3TS9A

Crystal structure of the mda5 helicase insert domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
128
Chain Sequence
ENPFKEKLLEIMASIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNSLKLDETDEFLMNLFFDNKKMLKKLAENPKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MDA5 cooperatively forms dimers and ATP-sensitive filaments upon binding double-stranded RNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antiviral protein, hydrolase
molecule keywords Interferon-induced helicase C domain-containing protein 1
total genus 53
structure length 128
sequence length 132
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1320.30 Mainly Alpha Up-down Bundle phosphoenolpyruvate carboxylase, domain 3 phosphoenolpyruvate carboxylase, domain 3 3ts9A00
4A2QA 5F9HA 3TBKA 4A2PA 4I1SA 4ON9A 4A2WA 4A36A 2YKGA 4AY2A 4GL2A 5F9FA 4BPBA 5E3HA 3TS9A 3ZD6A 3ZD7A 5F98A
chains in the Genus database with same CATH superfamily
4A2QA 1WP9A 3TBKA 4A2PA 5F9HA 4I1SA 4ON9A 4A2WA 4A36A 2YKGA 4AY2A 4GL2A 5F9FA 4BPBA 5E3HA 3TS9A 3ZD6A 3ZD7A 5F98A
chains in the Genus database with same CATH topology
4A2QA 5F9HA 3TBKA 4A2PA 4I1SA 4ON9A 4A2WA 4A36A 2YKGA 4AY2A 4GL2A 5F9FA 4BPBA 5E3HA 3TS9A 3ZD6A 3ZD7A 5F98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2Q A;  5F9H A;  3TBK A;  4A2P A;  4I1S A;  4ON9 A;  4A2W A;  4A36 A;  2YKG A;  4AY2 A;  4GL2 A;  5F9F A;  4BPB A;  5E3H A;  3TS9 A;  3ZD6 A;  3ZD7 A;  5F98 A; 
#chains in the Genus database with same CATH topology
 4A2Q A;  1WP9 A;  3TBK A;  4A2P A;  5F9H A;  4I1S A;  4ON9 A;  4A2W A;  4A36 A;  2YKG A;  4AY2 A;  4GL2 A;  5F9F A;  4BPB A;  5E3H A;  3TS9 A;  3ZD6 A;  3ZD7 A;  5F98 A; 
#chains in the Genus database with same CATH homology
 4A2Q A;  5F9H A;  3TBK A;  4A2P A;  4I1S A;  4ON9 A;  4A2W A;  4A36 A;  2YKG A;  4AY2 A;  4GL2 A;  5F9F A;  4BPB A;  5E3H A;  3TS9 A;  3ZD6 A;  3ZD7 A;  5F98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...