3TSCA

Crystal structure of short chain dehydrogenase map_2410 from mycobacterium paratuberculosis bound to nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
GKLEGRVAFITGAARGQGRAHAVRMAAEGADIIAVDIAGKLPSCVPYDPASPDDLSETVRLVEAANRRIVAAVVDTRDFDRLRKVVDDGVAALGRLDIIVANAGVAAPQAWDDITPEDFRDVMDINVTGTWNTVMAGAPRIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVTGLARAFAAELGKHSIRVNSVHPGPVNTPMGSGDMVTAVGQAMETNPQLSHVLTPFLPDWVAEPEDIADTVCWLASDESRKVTAAQIPVDQGSTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium subsp. paratuberculosis
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
total genus 101
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tscA00
1AHHA 3STHA 4CV0A 4ZHSA 4BO6A 5FYDA 5DBIA 2VZ0A 4Z0HO 4BB5A 3ENKA 5DN9A 1GPJA 3HJAA 1ZK3A 1ZEMA 2JJYA 4ZQEA 4WNCA 4J7UA 2O4CA 1YE3A 4AJEA 4RGBA 5JCJD 1BXZA 3VDRA 4YAGA 1GDHA 3DMTC 2O3RA 4XWYA 2I67A 3ZW8A 2HK7A 2JFFA 3UF0A 2G1UA 4CM4A 3W4JA 4IJUA 4BKUA 3DAFA 1YVEI 4D3DA 3AM4A 3ZNPA 2VQ3A 9LDTA 4IDEA 3GN1A 2W8ZA 1YB1A 4KQXA 4BO2A 3R0IA 1HDCA 3SX2A 4AJKA 3PYMA 2GN9A 4NK4A 1ONNA 4R4JA 1YB5A 1SBYA 2CZCA 3RUHA 4NJMA 1E0DA 1YOVA 1NPYA 1KY5A 1HXHA 3S1LA 3VZQA 5FWNA 3PHHA 1WW8A 2AA3A 1D1SA 4G81A 2X5JO 4JLWA 4AJ4A 3K5PA 1ARZA 2VWQA 1ISFA 3PWSA 4BUCA 4CR8A 1PQUA 3O8QA 3WGGA 2H1SA 1I01A 2Y1OA 4HUJA 4ITUA 4JNKA 3SLKA 1C1XB 2OOSA 1EBFA 2VYVD 4MPDA 1LXCA 3VKUA 4FR5A 4XGKA 5CFZA 4WOKA 4UVGA 2O3QA 3BTVA 4YJFA 1IB6A 1O8CA 1GPDG 2X5KO 4CMAA 3E48A 1CERA 1IOLA 1MX3A 1LBEA 2C2YA 5CDGA 4UAGA 2VTDA 3GHHA 4FCCA 3GNSA 5G4KA 1HSOA 1C0PA 2BFPA 4Y67A 2Y0EA 2HK9A 2DUWA 2EEZA 4YT4A 1WNTA 3JTMA 3FTPA 3TZQA 4LN1A 2BGMA 1V0JA 3KB6A 1OBFO 1BG6A 2VRBA 2C7VA 4HV4A 3H9JA 4BS9A 1IYZA 1A7KA 2ZYGA 3ZHBA 3DZJA 4KWHA 4EYEA 2RAFA 3T7EA 4XGNA 3GVXA 5G0VA 3F1LA 1K5HA 3KYCB 3IS3A 2OZPA 3ZWYA 5I7SA 3NDIA 5LDHA 1NR7A 1BXGB 5JAIA 2H6EA 1C0IA 1HDYA 1P1JA 3L77A 3G49A 1I5RA 2VHVA 3FWZA 3GPDG 2ZB4A 4NI5A 4BNUA 3GLQA 1LDNA 4IS3A 2BLLA 4YAIA 5I9NA 2HRBA 3NT5A 1B8PA 4N5NA 4N5MA 3Q6IA 2QX7A 3HG7A 5JAQA 1RYEA 2IDZA 2X9GA 3WIDA 4NHEA 4OSPA 4XA8A 4YJGA 3IP3A 1NPDA 3DBLB 4TQGA 5MGBA 4XJSA 2EJWA 1IZ0A 1CEQA 3RUEA 1L7DA 4PRLA 5CEEA 4NJMB 4YRAA 3GQVA 1C1DA 2ILTA 4YJGB 4C7JA 1SZJG 3PHLA 5BSGA 1GQQA 4DLAA 3DR3A 2GASA 1P1HA 5I7VA 5ITVA 1IPFA 3VPHA 4CMGA 3WGQA 3Q11A 2J5KA 1H0KA 5TQVA 2I66A 1MG0A 3ANLA 2WE8A 3PWZA 4PCVA 1KEWA 3B1KA 1YJ8A 3KYDB 3PGJA 4I5EA 5DF1A 4ZVVA 2DBQA 4JN6B 4II3A 1XA0A 4H16A 4CV1A 4Z0TA 1N8KA 5A9SB 1E3SA 3EGOA 3PJFA 1M76A 4KDFA 1E1LA 1E1KA 4L0QA 1FDTA 4JX8A 5BT9A 4DMLA 1F8FA 4NMHA 5TF4A 4DQXA 1E7YA 1T25A 1PWZA 3OICA 4E30A 5B4TA 3C7DB 3GRPA 4KTTE 3LF2A 5U4QA 1EVZA 4GX2A 4XQEA 4MVJF 4WNIA 1UXKA 3DZKA 1ISGA 3A06A 1QXSA 3F6YA 3OFSA 1VC2A 4PLTA 2AE1A 3O8QB 2NV6A 3WYCA 4CODB 5CDTA 1E3WA 1PU2A 3CEAA 2WSBA 3D4NA 3BYZA 3NT2A 1EBUA 2O4UX 3FNEA 4AJJA 1PGOA 2ZJ1A 2JL1A 3AWDA 2ZB3A 3RU9A 1EE2A 1NM5A 4CV3A 3TPCA 1DB3A 5A1TA 3X2FA 1ML3A 3AW9A 3ZWAA 2BRUA 3WTCA 1RPNA 3PHJA 4E6PA 2E49A 2PZKA 2CY0A 2Y0CA 4N5LA 2AG5A 3PJEA 1ZJYA 2VCYA 1NQOA 4RORA 3ZWBA 4DYDA 1NASA 3FD8A 1IZ9A 3VTFA 4WLEA 4QTZA 1H93A 4XYBA 4NH4A 1IHYA 1DJNA 3H9QA 4BQRA 5IZCA 2PY6A 1YGYA 1KIFA 3UXYA 1NNUA 3QJ5A 5IZ4A 2PA3A 1SCUA 4B7UA 2J3KA 1UH5A 3WBFA 2PTGA 3EVNA 3MWDB 1ZIDA 1PJSA 5JS6A 2OO5A 3NTOA 4J1TA 3PVZA 4U8GA 4TSKA 5COBA 3SVTA 1I10A 2J3IA 1NQAO 3PI7A 3ADOA 4ALLA 1DIRA 5IDQA 2QW8A 3E82A 2NTJA 3G1UA 5L4NA 2CFCA 5F5NA 3QVOA 4TZKA 4CMJA 3F1KA 1NPTO 1UUFA 2VHZA 3MTGA 3QRWA 4J4TA 1E7SA 3GVIA 1UAGA 3I9OA 4ND1A 4GVLA 3RUIA 5COAA 1I3LA 3I4CA 3IJPA 3K8ZA 1I32A 1ZKMA 1X15A 2NADA 3O4RA 4IDCA 4K6FA 4NBRA 4RF4A 4W99A 1T4DA 5ENVA 3M6IA 3S2IA 5DP1A 3V2UA 1NAHA 2IEBA 5KJCA 5DBGA 1OC4A 4EDFA 4R16A 1QSGA 4HX5A 4ZQFA 4JCOA 1X7GA 1G0OA 2HMTA 1PQWA 1ZMOA 3ZH2A 1U2DA 2AEJA 2PD4A 1X14A 3RUFA 3TWOA 5BNTA 4IPTA 2EV9A 3A28A 4CLHA 2NLOA 2PKQO 4IIUA 2AQIA 4E5MA 1HZZA 1V35A 3WGHA 1Y8RA 1DC3A 1YWGO 4J1NA 4R68A 4IXTA 4A2CA 4ID9A 1UXHA 4OGWA 4HY3A 4PZEA 1V9LA 4P38A 4PLVA 4B3IA 3JYQA 3H3FA 3LC7O 1VKNA 5L7TA 4RPJA 2FR1A 3G79A 3PHGA 4OIMA 2AHRA 4CMIB 3L6OO 1K6IA 3DBLA 3UW3A 1Z6ZA 5JDIC 4W9NC 4WGGA 3PRJA 2IYPA 4FS3A 2GSDA 4OM8A 4FD3A 1GR0A 3OBBA 1M2WA 2VZ9A 4IGFA 5H83A 2Q4EA 2EXXA 3BHMA 5CPFA 3QVSA 4PLCA 3WWZA 2NU7A 4FJ2A 4PN3A 3QQPA 2AQHA 1WWKA 3U09A 1U8FO 3RFVA 1VL6A 3PIIA 2YHIA 2XPCA 5HRUA 4XQ9A 4MIYA 4TRJA 1Y81A 1ULSA 3ONEA 1Y9AA 4Q3AA 2W90A 4PZDA 4RF2A 4F6CA 1PX0A 4GWKA 2WDZA 2AMFA 1GCOA 1HRDA 2B5WA 3VDQA 2GPTA 1NWHA 3AY3A 1GEGA 4S3MA 4YYZA 4UREA 5A03A 4YVFA 2P9CA 3FNHA 2Q50A 2JD2A 1H6DA 5F3RA 4ZA2A 2Q45A 4BGIA 3NRCA 1NFRA 1UP6A 3EAGA 3EDMA 4BNJA 4HFRA 1FDSA 4J9UE 3AJRA 4DXHA 2R00A 2HAEA 3GK3A 2IXAA 2WYWA 1MV8A 3WOHA 5F1OA 3H8VA 3I6QA 3PDUA 1SB8A 2AEMA 2EP7A 3MJEA 4CM9A 1UR5A 4NQZA 2NU6A 1H6BA 3L4SO 3UH1A 5L51A 4IJVA 4LISA 3KM0A 1DFIA 4RPLA 3GNTA 2EGGA 3H9EO 3ZV3A 3R3SA 3ZGYA 3H7AA 2CVOA 3OMLA 4HKTA 4XQCA 3ASUA 3P7MA 3N7UA 4D45A 2QZ9A 2YDYA 4TKMA 1YONA 1DLJA 4YACA 1PJCA 4UVDA 1U3TA 4GX1A 3V5NA 3LVFO 5KVVA 5LDGA 1FMCA 2JD0A 4C7KA 1ENOA 3PYLA 3F5SA 1EFKA 4XCVA 4EZBA 4U0KA 4ND5A 4BNHA 3INRA 2QG4A 1GL3A 4XYMA 2X58A 4AG3A 4CM4B 4H3VA 4RLHA 4BO7A 3UAGA 1OC2A 1AGNA 4RF5A 3WGOA 1V3VA 1HDRA 4JP2A 4BNNA 3BMCB 3TZ6A 1BWSA 3H2ZA 1EQUA 3E9NA 1JKIA 3OQBA 4I9HA 2PD6A 1KVTA 1EVIA 1FK8A 2DFVA 2JHFA 3GY0A 3E8XA 4RVFA 4M55A 4GSLA 4O5OA 1GYQA 3DFZA 1B8VA 2A9FA 4TZTA 1GQ2A 4XB2A 2W2KB 1AUPA 1U4OA 3HDJA 3FHLA 4E0BA 1BSVA 3NKLA 1U1IA 2VUSA 3HQ4O 3O26A 1LQUA 3Q9UA 4YEDA 3G3EA 5JFOA 4PG8A 5TJ9A 3P2OA 3U4IA 2DPGA 4DPKA 2P5YA 3QA9A 2HJSA 3M1AA 2YHUA 4L9RA 2FR8A 2ZB8A 1YO6A 5IZCC 3WFIA 4YJDA 3W6UA 7ADHA 3SEFA 3E6AA 1LRLA 3ETGA 2I65A 1DIBA 3GEDA 3I9LA 5C7LO 1BHSA 4E3ZA 3PIDA 2Q3EA 3HE3A 4LSMA 3MJTA 3RQSA 1X0XA 2NSDA 4BQPA 2GCGA 4K28A 4GQAA 1XQ1A 4E2XA 3PHIA 5KVSA 1DC4A 4Z0PA 1JAXA 2DT5A 3Q3CA 2PV7A 1EUDA 3TZKA 2RCYA 3D4PA 3FR8A 2DFDA 4CUZA 1PGQA 1RKXA 3U4DA 3BMNB 1YH3A 4W9NA 2NQ8A 3O03A 3FCOA 5DCWA 1N2SA 1HLPA 4M87A 1B3BA 3BTUA 5ER9A 5J23A 4R69A 4NG5A 2CF6A 3KXDA 1SOWA 4Z3DA 3OJLA 2BFAA 1I0ZA 4GLOA 1C14A 4NBWA 2OMEA 4L76A 3ZHZA 3ETEA 3FNGA 3WJ7A 4TVOA 3IQDB 2CSUA 5THKA 4EJ0A 2BD0A 1UDAA 3KYCA 3PZBA 4L4XA 4WE3A 1ORRA 4AJIA 2A35A 4XR4A 1EQ2A 3B20A 4H7PA 2BI7A 2POQX 3TL3A 1R16A 3EVTA 4YTEA 1GY8A 2FPGA 1E6WA 3OH8A 4CV2A 4E5KA 3Q9NA 3JQAB 1Q0HA 4WLUA 3K6JA 4KQWA 4B79A 1B14A 3KSUA 1N1EA 1L7EA 1PEDA 3LU1A 3LQFA 3C85A 3WIEA 2I3AA 1KEPA 2GRAA 1D4FA 3GHYA 1I2BA 2AQKA 2WD7A 5TGDA 1NHGA 1ZXBA 4XZ3A 1DAOA 2HMWA 3DHEA 4D42A 3BAZA 5JLAA 4DIOA 1K6XA 4J6FA 4UUMA 3D64A 1P77A 1G1AA 1ADFA 3HFSA 4BGVA 3P2YA 1UP4A 3FTNA 2HK8A 3JQBA 5CPBA 1G6KA 2PKQP 2ZK7A 5KJ1A 4UEKA 5L40A 1GQYA 3EHEA 3Q0EA 5G0WA 3JYNA 3WMXA 1SOVA 2EG9A 4AJOA 4CM5A 3OJEA 3MJ4A 2EKPA 2FRDA 2JAPA 2RHCA 1NFFA 1U3UA 4J1QA 2HMUA 4LGVA 3WBBA 4DVJA 5HS4A 3DL2A 3KLMX 3UCFA 5EQFA 3WJAA 1T2AA 1FDVA 5ITWA 1K6JA 4RZHA 2JFHA 1Y6JA 3ZHYA 4INAA 4PIVA 3PXXA 3IP1A 2BHLA 2YDXA 3KHUA 4ILKA 3DMYA 3PJGA 2VTEA 2BFMA 3CZRA 2BFOA 3OJ0A 2GD1O 4M86A 3K73O 4MVJD 4L73A 1Z73A 4WK6A 2AXQA 4PRKA 5KJFA 5A5FA 1WMAA 4JROA 1PZFA 4R41A 2DPHA 3DOOA 1KOLA 3UVEA 1A27A 2AEFA 1PJ3A 4PLFA 4BL5A 1AHIA 5L7YA 5G4KB 3ROKA 1B7GO 1ZSVA 1LJ8A 3GDGA 4S1VA 3TRIA 3BZUA 3GZ4A 1K2WA 4HXYA 1KVQA 4XRGA 3DBRB 4J16A 4O1MA 1R6DA 2I99A 4KUGA 5TC4A 4LMPA 3SXPA 4YT5A 3WGIA 5ER6A 4GWGA 4J91A 2QZZA 4IQGA 4YQZA 2DBVO 5BNFA 3R1IA 1PTJA 2WYVA 3TZCA 3WICA 1W6UA 4YRBA 2BGLA 3IC5A 5TIIA 3VOSA 1HTBA 4CUJA 3EUWA 4G65A 3IL2A 3K31A 3N74A 4BKOA 5CEJA 4RF3A 4DIBA 4UUNA 2X9NA 3D1LA 5IXSA 3BHJA 1Y5MA 1BMDA 2C20A 4LK3A 3CIFA 4UVEA 5I8ZA 1Y5RA 4XIJA 3A4VA 3VPFA 3QW2A 2P2SA 3VZRA 2R2GA 5H81A 4KWIA 1UZNA 3WNQA 2Y99A 4RDIA 2GZ3A 3RKUA 1ZUD1 3W1VA 3ZHXA 4CL3A 2Z1MA 4ALMA 4ALIA 5IAAA 5K6AA 1LDEA 3AUTA 3RCBA 1ZK0A 4MOWA 1D7OA 5A9RA 2VNAA 3I23A 1PZGA 3ON5A 3VPSA 5TNXA 3SBOA 5JMPA 3DONA 2IEDA 3JD0A 8ADHA 2C82A 2IXBA 2H63A 3IIEA 2QRKA 1QYWA 1KC3A 3VH2A 2Y1EA 4BO1A 2IZZA 5L4LA 4XIYA 1MP0A 3INGA 1X0VA 3D7LA 5L95A 4EW6A 4MINA 1VRWA 2DTDA 1WP4A 4J4HA 2B4QA 4AJHA 4CLRA 5TLSA 1PS9A 4GAEA 4NJOA 4AJ1A 4PLZA 4Z6KA 4IDDA 3I52A 2JCXA 1OAAA 3EC7A 4MP8A 3WLEA 4BMNA 1X1EA 4BNLA 1NQ5A 5KIAA 1HDOA 1VJ0A 1V3TA 3EYWA 1R0SA 5T67A 2PFGA 2J5QA 4BO8A 4M89A 1E3IA 5DOVA 1D8AA 1HT0A 1TVEA 2HMVA 3QP9A 4IIVA 4CM9D 4RV9A 4IQ0A 2V6GA 1N9GB 4E5NA 4EGFA 1QR6A 3GFGA 4L4RA 3ETDA 4I1IA 1JA9A 1H2BA 3JQ7A 1T2EA 1HSZA 3JQ8B 4AJPA 3DZHA 3PYXA 4BO5A 3DBHA 3WG9A 2VWHA 4WCDA 2WE7A 3AI2A 4WLNA 1FDWA 4DBVO 1YXMA 4XQGA 5A06A 1MG5A 3OECA 4RLSA 2QYSA 5JNLA 3EMKA 1ADGA 3PGXA 3NAQA 4R1UA 1E3LA 4EUFA 1GZ6A 3LT4A 3ROPA 5IN4A 2O3SA 2NVBA 3B70A 1RM5A 4JP3A 4B4OA 4N54A 3OQ1A 2FWMX 1P1RA 1I8TA 2I76A 1P0FA 5IFLA 2A94A 3TQHA 4QQRA 5IDWA 2PR2A 3F4LA 2XXJA 1CETA 4IZHA 3G17A 5HTOA 1OFGA 4RL6A 1IL0A 4D0SA 2V65A 2Q1WA 1ENPA 4CQMA 1YJQA 2VWPA 3ZNOA 2NU8A 4XRRA 2GNAA 3DZIA 3I9KA 1WVGA 1VE9A 4XR9A 3JD3A 3WDSA 3T4XA 1A7AA 1YQGA 3ZWOA 1LLCA 5I9MA 3JQFA 3ST7A 4CMBA 1IE3A 1QKIA 5U1PA 1NHWA 2IODA 1XYGA 1Y1PA 2BI8A 4YB8A 4CLOB 1KEUA 1XSEA 1EZ4A 4GKBA 4Q39A 5TS3A 1O6ZA 1UXGA 3PDJA 3OIGA 1BDBA 3TFOA 1PIWA 3DTYA 4F46A 3FPLA 4J3FA 1R4NA 3VVCA 4BIIA 3TZHA 5KWEA 3OA2A 1LC3A 1XLTA 1CIVA 2QRJA 4B3JA 3WS7A 4I08A 1WZEA 3CKYA 3UKOA 5AOVA 2DKNA 1DXYA 1C1XA 3C3XA 4FC7A 3WNVA 1EUCA 1R37A 3O38A 1BVRA 5DT9A 1PWXA 2GF2A 4P4GA 5ADHA 3OM9A 3JQ9C 1DRUA 3CUKA 4LVUA 4CM8B 4LRTB 5DCYA 1L1FA 3ORFA 1I36A 2P91A 3QWIA 1T2CA 3WYEA 4FOSA 2X6TA 3ADPA 2V6FA 4Q3CA 1J49A 2HU2A 2HMSA 2BMAA 3WSWA 2C54A 4NZ9A 5L53A 4YJFB 1N1GA 5HA5A 4ALJA 4FFRA 4XDZA 3AY6A 4E32A 4O6VA 5GZ6A 2D2IA 4M8SA 3ZN2A 3CTMA 3ZWCA 3FPCA 2JAHA 3MWEB 3S55A 1LA2A 3ZV6A 3GVPA 4DMMA 4GSKA 1E92A 2CDBA 2B69A 4RVGA 1J0XO 1K3TA 2VNSA 4I5GA 1CYDA 1EDZA 4NK5A 3RI3A 3RUAA 5JY1A 4X54A 2G76A 3AOGA 1HZJA 1X1TA 1NBOA 1EEHA 1KC1A 1E3EA 2CDCA 5T8KC 1A4UA 1GTMA 4L4SA 4MIOA 4OHUA 3GNQA 4NNJA 5L4SA 1CDOA 3BMOB 1YKFA 1HE5A 1NR1A 2J6IA 3W6ZA 2FY8A 3UUWA 1ZH8A 4RVSA 1HE2A 5IG2A 3U0BA 4PG6A 1VSUA 1VPDA 3OEWA 4BNMA 2J5RA 2VN8A 5KTKA 4YT8A 3IKVA 1X7HA 1BDMA 4J43A 1K0UA 3KRTA 3M2TA 2OORA 2Q2VA 4CLEA 3Q2IA 5G0SA 4DGSA 3COSA 4NFYA 4CMHA 1F06A 5BQFA 3GPIA 4ND3A 4CQLB 2Q99A 3CZMA 2SCUA 4HBGA 1LRJA 1PJQA 2PGDA 4GMGA 2HJRA 3V2HA 5A3JA 3PP8A 2JCVA 3JQBC 3GZNA 4ALKA 3D5TA 3E9QA 2DAPA 2G0TA 1DFGA 2EJVA 5EIOA 2UVDA 2O23A 3GOHA 4Q3EA 3H3JA 2WTBA 3K2BA 3ROQA 1Y8QA 4EI2A 2G5CA 3KVOA 3KEQA 3ZV4A 4HFMA 1ISHA 2O48X 1DPGA 5JC1A 3NDRA 3G0OA 4JK3A 3C1TA 2V6BA 3L9WA 4MDHA 4P8RA 1MLDA 2GGSA 1JVSA 5FI3A 2X23A 2ZQZA 2FZWA 4MVJA 2HUNA 1R12A 1NTOA 4U0JA 4F6LA 4W82A 3AFMA 1EMDA 1PJTA 3Q2KA 1A72A 2I3GA 1XGKA 2QRLA 1JDJA 1T1SA 4R1NA 4HADA 5BNIA 2VZ8A 2FHSA 2RIRA 4TWRA 5C3MA 1Z75A 3CH6A 3GDOA 4KOAA 3A14A 4DRYA 3B1JA 4U6QA 4A26A 3LT0A 4QFCA 3KTDA 3PLNA 4G2NA 4AICA 4DA9A 1ZSYA 2XAAA 3RC1A 3AOEA 2OL4A 2CMDA 3H65A 1U2GA 1WPQA 1LSOA 4OQZA 1D3AA 1HF3A 4R3WA 4Y6RA 4UEOA 2TMDA 3DBVO 3VH3A 3DBRA 4ZU3A 1YQXA 3QIVA 3VC7A 2ZTUA 1PL7A 1ENZA 2DM6A 4GBJA 1JAYA 3RAJA 3U9LA 1NQTA 1U3WA 3F4BA 4UUOA 3JV7A 5ILOA 3L07A 2X7HA 5TT0A 4OKIA 5ENDA 5ICSA 5KOIA 5DOZA 3HSKA 5CHEA 2YV1A 3HB5X 3TFQA 2D0IA 3D3WA 1P45A 1EUZA 4L74A 4YAKA 2O7SA 3AM3A 2XF8A 2EW2A 4KDEA 3NEPX 4F45A 2FPPA 2FSSA 2Q2QA 3V8BA 2AQ8A 4TRNA 2Y93A 3KUXA 4HNGA 1HKUA 1GV0A 2OXIA 1P1KA 5GZ1A 5K6AC 2B83A 3NGXA 4WKGA 2Q4BA 4ZRNA 3VAZA 1E7QA 3AOEC 1XU9A 3GR6A 6ADHA 1U4SA 4P4LA 2NVUA 4CQMD 3EZYA 2X9VA 2ZTVA 5JPIA 1NVGA 1YB4A 2YW9A 3ZWMA 1AXGA 3WGYA 1WMBA 3V1TC 5GZ3A 1OZAA 4RPKA 3QWBA 1LLUA 4B4UA 2RBEA 4MJLA 3ZZNA 5B12A 4L8VA 1IULA 1RM4A 3O9ZA 5EJ2A 1U5AA 3NX4A 4PG4A 1C0LA 1MB4A 1ULUA 4I8XA 1DJQA 1WLYA 2VT2A 3D5QA 3H9GA 3IDSA 3JQ9A 7MDHA 4E5PA 4ZD6A 1HE3A 5F1PA 1PZEA 2I9PA 3PQDA 3BMQA 4GGPA 2D4AA 4IBOA 3PWKA 5IDXA 3HDHA 1V8BA 3LYLA 3AY7A 4ZICA 3NJ8A 1DHRA 1CRWG 5JDCC 1IHXA 3ITKA 3DFUA 1ISIA 1ZK2A 3K96A 2AG8A 3KV3O 2D3TA 1JLLA 4JJIA 4FW8A 1Z45A 3ROMA 4R3NA 4OMUA 4JJGA 4PZCA 2VRCD 1KS9A 5THQA 1T1RA 1XELA 1Z82A 2CF5A 1DEHA 3H5RA 3CINA 4J4BA 3QLJA 1ADBA 4CLXA 3DEYX 2TMGA 4YQYA 4IZIA 4KP7A 4E2YA 2EIHA 3RUCA 1PSDA 3CMCO 4QFDA 2C07A 3HADA 1UXIA 3S2FA 1GYPA 4MKRA 3ZWVA 1VLLA 1H94A 2BGKA 5EINA 1XU7A 4RCVA 4MVJI 4A27A 4J7CA 3RUDA 3GFBA 1P33A 4RZIA 4E31A 1Z74A 2E82A 2X0JA 2ZYAA 4WEOA 2FP4A 4B8ZA 1GFSA 1Z7EA 3GDFA 1YQDA 3JQAD 1UZLA 1YBMA 5JCJA 3VPGA 3RBZA 1P9LA 2WYUA 4DIFA 2DU8A 2B4RO 5I9LA 3DHNA 4R54A 2RHRA 1RJWA 3GEGA 4O63O 4RDHA 1J5PA 1X13A 5DBFA 3AK4A 1SEPA 1PL8A 3M1LA 1M67A 4WEQA 4DQUA 5KCZA 3WWYA 1UXJA 1QLHA 3AUAA 3I83A 2JD1A 4L75A 3P5SA 1ZJZA 3F5QA 4AVYA 1PJ2A 1PZHA 3ZWXA 5CDUA 2G17A 5JDCA 3K30A 2H5LA 5JAMA 3QE3A 4IY1A 1TT5B 3ANNA 3H5NA 3K9QO 1P0CA 1QRRA 1E1MA 5AVOA 4YBZA 2GDZA 2WWRA 4LCJA 4R5HA 3SJ7A 3VH1A 4A0SA 3E18A 4AJLA 5JYDA 1OI7A 2F1KA 4M49A 3WQRA 4FIZA 3LC2O 4DPMA 1ZFNA 4CJXA 3A9WA 5TX7A 5CP8A 4MKXA 1F0YA 3IOYA 5AXDA 1BTOA 3JQ6A 1AN9A 3B1FA 3NJ4A 2PGJA 2B36A 2DUUA 4ROSA 3AI3A 4IDBA 4FFNA 2IE0A 4CM1A 3U5TA 1VSVA 4HWKA 4U6SA 1GYRA 4PVDA 4P22A 3HZZA 3F46A 5LC1A 1SC6A 3UN1A 1QV7A 1EDOA 3W4IA 4Z9FA 1SPXA 3TJRA 1JVBA 4D0RA 2NU9A 2YQ5A 4GKVA 4TRRA 3I9NA 4Q3BA 2X0NA 3UICA 3WGTA 5FF9A 3L0DA 1PJLA 1VJ1A 1KBZA 1N5DA 4J2HA 4BV8A 2Y68A 2E6UX 4XEHA 3PZRA 4Y98A 3TNLA 4TKLA 4NBVA 1ZCJA 2DC1A 3TF5A 5DULA 2OBYA 3OIFA 4EUEA 1LDGA 5CDSA 1EFLA 1F17A 4GL4A 2DBZA 2ZATA 4W4TA 1HLDA 1ZNQO 4Y9DA 5G0TA 5HS6A 4EJMA 5L7WA 1O95A 2DBRA 2PD3A 3ITDA 3ZI0A 3C24A 4YRDA 3ICCA 2HCTA 5DNAA 3L4BC 1B16A 5JSFA 4QXMA 3V1YA 2GUGA 2VYVA 4EUHA 4ZQGA 3T7CA 1I33A 2X86A 3I9MA 1TB4A 3W4KA 3QWHA 1DHTA 2QHXA 5JW6A 2QIOA 3ENNA 1E5LA 1WDKA 4FDAA 1QYCA 5BSFA 1JN0A 1JWAB 3JCZA 3ZNQA 4HNHA 2H9IA 1PL6A 4Q3NA 4II2A 4BVAA 1ZK4A 2HO5A 2GERA 3ZWNA 1RM0A 3TSCA 3GMDA 4J9VA 5DCUA 4MKZA 1PR9A 2YY7A 4XYGA 1I3NA 4YJHA 3UCEA 3EW7A 1T4BA 2D8AA 3TOZA 3QWAA 3G1TA 5L9AA 4W6ZA 3QVXA 3JD2A 4BB6A 3KZVA 3NTRA 3PEFA 1P1FA 4RPGA 2PH3A 3DTTA 4PG5A 1LEHA 1E1NA 1E6EA 1LLDA 2C5EA 3FRJA 4R5MA 4YA6A 1CJCA 4Z9YA 4E12A 4RQUA 1KETA 3NGLA 4XGIA 1A5ZA 3A1NA 1E6UA 3R3JA 4B4WA 3H4VA 2Q1TA 4BNZA 1R4MA 4E21A 1DRVA 1YDWA 1NVTA 3WSVA 3GAZA 4YAEA 4HFNA 1Q7GA 1BW9A 1SO8A 2XOXA 2B5VA 3JQGA 1Y9EA 4DQVA 4CL8A 2CUKA 4BNIA 3PFFA 3BXXA 3NDJA 4FJ0A 4IINA 3RWBA 3SC4A 3DAGA 4GVXA 1LSUA 3V1UA 4QT0A 2OBNA 4Q3DA 3ZU4A 1HETA 1DDOA 1U7TA 1WZIA 1PS0A 1G0NA 1NAIA 1R15A 1VL0A 2BKAA 2V6MA 4E2WA 3H6KA 5JO9A 3I9JA 5C7OO 2EKQA 2W2LD 5AQ1A 3QWFA 3AM5A 2B4TO 2YZ7A 1O9BA 2AW5A 3VZPA 4MP6A 3VZSA 4RPHA 1GZ4A 1LU9A 5DDIP 4EEZA 1LLQA 5TSDA 1O0SA 1Q2XA 2E48A 4KZPA 1UZMA 3CE6A 4BOYA 1PJBA 3E5MA 3FN4A 3D3EA 2Y1FA 1JTVA 1H6CA 1Y8QB 2YV2A 4QEDA 4D3SA 5CG1A 4NBTA 4QX6A 3HUDA 2PH5A 4ONEA 3HNPA 1P74A 3FF4A 4YXFA 1E77A 2CDAA 4D43A 2X1HA 2O2YA 1Q7CA 1MC4A 2YFHA 3DO5A 3WTBA 1DIGA 1MUUA 3GUYA 3QVWA 2PNFA 3KSDO 4KUHA 1TA4A 3LC1O 4D7AA 4CMCA 2YQ4A 2ZKLA 5IF3A 1B15A 3BTOA 1S6YA 3L9XA 3ONDA 1C0KA 5ILGA 3JQGB 1I3MA 1XWFA 3WXBA 1TT7A 2HRZA 3I3OA 3H2SA 2ZCVA 3MCVA 4RVHA 2IZ1A 1ADCA 2P9EA 5JAZA 4WLFA 1JW9B 4AJNA 1YS4A 4FB5A 5EESA 2OHXA 4JXKA 1CQJA 1EE9A 3AU8A 3NT4A 1HWYA 1XKQA 4PG7A 1CF2O 4E5YA 5I7EA 2VYND 3DOJA 1O94A 5KNLA 2UAGA 5BSHA 1LSSA 1JKJA 1Q0QA 2A92A 1KY4A 4CMIA 2OUIA 3K92A 4IQ8A 4YDRA 4OXKA 1DSSG 1MFPA 2C7GA 5JDIA 1I3KA 1ID1A 1JKFA 2JHGA 1LSJA 1EK5A 1QORA 2O7QA 4TVBA 3ZWPA 4LRSB 4BO9A 1R0LA 1T26A 3CSDA 1LTHR 1W73A 4EEXA 2AE2A 4C4OA 2NQTA 3RJ5A 1GADO 1TI7A 3F3SA 2EWMA 2OGUA 1MC5A 2Q49A 3JQDA 4OJNA 4AL4A 2OP1A 3BIOA 3GVCA 1ZO8A 3VHRA 2PZMA 3DHYA 1SB9A 1ZBQA 2ET6A 3H5AA 3LT1A 4ZJUA 4W7IA 3RC2A 5FFFA 3AFNA 4BMVA 1LUAA 1B2LA 3C7AA 2EHDA 1PS8A 2NM0A 2OP0A 5AXAA 3S2GA 4UUPA 5AYVA 3OEYA 2PKRA 4XB1A 4EJ6A 4W7HA 3TDKA 4Z3KA 4YCAA 1GEEA 1GCUA 2EW8A 1W0CA 1ENYA 4JIGA 4CM8A 1HE4A 1I30A 1NP3A 2Y0DA 5G0UA 3B6ZA 1JWBB 4R51A 2NUAA 2YFQA 3C8MA 3GG2A 3EZLA 4DUPA 3ABIA 1HYGA 1DC5A 1AXEA 5HBRA 4D3FA 4G5HA 5BSEA 4WLOA 1OMOA 1P1IA 3GRKA 4QSMA 5B37A 3K2EA 4IJKA 1VM6A 2R00C 2D1YA 4XX0A 4CLOA 3CXRA 4CQLA 4B4VA 5JMWA 4WASA 2WEKA 2HSDA 1DIHA 2VHYA 4BNVA 4CM6A 3JQAA 3ZU2A 1IPEA 1ONPA 3F9IA 1QLJA 3RBVA 4WPGA 3ZWWA 4WECA 5B4UA 2DTXA 2EERA 2EGHA 4ALNA 1KERA 1K89A 2ZJ0A 2GO1A 2VWGA 2Z1NA 3PLRA 1GUFA 1HDZA 4DL9A 4EITA 4FOOA 2YJZA 4CLRB 2GYYA 1YL7A 1MFZA 4MP3A 3HB4X 4UVIA 5JC8A 4R1SA 3LF1A 3PK0A 1MXHA 3RC9A 3FBGA 3RASA 1HYEA 2ZTLA 1LDMA 4U7WA 3JYPA 3AUUA 5JYEA 1DLIA 2PK3A 5FI5A 4OXYA 3LT2A 5KJEA 2A4KA 5KVQA 3TOXA 1RWBA 3E9MA 1JU9A 1B8UA 4LCEA 4XDYA 4J49A 5T5QA 2D5CA 5A9TA 1N7GA 1LX6A 2Y1GA 3VH4A 3FI9A 5A3VA 4BO3A 5EQDA 6LDHA 1GU7A 1QYXA 1NWCA 3DDNA 4P4NA 1T2FA 1ZVMA 1P3DA 2JCYA 4CM3A 4CMEC 3ZCXA 3N58A 1Q7BA 2W4QA 3W8EA 1NVMB 4IUYA 3MJVA 3EY4A 4I9UA 4FFLA 5TJHA 4LSWA 3RC7A 3UHAA 4OKNA 4OSOA 2HKIA 4CR6A 4K6CA 3WX0A 3V2GA 1D1TA 4IDFA 1HDXA 4M54A 1QP8A 3WB9A 1VL8A 2RH8A 4FQ8A 4BGEA 3GEMA 1H9BA 2BELA 2YHIB 2W2KA 4PLHA 4DWVA 4IXWA 3JQCA 4CQMB 3GVHA 3I4FA 4IDAA 4B3HA 1U3VA 2B0JA 3INTA 1ZMTA 3HDYA 2RH4A 2BH9A 1F14A 2UUOA 4N7RA 4PGFA 2Q1SA 1B0AA 1WXDA 3OA0A 5EL0A 5MDHA 1J4AA 4OAQA 5TRTA 2P9GA 2PWZA 5GY7A 1W8DA 2CVQA 1TT5A 2FN7A 1ZEJA 3U4HA 3BMQB 3PTZA 2NNLD 4DPLA 3F47A 1YDEA 3HN7A 3RU7A 3FR7A 1FF9A 4MVJM 3QSGA 4ZRMA 4YJHB 5CG2A 4B7XA 2EP5A 3P19A 4Y6SA 3ZW9A 4RJTA 3AUSA 1YRLA 3SC6A 4D41A 4E2ZA 4EBFA 4LW8A 5TT1A 3JQFC 3JQ8A 5AXBA 4JQCA 2I6TA 3JQ7B 1DOHA 1EVJA 3GT0A 4A03A 1QMGA 1LC0A 2DLDA 2QQ5A 3FSRA 2WM3A 5IDYA 1PJ4A 3KETA 4FFMA 4NU6A 4OH1A 1B26A 1DFHA 2X0RA 4H15A 4JBGA 1T24A 2C29D 4NPCA 5U9CA 4D46A 2O2SA 3MTJA 1B3RA 2F00A 3SJUA 2Q1UA 3JSAA 1H2HA 3ZDFA 4NU5A 2VRCA 3PQFA 1GUYA 2D5AA 3GC6A 4CPDA 2QYTA 5BR7A 5A5EA 4FFPA 4JGBA 5L3ZA 1NFQA 4NFHA 3IKTA 4R1TA 1PR3A 4A10A 3U4CA 5KKCA 4Y8VA 1E7RA 4IS2A 4MVJP 5AXCA 4K1LA 4DLBA 4F3YA 2Q2WA 2Y1DA 1ONOA 2VYNA 3S8MA 4A7PA 4FN4A 2UV8A 4FGSA 3VVBA 2JFGA 2ZB7A 1TEHA 3JYOA 1YBVA 4GMFA 2CNBA 2FOIA 1MA0A 2E37A 4XKJA 2V7PA 2ZTMA 4R01A 3ZU5A 3OHSX 3BHIA 4AJ2A 1TLTA 3DAPA 3U49A 1HYHA 5B4VA 1BW9B 2PZJA 4CR7A 2O3UA 4RVDA 2P5UA 1ISJA 3T4EA 3ZV5A 2CVZA 1E5QA 5G2OA 3RVDA 1M6WA 3RIHA 4NBUA 4BNXA 1DBVO 1TXGA 2WJPA 3IUSA 1BVUA 3MZ0A 1AE1A 2Z95A 4ND4A 2VOEA 4GX5A 2J8ZA 3QY9A 1UDCA 3WLFA 3KSZO 3ZNNA 3UOGA 1QV6A 1X7DA 4BNGA 2VHWA 3ASVA 5A05A 3RROA 4KTVE 4XYLA 1XEAA 2GN8A 5KKAA 4NDNE 3OETA 4FC6A 2OFPA 2NTNA 1RYDA 4B7CA 4R9RA 2FSVA 2E4AA 5JO0A 3NTQA 1QG6A 2HDHA 5EPOA 1CWUA 1N7HA 4D79A 1U8XX 3IMFA 4AFNA 5T64A 2UUPA 1YL6A 1R0KA 3BMCA 3QHAA 2C59A 3RJ9A 1V6AA 1YL5A 1KVRA 2D59A 3LLVA 4BKQA 2LDXA 3DZBA 1E7MA 3KO8A 3LSYA 5F5LA 3BA1A 1N9GA 1NX6A 3KLPX 3KBOA 5GMOA 4OOFA 1XIVA 1FDUA 4JBIA 1P31A 1HL3A 4IGEA 4RO0A 1CQIA 2PZLA 3U62A 3WGZA 2GLXA 3DQPA 3GMSA 1LQTA 1KVSA 1M6HA 3FNFA 4I5DA 2J3JA 4IMPA 3E1KA 2UYYA 3UCXA 1EVYA 1J6UA 3BTSA 4PVCA 5DZSA 4NR0A 3SLGA 3M2PA 4DTIA 3GGOA 1R4MB 2ZQYA 4LMRA 3WFJA 1C1DB 4J1SA 1C3VA 1FJHA 3JD1A 3JD4A 4DBZA 5C7IO 2HLPA 2VHXA 2YYYA 4ND2A 4IDGA 4UEJA 5ES3A 1LNQA 4B8WA 4IM7A 4O59O 3JYLA 1ZSNA 4BGUA 4E4YA 3MOGA 2DQ4A 1GD1O 1GUZA 1PGNA 2IZ0A 2NVWA 3LK7A 5DP2A 3DXFA 1U5CA 3KOUA 3RFXA 3HFGA 4CMKA 2Y66A 1Q0LA 4J0EA 2GZ1A 3VTZA 2W98A 3HHPA 4MVJG 5ICMA 5K9ZA 3HWRA 4E33A 1O89A 3W8DA 1S7CA 1PQPA 2O3TA 4XJTA 3Q1LA 3MOIA 1UJMA 1KEVA 1BRMA 4PFJA 4BKRA 4N18A 3IJRA 3RBXA 1VI2A 2JKVA 1A71A 4LVCA 2PGLA 3WQQA 1PGJA 1Z7BA 3D0OA 2X0IA 4TMFA 1VJTA 4K26A 1I2CA 5L45A 3LDHA 1RM3A 5CDYA 4Z9XA 1WDLA 2B35A 2YV3A 3DC2A 4K9DA 2Z5LA 2WMDA 4UVHA 3WR5A 2P4QA 3GG9A 1UDBA 5F1KA 1M66A 3IAHA 5A02A 3D4OA 1O5IA 1H5QA 8LDHA 4QO8A 4CMEA 2NVUB 2IYOA 3WQSB 4A5OA 4NIMA 2PLAA 3TL2A 1OOEA 3DOCA 2VUUA 1BXKA 1Q1NA 5KJ6A 3I5MA 2C0CA 1QYDA 3L6EA 5C5IA 3R6DA 2CD9A 1ZW1A 3DZGA 3PFWO 4BV9A 1XG5A 2GZ2A 3VPXA 1E7WA 5KVCA 2WD7B 3ONFA 1LDBA 4QO7A 4OO3A 4CUKA 5IXYA 1ZZEA 5EN4A 1HEUA 3D3WB 2X4GA 4ESOA 4ZN6A 4UULA 2X8LA 3L6DA 4DC0A 2GN6A 4M1QA 2C2XA 1MGOA 2XXBA 5CAEA 3HDQA 4ZQBA 5I8WA 2NTVA 3GUCA 1U7HA 4WCFB 4BNTA 5A9SA 3WYBA 4CM7A 5JBIA 3BMNA 3GH3A 3PJDA 4J2OA 4YAJA 3HN2A 4J0FA 1H9AA 1A4IA 3U3XA 3DWFA 5H82A 1KYQA 4WUVA 2W2LA 4FFOA 3AU9A 3KYDA 5JY6A 1QYVA 1SEVA 1LI4A 1ISMA 2ZYDA 5JE8A 2G82A 4PLGA 2DTEA 2FMUA 5G4LA 4IMRA 1I2ZA 3ZU3A 2J3HA 2NWQA 3OP4A 1N92A 4BMSA 1XQ6A 4WJZA 4BNFA 3FWNA 4D44A 4A73A 3KYBA 4FJ1A 4O0LA 1NXQA 2HQ1A 4PLWA 4YR9A 3FBTA 3DMTA 3LZ6A 4QECA 1DO8A 2Y1CA 2O3JA 5T6BA 5I7FA 5T57A 2YUTA 2LDBA 1KVUA 1U28A 1XDWA 3KEOA 1E3JA 4FPXA 3NV9A 4FBGA 5HWSA 1IY8A 2GN4A 3GGPA 1XHLA 2IRWA 4IJWA 3OJFA 3GA0A 1HDGO 1UAYA 4BHTA 1FXSA 1PGPA 4I9NA 2I5PO 3OIDA 3H9UA 1Y8RB 3E5RA 4XD2A 9LDBA 3GGGA 1JQBA 5A04A 2X5OA 4TRMA 5EERA 2R6JA 5A4DA 4GI2A 5IN5A 3GZNB 4GPD1 2FR0A 5CEFA 4BKPA 3X2EA 1YOVB 2NACA 2GR9A 4XYEA 2VUTA 3ULKA 2EKLA 5C37A 1F8GA 3MJSA 4WCFC 1XCBA 4KMSA 5F21A 3PQEA 5B1YA 1W4ZA 2EF1A 2UDPA 4URFA 4YPOA 1A9ZA 4BO0A 2P68A 4QUKA 4BNKA 1VKOA 3W8FA 4GX0A 1ZK1A 1A9YA 4HFJA 1DIAA 3OJOA 4U5QA 1R66A 3I6IA 5T8KA 4J7XA 3BMOA 5JCXA 1BGVA 1DAPA 4PLYA 2Y67A 4JJFA 3PPIA 1DRWA 3ANMA 3JQEA 1R4NB 1XR3A 2ZCUA 3CMMA 4GLLA 3NYWA 2B37A 5FEUA 3DZFA 4MVJH 4DC1A 2P4HX 3DB2A 4JBHA 3VKVA 4WLVA 5K0ZA 3RKRA 1EK6A 3C1AA 2ZIZA 4RQTA 4HP8A 4ZQHA 3IUPA 3I1JA 4BO4A 1SMKA 3AI1A 1SAYA 4OOEA 1ZXLA 2O50A 1E3WB 4KUEA 4DREA 3OF2A 2FZEA 4DYVA 1LRKA 3E03A 3C1OA 5HM8A 1I24A 2DVMA 1BXGA 3GAFA 3QVTA 4TROA 1H6AA 1MXFA 3WMWA 4CLDA 1V3UA 4Y6PA 4NFSA 1M75A 4FGWA 1T2DA 1UP7A 3OQ6A 3CPSA 4PLPA 1YBAA 3GN2A 2C5AA 5EMHA 1WAMA 3UFXA 1GV1A 2BF7A 2X22A 4Q9NA 3EK2A 4RVUA 4MVJE 4OQYA 4YWJA 4BNWA 4GH5A 1GZ3A 4GGOA 3RFTA 4WCFA 2VOJA 3MJCA 3MEQA 4DLLA 3L4BA 1Y7TA 5LCXA 4ZGWA 5JXWA 1P44A 5COQA 2VT3A 4OXNA 4FSHA 3S2EA 5IJZA 1LDYA 2WD8A 3GF4A 1GAEO 4MIEA 4OYRA 3C7CB 3QV1A 4WOJA 2Q46A 4MO2A 4YT2A 2Y05A 1F12A 1SNYA 3ICPA 1DC6A 4E13A 3OSUA 1U9JA 1WDMA 4I5FA 1IUKA 3UGKA 3DBHB 4OL9A 4BNYA 3RD5A 4J90A 3LLSA 3RSHA 3NUGA 4R9SA 3TN7A 1NYTA 2FPIA
chains in the Genus database with same CATH superfamily
4H1TA 2JLBA 4DN6A 4CV0A 1UBHS 4F2DA 4ZHSA 5FYDA 4WT7A 4QJ3A 1GZSA 3FNIA 1M9NA 5DBIA 1SCUB 2VZ0A 3KWLA 3NAGA 3ENKA 5DN9A 2IZOA 3HJAA 2HNAA 4L72A 1EWKA 4EG4A 5HZKA 2C5HA 3QKUA 4FNMA 1Z37A 1H3FA 4QHSA 4WNCA 1AO0A 2IK8A 3RVMA 4X3OA 3VDRA 1J2EA 2Y1WA 1VBKA 4NBKA 2EIXA 2I67A 4DCVA 1FP4A 1UBSB 1VJGA 2HK7A 2JFFA 4MIKA 3THRA 2XMDA 2UU9B 2KSQA 2W0SA 3DAFA 4FBLA 4NTZA 4XCXA 3TINA 2NZUG 1NJ5A 3GN1A 5A3SA 3BQMB 3PNBA 3O84A 1K2VN 1E8NA 2I2BA 1W85A 4JUFA 2EHJA 3T06B 1FFBA 2JW5A 3HYRA 4WBNA 3IO5A 4YP6A 1ONNA 2JVKA 1MT0A 4KPYA 3CE9A 1GZ7A 4NJMA 2A0XA 3OZAA 1YOVA 2LXNA 3O0DA 1EK0A 3R7WA 3U7GA 3S1LA 4DOMA 5FWNA 2AA3A 5GTDA 3B7PA 3LC0A 1N2CA 4JUDX 1MEOA 4DUGA 3O8OB 3ILVA 2AK2A 1PT7A 2HRCA 3ZGVA 1ARZA 3PEVA 4DRXA 4GKKB 1ISFA 1FSFA 2CXQA 1JHRA 1J23A 4BUCA 3MCZA 1JE1A 4CR8A 3WGGA 2QRQA 3NYIA 4IDQA 3AJ9A 1EJ6A 1XXLA 3H0KA 2C2ZA 3M7IA 3HYLA 2GBFA 3PNMA 3E0QA 1LXCA 2B1IA 4FR5A 1GRCA 4LFCB 4ZOEA 1ZIPA 3C14C 4O4JA 4YJFA 4ZYWA 3Q10A 4DJJA 2X5KO 2AJBA 4CMAA 1AA9A 2GT1A 1AO3A 4O4IA 4UBLA 4WZ6A 4UAGA 4DQKA 4LOHA 3JR3A 2XD4A 4K2HA 1BYIA 1QE3A 3AIOA 1VIMA 2Z83A 4MW5A 2DUWA 3FBWA 4ILEA 4QC2A 1JI0A 1WNTA 1ZJ6A 3JTMA 4LFAB 3TZQA 4FKZA 4Z7NB 3I2KA 4TKZA 3A3YA 1B1CA 1OBFO 1YUBA 4HV4A 3BJEA 3E70C 3H5LA 3HKEA 1IYZA 2ZYGA 3HV2A 2JCSA 5IAJA 4BS9A 1A69A 1XZMA 2ENUA 3T7EA 3QF7A 5CDHA 4I1RA 2QNRA 3PE3A 4U2CA 4ARZB 5KZMB 1W96A 1U2QA 2OZPA 3B9BA 1L4UA 3E2IA 3IS3A 3NDIA 5AVUA 3K0CC 5I7SA 1KDTA 3BWBA 3GNLA 3TTVA 2OECA 2BEKA 2V7WA 2ZB4A 4XQ0A 1GILA 1LDNA 2XHEA 1D8TA 2JLXA 2IC5A 5CA1A 2BLLA 4CKBA 3A6DA 5E4JA 1LBSA 1PNTA 1OZGA 4D98A 3UHOA 4X92A 1SU8A 4M21A 2ZUEA 2Y6UA 4N5MA 4Y18A 3KCNA 1Z63A 1RYEA 2IDZA 2X9GA 3IFSA 4NHEA 2JFPA 3CCBA 1HEIA 4XA8A 3J81A 4WBSA 4XDGA 5L3VA 2IP1A 13PKA 5MGBA 3EVGA 1AX9A 3ABQB 4YRGA 1ACJA 2EJWA 2VPXA 4JS0A 5GPBA 2HLDA 3SCZA 1J8MF 1RQ7A 4F9TA 3IJ5A 3GAMA 1SBCA 1TVMA 1P2SA 1YACA 2H2FA 3N3BC 4YJGB 5I9SA 3W5IA 2BJHA 4C7JA 2QIPA 4COKA 5HUHA 4NS4A 1M2OA 4MLPA 2UUAB 1SVKA 5HZHA 1KI1A 5E3IA 1GNRA 4CIDA 2QX8A 2WTMA 5ITVA 5FFMA 2AR7A 2H2GA 4FHFA 4KBFA 2Q5HA 4HDKB 2PPLA 1RCUA 2I66A 3NBFA 3ANLA 1VKRA 4JBXA 2R1ZA 5MGNA 3PWZA 1E9EA 4PCVA 1RLIA 2CCGA 5CURA 4G6ZA 3I37X 3B1KA 3PGJA 4I5EA 1DDGA 1SELA 5DRYA 5IAOA 3K0FB 2UUCB 1QAQA 4HEA6 2WUDA 2DBQA 1A8HA 2WB2A 4AP6A 4II3A 2PFKA 4H16A 5BMVB 3AL0C 1TF5A 1XBTA 2HX1A 5DX8A 4Z0TA 2PYDA 4YQEA 3TR0A 4A2PA 3C8UA 3PJFA 1FYDA 1NG9A 5WRFA 1FDTA 2NOAA 3GT4A 4TXMA 1DINA 4UXIA 3MXTA 4NMHA 4HL6A 3B9QA 3CZQA 3OICA 4J29A 3L4EA 4J3NA 3NXKA 3I5XA 2I1VB 721PA 5A4MS 2G06A 4KTTE 3IP8A 2I6GA 1LFAA 1W4BA 3L0IB 3DOFA 2XIJA 2A3RA 3DZKA 1ISGA 4P33A 4NMWA 3F6YA 1XRMA 1VC2A 3NYQA 3OTIA 3BB3A 2CVPA 4TLEA 3WE7A 2NV6A 4EJSB 4MLZA 5IPFA 4CODB 2WQ6A 1A9XB 1M5RA 3ANXA 1PR4A 1JHDA 2JI7A 4M0DA 3IUMA 4MKIA 3FNEA 3DD1A 4M98A 5AOCA 2B1GA 2JL1A 3HCNA 3QHQA 3UWMA 3VHQA 3JVEA 3ZD9A 3EG5A 5DYYA 4I4LA 3KZXA 1EXWA 3OOYA 4AZ3B 3H6GA 3LBFA 5A1TA 4IUDS 3X2FA 1ML3A 1JAHA 2BRUA 1Z6GA 4UOQA 1UPFA 3WTCA 3HU5A 2QD4A 3TZEA 4RBNA 4DCNA 4E6PA 3DEHA 5K7SA 2R7KA 4OHBA 3VO1A 2A7XA 4QPNA 3MWLA 4UAVA 5FO0A 4UW9A 1VHTA 3O3NB 2R6HA 3CF4G 3MJHA 4RESA 1EFRD 3T7DA 3OHPA 3DM9B 4CT0A 2YHBA 3WZLA 4EIWA 1KQFA 1NASA 1IU9A 1SKUA 1X77A 3FD8A 3LPAA 1J0BA 1TD1A 4DJDC 1L7PA 1JIVA 2RB5A 3L8EA 2P11A 3DO6A 1OUMA 4LX8A 4QAQA 2J08A 4MB6A 4UPDA 2C9CA 2C78A 4BAGA 5IZCA 4GOOD 3KJEA 1S9DA 3UXYA 3K3PA 4DIKA 1IEQA 3FY4A 4KGZA 5AWFC 1NZFA 3NORA 1ZM9A 1QQ6A 1KA9H 4N5IX 3WYNA 1NQUA 2PA3A 3LCCA 4Y8VA 2EFDB 2V59A 1J2RA 3KTAB 3I09A 4XWOA 2UYHA 3EVNA 1Z83A 2ZAYA 2IOQA 3QELB 3C3DA 3UK1A 4DV4B 2W6IA 4JQSA 4B6JA 2OO5A 1DS6A 1A04A 4RH3A 3IERA 3P1JA 2Q5LA 3OLVA 2O8BA 2DR2A 1SURA 4HPWA 1QIIA 3CRNA 5JWOA 2HWUA 2Q27A 1P7WA 1G16A 4UUQA 2R47A 3E7XA 4MRRA 5ADVA 1DTWA 1DWUA 1SR8A 4CTKA 3OE5A 2XNKA 2WVHA 4RM3A 2CFCA 2OO5C 4DY6A 5TY0A 3QVOA 1LPNA 4F8YA 3AVQA 4K1XA 4AO6A 2PAFA 3OFVA 1NPTO 5JJKA 5EKDA 2VHZA 3QRWA 4YRMA 3DFMA 4G5QA 4ZXFA 3KWJA 3KQNA 3IVAA 1WG8A 4NNPA 3M3DA 2XLBA 3WMEA 1YZGA 1E58A 2VAPA 2WW8A 3I4CA 1VRVA 4OBXA 2HTEA 1F5NA 3KLOA 5GP1A 5I45A 5LYJB 3I30X 3O4RA 4NBRA 4EK9A 5HYVA 4RF4A 3TNYA 2J59A 1T4DA 3QTTA 5ENVA 4C5AA 4RHXA 5CFQA 4CQNA 3KPVA 4EWLA 1QSGA 4HX5A 1OLXA 2C99A 1G0OA 1UBMS 2MWMA 2HMTA 4W1RA 1G291 3CH4B 1OXSC 3RUFA 3SYRA 2EV9A 3A28A 1A50B 5JJLA 2X1VA 1XCJA 4IIUA 3R5HA 4LE1A 1I3OA 4E3WA 1JKMA 1E5XA 4G1CA 2XT0A 1YDGA 3I5YA 3ZDYB 3PUHA 4LRWA 1ZY2A 3JALB 3SJZA 4PZEA 3OO1A 3ZUGA 4GWLA 4YAOA 4QVGA 1TUIA 3A6FA 5EIXA 1Z5GA 4I36A 2FR1A 4RPJA 1JBKA 2ZUCA 1JZTA 3P20A 4X8MA 3VR4D 1MB9A 1Z15A 2AHRA 2AUTA 3LUKA 4Q05A 4CMIB 2BE9A 2ZUVA 4Y2QA 3NLLA 1K6IA 4LKRA 3D8NA 4C4TA 4PY2A 2IEGA 4JBYA 4R8KA 4W8OA 5CAEB 4X6LA 2HSEA 4K9OA 1FFYA 5ALMA 2ODNA 2VBIA 3NH6A 2EFGA 2PN1A 4P5PA 3ZIAA 3ZCRA 2IYPA 1U8TA 5D5PA 3THSA 3CF2A 4FYPA 1XQXA 3A6EA 4FMBB 1GR0A 4WINA 3W7AA 1SXJD 4JA2A 1M2WA 2JGNA 4IGFA 3R76A 4Q7QA 5MHTA 4C89A 4EABA 2SHKA 1BIFA 4LOJA 5CPFA 2I1LA 1W48A 3QVSA 2NU7A 3SXJA 4U02A 4D4HA 4ZYLA 3QQPA 5A62A 3NFYA 2CJWA 2BZ1A 1WWKA 2FEWB 5EXSA 3UO8B 2JGDA 3RFVA 1VL6A 1HMPA 4TWBA 2C2MA 4H4EA 4AECA 2C9DA 2XPCA 4MIYA 2ZW9A 1E2EA 1ULSA 3FDIA 2REQA 3ORYA 4RF2A 3WO1A 3RSQA 4F6CA 2MSCB 1PX0A 4JT2A 5A4KA 1D2CA 1NF9A 4GWKA 1SXIA 2AMFA 2F43B 2WDZA 3T3IA 4ARZA 1VIAA 2GPTA 4KEAA 4N41A 4YYZA 1ELOA 3G82C 5A03A 1SRRA 4DLRA 3VR2D 3FJYA 1J42A 2B99A 3UV7A 1BC5A 1REQA 2FPUA 1E9RA 5IXJA 5DBEX 3V2IA 2UZIR 2PQ2A 4J9UE 1A95A 1OYYA 2OCYC 4UFOA 1YBHA 5EHZA 2R00A 2HAEA 3GK3A 5E1DA 4OHPA 3I01A 2W11A 4AO7A 1K98A 2Q6KA 4EJFA 1E5VA 1VKHA 4P98A 1OVGA 5F1OA 4BBPA 4JU8A 4ZI7A 2JRCA 3PDUA 1SB8A 3B7WA 4CKXA 1P4RA 5DGHA 3IOMA 3UGQA 1M74A 2IU6A 5BW6B 2EP7A 5TR9A 3MJEA 4CM9A 5BOSB 2ZI6A 2WKSA 4NQZA 5JALA 1T2VA 1PZNA 3GLTA 1PDWA 1NXPA 2OHGA 4C88A 1OT3A 1V8FA 3G2HA 4M1YA 4MWBA 3P9IA 3EE6A 5B1EA 4JSYA 3GBVA 2YWXA 3L7LA 4HDMB 4ZVRA 3I45A 3LZDA 3H9EO 5KSYA 1Z0JA 4MYCA 4TT3A 1GFIA 1TECE 3R3SA 3H7AA 4DR3B 2CN1A 4XQCA 3P7MA 3PKJA 1FFAA 3W3ZB 3BZBA 3DEKA 4U39A 1P62B 1Q14A 1RRKA 3TRDA 3VOBA 2H0AA 4D9IA 1OV4A 2BMVA 3A58B 4WBNB 1Y3BE 1PJCA 3HKCB 3RS0A 2ZE7A 4IOMA 1T1EA 3LVFO 1T0HB 5LDGA 3EGCA 1H69A 3LXRA 2JD0A 4F93B 3H84A 4C2TA 4N0PA 2B1QA 2PYIA 1EFKA 4KODA 3FTDA 4XCVA 1XRSB 2NO1A 5HIIA 1THZA 4ND5A 2IEAA 3MGBA 4CF7A 2EWVA 2FRDC 3EOAI 2R7MA 3IPRA 2W6JD 4XYMA 3TZLA 3NBMA 4H31A 5ITZB 1RPTA 4UTXA 1OAOC 3AX6A 3KCQA 3KOOA 4PTZA 2IKQA 1L5HA 3UAGA 1AGNA 1KZGB 1EGAA 2OT3B 3I6MA 2O14A 5CLJA 3N07A 4DDWA 1HDRA 4JP2A 5JAPA 1COWA 4LYYA 2V03A 1TW2A 3K5IA 3BMCB 1IEXA 1WKVA 4ZVSA 4HJXA 4KRFA 2PWAA 1JLRA 1L6RA 1QHEA 3E9NA 3OQBA 5CBPA 1KXJA 4I9HA 1Y98A 3DNMA 3GY0A 3U9TA 2LUOA 2JKYA 1FQWA 1SCNE 4M55A 1G20E 1GYQA 2Q5OA 1EK2A 1J1ZA 1PG0A 4KHZA 3IHTA 1NQXA 3AF1A 1GQ2A 3U7EB 3HDJA 4AKGA 3W1WA 1BSVA 3NKLA 4D25A 1CUCA 3PDWA 3O26A 3IYLW 3I04A 3H1BA 1GPH1 3A4MA 3B8EA 3L49A 1XJWA 3USES 5TJ9A 4CW7A 2VH2A 1DVRA 2YOGA 3P2OA 1R7RA 4WAUA 3T7TA 3W3AD 3U4IA 2VTBA 5AHRA 4DPKA 1UJCA 2QX6A 2P5YA 1V5IA 2R7NA 2HJSA 4PNZA 4BMYA 3RVJA 2CV2A 3MBIA 4L3VA 2ZB8A 3W06A 2QS9A 4GYWA 1BDHA 2QMUA 4QRIA 3ZDXB 2DEUA 3PX7A 4YJDA 1YZNA 3Q5GA 4BY9E 1W1WA 2JIDA 3WKBA 5LMUB 1LRLA 2QJTA 4B3XA 1EXNA 2XUFA 5A4FS 3FZNA 4Q12A 5E6RA 2I4OA 5HF9A 3SR3A 5MFPA 2I7TA 2XZOA 2X0DA 1Y3CE 4TWIA 5BXYA 5IDVA 1X0XA 4GI3A 5DLPA 1RWQA 3SC2B 1LV8A 2YYAA 2I7DA 4GQAA 3HVRA 3K6KA 1MORA 3C3EA 3H5TA 2F3RA 2F2TA 3PUWA 1EI9A 1NDUA 2HLNA 3N0TA 4MZXA 2MYTA 1EUDA 4PFSA 4IHAA 5ALPA 4PGAA 2DFDA 3FHOA 4ETIA 3HABA 1PGQA 3U4DA 4A16A 3BMNB 4E6EA 1YH3A 3B13B 3E84A 1KRHA 3FCOA 1QDUA 1N2SA 3HC7A 3M4ZA 4NMMA 5H4HA 1B3BA 2FFJA 2AJCA 1M2KA 4PPYA 3BDIA 3KXDA 3OJLA 1IHDA 2BFAA 5B1IA 2ZUDA 5HKKD 2QF7A 3D6UA 3R6LA 3FNGA 3WJ7A 3R6GA 3IQDB 2FJUA 2O8EA 4UXJA 5THKA 2P27A 2ZRNA 2Q62A 1VPVA 2G6BA 2GPAA 3CW2A 2IX9A 2WZBA 1Y1RA 2DH6A 3BXZA 1XTUA 2G9RA 3DC7A 2HBYA 1Q0PA 3FH0A 2OCKA 1A82A 2M6RA 3FCXA 3H5WA 4NPHA 4P34A 3A6PC 2YH2A 3C6ZA 2E85A 4RSHA 4DM4A 5ECYA 1BFDA 1XEXB 3TL3A 1OGYA 4YTEA 2R44A 1UBTS 1XHFA 1NUPA 5KYYA 4LYJA 3WO0A 3LSTA 3AH8A 3V7UA 3NAMA 3Q8WA 4EA9A 2Y9MB 2FMTA 1SUDA 1Q0HA 4WLUA 1ODSA 5IVIA 3C1UA 2J9GA 4FZRA 5F52A 3ROZA 3RT7A 4UZSA 2QJRA 3LU1A 4P7BA 4ZO9A 1Z6TA 1X1QA 2Q5EA 2W43A 4X8OA 4XLZA 5SZKB 3RV3A 3L1UA 5D3QA 1WTAA 3KJZA 3AVOA 3QUTA 3G7UA 2BHNA 3UWOA 3CU5A 3V34A 3WV4A 1JLKA 4LXGA 5IYZA 2GRAA 2I4NA 1ZM4A 3GHYA 2QDXA 3KT8A 3LYAA 1E3QA 1IJFA 1NHGA 1P7PA 4CEJA 3R7SA 1ZGGA 5DYGA 1VB5A 3RS7A 5EP4A 3UAWA 1VPEA 3L4JA 4YRIA 4MEJA 1K6XA 1T0JB 4RLFA 3WLIA 3ZWKA 4DEYA 1G5RA 1QQ5A 1QTQA 2AOTA 1KNXA 3ICWA 4PRYA 4BGVA 4LF4B 2OLJA 5B6IA 3IR6A 4ENQA 1QTRA 1G2QA 2PKQP 2ZK7A 3BD7A 5EUQB 4ZFNA 3Q0EA 3WMXA 3H1FA 4MPJA 4AKSA 1QHIA 1WL8A 3F6RA 3UHPA 5JASA 5TQ2B 4V0RA 2I3DA 1OZFA 1U3UA 5EXPA 2HMUA 2QAGB 1NRJB 4P32A 4UEWA 4B9EA 4OX9Y 3FPKA 3KLMX 5FUBA 3U81A 3WJAA 1S0UA 4RZQA 1QOPB 1QIMA 4A1FA 4Y9TA 1RLTA 1V11A 2G77B 5TV2A 1QZZA 4RZHA 5J47A 2BSXA 3TRJA 4PIVA 2QAIA 1MW8X 4Q7LA 1FYXA 2J6HA 4ILKA 3KUCA 1TYCA 3MAAC 2P9ZA 4WK4B 2HO4A 2DPMA 3V46A 1MF7A 3DVRX 4IUCS 1SBZA 2ZVDA 3KKKA 5K3AA 3ZTYA 2AXQA 3CO5A 1IAVA 5KJFA 5FPTA 1Z5PA 1CJVC 5EE1A 2WNSA 1KOLA 4PZ9A 1T0UA 3Q2OA 5J58A 2GM3A 1RACA 1DX9A 5FV4A 2FPRA 3M4NA 4HD8A 4GZ3A 4EKNB 2XNSA 4PLFA 1PJ3A 5BSUA 2Q1XA 2EBHX 4NS1A 5ED0A 4A0HA 5TMDA 3QLTA 1C2TA 1Z08A 3KDAA 1QO9A 4NVRA 3WNDA 1V1MB 2BEUB 1JLMA 4P93A 3WQBA 1GU0A 1E98A 3BORA 3DAHA 1SWVA 4RSGA 3QXCA 1QRUA 5DMHA 5SZIA 4EZEA 4QYMA 3KVRA 2ZVQX 1J09A 1JHZA 4RD4A 4A8JA 3BRQA 1XZDA 5F23A 1MPXA 4KNWA 4J16A 1C30B 4O1MA 5AHKA 1X8JA 1U6IA 5DWQA 5BSVA 1NG1A 3R44A 4LMPA 1KSGA 8GPBA 5JD4A 5EIWA 3CRW1 4DLZA 1RXVA 4G0UA 3G13A 3AO0B 4IQGA 3TIVA 5C8ZA 4OI0A 2Z4RA 4PAWA 5BNFA 3R1IA 2IU0A 2ORVA 4DRXB 2C7QA 3AF5A 1CQIB 3GDHA 1PCXA 2BGLA 2AFIB 1F6BA 3VOSA 2HYDA 1AKNA 2YXDA 3CLUC 4G0ZA 4D56A 1BYUA 3VKHA 4H7IA 4HXFB 4NF2A 3TFWA 1W94A 1T3ZA 3IL2A 1AHPA 1VI6A 4ZAFA 1PFYA 2DX7A 2WSLA 2FWJA 2CSXA 1RC1A 5CEJA 5JNSA 4PC7A 1SBNE 3FKSA 4LRQA 1MB3A 3UTDA 4D96A 4X41A 2HC9A 4HX2A 4X8LA 4OJQA 3NIWA 4MS4B 5CIQA 1PEYA 4RTNA 1U7WA 1Y34E 3KC2A 4F97A 1BEUB 1Y5MA 5K3SA 1H1LB 1UBKS 3ZK8A 1BMDA 2C20A 3I5AA 4O2AA 4X85A 3I0NA 1YQ9A 4BV2A 5CFOA 2CUNA 3QW2A 4Q0MA 3VZRA 5H81A 1KBOA 1JHXA 3CVWA 3WKCA 3L1JA 1J9GA 1T5SA 4QLBA 1ZUD1 2EZTA 5GM2A 5TQ0A 5JBNA 4CL3A 4NSNA 2B6NA 4ALIA 1DKRA 1ZD5A 3AUTA 2JB9A 1EGHA 1R5JA 2ZRBA 3BA6A 1OX4A 3ZXUB 1ZK0A 3MELA 4NH0A 4MW7A 3QNWA 2VNAA 1T43A 3I23A 1PZGA 5LUBA 3ON5A 5I7RA 3S1SA 4HS4A 3SBOA 1HM5A 5JMPA 1K7YA 2WHEA 4FFBA 1ZD9A 4MI3A 1FRVA 1QVRA 1S3FA 2RSLA 3ILSA 4OTZA 4H1VA 3AEXA 4I50A 1BWQA 1P4GA 2Y1EA 2GLUA 4WN3A 3QPAA 1R4AA 1IC6A 1MP0A 3Q5EA 4ITVA 3HO8A 4MWTA 4XIYA 3WGNA 1RYZA 4N3AA 4D8TA 3KZMA 4EW6A 5A1JA 3A0UA 4EHAA 3ZVKA 2VL7A 1C81A 1XXHA 4AJHA 1C9MA 4PLZA 3SJBA 1FLVA 1Q21A 2JLZA 2QTNA 4PBSA 1JVNA 2ZXUA 4AY6A 3MLBA 1X1EA 4YCBA 3VX3A 4K3VA 2G72A 5DNCA 4WNYA 1P91A 5E6RB 3GROA 1QCCA 3P32A 4BO8A 4AS3A 4MEBA 4M89A 3LE8A 4DR4B 1E3IA 4AZ0A 2FWBA 3IP6A 4RV9A 3VU9A 1P5FA 3CCFA 4Z4FA 2Q6IA 1QR6A 2H5EA 4L4RA 3ETDA 2JLSA 2VDOB 4JOSA 2QTAA 1XB2A 4AS2A 2V3VA 4YUWA 1H2BA 5FCDA 3A7EA 3OQOA 4ZCLA 1HSZA 3LRPA 3JQ8B 4BGDA 2HLHA 4LFBB 4HGYA 3X43A 5A7HA 2ZI7A 4LWPA 3KE9A 4WN9B 3WG9A 4ER0A 2YZGA 4YRZA 5CITA 1MJGA 2WABA 5JAMA 3P9YA 3AHCA 4AO8A 1JSRA 5A06A 7REQB 4C43A 1GQOA 4LHEA 5LQUA 1JHQA 4C14A 5AUNB 1FTNA 4MHTA 2FRXA 2EU8A 2VDMB 1HL7A 1K68A 1Q0UA 3GUUA 3LVBA 5K8CA 5F98A 4S1WA 3LW7A 3TVTA 3HXOA 3R3UA 3W5BA 1GZ6A 5B2FA 2QY9A 5FI1B 1DXQA 3ROPA 1AVTA 4KYVA 1HE1C 1DAIA 2C88A 4N54A 3T3HA 4B4OA 2VS1A 1QC5A 1GRNA 2FWMX 4F6RA 1P1RA 2I76A 3ZTWA 2FEMA 2QGFA 2H54A 1GTG1 3OZXA 3TQHA 1WCYA 2V4ZA 1M2HA 1N5JA 3MT8A 5HF5A 1W52X 2XQFA 1TM4E 5AK0A 5NLLA 4EL5A 5IJZA 3KKNA 1OFGA 2CKDA 1KGSA 2CMFA 1N3YA 2V65A 1Q1ZA 4CQMA 4CL2A 2VJOA 4QBGB 3J81k 4Z2YA 5E1BA 4L8LA 2P6NA 3SVZA 1WVGA 3ZX4A 2V8BA 5FDFA 3SYNA 5BXQC 3T4XA 3H99A 3HKCA 2BRUC 4KPUA 1LLCA 4JT4A 2CDRA 2XGOA 2ZT7A 5T4BA 2FPXA 4DILA 2VNHA 1XYGA 1DG1G 4GS5A 1H9CA 1XSEA 1EZ4A 4EGCB 4GP6A 4GKBA 5TS3A 5JVDF 1UXGA 5L3RA 3DXXA 1GA6A 1JZSA 3VR4A 3TFOA 1PIWA 2WJJA 1SUFA 4D8VA 3PV0A 4J3FA 3T54A 1MIHA 1EA7A 1R4NA 2NU9B 2PUBA 1AKVA 4UDNA 1QP0A 3OA2A 5BYAA 2H3HA 1XLTA 1QB7A 3M81A 4D3YA 4ENSA 2GFIA 5BY2A 1F5SA 1QYIA 4R6XA 2ES4A 3UMSA 4TYWA 2WKQA 1GJRA 2WM8A 3C39A 4B9AA 2Q0XA 1AOXA 2Y0PA 3CKYA 3UKOA 4EB6A 3TXYA 1C1XA 2XSZD 4CBVA 3C16C 1FLNA 1NXSA 1F60A 2KX7A 3E5NA 3I92A 4EYKA 2Q6TA 2AJDA 4DWJA 3S1AA 4UHCA 2CXRA 5H9VA 3P5BA 3ORRA 2C2BA 3ETNA 4LYGA 2XUDA 4YIHA 5C1DA 2REXB 2BBSA 1CV2A 2P1ZA 3CX8A 3PQ6A 4JVLA 4LRTB 5DCYA 1SKYE 3NHMA 1E4VA 1Y82A 4RMGA 1CF9A 4ZAGA 2P91A 1OIVA 3A36A 3ESYA 3OT1B 1T2CA 1WHSB 4LWZA 3WYEA 1NOIA 4FOSA 2FP4B 4MWEA 4RWZA 4Q3CA 1S96A 1YKSA 4WL0A 4FDUA 1O8BA 5ICCA 1J49A 1T2NA 3WSWA 1XLWA 1PK8A 4IRXA 1RRMA 3OOJA 4KK4A 1PTJC 3BBLA 1YZUA 4RA9B 2O5RA 3GGCA 2HJHA 3RQIA 5FNVF 4IX1A 3PC2A 5DMXA 4M8SA 5IT4A 4JDUA 2GBLC 2H59A 3U17A 3YASA 2P65A 2VQ6A 1LA2A 3GVPA 4LECA 4DMMA 2IFTA 2QG9A 3BE4A 4INJA 1DZIA 2B69A 4RVGA 2XKKA 4NK5A 3D59A 3RI3A 3HP7A 2A0FA 5HCUA 2Z5GA 4BP9A 2PH7A 2ZJOA 3NV7A 3W2IA 3A3KA 1DCKA 3BSSA 3WRWA 4AULA 4DDVA 1G5HA 4ZAVA 4B44A 1S2DA 1NBOA 2CDCA 3DDCA 3UT6A 4B8YA 4C3OB 5IX8A 1R4ZA 1U90A 3H1TA 3GNQA 3LY7A 1AH2A 1K3UB 4ZI3A 1XTTA 4PZLA 4GMHA 1HYQA 4NNJA 3ZX5A 4DT1B 1X1RA 2J7PD 2CK3A 1LX7A 1SXJB 4HXEB 2CZQA 4LYHA 5EYPA 4C0XA 2IBSA 3TDNA 1ZD4A 3I2IA 2FY8A 4MQUA 2A5LA 4RVSA 5CX4A 1V26A 1JDTA 4TTQA 1M2GA 4FW9A 5FL3A 2PEYA 1SVNA 2XIQA 1G3MA 1XQWA 2YVQA 1VPDA 3O8BA 4PG6A 4EHJA 4HS9A 5KTKA 1C7JA 5L8VA 4CDNA 1N2OA 3OPXA 4HWTA 4XFDA 4YT8A 1FQJA 3UXMA 2OORA 2Q2VA 3RS5A 1V8DA 4X44A 4I4IA 1DI0A 2G71A 4M76B 1L0BA 2P41A 3RFCA 2XYVA 4OQQA 5DISB 5IJ9A 3UGJA 1L7AA 1P4SA 1RWKA 1VIVA 4FKMA 3UC9A 4CQLB 5JQGA 5K09A 4O2RA 3CZMA 4Y7CA 1P8AA 4FEAA 1ODJA 5IP5A 5A3JA 2QM8A 3PP8A 1PNVA 1JXQA 1SCIA 3DYVA 5C2JB 1LS1A 3OU2A 3ICEA 1IN1A 2AMYA 1I6KA 4IMIB 4EHBA 5DNDA 2EJVA 4OHOA 4XSHA 3RANA 3LX5A 1KFKB 4M1WA 5F12A 4PIPA 3ROQA 5CB0A 1MOPA 1X19A 2D4HA 3AVTA 3HDTA 2MT9A 3KVOA 3B6EA 2VP4A 4H7KA 4P7KA 1V4NA 3THXB 1OI2A 3VR4H 4HFMA 3NVDA 3A9CA 2O48X 5JAUA 1QVZA 2OQVA 2C7PA 4U7GA 1U4NA 2BFDA 2ZETA 1J8DA 3L9WA 3U5ZB 1MLDA 1JVSA 3DMGA 4X65B 2A9RA 3OJCA 2X23A 3OFJA 2HUNA 1JEQA 3KP1A 3OF5A 3OD5A 3KQKA 4EG6A 2AN3A 4PTYA 1VMKA 5A6SB 3ZGZA 1HYBA 5JJIA 1EMDA 2ISSD 1PLLA 3A37A 3D31A 3LX6A 2HHCA 1BWRA 1KJ8A 1XGKA 3Q2KA 4RZUA 1Z3IX 1TL7C 2J0EA 3UB3A 1Q95A 4R1NA 4FILA 4O4HB 1PEKE 2EFEB 2PCLA 3I34X 1G20A 3QUCA 1P6UA 1Z75A 2IY9A 4QRDA 3CH6A 1Y6GA 1OV6A 4WBNF 3LQ2A 1DBSA 3A14A 3WDKA 3B1JA 4EPRA 1YDHA 3HJBA 4QFCA 3WGJA 1RCFA 3H11A 1BS2A 1ZSYA 2XAAA 2JASA 2GK7A 2OL4A 3AOEA 3G2IA 2GS9A 4V39A 1TJ3A 5HQJA 3ZYCA 4QBIA 2XR1A 3IRUA 4OQZA 1A9TA 1D3AA 1CUYA 1HF3A 1XJ0A 2GEVA 2B92A 3EIHA 1RP1A 4R3WA 2TMDA 4Y2TA 5LD2B 1X1SA 4LV5B 3X2SA 1T3GA 3FVTA 1YQXA 3QIVA 1Z9BA 4YAUA 1QF7A 1Y4UA 2KYRA 3IHKA 4S1TA 3U9LA 5PGMA 4X0EA 5I4BA 5KOHA 3QKRA 2C58A 4OKIA 4DLUA 1IQUA 3LCRA 3Q15C 3R41A 1EFHA 5HFJA 1TYAE 1V5GA 3HP1A 5LZ8A 1VG8A 5AIBA 3BK1A 2O8VA 3E9ZA 1P45A 2V54A 1M5TA 3M4XA 5CNMA 1SQ5A 1ZHOA 4X66B 4Y2XA 4HH3C 4BQOA 3ZBQA 1GITA 4HGNA 4C3VA 4BPRA 1E99A 1EAYA 1I4OA 4DAOA 2LKCA 3C5VA 1CFJA 3FKQA 1VLMA 1JTEA 2B83A 3G8YA 3PDIB 3GI1A 4WKGA 5BN5B 1E7QA 5JSYA 3AOEC 3EDYA 4RAQA 2PRKA 2ZSHA 3ZVMA 2I8CA 2NVUA 4WN9A 4EHHA 2X9VA 5D8DA 2I6QA 1YB4A 2G9UA 1N8NA 1DV2A 1GFZA 2X41A 3V1TC 1U02A 4NXMB 1OGIA 4CGZA 2FTKE 4LC0A 3C5CA 1E1RD 1W59A 4EVIA 1LLUA 2QUJA 2WYOA 3AB3A 3G0IA 3HR8A 2G1JA 1RXEA 4HJRA 5FLYA 2NO5A 2RK6A 3SR4A 3WLKX 3ICQB 5B12A 5K0SA 3VYWA 1IULA 5FTLA 3B85A 4GZ6A 2FX2A 5EJ2A 4AZ0B 1U5AA 1T9BA 1K88A 4HUQA 3W90A 1P0QA 4GUDA 4YUVA 4GXTA 4RD1A 1R00A 1N2XA 2VH5R 4GFDA 2VT2A 3D5QA 3IDSA 4DLVA 5JI3E 1FYWA 3EF1A 4N76A 3O1IC 4RSMA 4YMWA 1YFZA 3KTOA 7MDHA 1EK1A 2PIDA 4ZD6A 3ZXYA 3QKTA 1VDMA 1J8FA 1K63A 1CQZA 2IHVA 2RGNA 2J32A 3BMQA 2PKEA 3PQDA 3RB8A 4DLYA 3OZ7A 1Z4JA 4BC0A 2B7LA 1XC7A 2WSMA 2HXYA 3DV9A 3IXLA 5ALHA 4E1VA 5JDCC 3IV6A 4NESA 3ITKA 1ISIA 5K20A 3W2HA 1CVIA 1H2ZA 3EZGA 4FMDF 1GWNA 3PQCA 2NO7A 2YIJA 4KBYA 4KLCA 2C5BA 2XUIA 3DYIA 2P0EA 4C6TB 4KNYA 4FI3F 1T0IA 3ROMA 5C32A 4TYYA 3IOBA 2WU4A 1ZR4A 3BMXA 1RC0A 1XELA 4UBKA 4OHVA 1ZM7A 3BQ9A 3ZW7A 4YQYA 2BIFA 4RHFA 2NZJA 2XZTA 1QBGA 3DKKA 2EIHA 4PHTA 4LE0A 4MV0A 4QICA 1EP1B 1PF7E 3CMCO 2Z9CA 4NMLA 2C04A 1R9MA 2YICA 1L9KA 3HCDA 4HAOA 1BU8A 1J2YA 4N7BA 1X1DA 4R8LA 2ERCA 3NBZC 1JIJA 1K7FB 4I55F 3ZWVA 4X7MA 3GLSA 2I22A 5EINA 1PR5A 1XU7A 3F5FA 2QD5A 4A27A 4BJ1A 1C7ZA 5KYXB 1N0IA 3IAS6 3SDBA 1JDBC 2VJDA 3I76A 1FNSA 1Z74A 2X0JA 4JUCA 4WDQA 1JF8A 4WEOA 5AMXA 1ZI9A 1TUBB 3C7KA 1GFSA 1Z7EA 3QEKA 5AW3A 3WYAA 3GDFA 1HQDA 4PU0A 3VPGA 1Y8CA 1C3OB 4KGVA 2M98A 1UINA 1YRYE 5J4YA 4DIFA 2DU8A 1JXAA 3MRTA 4FFVA 4C0HA 1CNFA 3SHQA 4JI5B 4C4ZA 5I9LA 4HVCA 4O4LA 1RJWA 2VR1A 4O63O 4HQRA 1KP9A 4RDHA 2DPXA 1X13A 2IEIA 5DBFA 3AK4A 4H7JA 1SEPA 2EKDA 1M67A 5KWSA 4DQUA 4JYCA 3WWYA 1Y37A 5JANA 1UXJA 4TV8A 3AUAA 1XMXA 3F5QA 1PJ2A 2ZBRA 4G97A 4BQQA 4RD3A 4Z7QB 4HRYA 4JI4B 1TYBE 3AFIA 4W5JA 4F4UA 3CA8A 2BHRA 2AT1A 1JR3A 1KY3A 2HF2A 5DX0A 4TQAA 3H5NA 4E88A 5IHXA 4MK4A 3JZFA 4HB4A 3OE7D 1L4NA 1QRRA 4WKPA 4DG8A 2C9YA 2HWYA 3NHPA 3AKEA 4MYDA 1EBBA 1FBTA 5CB8A 1Q0TA 1FP6A 3DWIA 3PC7A 3R7FA 3SJ7A 4BQFA 5JSZB 4KQFA 1BMTA 2F1KA 4M49A 4ZOLA 1WZCA 3Q87B 3RSLA 3BICA 4B0OA 2AJ8A 2XTJA 3A1UA 4Y1RB 3HO6A 4DPMA 5TX7A 3VZDA 1NP7A 2Z98A 3ZE7A 5CCBA 5J2TF 5FWXA 4AF7A 3GUVA 2BFEA 2QGNA 3INNA 4B76A 2LW7A 2RAPA 3QYAA 3F8WA 3JQ6A 3B1FA 5DLQC 2DUUA 2P0AA 3EWAA 3CF0A 3LUHA 2WZDA 3JATA 3AI3A 4FFNA 2FE1A 1ESEA 4K46A 3F5MA 4LDAA 4URZR 1GTVA 3HCFA 4F3KA 5DYTA 5HNKA 3HZZA 3SLRA 4QNRA 5LC1A 1DAMA 3I8OA 4CVNA 4PHFA 5JAHA 1EDOA 3W4IA 3HWX1 1MB0A 4M9ZA 4MGEA 2P67A 4JL5A 3WIBA 1JVBA 4D0RA 2GRUA 1BU5A 2D62A 2YQ5A 3N76A 1ZCZA 2IDKA 4TRRA 2X0NA 1EPUA 3COPA 4MR9B 2QLJA 3V00A 5CXXA 1VJ1A 1TM2A 3VAAA 2Y68A 3WK8A 2O7RA 2ZRHA 4XEHA 3TNLA 4AF8A 4UOEA 2IUUA 4H7EA 2DC1A 1H2XA 3N53A 2ATVA 3TF5A 3CLSC 4EUEA 4M60A 4AQ7A 4XXHA 4C78A 1DAFA 1MR3F 3SPXA 2NUTB 4V0SA 3RRXA 3QBTA 4Y9DA 4B80A 3CRZA 2MR6A 2PMDA 4OP3A 4H1HA 3N05A 3ZDEA 3TUZC 1OXUA 4DZZA 1UKBA 2PD3A 2EJTA 3D2AA 3V7YA 1E2MA 3G89A 3HYTA 2HCTA 3MMXA 5DNAA 1Y9DA 3ADDA 5IAGA 1RCTE 4QUGA 3CN9A 4GICA 4ZZIA 5EE0A 1CZUA 3IUQA 3V1YA 4NBLA 5JSZA 3QU4A 3T7CA 1FVXA 2DQSA 2YWEA 3DE5X 3M6LA 3TEJA 3I9MA 1RJEA 1DHTA 1OF1A 2QV7A 1CUZA 1MABB 1ZICA 3L8ZA 3P71T 2DFKB 4LGCA 5JMTA 1FDRA 3T7RA 5F2OA 3JCZA 1XXHE 3SD7A 4Q3NA 1PL6A 1PJZA 3B9RA 1CQWA 3H2KA 4BVAA 4JYAB 1ZK4A 1MENA 3OMWA 2NSJA 1R6XA 5FL7A 2EJBA 2PX5A 1Q11A 2RGUA 4EY6A 2UUBB 4YV2A 2V1UA 1PR9A 1SU4A 2I7VA 4HH1A 5B58C 2YY7A 3EYAA 3M6XA 4XYGA 3I2HA 1NRIA 1QIKA 3NTLA 1T4BA 3LGAA 5CVEA 3EPHA 2J7PA 3OP1A 1UOOA 3DOIA 1X8KA 4GZMA 5C34B 2DERA 2BMEA 2QG6A 3PEFA 3WLAA 3SKVA 5BN1A 4ZU6X 4WTOA 3DTTA 1Z5UA 1A8IA 1EESA 5KHAA 3JAKA 4R6WA 5CTJA 2C5EA 3FRJA 2VJNA 2P6PA 2V7TA 3IBTA 1CJCA 4H18A 3AVXA 1B73A 5CT8A 4PFKA 1UZUA 2WWGA 4G0MA 4H4DA 3AV3A 1JG6A 1SD2A 1L5FA 3WIVA 2GVNA 4XWAA 2Q1TA 3ADKA 4INZA 4BNZA 2C4NA 1A1VA 3ZJ5A 1NVKA 2ANBA 2P4EA 2WTEA 4PZYA 5F76A 4QQKA 1FLDA 1NVTA 3VOAA 2G70A 3IKLA 2NU8B 4QU5A 2XMBA 1Q7GA 2IYWA 4Z1MD 1A8PA 2BMFA 1EX1A 3PGMA 3S2UA 3U26A 4DQVA 3HJRA 4UQOA 4CEHB 2VA8A 4BNIA 3BC1A 3LP5A 5DLDA 2OAEA 4G85A 3NDJA 4JB3A 4DLPA 4ZRDA 4V2IA 2WUFA 1ODCA 5DSXA 3RRMA 1XTKA 3BGOS 5I9TA 1UMCA 3D6MA 2OBNA 1D2RA 3ZU4A 2W6JA 5SY4A 1U7TA 5IJWA 4WXMA 5C51B 1MEJA 1PS0A 3HNRA 1G0NA 1EE1A 2BTQB