3TS4A

Human mmp12 in complex with l-glutamate motif inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simple pseudo-dipeptides with a P2' glutamate: a novel inhibitor family of matrix metalloproteases and other metzincins.
pubmed doi rcsb
molecule keywords Macrophage metalloelastase
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ts4A00
4DD8A 4IUWA 4WKEA 1XFYA 2D1OA 4A3WA 3HDBA 1JIWP 2FV5A 3LJGA 5D1UA 1DMTA 4PKWA 1CIZA 1BKCA 4I03A 1ZXVA 4JPAA 3HB2P 4JIJA 4L6TA 1GO7P 1BM6A 1ZP5A 4XM7A 4IN9A 3F15A 1B3DA 1EB6A 2AYKA 4PKQA 3WV3A 4XM8A 3LIRA 4H49A 2USNA 1ZVXA 3HY9A 1Q3AA 3O2XA 2OW2A 2DDYA 2W14A 1IAGA 1EAKA 1Z3JA 1ZXCA 3VTGA 2X3AA 4PKUA 1YP1A 4H2EA 3UVCA 2EROA 1QUAA 1KUFA 1L6JA 3N2UA 3TS4A 1K7IA 3KMEA 2Y6CA 5I43A 2MZHA 2W15A 3WV1A 2OXWA 3BA0A 1IAEA 3KEJA 2OY4A 1C3IA 1QJJA 1SATA 2K2GA 1UEAA 1WNIA 3HBUP 4AUOA 5D2BA 2HU6A 1AYKA 1CGFA 1SU3A 3F16A 2JT5A 1HV5A 2YB9A 2DW2A 3F1AA 3ZVSA 3E8RA 2E2DA 3Q2HA 4WK7A 1GKDA 1G4KA 3DNGA 3ZUKA 4PKTA 1PWWA 1XFUA 1BIWA 1R1IA 5D1SA 1JIZA 2CKIA 1USNA 3EDHA 4Q1LA 3LE9A 3WV2A 1MNCA 2O36A 3LUNA 1CK7A 1Y8JA 1I76A 2WO8A 1I1IP 5BPAA 4WF6A 3TVCA 5L79A 5D3CA 2MLSA 1BKCI 1HFCA 3B8ZA 1ATLA 5I0LA 2ERQA 2PJTA 2ERPA 2D1NA 2YIGA 1D8MA 1XURA 3L0TA 3F18A 5BOTA 1SLNA 1QIBA 4EFSA 3KMCA 4GF1A 1MMRA 3LIKA 456CA 2DDFA 5CZMA 1B8YA 2OZRA 3AYUA 5D7WA 1GO8P 4QKZA 1O0TA 1D8FA 1J7NA 1OS9A 2FV9A 4GUYA 3EDIA 4WKIA 1G05A 4HX3A 1BSWA 1QICA 1R54A 2Y6DA 4GR3A 1PWQA 3KECA 3SHIA 1MMPA 3AIGA 2A8HA 3U1RA 1PWUA 2MLRA 2X3CA 3F17A 1JANA 1FLSA 3DPFA 1OM7A 1UMSA 3DL1A 2XS4A 2AIGP 2OY2A 3LMCA 3OHLA 2OI0A 1Y0VA 3TT4A 1QIAA 3LK8A 3CKIA 3I7IA 4G0DA 3K7LA 1ASTA 4JQGA 3B92A 3F19A 4DV8A 2RJPA 2JNPA 3EHXA 1BZSA 2JSDA 1C8TA 3LQ0A 4WZVA 830CA 4H1QA 3TSKA 1KUIA 1PWVA 1XFWA 2O3EA 1AKLA 3LILA 1KUKA 4FXQA 1EUBA 3VI1A 4AXQA 3P1VA 2POJA 2OXZA 1O0QA 4DPEA 4FU4A 3N2VA 4GR8A 1IAAA 3AYKA 1JH1A 4PKVA 4H3XA 4CTHA 3DPEA 3HDAP 4JP4A 4ON1A 4H76A 1GE7A 1BQQM 1BKCE 5I4OA 3ZXHA 4J4MA 1HFSA 2MZEA 3O64A 2V4BA 3MA2A 4H30A 4PKSA 3LJZA 1SRPA 2XS3A 5I12A 1CGLA 1YOUA 1BUVM 3EDGA 1GXDA 3G42A 3DSLA 1JAPA 5JMYA 1C7KA 3V96B 4XCTA 966CA 2OVZA 1DTHA 1CAQA 1YQYA 3LQBA 3USNA 1MMQA 1KUGA 1PWPA 1GE6A 1K7GA 1CGEA 4GQLA 1Y93A 2X3BA 3HYGA 1XUCA 1OMJA 5CUHA 3I7GA 3LEAA 1A85A 2RJQA 1FM1A 1H71P 3DWBA 3K7NA 3LUMA 4GWMA 5CXAA 1I73A 3OHOA 1D7XA 5B5PA 4GWNA 4AYKA 3NX7A 1JAOA 1SLMA 1BQOA 1R55A 3L0VA 1JJ9A 4A7BA 3HY7A 1XFVA 2DW1A 1RM8A 1G49A 1ZS0A 2W12A 1CQRA 2OW1A 4G9LA 1AF0A 2N8RA 5L7FA 1IADA 4FVLA 4L19A 1UTTA 4ILWD 1JKYA 4FXYP 2KRJA 1JAQA 1IABA 4JA1A 1XFZA 1XFXA 4I35A 4DF9A 1GKCA 1OM6A 3KRYA 1HY7A 2OVXA 1D5JA 2OW9A 1R1HA 2WO9A 3GBOA 3LGPA 4ZR5A 4PKRA 2W13A 2QPJA 3LJTA 2J0TA 1KBCA 3KEKA 1S4BP 1QJIA 2DW0A 3EDZA 2MZIA 4XBHA 4H84A 1G9KA 5I3MA 2WOAA 4XM6A 1UTZA 2OXUA 4HMAA 1ROSA 5I2ZA 2OW0A 2X7MA 4AIGA 2J83A 3EHYA 5D1TA 1MMBA 1YCMA 1ND1A 2JT6A 1OS2A 1ZTQA 4L63A 1UMTA 1SMPA 1A86A 1RMZA 3LKAA 3ELMA 1XUDA 1FBLA 5LABA 3B2ZA 5BOYA 1JK3A 1OM8A 1GE5A 1R1JA 1KUHA 3Q2GA 4H82A 3G5CA 1HOVA 3RTTA 2JIHA 1HTDA 1K7QA 2W0DA 1G12A 2L0RA 4IJOA 1OO9A 3KHIA 3KWVC 1BUDA 2Z2DA 1CXVA 3HBVP 4GR0A 5H8XA 2E3XA 3RTSA 3P24A 2SRTA 5B5OA 4R3VA 2I47A 1IACA 2K9CA 3EWJA 1KAPP 2CLTA 2TCLA
chains in the Genus database with same CATH superfamily
4DD8A 4IUWA 4WKEA 1XFYA 2D1OA 4A3WA 3HDBA 1JIWP 2FV5A 3LJGA 5D1UA 1DMTA 4PKWA 2YUFA 1CIZA 1BKCA 4I03A 1ZXVA 4JPAA 3HB2P 4JIJA 4L6TA 1GO7P 1BM6A 1ZP5A 4XM7A 4IN9A 3F15A 1B3DA 1EB6A 2AYKA 4PKQA 3WV3A 4XM8A 3LIRA 4H49A 2USNA 1ZVXA 3HY9A 1Q3AA 3O2XA 2OW2A 2DDYA 2W14A 1IAGA 1EAKA 1Z3JA 1ZXCA 3VTGA 2X3AA 4PKUA 1YP1A 4H2EA 3UVCA 2EROA 1QUAA 1KUFA 1L6JA 3N2UA 3TS4A 1K7IA 3KMEA 2Y6CA 5I43A 2MZHA 2W15A 3WV1A 2OXWA 3BA0A 1IAEA 3KEJA 4L7AA 2OY4A 1C3IA 1QJJA 1SATA 2K2GA 1UEAA 1WNIA 3HBUP 4AUOA 5D2BA 2HU6A 1AYKA 1CGFA 1SU3A 3F16A 2JT5A 1HV5A 2YB9A 2DW2A 3F1AA 3ZVSA 3E8RA 2E2DA 3Q2HA 4WK7A 1GKDA 1G4KA 3DNGA 3ZUKA 4PKTA 1PWWA 1XFUA 1BIWA 1R1IA 5D1SA 1JIZA 2CKIA 1USNA 3EDHA 4Q1LA 3LE9A 3WV2A 1MNCA 2O36A 3LUNA 1CK7A 1Y8JA 1I76A 2WO8A 1I1IP 5BPAA 4WF6A 3TVCA 1XM5A 5L79A 5D3CA 2MLSA 1BKCI 1HFCA 3B8ZA 1ATLA 5I0LA 2ERQA 2PJTA 2ERPA 2D1NA 2YIGA 1D8MA 1XURA 3L0TA 3F18A 5BOTA 1SLNA 1QIBA 4EFSA 3KMCA 4GF1A 1MMRA 3LIKA 456CA 2DDFA 3DTIA 5CZMA 1B8YA 2OZRA 3AYUA 1OZ9A 5D7WA 1GO8P 4QKZA 1O0TA 1D8FA 1J7NA 1OS9A 2FV9A 3DTKA 4GUYA 3EDIA 4WKIA 1G05A 4HX3A 1BSWA 1QICA 1R54A 2Y6DA 4GR3A 1PWQA 3KECA 3SHIA 1MMPA 3AIGA 2A8HA 3U1RA 1PWUA 2MLRA 2X3CA 3F17A 1JANA 1FLSA 3DPFA 1OM7A 1UMSA 3DL1A 2XS4A 2AIGP 2OY2A 3LMCA 3OHLA 2OI0A 1Y0VA 3TT4A 1QIAA 3LK8A 3CKIA 3I7IA 4G0DA 3K7LA 1ASTA 4JQGA 3B92A 3F19A 4DV8A 2RJPA 2JNPA 3EHXA 1BZSA 2JSDA 1C8TA 3LQ0A 4WZVA 830CA 4H1QA 3TSKA 1KUIA 1PWVA 1XFWA 2O3EA 1AKLA 3LILA 1KUKA 4FXQA 1EUBA 3VI1A 4AXQA 3P1VA 2POJA 2OXZA 1O0QA 4DPEA 4FU4A 3N2VA 4GR8A 1IAAA 3DTEA 3AYKA 1JH1A 4PKVA 4H3XA 4CTHA 3DPEA 3HDAP 4JP4A 4ON1A 4H76A 1GE7A 1BQQM 1BKCE 5I4OA 3ZXHA 4J4MA 1HFSA 2MZEA 3O64A 2V4BA 3MA2A 4H30A 4PKSA 3LJZA 1SRPA 2XS3A 5I12A 1CGLA 1YOUA 1BUVM 3EDGA 1GXDA 3G42A 3DSLA 1JAPA 5JMYA 1C7KA 3V96B 4XCTA 966CA 2OVZA 1DTHA 1CAQA 1YQYA 3LQBA 3USNA 1MMQA 1KUGA 1PWPA 1GE6A 1K7GA 1CGEA 1TVIA 4GQLA 1XAXA 1Y93A 2X3BA 3HYGA 1XUCA 1OMJA 5CUHA 3I7GA 3LEAA 1A85A 2RJQA 1FM1A 1H71P 3DWBA 3K7NA 3LUMA 4GWMA 5CXAA 1I73A 3OHOA 1D7XA 5B5PA 4GWNA 4AYKA 3NX7A 1JAOA 1SLMA 1BQOA 1R55A 3L0VA 1JJ9A 4A7BA 3HY7A 1XFVA 2DW1A 1RM8A 1G49A 1ZS0A 2W12A 1CQRA 2OW1A 4G9LA 1AF0A 2N8RA 5L7FA 1IADA 4FVLA 4L19A 1UTTA 4ILWD 1JKYA 4FXYP 2KRJA 1JAQA 1IABA 4JA1A 1XFZA 1XFXA 4I35A 4DF9A 1GKCA 1OM6A 3KRYA 1HY7A 2OVXA 1D5JA 2OW9A 1R1HA 2WO9A 3GBOA 3LGPA 4ZR5A 4PKRA 2W13A 2QPJA 3LJTA 2J0TA 1KBCA 3KEKA 1S4BP 1QJIA 2DW0A 3EDZA 2MZIA 4XBHA 4H84A 1G9KA 5I3MA 2WOAA 4XM6A 1UTZA 2OXUA 4HMAA 1ROSA 5I2ZA 2OW0A 2X7MA 4AIGA 2J83A 3EHYA 5D1TA 1MMBA 1YCMA 1ND1A 2JT6A 1OS2A 1ZTQA 4L63A 1UMTA 1SMPA 1A86A 1RMZA 3LKAA 3ELMA 1XUDA 1FBLA 5LABA 3B2ZA 5BOYA 1JK3A 1OM8A 1GE5A 1R1JA 1KUHA 3Q2GA 4H82A 3G5CA 1HOVA 3RTTA 2JIHA 1HTDA 1K7QA 2W0DA 1G12A 2L0RA 4IJOA 1OO9A 3KHIA 3KWVC 1BUDA 2Z2DA 1CXVA 3HBVP 4GR0A 5H8XA 2E3XA 3RTSA 3P24A 2SRTA 5B5OA 4R3VA 2I47A 1IACA 2K9CA 3EWJA 1KAPP 2CLTA 2TCLA
chains in the Genus database with same CATH topology
4DD8A 4IUWA 4WKEA 1XFYA 2D1OA 4A3WA 3HDBA 1JIWP 2FV5A 3LJGA 5D1UA 1DMTA 4PKWA 2YUFA 1CIZA 1BKCA 4I03A 1ZXVA 4JPAA 3HB2P 4JIJA 4L6TA 1GO7P 1BM6A 1ZP5A 4XM7A 4IN9A 3F15A 1B3DA 1EB6A 2AYKA 4PKQA 3WV3A 4XM8A 3LIRA 4H49A 2USNA 1ZVXA 3HY9A 1Q3AA 3O2XA 2OW2A 2DDYA 2W14A 1IAGA 1EAKA 1Z3JA 1ZXCA 3VTGA 2X3AA 4PKUA 1YP1A 4H2EA 3UVCA 2EROA 1QUAA 1KUFA 1L6JA 3N2UA 3TS4A 1K7IA 3KMEA 2Y6CA 5I43A 2MZHA 2W15A 3WV1A 2OXWA 3BA0A 1IAEA 3KEJA 4L7AA 2OY4A 1C3IA 1QJJA 1SATA 2K2GA 1UEAA 1WNIA 3HBUP 4AUOA 5D2BA 2HU6A 1AYKA 1CGFA 1SU3A 3F16A 2JT5A 1HV5A 2YB9A 2DW2A 3F1AA 3ZVSA 3E8RA 2E2DA 3Q2HA 4WK7A 1GKDA 1G4KA 3DNGA 3ZUKA 4PKTA 1PWWA 1XFUA 1BIWA 1R1IA 5D1SA 1JIZA 2CKIA 1USNA 3EDHA 4Q1LA 3LE9A 3WV2A 1MNCA 2O36A 3LUNA 1CK7A 1Y8JA 1I76A 2WO8A 1I1IP 5BPAA 4WF6A 3TVCA 5L79A 5D3CA 2MLSA 1BKCI 1HFCA 3B8ZA 1ATLA 5I0LA 2ERQA 2PJTA 2ERPA 2D1NA 2YIGA 1D8MA 1XURA 3L0TA 3F18A 5BOTA 1SLNA 1QIBA 4EFSA 3KMCA 4GF1A 1MMRA 3LIKA 456CA 2DDFA 3DTIA 5CZMA 1B8YA 2OZRA 3AYUA 5D7WA 1GO8P 4QKZA 1O0TA 1D8FA 1J7NA 1OS9A 2FV9A 3DTKA 4GUYA 3EDIA 4WKIA 1G05A 4HX3A 1BSWA 1QICA 1R54A 2Y6DA 4GR3A 1PWQA 3KECA 3SHIA 1MMPA 3AIGA 2A8HA 3U1RA 1PWUA 2MLRA 2X3CA 3F17A 1JANA 1FLSA 3DPFA 1OM7A 1UMSA 3DL1A 2XS4A 2AIGP 2OY2A 3LMCA 3OHLA 2OI0A 1Y0VA 3TT4A 1QIAA 3LK8A 3CKIA 3I7IA 4G0DA 3K7LA 1ASTA 4JQGA 3B92A 3F19A 4DV8A 2RJPA 2JNPA 3EHXA 1BZSA 2JSDA 1C8TA 3LQ0A 4WZVA 830CA 4H1QA 3TSKA 1KUIA 1PWVA 1XFWA 2O3EA 1AKLA 3LILA 1KUKA 4FXQA 1EUBA 3VI1A 4AXQA 3P1VA 2POJA 2OXZA 1O0QA 4DPEA 4FU4A 3N2VA 4GR8A 1IAAA 3DTEA 3AYKA 1JH1A 4PKVA 4H3XA 4CTHA 3DPEA 3HDAP 4JP4A 4ON1A 4H76A 1GE7A 1BQQM 1BKCE 5I4OA 3ZXHA 4J4MA 1HFSA 2MZEA 3O64A 2V4BA 3MA2A 4H30A 4PKSA 3LJZA 1SRPA 2XS3A 5I12A 1CGLA 1YOUA 1BUVM 3EDGA 1GXDA 3G42A 3DSLA 1JAPA 5JMYA 1C7KA 3V96B 4XCTA 966CA 2OVZA 1DTHA 1CAQA 1YQYA 3LQBA 3USNA 1MMQA 1KUGA 1PWPA 1GE6A 1K7GA 1CGEA 4GQLA 1Y93A 2X3BA 3HYGA 1XUCA 1OMJA 5CUHA 3I7GA 3LEAA 1A85A 2RJQA 1FM1A 1H71P 3DWBA 3K7NA 3LUMA 4GWMA 5CXAA 1I73A 3OHOA 1D7XA 5B5PA 4GWNA 4AYKA 3NX7A 1JAOA 1SLMA 1BQOA 1R55A 3L0VA 1JJ9A 4A7BA 3HY7A 1XFVA 2DW1A 1RM8A 1G49A 1ZS0A 2W12A 1CQRA 2OW1A 4G9LA 1AF0A 2N8RA 5L7FA 1IADA 4FVLA 4L19A 1UTTA 4ILWD 1JKYA 4FXYP 2KRJA 1JAQA 1IABA 4JA1A 1XFZA 1XFXA 4I35A 4DF9A 1GKCA 1OM6A 3KRYA 1HY7A 2OVXA 1D5JA 2OW9A 1R1HA 2WO9A 3GBOA 3LGPA 4ZR5A 4PKRA 2W13A 2QPJA 3LJTA 2J0TA 1KBCA 3KEKA 1S4BP 1QJIA 2DW0A 3EDZA 2MZIA 4XBHA 4H84A 1G9KA 5I3MA 2WOAA 4XM6A 1UTZA 2OXUA 4HMAA 1ROSA 5I2ZA 2OW0A 2X7MA 4AIGA 2J83A 3EHYA 5D1TA 1MMBA 1YCMA 1ND1A 2JT6A 1OS2A 1ZTQA 4L63A 1UMTA 1SMPA 1A86A 1RMZA 3LKAA 3ELMA 1XUDA 1FBLA 5LABA 3B2ZA 5BOYA 1JK3A 1OM8A 1GE5A 1R1JA 1KUHA 3Q2GA 4H82A 3G5CA 1HOVA 3RTTA 2JIHA 1HTDA 1K7QA 2W0DA 1G12A 2L0RA 4IJOA 1OO9A 3KHIA 3KWVC 1BUDA 2Z2DA 1CXVA 3HBVP 4GR0A 5H8XA 2E3XA 3RTSA 3P24A 2SRTA 5B5OA 4R3VA 2I47A 1IACA 2K9CA 3EWJA 1KAPP 2CLTA 2TCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DD8 A;  4IUW A;  4WKE A;  1XFY A;  2D1O A;  4A3W A;  3HDB A;  1JIW P;  2FV5 A;  3LJG A;  5D1U A;  1DMT A;  4PKW A;  1CIZ A;  1BKC A;  4I03 A;  1ZXV A;  4JPA A;  3HB2 P;  4JIJ A;  4L6T A;  1GO7 P;  1BM6 A;  1ZP5 A;  4XM7 A;  4IN9 A;  3F15 A;  1B3D A;  1EB6 A;  2AYK A;  4PKQ A;  3WV3 A;  4XM8 A;  3LIR A;  4H49 A;  2USN A;  1ZVX A;  3HY9 A;  1Q3A A;  3O2X A;  2OW2 A;  2DDY A;  2W14 A;  1IAG A;  1EAK A;  1Z3J A;  1ZXC A;  3VTG A;  2X3A A;  4PKU A;  1YP1 A;  4H2E A;  3UVC A;  2ERO A;  1QUA A;  1KUF A;  1L6J A;  3N2U A;  3TS4 A;  1K7I A;  3KME A;  2Y6C A;  5I43 A;  2MZH A;  2W15 A;  3WV1 A;  2OXW A;  3BA0 A;  1IAE A;  3KEJ A;  2OY4 A;  1C3I A;  1QJJ A;  1SAT A;  2K2G A;  1UEA A;  1WNI A;  3HBU P;  4AUO A;  5D2B A;  2HU6 A;  1AYK A;  1CGF A;  1SU3 A;  3F16 A;  2JT5 A;  1HV5 A;  2YB9 A;  2DW2 A;  3F1A A;  3ZVS A;  3E8R A;  2E2D A;  3Q2H A;  4WK7 A;  1GKD A;  1G4K A;  3DNG A;  3ZUK A;  4PKT A;  1PWW A;  1XFU A;  1BIW A;  1R1I A;  5D1S A;  1JIZ A;  2CKI A;  1USN A;  3EDH A;  4Q1L A;  3LE9 A;  3WV2 A;  1MNC A;  2O36 A;  3LUN A;  1CK7 A;  1Y8J A;  1I76 A;  2WO8 A;  1I1I P;  5BPA A;  4WF6 A;  3TVC A;  5L79 A;  5D3C A;  2MLS A;  1BKC I;  1HFC A;  3B8Z A;  1ATL A;  5I0L A;  2ERQ A;  2PJT A;  2ERP A;  2D1N A;  2YIG A;  1D8M A;  1XUR A;  3L0T A;  3F18 A;  5BOT A;  1SLN A;  1QIB A;  4EFS A;  3KMC A;  4GF1 A;  1MMR A;  3LIK A;  456C A;  2DDF A;  5CZM A;  1B8Y A;  2OZR A;  3AYU A;  5D7W A;  1GO8 P;  4QKZ A;  1O0T A;  1D8F A;  1J7N A;  1OS9 A;  2FV9 A;  4GUY A;  3EDI A;  4WKI A;  1G05 A;  4HX3 A;  1BSW A;  1QIC A;  1R54 A;  2Y6D A;  4GR3 A;  1PWQ A;  3KEC A;  3SHI A;  1MMP A;  3AIG A;  2A8H A;  3U1R A;  1PWU A;  2MLR A;  2X3C A;  3F17 A;  1JAN A;  1FLS A;  3DPF A;  1OM7 A;  1UMS A;  3DL1 A;  2XS4 A;  2AIG P;  2OY2 A;  3LMC A;  3OHL A;  2OI0 A;  1Y0V A;  3TT4 A;  1QIA A;  3LK8 A;  3CKI A;  3I7I A;  4G0D A;  3K7L A;  1AST A;  4JQG A;  3B92 A;  3F19 A;  4DV8 A;  2RJP A;  2JNP A;  3EHX A;  1BZS A;  2JSD A;  1C8T A;  3LQ0 A;  4WZV A;  830C A;  4H1Q A;  3TSK A;  1KUI A;  1PWV A;  1XFW A;  2O3E A;  1AKL A;  3LIL A;  1KUK A;  4FXQ A;  1EUB A;  3VI1 A;  4AXQ A;  3P1V A;  2POJ A;  2OXZ A;  1O0Q A;  4DPE A;  4FU4 A;  3N2V A;  4GR8 A;  1IAA A;  3AYK A;  1JH1 A;  4PKV A;  4H3X A;  4CTH A;  3DPE A;  3HDA P;  4JP4 A;  4ON1 A;  4H76 A;  1GE7 A;  1BQQ M;  1BKC E;  5I4O A;  3ZXH A;  4J4M A;  1HFS A;  2MZE A;  3O64 A;  2V4B A;  3MA2 A;  4H30 A;  4PKS A;  3LJZ A;  1SRP A;  2XS3 A;  5I12 A;  1CGL A;  1YOU A;  1BUV M;  3EDG A;  1GXD A;  3G42 A;  3DSL A;  1JAP A;  5JMY A;  1C7K A;  3V96 B;  4XCT A;  966C A;  2OVZ A;  1DTH A;  1CAQ A;  1YQY A;  3LQB A;  3USN A;  1MMQ A;  1KUG A;  1PWP A;  1GE6 A;  1K7G A;  1CGE A;  4GQL A;  1Y93 A;  2X3B A;  3HYG A;  1XUC A;  1OMJ A;  5CUH A;  3I7G A;  3LEA A;  1A85 A;  2RJQ A;  1FM1 A;  1H71 P;  3DWB A;  3K7N A;  3LUM A;  4GWM A;  5CXA A;  1I73 A;  3OHO A;  1D7X A;  5B5P A;  4GWN A;  4AYK A;  3NX7 A;  1JAO A;  1SLM A;  1BQO A;  1R55 A;  3L0V A;  1JJ9 A;  4A7B A;  3HY7 A;  1XFV A;  2DW1 A;  1RM8 A;  1G49 A;  1ZS0 A;  2W12 A;  1CQR A;  2OW1 A;  4G9L A;  1AF0 A;  2N8R A;  5L7F A;  1IAD A;  4FVL A;  4L19 A;  1UTT A;  4ILW D;  1JKY A;  4FXY P;  2KRJ A;  1JAQ A;  1IAB A;  4JA1 A;  1XFZ A;  1XFX A;  4I35 A;  4DF9 A;  1GKC A;  1OM6 A;  3KRY A;  1HY7 A;  2OVX A;  1D5J A;  2OW9 A;  1R1H A;  2WO9 A;  3GBO A;  3LGP A;  4ZR5 A;  4PKR A;  2W13 A;  2QPJ A;  3LJT A;  2J0T A;  1KBC A;  3KEK A;  1S4B P;  1QJI A;  2DW0 A;  3EDZ A;  2MZI A;  4XBH A;  4H84 A;  1G9K A;  5I3M A;  2WOA A;  4XM6 A;  1UTZ A;  2OXU A;  4HMA A;  1ROS A;  5I2Z A;  2OW0 A;  2X7M A;  4AIG A;  2J83 A;  3EHY A;  5D1T A;  1MMB A;  1YCM A;  1ND1 A;  2JT6 A;  1OS2 A;  1ZTQ A;  4L63 A;  1UMT A;  1SMP A;  1A86 A;  1RMZ A;  3LKA A;  3ELM A;  1XUD A;  1FBL A;  5LAB A;  3B2Z A;  5BOY A;  1JK3 A;  1OM8 A;  1GE5 A;  1R1J A;  1KUH A;  3Q2G A;  4H82 A;  3G5C A;  1HOV A;  3RTT A;  2JIH A;  1HTD A;  1K7Q A;  2W0D A;  1G12 A;  2L0R A;  4IJO A;  1OO9 A;  3KHI A;  3KWV C;  1BUD A;  2Z2D A;  1CXV A;  3HBV P;  4GR0 A;  5H8X A;  2E3X A;  3RTS A;  3P24 A;  2SRT A;  5B5O A;  4R3V A;  2I47 A;  1IAC A;  2K9C A;  3EWJ A;  1KAP P;  2CLT A;  2TCL A; 
#chains in the Genus database with same CATH topology
 4DD8 A;  4IUW A;  4WKE A;  1XFY A;  2D1O A;  4A3W A;  3HDB A;  1JIW P;  2FV5 A;  3LJG A;  5D1U A;  1DMT A;  4PKW A;  2YUF A;  1CIZ A;  1BKC A;  4I03 A;  1ZXV A;  4JPA A;  3HB2 P;  4JIJ A;  4L6T A;  1GO7 P;  1BM6 A;  1ZP5 A;  4XM7 A;  4IN9 A;  3F15 A;  1B3D A;  1EB6 A;  2AYK A;  4PKQ A;  3WV3 A;  4XM8 A;  3LIR A;  4H49 A;  2USN A;  1ZVX A;  3HY9 A;  1Q3A A;  3O2X A;  2OW2 A;  2DDY A;  2W14 A;  1IAG A;  1EAK A;  1Z3J A;  1ZXC A;  3VTG A;  2X3A A;  4PKU A;  1YP1 A;  4H2E A;  3UVC A;  2ERO A;  1QUA A;  1KUF A;  1L6J A;  3N2U A;  3TS4 A;  1K7I A;  3KME A;  2Y6C A;  5I43 A;  2MZH A;  2W15 A;  3WV1 A;  2OXW A;  3BA0 A;  1IAE A;  3KEJ A;  4L7A A;  2OY4 A;  1C3I A;  1QJJ A;  1SAT A;  2K2G A;  1UEA A;  1WNI A;  3HBU P;  4AUO A;  5D2B A;  2HU6 A;  1AYK A;  1CGF A;  1SU3 A;  3F16 A;  2JT5 A;  1HV5 A;  2YB9 A;  2DW2 A;  3F1A A;  3ZVS A;  3E8R A;  2E2D A;  3Q2H A;  4WK7 A;  1GKD A;  1G4K A;  3DNG A;  3ZUK A;  4PKT A;  1PWW A;  1XFU A;  1BIW A;  1R1I A;  5D1S A;  1JIZ A;  2CKI A;  1USN A;  3EDH A;  4Q1L A;  3LE9 A;  3WV2 A;  1MNC A;  2O36 A;  3LUN A;  1CK7 A;  1Y8J A;  1I76 A;  2WO8 A;  1I1I P;  5BPA A;  4WF6 A;  3TVC A;  1XM5 A;  5L79 A;  5D3C A;  2MLS A;  1BKC I;  1HFC A;  3B8Z A;  1ATL A;  5I0L A;  2ERQ A;  2PJT A;  2ERP A;  2D1N A;  2YIG A;  1D8M A;  1XUR A;  3L0T A;  3F18 A;  5BOT A;  1SLN A;  1QIB A;  4EFS A;  3KMC A;  4GF1 A;  1MMR A;  3LIK A;  456C A;  2DDF A;  3DTI A;  5CZM A;  1B8Y A;  2OZR A;  3AYU A;  1OZ9 A;  5D7W A;  1GO8 P;  4QKZ A;  1O0T A;  1D8F A;  1J7N A;  1OS9 A;  2FV9 A;  3DTK A;  4GUY A;  3EDI A;  4WKI A;  1G05 A;  4HX3 A;  1BSW A;  1QIC A;  1R54 A;  2Y6D A;  4GR3 A;  1PWQ A;  3KEC A;  3SHI A;  1MMP A;  3AIG A;  2A8H A;  3U1R A;  1PWU A;  2MLR A;  2X3C A;  3F17 A;  1JAN A;  1FLS A;  3DPF A;  1OM7 A;  1UMS A;  3DL1 A;  2XS4 A;  2AIG P;  2OY2 A;  3LMC A;  3OHL A;  2OI0 A;  1Y0V A;  3TT4 A;  1QIA A;  3LK8 A;  3CKI A;  3I7I A;  4G0D A;  3K7L A;  1AST A;  4JQG A;  3B92 A;  3F19 A;  4DV8 A;  2RJP A;  2JNP A;  3EHX A;  1BZS A;  2JSD A;  1C8T A;  3LQ0 A;  4WZV A;  830C A;  4H1Q A;  3TSK A;  1KUI A;  1PWV A;  1XFW A;  2O3E A;  1AKL A;  3LIL A;  1KUK A;  4FXQ A;  1EUB A;  3VI1 A;  4AXQ A;  3P1V A;  2POJ A;  2OXZ A;  1O0Q A;  4DPE A;  4FU4 A;  3N2V A;  4GR8 A;  1IAA A;  3DTE A;  3AYK A;  1JH1 A;  4PKV A;  4H3X A;  4CTH A;  3DPE A;  3HDA P;  4JP4 A;  4ON1 A;  4H76 A;  1GE7 A;  1BQQ M;  1BKC E;  5I4O A;  3ZXH A;  4J4M A;  1HFS A;  2MZE A;  3O64 A;  2V4B A;  3MA2 A;  4H30 A;  4PKS A;  3LJZ A;  1SRP A;  2XS3 A;  5I12 A;  1CGL A;  1YOU A;  1BUV M;  3EDG A;  1GXD A;  3G42 A;  3DSL A;  1JAP A;  5JMY A;  1C7K A;  3V96 B;  4XCT A;  966C A;  2OVZ A;  1DTH A;  1CAQ A;  1YQY A;  3LQB A;  3USN A;  1MMQ A;  1KUG A;  1PWP A;  1GE6 A;  1K7G A;  1CGE A;  1TVI A;  4GQL A;  1XAX A;  1Y93 A;  2X3B A;  3HYG A;  1XUC A;  1OMJ A;  5CUH A;  3I7G A;  3LEA A;  1A85 A;  2RJQ A;  1FM1 A;  1H71 P;  3DWB A;  3K7N A;  3LUM A;  4GWM A;  5CXA A;  1I73 A;  3OHO A;  1D7X A;  5B5P A;  4GWN A;  4AYK A;  3NX7 A;  1JAO A;  1SLM A;  1BQO A;  1R55 A;  3L0V A;  1JJ9 A;  4A7B A;  3HY7 A;  1XFV A;  2DW1 A;  1RM8 A;  1G49 A;  1ZS0 A;  2W12 A;  1CQR A;  2OW1 A;  4G9L A;  1AF0 A;  2N8R A;  5L7F A;  1IAD A;  4FVL A;  4L19 A;  1UTT A;  4ILW D;  1JKY A;  4FXY P;  2KRJ A;  1JAQ A;  1IAB A;  4JA1 A;  1XFZ A;  1XFX A;  4I35 A;  4DF9 A;  1GKC A;  1OM6 A;  3KRY A;  1HY7 A;  2OVX A;  1D5J A;  2OW9 A;  1R1H A;  2WO9 A;  3GBO A;  3LGP A;  4ZR5 A;  4PKR A;  2W13 A;  2QPJ A;  3LJT A;  2J0T A;  1KBC A;  3KEK A;  1S4B P;  1QJI A;  2DW0 A;  3EDZ A;  2MZI A;  4XBH A;  4H84 A;  1G9K A;  5I3M A;  2WOA A;  4XM6 A;  1UTZ A;  2OXU A;  4HMA A;  1ROS A;  5I2Z A;  2OW0 A;  2X7M A;  4AIG A;  2J83 A;  3EHY A;  5D1T A;  1MMB A;  1YCM A;  1ND1 A;  2JT6 A;  1OS2 A;  1ZTQ A;  4L63 A;  1UMT A;  1SMP A;  1A86 A;  1RMZ A;  3LKA A;  3ELM A;  1XUD A;  1FBL A;  5LAB A;  3B2Z A;  5BOY A;  1JK3 A;  1OM8 A;  1GE5 A;  1R1J A;  1KUH A;  3Q2G A;  4H82 A;  3G5C A;  1HOV A;  3RTT A;  2JIH A;  1HTD A;  1K7Q A;  2W0D A;  1G12 A;  2L0R A;  4IJO A;  1OO9 A;  3KHI A;  3KWV C;  1BUD A;  2Z2D A;  1CXV A;  3HBV P;  4GR0 A;  5H8X A;  2E3X A;  3RTS A;  3P24 A;  2SRT A;  5B5O A;  4R3V A;  2I47 A;  1IAC A;  2K9C A;  3EWJ A;  1KAP P;  2CLT A;  2TCL A; 
#chains in the Genus database with same CATH homology
 4DD8 A;  4IUW A;  4WKE A;  1XFY A;  2D1O A;  4A3W A;  3HDB A;  1JIW P;  2FV5 A;  3LJG A;  5D1U A;  1DMT A;  4PKW A;  2YUF A;  1CIZ A;  1BKC A;  4I03 A;  1ZXV A;  4JPA A;  3HB2 P;  4JIJ A;  4L6T A;  1GO7 P;  1BM6 A;  1ZP5 A;  4XM7 A;  4IN9 A;  3F15 A;  1B3D A;  1EB6 A;  2AYK A;  4PKQ A;  3WV3 A;  4XM8 A;  3LIR A;  4H49 A;  2USN A;  1ZVX A;  3HY9 A;  1Q3A A;  3O2X A;  2OW2 A;  2DDY A;  2W14 A;  1IAG A;  1EAK A;  1Z3J A;  1ZXC A;  3VTG A;  2X3A A;  4PKU A;  1YP1 A;  4H2E A;  3UVC A;  2ERO A;  1QUA A;  1KUF A;  1L6J A;  3N2U A;  3TS4 A;  1K7I A;  3KME A;  2Y6C A;  5I43 A;  2MZH A;  2W15 A;  3WV1 A;  2OXW A;  3BA0 A;  1IAE A;  3KEJ A;  4L7A A;  2OY4 A;  1C3I A;  1QJJ A;  1SAT A;  2K2G A;  1UEA A;  1WNI A;  3HBU P;  4AUO A;  5D2B A;  2HU6 A;  1AYK A;  1CGF A;  1SU3 A;  3F16 A;  2JT5 A;  1HV5 A;  2YB9 A;  2DW2 A;  3F1A A;  3ZVS A;  3E8R A;  2E2D A;  3Q2H A;  4WK7 A;  1GKD A;  1G4K A;  3DNG A;  3ZUK A;  4PKT A;  1PWW A;  1XFU A;  1BIW A;  1R1I A;  5D1S A;  1JIZ A;  2CKI A;  1USN A;  3EDH A;  4Q1L A;  3LE9 A;  3WV2 A;  1MNC A;  2O36 A;  3LUN A;  1CK7 A;  1Y8J A;  1I76 A;  2WO8 A;  1I1I P;  5BPA A;  4WF6 A;  3TVC A;  5L79 A;  5D3C A;  2MLS A;  1BKC I;  1HFC A;  3B8Z A;  1ATL A;  5I0L A;  2ERQ A;  2PJT A;  2ERP A;  2D1N A;  2YIG A;  1D8M A;  1XUR A;  3L0T A;  3F18 A;  5BOT A;  1SLN A;  1QIB A;  4EFS A;  3KMC A;  4GF1 A;  1MMR A;  3LIK A;  456C A;  2DDF A;  3DTI A;  5CZM A;  1B8Y A;  2OZR A;  3AYU A;  5D7W A;  1GO8 P;  4QKZ A;  1O0T A;  1D8F A;  1J7N A;  1OS9 A;  2FV9 A;  3DTK A;  4GUY A;  3EDI A;  4WKI A;  1G05 A;  4HX3 A;  1BSW A;  1QIC A;  1R54 A;  2Y6D A;  4GR3 A;  1PWQ A;  3KEC A;  3SHI A;  1MMP A;  3AIG A;  2A8H A;  3U1R A;  1PWU A;  2MLR A;  2X3C A;  3F17 A;  1JAN A;  1FLS A;  3DPF A;  1OM7 A;  1UMS A;  3DL1 A;  2XS4 A;  2AIG P;  2OY2 A;  3LMC A;  3OHL A;  2OI0 A;  1Y0V A;  3TT4 A;  1QIA A;  3LK8 A;  3CKI A;  3I7I A;  4G0D A;  3K7L A;  1AST A;  4JQG A;  3B92 A;  3F19 A;  4DV8 A;  2RJP A;  2JNP A;  3EHX A;  1BZS A;  2JSD A;  1C8T A;  3LQ0 A;  4WZV A;  830C A;  4H1Q A;  3TSK A;  1KUI A;  1PWV A;  1XFW A;  2O3E A;  1AKL A;  3LIL A;  1KUK A;  4FXQ A;  1EUB A;  3VI1 A;  4AXQ A;  3P1V A;  2POJ A;  2OXZ A;  1O0Q A;  4DPE A;  4FU4 A;  3N2V A;  4GR8 A;  1IAA A;  3DTE A;  3AYK A;  1JH1 A;  4PKV A;  4H3X A;  4CTH A;  3DPE A;  3HDA P;  4JP4 A;  4ON1 A;  4H76 A;  1GE7 A;  1BQQ M;  1BKC E;  5I4O A;  3ZXH A;  4J4M A;  1HFS A;  2MZE A;  3O64 A;  2V4B A;  3MA2 A;  4H30 A;  4PKS A;  3LJZ A;  1SRP A;  2XS3 A;  5I12 A;  1CGL A;  1YOU A;  1BUV M;  3EDG A;  1GXD A;  3G42 A;  3DSL A;  1JAP A;  5JMY A;  1C7K A;  3V96 B;  4XCT A;  966C A;  2OVZ A;  1DTH A;  1CAQ A;  1YQY A;  3LQB A;  3USN A;  1MMQ A;  1KUG A;  1PWP A;  1GE6 A;  1K7G A;  1CGE A;  4GQL A;  1Y93 A;  2X3B A;  3HYG A;  1XUC A;  1OMJ A;  5CUH A;  3I7G A;  3LEA A;  1A85 A;  2RJQ A;  1FM1 A;  1H71 P;  3DWB A;  3K7N A;  3LUM A;  4GWM A;  5CXA A;  1I73 A;  3OHO A;  1D7X A;  5B5P A;  4GWN A;  4AYK A;  3NX7 A;  1JAO A;  1SLM A;  1BQO A;  1R55 A;  3L0V A;  1JJ9 A;  4A7B A;  3HY7 A;  1XFV A;  2DW1 A;  1RM8 A;  1G49 A;  1ZS0 A;  2W12 A;  1CQR A;  2OW1 A;  4G9L A;  1AF0 A;  2N8R A;  5L7F A;  1IAD A;  4FVL A;  4L19 A;  1UTT A;  4ILW D;  1JKY A;  4FXY P;  2KRJ A;  1JAQ A;  1IAB A;  4JA1 A;  1XFZ A;  1XFX A;  4I35 A;  4DF9 A;  1GKC A;  1OM6 A;  3KRY A;  1HY7 A;  2OVX A;  1D5J A;  2OW9 A;  1R1H A;  2WO9 A;  3GBO A;  3LGP A;  4ZR5 A;  4PKR A;  2W13 A;  2QPJ A;  3LJT A;  2J0T A;  1KBC A;  3KEK A;  1S4B P;  1QJI A;  2DW0 A;  3EDZ A;  2MZI A;  4XBH A;  4H84 A;  1G9K A;  5I3M A;  2WOA A;  4XM6 A;  1UTZ A;  2OXU A;  4HMA A;  1ROS A;  5I2Z A;  2OW0 A;  2X7M A;  4AIG A;  2J83 A;  3EHY A;  5D1T A;  1MMB A;  1YCM A;  1ND1 A;  2JT6 A;  1OS2 A;  1ZTQ A;  4L63 A;  1UMT A;  1SMP A;  1A86 A;  1RMZ A;  3LKA A;  3ELM A;  1XUD A;  1FBL A;  5LAB A;  3B2Z A;  5BOY A;  1JK3 A;  1OM8 A;  1GE5 A;  1R1J A;  1KUH A;  3Q2G A;  4H82 A;  3G5C A;  1HOV A;  3RTT A;  2JIH A;  1HTD A;  1K7Q A;  2W0D A;  1G12 A;  2L0R A;  4IJO A;  1OO9 A;  3KHI A;  3KWV C;  1BUD A;  2Z2D A;  1CXV A;  3HBV P;  4GR0 A;  5H8X A;  2E3X A;  3RTS A;  3P24 A;  2SRT A;  5B5O A;  4R3V A;  2I47 A;  1IAC A;  2K9C A;  3EWJ A;  1KAP P;  2CLT A;  2TCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...