1BYHA 1BVP1 2VNRA 5CISA 3OF1A 1K5MA 1JTZX 2VZRA 1OBNA 3KV9A 1NQDA 1K3IA 5FP9A 3TB0A 4AAPA 4RR3B 2QNKA 4QPGA 1J83A 1XRUA 4UBHA 5FK8A 3LEIA 4P9JA 1JI6A 1CPNA 2ET1A 4XJWA 1E5SA 3KMHA 1S0CA 5A7PA 4AFDA 4YW2A 3M1HA 3CO2A 3WW4A 5BNOB 1OPOA 2W3JA 3I3EA 1DZRA 1FATA 1H0BA 4CDXB 5ABJB 1GZTA 4GA9A 3ZR5A 3UK9A 5I0RA 4Z92B 2G9GA 1W8WA 3VBUB 2I2SA 1QDCA 2XJSA 1UMZA 3WF1A 1XPWA 4AZZA 3LZZA 1JU3A 1CZTA 4XZPA 1KFXL 5JR2A 1VBA2 4E27A 4S2FA 1VBB1 2QUOA 4RGGA 1D4VB 2D44A 4Q4W1 2ZMNA 3KV5A 3R4SA 1IS5A 4KNCA 4A7KA 2QBXA 3IDEA 1JZ6A 3RZMA 3PJQA 4FTBA 2JG9A 4ZXKA 2PFWA 3WLUA 5FZAA 1REFA 5ACA3 1U5ZA 4RSUA 3FUQA 5H9RA 4LHKA 1LHOA 3WHUA 4DUWA 2HEVF 3MV01 4S2DA 3WSOA 2JDNA 4AEKA 4ZZ8A 4H3WA 1ND2B 4HL0A 4OUMA 3VBOA 1TMF3 2ZHLA 3ZFEA 4PBOA 2W9XA 3H3UA 3AL6A 5IVCA 3RG0A 2BDRA 4GIQA 3POEA 4XC9A 1WBFA 4ZXEA 2QQVA 4PCRA 2P3IA 3VDDC 4LBLA 3PUAA 1PVXA 1QU0A 4HBNA 2YFZA 4HK8A 1O3QA 1EYBA 1OFNA 1Z7S3 1OD3A 3AZXA 4OQ8A 3FBYA 4H7LA 5FP7A 2B7YA 4DPNA 3BALA 4ORFA 3GF6A 4Z82A 1RTVA 4WBBA 2ZGKA 4XFIA 5FJKA 3ZPYA 4I09A 5JDBA 2YC0A 4JCKA 5GZCA 1DF0A 4IV1B 3LF7A 3NJXA 4QPIC 4AFCA 3D0SA 1YRZA 5FYCA 3AYAA 4NR1A 4MYEA 4XUOA 1DYOA 4YGCA 2VZPA 3HT2A 4XPVA 3U11A 2QQMA 1PO23 3AC0A 2VUCA 4N90A 4N9HA 4N8MA 3JZVA 3V56A 1DQ1A 4Q4W2 3UKTA 1C3HA 3ZFGC 4XACA 4DRVA 4BCUA 2WNVC 4OYUA 4WVZA 4LUKA 4Y1VA 1YIFA 4HSLA 4CDQB 4URAA 1K5JA 4C0HA 3U4XA 5BNPA 3MPBA 1RUC2 2QQNA 5BNNC 1LOBA 4Y5Z0 5FPXA 3W20A 1EPWA 5LATA 4GB33 4DIQA 3OBAA 4O9GA 3A7QA 5DPNA 2AACA 3K46A 3POFA 1Q3EA 4CXYA 1CD3G 2R073 4XVHA 3AFKA 3RZLA 1QF3A 3LWCA 1QXPA 3J8F1 2QQIA 3DCQA 4NAOA 2Y64A 3CZJA 1CAXB 2PHUA 5JZGB 4NHXA 4OI1A 5IT6A 1G8WA 3I2GA 4F83A 2QQOA 4AVBA 1OLRA 1B35A 1AR81 3MGUA 3DKWA 5FZLA 4QGLA 4OUEA 1F5FA 1W39A 4A2UA 3M8LA 4JRLA 2MNGA 1CAVB 2WZEA 3J4UH 5FUIA 3ATGA 4ZPIA 3SQOA 1G6NA 1RUE1 4JTNA 4BYYA 1LOGA 5LBEA 2UWBA 4N9IA 2JD4A 4V1PA 4LO6B 4JDMA 4XOGA 2HWB3 5KXBA 4MUVA 1UZZA 5A33A 1Q8PA 5J96B 3T0DA 2B9VA 1F4AA 5FO8B 2WQZC 1UKGA 2WWJA 2ET7A 3QH7A 2XL9A 4L99A 1FYUA 1AL23 5DUUA 1EY2A 2ZGNA 4PJYA 4XBLA 4XFAA 4N53C 1Y7BA 1LGNA 3OSDA 4L2NA 2W46A 2IXJA 5JAXA 2FDIA 5A3TA 4N43A 2V09A 4META 3BU0A 2BGPA 2FCVA 1DQ6A 5H9QA 4G3YC 3CQOA 1K12A 1H30A 4PDWC 5KWRA 4AHXA 2Y8KA 3RSJA 4R9BA 4ONUA 4K7JA 3ZVXA 3VBHA 1NLSA 2VNOA 5KXEA 2XBO3 3AKRA 4LBJA 4UFKA 4WZCA 1UOGA 5IATA 3CZUA 2BYVE 1D0HA 4A7YA 3VDBA 1OLME 1NA1B 4IEUA 1G7YA 1SFNA 3JCIA 2WLQA 3POSA 3BIWE 2VZ3A 2QQPA 1J3PA 2DURA 1Q56A 3J8F2 1VPHA 5FZ0A 3H1MA 5I91A 1XE8A 2VZSA 1MS4A 1OF4A 5G04L 4MXVA 2PAEA 4E2GA 2P37A 1G9DA 1ASJ1 4A7ZA 1O6UA 5F2WA 1LOEA 2XWJB 1W8FA 1WMEA 4XURA 1RHI1 1S0BA 3SEEA 4XUQA 1UXXX 1AR82 4RHV2 5IAVA 1UMHA 4UF0B 1ZBA2 2JDUA 3T4HB 1LEDA 1PX4A 2DDUA 5EP9A 3WW2A 3WDUA 3ZFEC 2B45X 5HPOA 1MQTC 2VU9A 4AGRA 2A1XA 3JB8A 5IVBA 1YFYA 1CX1A 3DPRB 1NY71 1I3HA 1RUE2 3R05A 4MSVA 1ULEA 4I30A 4NRMA 2A6YA 1GZWB 3MUY1 3IDBB 4OVEA 4OMDA 5B4XA 4LNVA 2V4AA 1YJLA 4XF0A 4P5YA 1LGBA 4LO4B 1AXZA 1HRV3 1VB2A 2HWE1 4MGKE 5LEKA 1QJX1 4M00A 1B09A 4I0AA 2BV4A 3Q9OA 1YO8A 3LCPA 3VDCA 4G4FA 2J1VA 5TSWA 5IK7A 5FY1A 4JZRA 5GLUA 2VG9A 5FYMA 4YW6A 5KHJA 2DUPA 5JOXA 1JYTA 1Q8SA 1PZ8A 3EBRA 4IERA 2AZ5A 3USSA 3VUOA 2CV6A 1N1YA 2FDGA 2VZOA 5IVJA 5K0UB 4I2OA 3C7OA 3HN3A 4S2HA 4URTA 3OB8A 4HMZA 1ZRCA 3MUZ1 1TME3 4E4HA 1CIWA 4CP0A 1JUIA 2HWC3 2KD7A 2E63A 2WLPA 4CEWA 5IFPA 4C91A 3ZIWA 3VHOA 1R64A 1HV1A 1ASJ2 5DN2A 4A4AA 1NXMA 3OUJA 5C3QA 1W8ZA 2ZBJA 4EJRA 4QXHA 1RHI2 1N3QA 1OKQA 2RJLA 2Y38A 3LIHA 4LE3A 4AEDB 1MEC3 3AKTA 2DCJA 3ABZA 3GM8A 5E88A 5GJ6A 1RINA 4CXWA 4GWJA 4EWEA 3PTRB 1VBC3 2X5IB 5IHRA 2PHXA 5JPMB 1DIWA 2GMEA 4RGAA 4AGVA 2Q5TA 2RR13 4YM1A 4YARA 5CAZA 2YBKA 3MIFA 2CAVA 4QM9A 1GNHA 4W6XA 3WUCA 1ULFA 1WBLA 2QTWB 3BVCA 1ENRA 1I5ZA 3JB4C 4ZU5A 1SBDA 1UD1A 3KSCA 4NVPA 2GN7A 1R1ZA 1BEV3 5IK5A 3ILNA 4WM7B 2PQQA 3T0BA 1CJDA 2P17A 4K1ZA 2EALA 2HWE2 4RFRB 4ZY9A 3SCGA 1QJX2 1H2KA 1X9TA 4K1YA 1GSLA 2A3WA 3HJRA 3PURA 5CZKA 5ACA1 1RL3A 2BZDA 4XXAA 2W47A 1AR63 5A7WA 2F17A 4CDWA 2K0GA 2XXZA 2F6BA 4HVOA 2ZZJA 4OFGA 4COYA 4L0PA 4UW5A 2RS13 3I3QA 1PGSA 5ANQA 3POBA 4FVVA 4NPRA 3E6DA 4NE9A 5FV3A 4BHPA 5JSOA 3WZ1A 1ZM1A 3I8TA 2DU1A 4HKLA 2W5FA 5C70A 3AP5A 5FYZA 5A3PA 1JYNA 1LCLA 5FKCA 5KXCA 1F5JA 3BPZA 5FLJA 1Z7S1 1N1SA 1ZNPA 5K9YA 2CGNA 2JWPA 3NRUA 5C4WA 2B4KA 4NAMA 3LFMA 1UY3A 5CG9A 4HKOA 1US2A 1W9WA 5JR7B 4LQRA 3HN1A 4M4PA 2IFRA 2ZZQA 4NHLA 1KJRA 4LUMA 3DGTA 4HANA 4XAAA 5CA6A 1GNZA 2H0VA 5K8SA 2A3YA 2P3JA 2R042 2VZVA 1WUVA 3NVCA 3KF5A 2WRAA 5T3NA 1AXYA 1PO21 2DCTA 2VTXA 2QQUA 4BE3A 4Y1XA 3J7NA 4QX7A 3D0JA 1RUI3 3IAPA 1QQP3 1WMXA 4L97A 5JVVA 3T2OA 3F95A 1W05A 5L7OA 1ZREA 1OC1A 2XG3A 3J7HA 3MICA 4YG6A 1R083 2V72A 3T08A 4KG8A 2FCUA 2R1DA 3CF6E 3GJBA 4IGPA 4QX1A 1OUXA 1VLNA 3N9QA 4A3XA 2W39A 2WFPA 3HQUA 3RGBA 2RJKA 2ORXA 2DWRA 3OYWA 4XJ9A 5DQ0A 1O91A 2AEZA 1GP5A 2DCKA 3OY8A 2C5DA 4XJZA 5ACA2 2CL2A 1J3QA 3Q8BA 4JHTA 1HRI3 4GB31 1UPSA 2FDKA 2E32A 1G9FA 4E2SA 1WCDJ 1TMF2 3HBKA 1M4WA 1L7LA 2ZA9A 3PIGA 2R071 1TQ5A 5FXXA 3BOPA 1SPPA 1W9SA 2OPKA 3F2ZA 3LSEA 2EAKA 2DTYA 4FQZA 4RA0A 3RWNA 4OHZA 3AZZA 3FFQA 4R4ZA 2GP5A 4A45A 4YVSA 4FPOB 3I3MA 2Y6GA 4B4RA 2ZEYA 1CZVA 2JIGA 3KZ4C 4KGGA 4LA2A 3B69A 1Z7S2 1OT5A 1E57A 2EXKA 1HQNA 3EMRA 3H8XA 3O1UA 3D6EA 3VHPA 3ACIA 3I49A 1REEA 1KRIA 4K3UA 1AUYA 1YC61 2F4LA 3NV3A 4DNYA 2D93A 2JICA 1I1EA 2A7AA 2FZ1A 2XONA 1H6YA 2ZABA 3HAGA 4XUNA 3ZKUA 5JOWA 4Y33A 5LWBA 2XMLA 3BN6A 2D5HA 1W9YA 2HWB1 3ES1A 3GBFA 4QKDA 5FYIA 1NE4A 5JI9A 5DAQA 3OGGA 2NP0A 4O7XA 2FMYA 4OQ9A 1PO22 1W6OA 1RJ7A 1ZZ9A 1LNSA 1T6BX 5FZGA 1RYYA 3GYDA 1AL21 2ZKNA 4F3JA 1O8SA 2N7GA 4KG0A 1IG3A 5FZCA 3RQ0A 3OTFA 2NQYA 3FL7A 4A42A 3KS7A 4MXWB 3T0AA 5CFDA 2YDEA 2VUAA 2Q4SA 3GBWA 1LOFA 1LOAA 1GQPA 3LAGA 4P02B 3B93A 3VV1A 4CEYC 3FMGA 1XYPA 4KI5M 4ES8A 3NAPB 2XBO1 1YQ5A 2DTWA 3ZFFA 5AFEA 4GB32 1VAKA 1UYPA 3HWJA 3OBTA 4AVCA 4UFJA 3AMQA 2WS93 4TSVA 2OZJA 4UWDA 2R072 2R0FA 3CJIC 5FPZA 5JI7A 4Z2AA 1R1A2 1V0AA 2C6SA 5C33A 2BWAA 2YC4A 3C8XA 1OD5A 1IOAA 2KM2A 3QCWA 5EPAA 4ZZ5A 4W4ZA 3WDTA 5A6ZA 4LR4A 4C1XA 1KDKA 4Q2FA 4TTGA 3ZYHA 2VZTA 1CX4A 3GXUA 2XR4A 1RUC3 4MLOA 3WP5A 4NHYA 1WZXA 4ZS3A 3ZYPA 4COZA 2PAKA 5IJRA 1LAJA 5FYBA 2WNUB 3UJQA 3UGHA 3GZAA 3DF0A 5FMCA 1W6NB 5IK4A 3ACLA 4KU7A 5JWPA 1OSGA 3INAA 4QX3A 3I54A 1DGRN 4XE9A 1ULPA 5CU1A 1FMD3 5JXJA 3LB9A 2VJXA 4WM8B 1D2QA 2HWB2 2JE9A 4IEPA 1A6CA 3V65A 1QJY3 4Q4Y3 1XQNA 4E2QA 4ET7A 1O8PA 4FP3A 1SZBA 3KQ4B 1OLMA 1HRV1 2PYTA 2ZGPA 3LPGA 3GHNA 1AL22 1CAUB 3M3QA 1LHWA 5E6HA 3MIGA 3LKJA 3OEBA 3S0MA 3A4UA 2Y34A 4COUA 2PLV3 4Q4V3 5DAVA 1KITA 3OUIA 1NCQC 2P3KA 1JZ8A 2B42B 1HN1A 3VKFC 2ZACA 3TEXA 3A23A 3ZXJA 1HXS3 2O1QA 3G6JB 1YQ2A 4FBFA 2ZEXA 1XOYA 3IIAA 3VZMA 1LRHA 4W8JA 2BW8A 5D8AB 1CESA 2XBO2 2DCZA 5FREA 2A70A 2NPIA 3THPA 3RZKA 2V5YA 4CDUC 4NO4A 2TBVA 1S0EA 4HN1A 3SKVA 2DFCA 1W3VA 4LOTA 2Q1ZB 1TME1 1V6LA 3SH4A 5FO7B 4QU1A 5FR3A 2HWC1 4UT5A 5FMOS 5FUPA 5F3CA 2W68A 3TEWA 3E6BA 1BK0A 1W6QA 2A71A 3MLJA 4JGYB 5FZ8A 3THCA 2LUWA 4XAEA 1SEFA 4LBQD 3U37A 1POV0 1YQCA 1YJKA 2YPJA 3OEAA 5FLIA 1MEC1 2ILMA 2VGDA 4W6WA 5A3WA 3O14A 3SHRA 1VBC1 1MS8A 1KEXA 4HETA 3Q8CA 5HXMA 1UIJA 4IEOA 4LHSA 1DGRA 2RR11 5F5CA 3RYKA 2GC1A 4M3CA 2I74A 1GWKA 2RV9A 1CIYA 1D7PM 3AL5A 4QWNA 3THTA 3ZKYA 4AI3A 2QQWA 1AXKA 5FJHA 3QOPA 1V6NA 2I45A 1BEV1 3CJXA 4XBQA 2D6OX 3RS6A 1NCRA 2OX0A 2DUQA 5CEHA 3BTAA 2HWF1 1FV2A 4XTPA 1ZBA3 3ITQA 4UW6A 2ZJCA 3ILRA 2P34A 1ZZBA 2D98A 4YGEA 5BUVA 2WYSA 3VGIA 2X10A 4BXFA 2BWCA 4CCJA 3N9LA 2ZCWA 1W2AX 4YFZA 1AR61 5FPLA 4XFHA 2WYFA 3VBSC 4X6QB 3APBA 3O0XA 4Z1VA 5BYNA 4BISA 5A32A 3K3NA 4XETA 1F15A 5IVFA 3WDXA 1XNBA 1WMDA 2PHDA 2RS11 1RUNA 2D7FA 2XL7A 5GALA 3VHRA 4NHKA 4YFWA 4YLZA 2CAUA 3ASIA 1PX3A 2XLGA 3ZYRA 4PF5A 4QB6A 1WD3A 4X8NA 3PVNA 5A1LA 2VW1A 3BPSA 2IUWA 5EFUA 1TME2 5GZDA 1L3JA 2ZX4A 4DEQA 4EE2A 2HWC2 1COV3 3PMEA 2WR9A 4Y4RA 2RM23 4D94A 1DP0A 4QU2A 3KLSA 4Q8KA 3VDDB 1CAWB 3BTXA 2E26A 3BODA 2RMU3 2MHFA 1MEC2 1BKZA 1UXZA 1UZYA 1VBC2 2QQLA 4LTAA 5APAA 3ZXLA 1CN1A 1OOPC 2VQUA 2Y33A 4XF4A 2BOIA 2E7QA 4LKEA 4QPIB 2RR12 1W6PB 4Q0QA 2EXIA 2LROA 4WVVA 4TN7A 1Y3TA 1RUI1 1QQP1 4BA6A 1HX6A 1SFPA 4MGQA 5AC93 2YROA 3T09A 3WD5A 2FDHA 1BEV2 4AI2A 1R081 2W1SA 1K45A 3IPVA 3IWZA 5K7PA 2XJTA 3LPFA 1S2BA 2XOMA 3ZFGB 4XCAA 5FUNA 2K2SA 2BEOA 2J1UA 1OURA 2EF6A 5EV7A 2WNVB 4DQAA 4MGTA 2R6QA 3TN93 5HCBA 2JG8A 2TEPA 1ENQA 2V4VA 1AR62 2Y6KA 1HRI1 4E8CA 1VR3A 1EP0A 1IS4A 2ZMLA 4WVMA 5F8PA 1RIRA 3H9AA 4LBQA 5BNNB 4LHNA 1HDKA 1Y43B 3U14A 2RS12 5HCFA 3IB3A 3CLPA 1C1FA 1ND3A 4W50A 5DAWA 2XJPA 1O3SA 3FLTA 1AX1A 3ES4A 3VBSA 4QQPA 3H1WA 3P3NA 3TEZA 1W2UA 4OHVA 2SBAA 4YVWB 4LBNA 2RJ2A 2VBBA 1BLZA 1WW6A 4RQPA 3EXUA 1UWWA 1WW5A 1A8DA 3DUIA 3NNLA 4R9AA 1DBNA 1KGYA 2AREA 4LK6A 5LA9A 2OVUA 4L9BA 4AK3A 4JVAA 4RS5C 2YV8A 4IESA 3B7MA 3JD73 1UX6A 2WZR3 3ACGA 4XCBA 3P5BA 3WF2A 5IVVA 3RJRA 5DXDA 4JGYC 3A0KA 3I2JA 3VBFC 3C7GA 1SCSA 3WNPA 3E5XA 1CZSA 1ST8A 4AFMA 1RUI2 1ZRDA 1QQP2 4AFBA 2QDNA 2ZTNA 5F3EA 4FTEA 2JDKA 3WEZA 1C5IA 1R082 1X7NA 1V9U3 4GMP0 2Y6LA 3MFAA 5ANNA 2EVXA 3MO4A 5LB6A 3JBG3 4B7EA 5JOYA 5I8TA 4QT6A 4M4RA 5FCCA 4N53B 1QOSA 2CY6A 2R043 4FXKB 1AZDA 2XVGA 3BGAA 1VE0A 3M2MA 3HBZA 5DABA 4AF9A 5CFCC 3U78A 4RR3A 1MR5A 4QQLA 1WLDA 1KS5A 2RDSA 1DQ4A 2CGOA 1NUKA 1NZIA 2W2IA 4PDWB 4BOWA 1HRI2 5JIUA 5FZMA 2DBNA 3ELNA 2WS91 4L8QA 4MOAA 3AKSA 5BNOA 5I8SA 1NAEA 3VZLA 4CDXA 4YGDA 5ABJA 3VD9A 1AR73 1REDA 4AQTA 3VBUA 4ASLA 4NPLA 3D8CA 4XTMA 2YGLA 4LMFA 5A6QA 1DFQA 1RUC1 1ZZ6A 3DYPA 1GP4A 2GC0A 4HZFA 4N7IA 4NMIA 1N1TA 5GLVA 3TEYA 1XNKA 2W95A 3E5QA 5LEJA 1DGWX 3FUOA 3I2OA 4EYUA 4ATFA 4DXZA 1VBE3 4I3PA 4NRQA 4K20A 4R52A 5LW9A 1S0GA 5EYYA 1RVF3 3MHZA 5FPVA 4B1MA 4AGGA 3KQRA 4N7UA 5C5UA 2RE9A 3POYA 4ATEA 4JRAA 3ZFEB 5M0TA 1RUG3 5FZOB 1FMD1 1MQTB 1V00A 2EIGA 5C71A 4FFIA 3AVRA 1QJY1 1RMU3 1Z0HA 4Q4Y1 1OA4A 4XHBA 1ND2A 1FT9A 1Z78A 3USUB 4AR2A 1HW5A 3O5SA 4IEWA 5FYTA 4AHWA 3TBDA 1UOJA 4XF1A 1LHUA 1NOVA 2X53S 3QD6A 1C8NA 3EYPA 4B1LA 1QIQA 3LSDA 3FX3A 2XQRA 1Q5OA 3WCSA 3BOWA 1CVNA 4JAAA 2PLV1 2WO2A 3I97A 4Q4V1 2D3PA 3RJ2X 4ZONA 2VVFA 3O0WA 4XF9A 4EN7B 1IPSA 3EO6A 5IAXA 4YG0A 1HXS1 4H14A 2C0ZA 2XB6C 2YBSA 3MW2A 2WKKA 2XJVA 2Z79A 3RZHA 2CWMA 2XVKA 4XHXA 2PQSA 1J58A 5FYSA 4CSWA 4E4DX 2ZHMA 2PHFA 4BMEA 1KS4A 5KBFA 3KT7A 2WS92 2Y0IA 1OFSA 3K48A 1UF2C 4IV1A 3SMHA 2OS2A 1IQDC 2LM3A 4CRQA 4EV0A 4GH4C 1JYXA 1IPJA 3MV11 2OUHA 1Q43A 1W04A 1MS9A 3UESA 3AVSA 3B5LB 2Y0OA 2AUYA 3D4KA 1RGSA 2YBPA 2PHWA 4P9IA 5C3SA 2ZX3A 2JG8C 4IV3C 3HEIA 3NKTA 3S6PA 2HYXA 3AK0A 4Q0PA 1QXJA 1W0PA 1ZVFA 3PHMA 2ZGOA 2IXIA 5IW0A 3WG1A 1JZ7A 3WW1A 2VMFA 2GSYA 1POV3 5F37A 1O4YA 1R1A3 4XDQA 1ZZ7A 4PIZA 5GM0A 5L9BA 3WG3A 1OLQA 4WZFA 3N36A 4PBPA 1RUH3 4CDQA 4YVWC 2QKDA 3DYOA 3NMBA 4QB1A 2XKOA 3IBMA 3ZR6A 1FMD2 5EIYB 5GZFA 2ADDA 4XW3A 4OI2A 5C9AC 5I0SA 1JOJA 5J09A 1QJY2 4Q4Y2 2D40A 4KWUA 1JYWA 4XDOA 1MVQA 5EJ1B 4EN8B 1C28A 2ZS6B 4LHLA 3KVBA 3M70A 4I0BA 1ZBA1 2A6ZA 4RHV1 3SNMA 5FOJB 3VN4A 5GZGA 5E89A 1MZ5A 1VMHA 1SFYA 2DVGA 2EXJA 4GD4A 5JXIA 4R9CA 2Q8OA 3ZMNA 2ZOEB 4YW3A 4W65A 1CAXA 2R32A 2C24A 2JB8A 4GWNA 5JZGA 1V70A 3ACHA 2PLV2 4Q4V2 1SDWA 5FP4A 1DG6A 1K5MC 3BTYA 1HXS2 2UURA 1H8TA 4FCAA 3R6SA 2ZEWA 4QPGC 2JIJA 1S2KA 2HJIA 2JECA 3M3IA 1QJFA 1CAVA 5F6KA 3WNNA 3GHMA 4PI2A 4YW5A 4LKDA 3QH6A 5HBAA 5HXVA 1HJFA 3EHKA 3O0VA 1D4M3 1AHSA 2BQPA 2JE7A 2YMZA 2BERA 4XBNA 1IKQA 4Y1UA 5T5PA 5KC5A 5A3UA 1COV1 3MIHA 2RM21 3CU7A 4YRDA 4I0WB 4DS0A 2Y60A 4FTSA 1SLCA 3N4MA 4XDPA 2WNOA 1XSQA 2W92A 1QHDA 3SLIA 2HBUA 4E8DA 3N7KA 2RMU1 1JYIA 4HOOA 1QXRA 2IXKA 4K8FA 3H3ZA 5CBLA 2QFEA 4IDZA 5F39A 4E9KA 4CPBD 4QXKA 4NIAA 4LORA 4XQWA 3I2IA 2GZWA 3Q8FA 3NNJA 2XHNA 1US3A 2JG9C 5KXDA 1X82A 1S1AA 3UYJA 4L92A 3O12A 3HIFA 2ARXA 5FP8A 4BLIA 4Q0VA 5AC91 3I2HA 4QAWA 2UY9A 1Q8QA 4IE4A 4NHMA 4QGMA 5C5TA 2WAOA 1NA1A 1E5HA 2VPVA 2BTVC 4MX3A 3VBOC 2VBDA 3ZN4A 3AJZA 1QJEA 3OCPA 1ZBE3 4Z8BA 1IGOA 3CNAA 1LENA 1MACA 1UU5A 3MPPG 3TN91 4LJHA 2X8KA 3H50A 3ETQA 1W6MB 2EICA 3EJKA 2XJQA 4UW4A 1EUTA 4UF0A 2D6KA 2JKBA 3PU8A 4QHOA 5GKAC 3WNKA 1W2NA 3O1RA 4BU2A 3IT8A 2K9ZA 1PIV3 3R4UA 2DUOA 1JUHA 1YLLA 3DPRA 2VXRA 2B39A 4BQWA 1J1LA 4P9WA 5D21A 3O1TA 1GZWA 5DDJ3 1PGL1 2FD8A 4RFT0 1F4HA 5ISLA 2VW0A 4JX0A 1COV2 4XIKA 2RM22 5I0TA 2LALA 3I4IA 3ZXGA 2VCAA 3KGZA 5FIXA 1QDOA 1RC6A 5FZKA 1W90A 2RMU2 2BGOA 4YZ1A 1UKRA 2P1BA
chains in the Genus database with same CATH topology
3JD71 4JTOA 4BZ4A 2WZR1 4IXLA 1A3KA 2XWBB 4XMAA 2XGXA 1FNZA 3RI8A 4CZSA 2PA7A 4GKXA 5L19A 3FLRA 1IS6A 2TNFA 3BB6A 5D1IA 5BNPC 4XJUA 5AC92 2QE3A 1UIKA 2GAUA 4AQ2A 3VLBB 3VKMA 5K0UA 1V9U1 2CGPA 4QX5A 4BPZA 5FTTC 1RUF3 1SLIA 3JBG1 5EXOA 1QKQA 4GMP3 2R041 5JSRA 3NL1A 1DU3D 3WP6A 1SLAA 1H4HA 3LA7A 4P5HA 4ZU7A 3TN92 1DZTA 3DL3A 3T1MA 2DFBA 5FOBB 3KM5A 1OI6A 4AEDA 3I59B 1MS0A 4CEYB 4MGZE 3V0BB 5C6CA 1B35C 4MGYE 1AR71 4GQ7A 2X5IA 1IKPA 4NWWA 1ENSA 3WG4A 4Y20B 3CJIB 2ES3A 2WSVA 2YZ4A 5FQ0B 4UBGA 3NJZA 1PGL2 1BBT3 1FPN3 5J98B 1VBE1 1TMF1 4WM7A 1EV13 1RVF1 5C8CA 1GV9A 4DFSA 3JD72 3MIBA 1RUG1 4W6YA 2WZR2 4SLIA 3ZO0B 1VB4A 4N43C 1RMU1 1I6XA 2ETEA 1LJ7A 1FOD3 1UU4A 4IEQA 5KHGA 2JDZA 3QLQA 3VBHC 1AVBA 1OQEA 5LRRA 1V9U2 1MS1A 1AR93 3BU7A 2ZGTA 3JBG2 5EZWA 1CGPA 1QGLA 2MPFA 5DUVA 1U5IA 1GICA 2VUJA 2PHRA 3B94A 1NCQB 1EPZA 1URXA 4FQ4A 4RL7A 4AE2A 4QPYA 4D3WA 4KL1A 4BIOA 4AQ6A 3AM2A 3RZZA 4FAGA 4XFGA 2OUJA 3FWEA 4CDUB 1AR72 2QZ2A 5JIAA 4IEVA 1NLRA 4F7ZA 4QQ2A 1A78A 1U5YA 1FXZA 3AZWA 4GWMA 1V6IA 4OUSA 4OHXA 2JEMA 1JN2P 1XNDA 3GALA 3KT1A 1VBE2 1UU6A 1POV1 1WLTA 1RVF2 1R1A1 2E53A 4LEJA 1VAMA 2D97A 1S0JA 4GKYA 4K21A 4CTEA 1RUH1 2Z42A 1QY4A 4B4QA 1AX2A 4UW3A 1RUG2 3FE5A 1RMU2 3SH5A 1PK6A 3QACA 1A8MA 4U2AA 4OHWA 2R16A 4KU8A 2GU9A 3UKNA 3URFA 1X50A 2FBEA 4YW4A 3N7JA 4P14A 4QGNA 1GZ9A 2DU0A 2NZ9A 2FMDA 1DYPA 3UJOA 4AXOA 4YNIA 4CEWC 2B46X 3WUDA 4TYSA 3WDYA 4OZXA 1HQLA 3B9IA 1VBD3 3A0NA 3ZDSA 4Q0SA 3AYCA 1LGCA 1T6GC 2XVLA 4YW1A 3E6CC 4HPKB 2ZGUA 1CJPA 5B2GB 2XUMA 3MW3A 3DN7A 4LULA 3IM0A 2E7TA 3P3PA 2JJ6A 5J7MA 3AZYA 2WA3A 2HEYF 1LEMA 1RUH2 2JX9A 5H9SA 1OOPB 1NYWA 4LLFA 3OPZA 1XU1A 3AKQA 4D69A 4CDWC 2GC2A 1VBB3 1WLWA 2D6PA 4CP2A 2H6CA 1XXNA 1PGW1 3ZYIB 4K40A 3R0RA 1BCXA 1O5UA 3HQXA 5IK8A 1KD7A 4XFBA 4XF3A 1LODA 4XQ4A 1FX5A 2WNUA 4ISQA 1KFUL 1S0FA 4Z07A 5I93A 1N3PA 3LOIA 1W6NA 5C4WC 1XYNA 1G9CA 1PIV1 4E4SA 1WCSA 2GDFA 4DINB 1D4M2 5DDJ1 4WM8A 4MGIE 3WHTA 3FBMA 1N3OA 1QH7A 2GN3A 2UYBA 4ZU4A 3W58A 4XJ8A 4AVVA 1YFUA 2YGMA 5DUWA 1C5HA 1CAUA 3ALQA 1LHNA 2KXLA 4OHYA 5L7OC 3C3VA 3WXPA 2YUEA 4YZ4A 1IPKA 3NV4A 3KD4A 1DGWA 4RS5B 4IEYA 1YIPA 3C2UA 3H7JA 1JHNA 2VVEA 2VMHA 3FLPA 1WLCA 3NSTA 3PVBB 5D8AA 3VBFB 4EN6B 1XE7A 3WX5A 5KHKA 2P2KA 4QMAA 4MZUA 1AYM3 4C1WA 4FPJA 1RUF1 5CIRA 1YUDA 2ZKLA 3V0AA 4LO5B 1ZBE2 2VOKA 4GMP1 3WDWA 1RJ8A 5I0UA 1JYCA 1PGW2 4D7TA 4C0BA 2W0XA 4YVSC 5CFCB 1H2LA 2O0OA 3VBRA 5KHIA 1YHFA 2D6NA 1DDLA 1GANA 4DY5A 2JENA 3AX4A 4QHBA 4AHYA 5GLTA 3WP4A 1PIV2 3AFGA 4C90A 4KGQA 4MV2A 3ZN6B 4AI0A 2DVBA 4JDNA 3ZSEA 3WY6A 3N35A 5DDJ2 1LECA 3L9JT 1PNFA 3PLQA 1BBT1 2E7AA 2OYZA 5FDBA 1EV11 4XEZA 2FQPA 3H8UA 2R49A 3GZTB 4DMIA 2NMOA 1BVVA 3PMSA 3GBGA 3OBRA 3AJYA 4J1WA 2DVAA 2HYKA 5CADA 5CFDC 2XJRA 4EN9B 1S55A 1LOFC 4LA3A 1W0OA 1BQPA 1FOD1 4Q0UA 3NV2A 3O7OA 4E4ZA 5AVAA 4IQPA 3U07A 1G9BA 3ZFFC 5CG8A 5SV5A 2ZAHA 4JGZA 2PTMA 1RUF2 4DY3A 1PVC3 1VJ2A 4YSFA 3OD0A 1GYKA 1H9WA 1H2NA 1TNRA 2ENRA 2QCSB 1O7FA 3G7DA 1JXNA 1IS3A 1ZRFA 1VIWB 4HFSA 5T5OA 4EWAA 1OPMA 1SQ4A 4QPIA 4AI8A 1W6PA 3WOGA 1ZZCA 3IPVB 4GH4B 3NW4A 3FC0A 4FAHA 2GNBA 3WDVA 4YZ2A 2AENA 2VOXA 2DCYA 1JW6A 1F9KA 1BBT2 3B00A 4K6BA 1FPN2 2W52A 1EV12 2NMNA 2JG8B 4IV3B 4Y22B 3MZHA 4Q4X3 3ZFGA 4B29A 2I07B 3D82A 3KGLA 3HR9A 5EYXA 3RDIA 3TNQA 2WNVA 2AR6A 4XYXA 3ZIXA 1OQ1A 3MI8A 1SMVA 4MH0E 2OW4A 3M4FA 4OI4A 3VKLA 3ME2A 3WVJA 5BNNA 5C9AB 1FOD2 5L73A 2ZX1A 4JV4A 4Q27A 3WG2A 3H0OA 3NWKA 4KWKA 4SBVA 1H4GA 1BJQA 1AR92 4WV8A 2XJUA 3POWA 1UN1A 3NV1A 4ZKTB 2NYYA 4FT8A 2A6WA 2VMGA 2V73A 2BVBA 2RS32 4Z2WA 2ZHNA 1K5MB 5KHHA 1ULDA 3T2TA 4D7YA 2BNNA 1VBD1 1TEIA 4H55A 2H0BA 4I3GA 4QPGB 3WP3A 5T5LA 3N7MA 3R4DB 1UW8A 3M3CA 2TUNA 3J9SA 1AYN3 3MFCA 1U12A 1FI2A 1VAVA 1NXD1 4AVSA 3TAYA 1QWRA 1F8VA 3VBRC 4LBKA 1NCRC 5FMOL 3WT3A 1O4TA 1X8EA 4N53A 1WMFA 2WC2A 2WSUA 4AQSA 5HCAA 2CYFA 2GALA 4FPFA 3B3QE 4YGBA 2E9QA 3WQ1A 4PDWA 1X33A 2JG9B 4KBBA 4M01A 4PQ9A 1RITA 3RI9A 3JQXA 2R062 3M7AA 4ES9A 1ZX5A 3VBOB 1GBGA 2PAMA 3TWIA 5LK5A 3L2HA 4M0NA 1CQ9A 3ZSLA 3AP9A 5A3LA 3W59A 4BH9A 1PO13 5CNAA 1DQ2A 2Y26A 1VBD2 1SBFA 2XKPA 4R8HA 1DQ5A 2A75A 2IXLA 1VRH3 3CEWA 1MQTA 4FOQA 4JGZC 3ZXDA 4X6RB 1Q8OA 1S0IA 4YM0A 3USUA 1YFXA 2SLIA 4DOUA 4PIYA 2GH8A 2O8OA 3ZYJB 4ASMB 1MS3A 4YG3A 2UU8A 4KWLA 1OA3A 3RNSA 3NKGA 1QJZA 4WVWA 1QOTA 3OGJA 4FP2A 1YNAA 1MZEA 4Y4YA 5DG2A 4J6GA 3LA3A 1EAH3 3B01A 2EAAA 2GNDA 1QJU3 1XNCA 5FRAA 1AYM1 2ZHKA 5BNPB 3RYRA 1VBB2 1SBEA 3S7IA 1WW7A 3ZMOA 1ND3C 2A5ZA 4GXLA 4KQ7A 3VZOA 1OA2A 1RB8G 3MEPA 3RPQA 3ST7A 1FV3A 1IHMA 1NG0A 3J26N 5DZGA 4H7MA 5CVRA 5FAXA 1Q8VA 3VBSC 4LBMA 2BFUS 4LT5A 1GLHA 1AL0G 1VALA 2WT0A 3VL8A 2ZMKA 4RQPC 2WT1A 2QDRA 4PIXA 3MLKA 1MZ6A 2ZGRA 5T55A 3AP7A 1GQGA 3I7DA 4L11A 4XFCA 1B35B 1CPMA 2XHKA 5E1RA 4ISRA 3AZVA 5CB7A 2D6LX 3PTYA 1YFWA 3LGRA 2GNTA 1ULGA 5H9PA 1IZ3A 3TYJA 3EQEA 3K51A 1AX0A 2BBVA 5J37A 1ENXA 4X8PA 5A33B 2WA4A 1KDMA 1H8TB 1WGPA 2VVDA 3NO8A 4I02A 5LK7B 3IDCB 5AVPA 3U10A 4N43B 4RR3C 5F5QA 3FJSA 2IC1A 1MZFA 1KXGA 2XLFA 1RUD3 1SLLA 4QM8A 1AYM2 1WA4A 1N1VA 3VBHB 5BNOC 1V6OA 4CDXC 5ABJC 2Q30A 4JC1A 1PVC1 3VBUC 1JH5A 2WNEA 1U0AA 3GZUC 2HKXA 2QZ3A 1C1LA 5DZFA 2WINB 4AG4A 5GLZA 1PNGA 2RHPA 4M3CF 1DQ0A 2WFF3 2C9AA 2H6BA 1DYKA 1H1IA 2RS53 5F6LB 4XMIA 4IETA 1R093 3MYXA 3MW4A 2X29A 5T5JA 1DLLA 1C4RA 4HK9A 1C57A 3DV8A 2VH9A 1SCRA 1LOCA 1LB2A 3BCWA 4Q8LA 4EWDA 1ND2C 4Q4X1 5GLWA 3FFZA 4AI1A 3LA2A 1O5LA 5JMCA 1S0DA 2GH2A 1W6MA 4YM3A 2CNAA 4YM2A 2HWD3 2G4IA 2UWCA 2R1BA 5FFOC 2D5FA 1RUJ3 3IN9A 2PHTA 1KJLA 2R30A 5DUXA 3PVEA 3FHIB 3KT4A 1WD4A 4HN0A 4AVTA 4TWTA 4P9YA 4IV1C 1H2MA 3E97A 3W9AA 3ZXEA 5DG1A 1PVC2 5EWSA 5J48A 1WCKA 2JXAA 1YI9A 4R4XA 4NWVA 4JQRA 3VKOA 3SITA 2WIIB 4GULA 2PN5A 4Y24A 4FOWA 4FSJA 4M3CE 2ARBA 4CEWB 3B02A 4P9LA 4U36A 3CL1A 1AYN1 1FNYA 1OQDA 4Q1RA 3VZKA 4CDQC 4KH9A 3AB0A 1V6MA 4BM8A 1NQJA 5BPXA 1G86A 4HKWA 4DZGA 3TRSB 4B3NA 1ONAA 1C8M3 1WW4A 2VY0A 3RYPA 4Q4X2 5FBZA 3VL9A 2IXCA 2Z2SB 1V6KA 5FLHA 3IMNA 3AYEA 1GQHA 2ATFA 5JZGC 1AF9A 3I59A 4CEYA 1NY72 3V0BA 3SCFA 4R9DA 1H8TC 4CDWB 4MVTA 4COWA 3ZXKA 4Y20A 3UL2A 3SISA 3CJIA 2ERFA 2BFUL 2HWF3 5C8CB 5FQ0A 2AH2A 5A3MA 2BPA2 2Z69A 3SCHA 3KCCA 1PO11 3TOJA 3JQWA 2MEV3 1YCIA 4ITCA 1MS5A 2YYOA 4FOYA 4AEMA 5GZEA 5C4WB 1D2SA 1VRH1 4AW7A 3AKPA 1PMIA 1AYN2 4FPLA 2B5HA 4BQ1A 2RS33 1ZYBA 2FZ2A 2A73B 3M3OA 3MF9A 2PELA 3M3EA 1NA1C 5L7OB 3JUUA 2XH6A 4Q26A 4FPHA 4AVAA 2D43A 4PLNA 4D7SA 2A6XA 1NCQA 2GC3A 1ZZ8A 5L36A 2DV9A 1SLTA 1EAH1 1HLCA 2DYCA 1QJU1 5JPNB 4S2GA 1OMIA 3OYWB 3OY8B 1PM7A 1U5XA 4OI0A 4P9GA 3WV6A 4YZ5A 2WZPP 4CDUA 2ZX2A 4FXGB 4Q29A 1F2NA 2DF7A 2BGCA 3N7LA 4FPGA 4RD7A 3DPRC 4FOVA 3IKWA 1F31A 3MIDA 3RMYA 3SH3A 1TNFA 1PO12 4O9EA 4Y1ZA 3LOBA 4YVSB 1TE1B 1VBA3 2VQ0A 2WWSA 4P9XA 1LU2A 2R063 2UYAA 2VECA 5I8YA 1PK6B 1M06G 2F4PA 1GR3A 3T1LA 2ZGQA 1VRH2 2EA7A 3RMXA 1RUOA 2ZGLA 3UKVA 4HT1T 4HVQA 2GMMA 1UPIA 4KWJA 4FPYA 3OJBA 1J3RA 5T50A 4FO9A 4EN0A 4BWOA 4IL7A 1QH6A 1W6OB 5K0UC 1HKDA 1D4M1 1UAIA 2C1FA 5C8WA 3AXDA 3AP6A 4BIFA 1I9RA 1O3TA 2ZX0A 4TLFA 2VOWA 4AYUA 1APNA 3VKNA 2LTNA 5CFDB 1JBCA 1EAH2 1RUD1 1QJU2 1LESA 5J3UA 1Y9QA 4LBOA 4DRRA 4AEDC 3WNXA 3WQ7A 4MXWA 2IXHA 5KC6A 3ZFFB 3VZJA 4QQHA 1QOOA 1GZCA 2X5IC 4HPKA 2BVVA 1NE6A 1H8VA 3UV9A 3NAPA 4LO7A 4Y1YA 3SXWA 3ZSJA 4G9SB 1DHKB 1LU1A 3JU9A 2BUKA 4M0HA 1BMV1 2WFF1 4WM7C 1H1AA 2VNGA 4FPCA 1ULCA 1VP6A 3WR0A 1ZBE1 5C8CC 2RS51 4Q4W3 4Q1PA 1R091 2DVDA 2GNMA 4LO8A 3ZSMA 3ZXAC 1OOPA 4TZDA 4NOTA 1IQAA 1FAYA 4BMBA 3E5UA 1LR5A 1PZ9A 1XYOA 1LHVA 2NLRA 3MLLA 5HI0A 3D5OA 5AFBA 4XFFA 1KQRA 1H1MA 4IEXA 2YHJA 3ROUA 5JLVA 1G9AA 2WJSA 1X36A 2PHLA 3WW3A 3AXEA 2HEWF 5E8AA 1QMJA 5LRSA 2VW2A 1SLBA 2HWD1 2BNOA 4OLLA 5BNQA 1RUJ1 1YYNA 3MIEA 1X8MA 2WL1A 1CR7A 1RUD2 4I01A 2ZPXA 3VZNA 4HLTA 2D3SA 3WQ0A 1PZ7A 3S7EA 2DVFA 2CTVA 4XXPA 2OIIA 3H1YA 1GFF2 2Q1MA 4Y26A 3ZYGA 3AMNA 1ALYA 1MVEA 2QJVA 2ZAAA 4AFAA 1DZQA 3AMHA 4INDA 2ZGMA 1W6QB 1BXHA 4HVRA 5FO9B 3MF6A 1BMV2 2WFF2 2VQAA 1UCXA 4RS5A 1XU2A 5BV6A 2RS52 1R092 5F9TA 1PHMA 3V0AB 2A6VA 2IZWA 4JGYA 3VBFA 3ILFA 2E51A 2Q0AA 4M3CB 5IUQA 1PK6C 5SV8A 1C8M1 4IEZA 5JSPA 1OHFA 4B7KA 2R0HA 2B9UA 4LE4A 3VBRB 1AJOA 1NCRB 2WT2A 1QNWA 2AYHA 2OZ6A 3HD8B 1BK1A 5CFCA 3HT1A 1LKNA 3J8F3 3ZN5A 2HWD2 1FPN1 2UWAA 1V6JA 3ZX7A 1RUJ2 3L2YA 2YY1A 1GKBA 4JDOA 2W08A 4QD2A 2Z5WA 3OD4A 5A32B 3ZN6A 4BLJA 1AR83 4RHV3 1HRV2 5JOZA 1YWKA 4LLOA 2QVSB 1RUE3 1YI7A 1D0GA 2B8MA 2O8QA 2MEV1 3FZ3A 4B4PA 5J36A 5F1RA 2NM1A 4K9SA 2D3RA 4PLMA 1AR91 2FHRA 3WCRA 2WQ4A 3ZXFA 3H7YA 4HSJA 1LTEA 4JGZB 1BZWA 2RS31 3VDDA 1CAWA 4DB5A 5JCTA 1N47A 3B9CA 2VULA 1UL9A 3NAPC 5T54A 4CP1A 4COVA 3AYDA 1AJKA 3X29B 1C8M2 4EROA 3ZSKA 3N3HA 4YZ3A 2D6MA 2OA2A 3ENRA 3ECQA 4XQDA 5BXXA 3TNPB 4YYOA 2VOVA 4FPEA 4AHZA 3AP4A 4PLOA 4XJAA 5EJ3A 3AMPA 2UY8A 4UXAA 2EXHA 2IWGB 4NN0A 2ZGSA 1ASJ3 2WNUC 3V64A 2XPJA 3KB5A 3PJYA 1RHI3 4WVMB 4LBQB 1O3RA 4GH4A 1H9PA 2YXSA 4XILA 2HWF2 2CWSA 3QBQA 1ND3B 1O4ZA 4CYDA 2GMPA 4WM8C 4XIOA 1J59A 2G9FA 4QQOA 3VBSB 3PNAA 3S30A 4IV3A 4OULA 4Y22A 1VBA1 2MEV2 4AWDA 1YXWA 1ZRRA 2R061 3HMYA 3VHNA 4RQPB 1ZA4A 5T52A 2XLAA 1CONA 2IFWA 4J1XA 3I2DA 4GALA 2HWE3 4B8EA 1J1TA 4YVWA 1QJX3 1NZCA 4AEJA 1QNYA 2BNMA 1SACA 4FPKA 5C9AA 1DGLA 1HV0A 2KA3A 1HQWA 3GNEA 5D8AC 1HIXA 5BY5A 2E6VA 3MDPA 5DZEA 3AMMA 5E16A 2A3XA 3KCYA 4F8AA 3PVOA 2AGSA 3WINE 2VMIA 1LULA 3KCXA 2NN8A 3U0ZA 1BYHA 1BVP1 2VNRA 3OF1A 1K5MA 1JTZX 1NQDA 3TB0A 4RR3B 2QNKA 4QPGA 1XRUA 4UBHA 4P9JA 1CPNA 2ET1A 4XJWA 3KMHA 1S0CA 4AFDA 4YW2A 3M1HA 3CO2A 3WW4A 5BNOB 1OPOA 1DZRA 1FATA 1H0BA 4CDXB 5ABJB 4GA9A 3UK9A 5I0RA 4Z92B 2G9GA 3VBUB 2I2SA 1QDCA 2XJSA 1UMZA 3LZZA 4XZPA 1KFXL 1VBA2 4E27A 4S2FA 1VBB1 2QUOA 4RGGA 1D4VB 2D44A 4Q4W1 2ZMNA 3R4SA 1IS5A 4KNCA 4A7KA 3IDEA 3PJQA 4FTBA 2JG9A 4ZXKA 2PFWA 3WLUA 1REFA 5ACA3 1U5ZA 4RSUA 3FUQA 5H9RA 4LHKA 1LHOA 3WHUA 2HEVF 4S2DA 4AEKA 4H3WA 1ND2B 4HL0A 4OUMA 3VBOA 1TMF3 2ZHLA 3ZFEA 4PBOA 3H3UA 3RG0A 4GIQA 1WBFA 4PCRA 2P3IA 3VDDC 4LBLA 1PVXA 1QU0A 4HBNA 4HK8A 1O3QA 1EYBA 1OFNA 1Z7S3 3AZXA 3FBYA 4H7LA 2B7YA 4DPNA 3BALA 4ORFA 3GF6A 4Z82A 1RTVA 4WBBA 2ZGKA 4XFIA 3ZPYA 4I09A 5JDBA 2YC0A 4JCKA 5GZCA 1DF0A 4IV1B 4QPIC 4AFCA 3D0SA 1YRZA 3AYAA 4NR1A 4MYEA 4YGCA 3HT2A 4XPVA 3U11A 1PO23 4N90A 4N9HA 3JZVA 3V56A 1DQ1A 4Q4W2 3UKTA 1C3HA 3ZFGC 4DRVA 4BCUA 2WNVC 4WVZA 4LUKA 4Y1VA 1YIFA 4HSLA 4CDQB 4C0HA 3U4XA 5BNPA 3MPBA 1RUC2 5BNNC 1LOBA 4Y5Z0 5FPXA 1EPWA 4GB33 4O9GA 1Q3EA 1CD3G 2R073 3AFKA 1QF3A 3LWCA 1QXPA 3J8F1 1CAXB 2PHUA 5JZGB 4OI1A 5IT6A 1G8WA 4F83A 4AVBA 1OLRA 1B35A 1AR81 3MGUA 3DKWA 4QGLA 1F5FA 1W39A 4A2UA 3M8LA 4JRLA 2MNGA 1CAVB 3J4UH 3ATGA 4BYYA 1G6NA 1RUE1 4JTNA 1LOGA 2UWBA 4N9IA 2JD4A 4V1PA 4LO6B 4JDMA 4XOGA 2HWB3 5KXBA 4MUVA 1UZZA 5A33A 1Q8PA 5J96B 5FO8B 2WQZC 1UKGA 2ET7A 3QH7A 2XL9A 4L99A 1FYUA 1AL23 5DUUA 1EY2A 2ZGNA 4PJYA 4XBLA 4XFAA 4N53C 1Y7BA 1LGNA 4L2NA 5JAXA 2IXJA 4N43A 2V09A 4META 1DQ6A 5H9QA 4G3YC 1H30A 4PDWC 5KWRA 4AHXA 3RSJA 4R9BA 4ONUA 4K7JA 3ZVXA 3VBHA 1NLSA 2VNOA 5KXEA 2XBO3 3AKRA 4LBJA 4WZCA 2BYVE 1D0HA 4A7YA 1NA1B 4IEUA 1G7YA 1SFNA 3JCIA 2WLQA 3POSA 3BIWE 2QQPA 1J3PA 2DURA 1Q56A 3J8F2 5I91A 3H1MA 1XE8A 1MS4A 4MXVA 2PAEA 4E2GA 2P37A 1G9DA 1ASJ1 4A7ZA 1LOEA 2XWJB 1WMEA 1RHI1 1S0BA 1AR82 4RHV2 1ZBA2 1LEDA 3ZFEC 3WW2A 3WDUA 2B45X 1MQTC 2VU9A 4AGRA 3JB8A 1YFYA 3DPRB 1NY71 1I3HA 1RUE2 3R05A 4MSVA 1ULEA 4I30A 2A6YA 1GZWB 3IDBB 4OVEA 4LNVA 1YJLA 4XF0A 1LGBA 4LO4B 1AXZA 1HRV3 1VB2A 2HWE1 4MGKE 5LEKA 1QJX1 4M00A 1B09A 4I0AA 3Q9OA 1YO8A 3LCPA 4G4FA 5TSWA 5IK7A 5GLUA 2VG9A 5KHJA 2DUPA 5JOXA 1Q8SA 1PZ8A 3EBRA 4IERA 2AZ5A 3USSA 3VUOA 2CV6A 1N1YA 5K0UB 4I2OA 4S2HA 4URTA 4HMZA 1ZRCA 1TME3 1CIWA 4CP0A 1JUIA 2HWC3 2WLPA 2E63A 4CEWA 4C91A 3ZIWA 3VHOA 1HV1A 1ASJ2 1NXMA 2ZBJA 4EJRA 1RHI2 1N3QA 1OKQA 2RJLA 2Y38A 4LE3A 4AEDB 1MEC3 3AKTA 2DCJA 5GJ6A 4EWEA 5E88A 1RINA 1VBC3 2X5IB 2PHXA 5JPMB 1DIWA 2GMEA 4RGAA 4AGVA 2Q5TA 2RR13 4YM1A 4YARA 5CAZA 3MIFA 2CAVA 4QM9A 1GNHA 4W6XA 3WUCA 1ULFA 1WBLA 4ZU5A 1ENRA 1I5ZA 3JB4C 1SBDA 1UD1A 3KSCA 4NVPA 2GN7A 1R1ZA 1BEV3 5IK5A 3ILNA 4WM7B 2PQQA 1CJDA 2P17A 4K1ZA 2EALA 2HWE2 3SCGA 1QJX2 1H2KA 4K1YA 1GSLA 2A3WA 5ACA1 1RL3A 4XXAA 1AR63 4CDWA 2K0GA 2F6BA 4HVOA 2ZZJA 4OFGA 4COYA 4UW5A 2RS13 1PGSA 4FVVA 4NPRA 3E6DA 4BHPA 5JSOA 3WZ1A 1ZM1A 3I8TA 2DU1A 4HKLA 3AP5A 1LCLA 5KXCA 1F5JA 3BPZA 5FLJA 1Z7S1 1N1SA 1ZNPA 5K9YA 2CGNA 5C4WA 5CG9A 4HKOA 5JR7B 3HN1A 2IFRA 2ZZQA 4NHLA 1KJRA 4LUMA 3DGTA 4HANA 5CA6A 1GNZA 2H0VA 5K8SA 2A3YA 2P3JA 2R042 1WUVA 3NVCA 5T3NA 1AXYA 1PO21 2DCTA 4BE3A 4Y1XA 3D0JA 1RUI3 4L97A 1QQP3 5JVVA 5L7OA 1ZREA 2XG3A 3MICA 4YG6A 1R083 4KG8A 2R1DA 3CF6E 1VLNA 4A3XA 2W39A 2WFPA 2RJKA 2DWRA 3OYWA 4XJ9A 1O91A 3OY8A 2DCKA 4XJZA 5ACA2 2C5DA 2CL2A 1J3QA 1HRI3 4GB31 1UPSA 1G9FA 4E2SA 1WCDJ 1TMF2 1M4WA 2ZA9A 2R071 1TQ5A 3BOPA 2OPKA 3LSEA 2EAKA 2DTYA 4FQZA 4RA0A 3RWNA 4OHZA 3AZZA 3FFQA 4R4ZA 4YVSA 4FPOB 4B4RA 3KZ4C 4KGGA 4LA2A 3B69A 1Z7S2 1E57A 2EXKA 1HQNA 3D6EA 3VHPA 1REEA 1KRIA 4K3UA 1AUYA 4DNYA 3NV3A 2D93A 2JICA 1I1EA 2A7AA 2FZ1A 2ZABA 3HAGA 5JOWA 3ES1A 2D5HA 3GBFA 2HWB1 5JI9A 1NE4A 2NP0A 3OGGA 2FMYA 1PO22 1W6OA 1RJ7A 1ZZ9A 3GYDA 1AL21 2ZKNA 4F3JA 2N7GA 4KG0A 3RQ0A 3OTFA 2NQYA 3KS7A 4MXWB 5CFDA 2YDEA 2VUAA 2Q4SA 3GBWA 1LOFA 1LOAA 3LAGA 3B93A 3VV1A 4CEYC 3FMGA 1XYPA 4ES8A 3NAPB 2XBO1 2DTWA 3ZFFA 5AFEA 4GB32 1VAKA 3HWJA 3OBTA 4AVCA 3AMQA 2WS93 4TSVA 2OZJA 2R072 2R0FA 3CJIC 5FPZA 5JI7A 5C33A 1R1A2 2BWAA 1OD5A 1IOAA 2KM2A 3QCWA 3WDTA 4LR4A 4C1XA 1KDKA 4Q2FA 1CX4A 1RUC3 4MLOA 3WP5A 3ZYPA 4COZA 2PAKA 2WNUB 3UJQA 3GZAA 3DF0A 1W6NB 5IK4A 3ACLA 4KU7A 5JWPA 1OSGA 3INAA 3I54A 1DGRN 4XE9A 5CU1A 1FMD3 3LB9A 4WM8B 1D2QA 2HWB2 2JE9A 4IEPA 1A6CA 3V65A 1QJY3 4Q4Y3 1XQNA 4E2QA 4FP3A 1HRV1 2PYTA 2ZGPA 3GHNA 1AL22 1CAUB 3M3QA 1LHWA 3MIGA 3LKJA 3S0MA 3A4UA 4COUA 2PLV3 4Q4V3 1KITA 1NCQC 2P3KA 2B42B 3VKFC 2ZACA 3ZXJA 1HXS3 2O1QA 3G6JB 4FBFA 3VZMA 3IIAA 1LRHA 5D8AB 2BW8A 1CESA 2XBO2 2DCZA 5FREA 2A70A 2NPIA 3THPA 2V5YA 4CDUC 4NO4A 2TBVA