3TSHA

Crystal structure of phl p 4, a grass pollen allergen with glucose dehydrogenase activity
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and immunologic characterization of the major grass pollen allergen Phl p 4.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen, oxidoreductase
molecule keywords Pollen allergen Phl p 4
total genus 172
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tshA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tshA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 3tshA03
1FFVC 3SR6B 5AE2A 5L6GA 4ML8A 5FXEA 4XLOA 1WYGA 1W1LA 2Y3SA 1W1RA 5K8EA 5FXFA 1AHVA 5HMRA 3JS8A 4EC3A 1W1MA 1V97A 3FW9A 4UD8A 5HHZA 3S1EA 3HSUA 3NS1B 4PZFA 3POPA 2BVHA 3ETRB 5I1WA 3FW8A 4BC9A 1VAOA 3DQ0A 2Q85A 3W8ZA 3EUB3 1MBBA 3TSJA 5ADZA 2MBRA 2VFRA 1N61C 1QLTA 2Y3RA 3KJMA 3PQBA 1DIIA 1AHZA 1WVFA 3S1DA 1FIQB 3D2JA 5AE1A 1DZNA 2VFSA 2WDWA 1DIQA 1T3QC 2AXRA 4PVHA 3S1CA 3S1FA 3VTEA 2QKNA 5I1VA 1E8HA 1MBTA 4DNSA 3TSHA 5FXDA 2VFUA 5D79A 1VDVA 3W8WA 3FW7A 5AE3A 1JROA 2Y4GA 4BBYA 1UXYA 3NRZB 3RJAA 3D2HA 3AN1A 3FWAA 1W1KA 2GQUA 2I0KA 4JAYA 2VAOA 1QLUA 2BVFA 1ZR6A 2GQTA 3D2DA 4O95A 1FO4A 3PM9A 3AMZA 1I19A 1E0YA 2VFVA 2W54A 4BCAA 3RJ8A 4JB1A 4MLAA 2E3TA 1ZXIC 2W3RA 3W8XA 1E8FA 3C0PA 3NVZB 3BW7A 4PVJA 2EXRA 1W1OA 1N5XA 4PVEA 3AM9A 5FXPA 2QPMA 1N63C 2Y08A 1HSKA 1N60C 1W1JA 5L6FA 1W1QA 4PVKA 1W1SA 2BVGA 1AHUA 1FFUC 1N5WC 1E8GA 2W55A 2VFTA 3GSYA 4BC7A 1WVEA 4OALA 2IPIA 3I99A 5HQXA 3B9JB 1N62C 2Q4WA 4ZOHB 3TX1A 1F0XA 5AWVA 4PWBA 4PYTA 4PWCA 2W3SA
chains in the Genus database with same CATH superfamily
1FFVC 3SR6B 5AE2A 3LAEA 4ML8A 5L6GA 5FXEA 4XLOA 1WYGA 1W1LA 2Y3SA 1W1RA 3EJEB 5K8EA 5FXFA 3NVVB 2P13A 1AHVA 5HMRA 2R8DA 2PLIA 3JS8A 4EC3A 1W1MA 1V97A 3FW9A 4UD8A 5HHZA 3S1EA 2P3HA 3HSUA 3NS1B 4PZFA 3POPA 1JRPA 2BVHA 3ETRB 3EJBB 5I1WA 3FW8A 4BC9A 1VAOA 3DQ0A 2Q85A 2PLSA 3W8ZA 3EUB3 1MBBA 3TSJA 5ADZA 2MBRA 2VFRA 3HRDC 5G5GB 1N61C 1QLTA 2Y3RA 3KJMA 3PQBA 1DIIA 1AHZA 1WVFA 3S1DA 4HG0A 1FIQB 3NVYB 3D2JA 5AE1A 2OAIA 2UUUA 1DZNA 2VFSA 2WDWA 1DIQA 1T3QC 2AXRA 4PVHA 3S1CA 2UUVA 3S1FA 3VTEA 2QKNA 5I1VA 1E8HA 1MBTA 4DNSA 3LLBA 2R2ZA 3TSHA 2YVSA 5FXDA 2VFUA 5D79A 1VDVA 3W8WA 2NQWA 3FW7A 3DEDA 5AE3A 1JROA 2Y4GA 4BBYA 1UXYA 3NRZB 3RJAA 3D2HA 3AN1A 3FWAA 1SB3B 1W1KA 2GQUA 2I0KA 4JAYA 2VAOA 1QLUA 2BVFA 1ZR6A 2GQTA 3D2DA 4O95A 1FO4A 3PM9A 2P4PA 3AMZA 1I19A 5G5HB 3NVWB 1E0YA 2VFVA 2W54A 4BCAA 1RM6B 3RJ8A 4JB1A 4MLAA 2E3TA 1ZXIC 2W3RA 3W8XA 1E8FA 3C0PA 3NVZB 3BW7A 4PVJA 2RK5A 2EXRA 1W1OA 1N5XA 4PVEA 3AM9A 5FXPA 2QPMA 2O3GA 1N63C 2Y08A 1HSKA 1N60C 1W1JA 5L6FA 1W1QA 4PVKA 1W1SA 2BVGA 1AHUA 1FFUC 1N5WC 1E8GA 2W55A 2VFTA 3EJDB 3GSYA 4BC7A 1WVEA 4OALA 2IPIA 3I99A 5HQXA 3B9JB 1N62C 2Q4WA 4ZOHB 3TX1A 1F0XA 5AWVA 4PWBA 4PYTA 4PWCA 2W3SA
chains in the Genus database with same CATH topology
1FFVC 3SR6B 5AE2A 3LAEA 4ML8A 5L6GA 5FXEA 4XLOA 1WYGA 1W1LA 2Y3SA 1W1RA 5K8EA 5FXFA 2P13A 3NVVB 1AHVA 5HMRA 2R8DA 2PLIA 3JS8A 4EC3A 1W1MA 1V97A 3FW9A 4UD8A 5HHZA 3S1EA 2P3HA 3HSUA 3NS1B 4PZFA 3POPA 1JRPA 2BVHA 3ETRB 5I1WA 3FW8A 4BC9A 1VAOA 3DQ0A 2Q85A 2PLSA 3W8ZA 3EUB3 1MBBA 3TSJA 5ADZA 2MBRA 2VFRA 3HRDC 5G5GB 1N61C 1QLTA 2Y3RA 3KJMA 3PQBA 1DIIA 1AHZA 1WVFA 3S1DA 4HG0A 1FIQB 3NVYB 3D2JA 5AE1A 2OAIA 2UUUA 1DZNA 2VFSA 2WDWA 1DIQA 1T3QC 2AXRA 4PVHA 3S1CA 2UUVA 3S1FA 3VTEA 2QKNA 5I1VA 1E8HA 1MBTA 4DNSA 3LLBA 2R2ZA 3TSHA 2YVSA 5FXDA 2VFUA 5D79A 1VDVA 3W8WA 2NQWA 3FW7A 3DEDA 5AE3A 1JROA 2Y4GA 4BBYA 1UXYA 3NRZB 3RJAA 3D2HA 3AN1A 3FWAA 1SB3B 1W1KA 2GQUA 2I0KA 4JAYA 2VAOA 1QLUA 2BVFA 1ZR6A 2GQTA 3D2DA 4O95A 1FO4A 3PM9A 2P4PA 3AMZA 1I19A 5G5HB 3NVWB 1E0YA 2VFVA 2W54A 4BCAA 1RM6B 3RJ8A 4JB1A 4MLAA 2E3TA 1ZXIC 2W3RA 3W8XA 1E8FA 3C0PA 3NVZB 3BW7A 4PVJA 2RK5A 2EXRA 1W1OA 1N5XA 4PVEA 3AM9A 5FXPA 2QPMA 2O3GA 1N63C 2Y08A 1HSKA 1N60C 1W1JA 5L6FA 1W1QA 4PVKA 1W1SA 2BVGA 1AHUA 1FFUC 1N5WC 1E8GA 2W55A 2VFTA 3GSYA 4BC7A 1WVEA 4OALA 2IPIA 3I99A 5HQXA 3B9JB 1N62C 2Q4WA 4ZOHB 3TX1A 1F0XA 5AWVA 4PWBA 4PYTA 4PWCA 2W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFV C;  3SR6 B;  5AE2 A;  5L6G A;  4ML8 A;  5FXE A;  4XLO A;  1WYG A;  1W1L A;  2Y3S A;  1W1R A;  5K8E A;  5FXF A;  1AHV A;  5HMR A;  3JS8 A;  4EC3 A;  1W1M A;  1V97 A;  3FW9 A;  4UD8 A;  5HHZ A;  3S1E A;  3HSU A;  3NS1 B;  4PZF A;  3POP A;  2BVH A;  3ETR B;  5I1W A;  3FW8 A;  4BC9 A;  1VAO A;  3DQ0 A;  2Q85 A;  3W8Z A;  3EUB 3;  1MBB A;  3TSJ A;  5ADZ A;  2MBR A;  2VFR A;  1N61 C;  1QLT A;  2Y3R A;  3KJM A;  3PQB A;  1DII A;  1AHZ A;  1WVF A;  3S1D A;  1FIQ B;  3D2J A;  5AE1 A;  1DZN A;  2VFS A;  2WDW A;  1DIQ A;  1T3Q C;  2AXR A;  4PVH A;  3S1C A;  3S1F A;  3VTE A;  2QKN A;  5I1V A;  1E8H A;  1MBT A;  4DNS A;  3TSH A;  5FXD A;  2VFU A;  5D79 A;  1VDV A;  3W8W A;  3FW7 A;  5AE3 A;  1JRO A;  2Y4G A;  4BBY A;  1UXY A;  3NRZ B;  3RJA A;  3D2H A;  3AN1 A;  3FWA A;  1W1K A;  2GQU A;  2I0K A;  4JAY A;  2VAO A;  1QLU A;  2BVF A;  1ZR6 A;  2GQT A;  3D2D A;  4O95 A;  1FO4 A;  3PM9 A;  3AMZ A;  1I19 A;  1E0Y A;  2VFV A;  2W54 A;  4BCA A;  3RJ8 A;  4JB1 A;  4MLA A;  2E3T A;  1ZXI C;  2W3R A;  3W8X A;  1E8F A;  3C0P A;  3NVZ B;  3BW7 A;  4PVJ A;  2EXR A;  1W1O A;  1N5X A;  4PVE A;  3AM9 A;  5FXP A;  2QPM A;  1N63 C;  2Y08 A;  1HSK A;  1N60 C;  1W1J A;  5L6F A;  1W1Q A;  4PVK A;  1W1S A;  2BVG A;  1AHU A;  1FFU C;  1N5W C;  1E8G A;  2W55 A;  2VFT A;  3GSY A;  4BC7 A;  1WVE A;  4OAL A;  2IPI A;  3I99 A;  5HQX A;  3B9J B;  1N62 C;  2Q4W A;  4ZOH B;  3TX1 A;  1F0X A;  5AWV A;  4PWB A;  4PYT A;  4PWC A;  2W3S A; 
#chains in the Genus database with same CATH topology
 1FFV C;  3SR6 B;  5AE2 A;  3LAE A;  4ML8 A;  5L6G A;  5FXE A;  4XLO A;  1WYG A;  1W1L A;  2Y3S A;  1W1R A;  3EJE B;  5K8E A;  5FXF A;  3NVV B;  2P13 A;  1AHV A;  5HMR A;  2R8D A;  2PLI A;  3JS8 A;  4EC3 A;  1W1M A;  1V97 A;  3FW9 A;  4UD8 A;  5HHZ A;  3S1E A;  2P3H A;  3HSU A;  3NS1 B;  4PZF A;  3POP A;  1JRP A;  2BVH A;  3ETR B;  3EJB B;  5I1W A;  3FW8 A;  4BC9 A;  1VAO A;  3DQ0 A;  2Q85 A;  2PLS A;  3W8Z A;  3EUB 3;  1MBB A;  3TSJ A;  5ADZ A;  2MBR A;  2VFR A;  3HRD C;  5G5G B;  1N61 C;  1QLT A;  2Y3R A;  3KJM A;  3PQB A;  1DII A;  1AHZ A;  1WVF A;  3S1D A;  4HG0 A;  1FIQ B;  3NVY B;  3D2J A;  5AE1 A;  2OAI A;  2UUU A;  1DZN A;  2VFS A;  2WDW A;  1DIQ A;  1T3Q C;  2AXR A;  4PVH A;  3S1C A;  2UUV A;  3S1F A;  3VTE A;  2QKN A;  5I1V A;  1E8H A;  1MBT A;  4DNS A;  3LLB A;  2R2Z A;  3TSH A;  2YVS A;  5FXD A;  2VFU A;  5D79 A;  1VDV A;  3W8W A;  2NQW A;  3FW7 A;  3DED A;  5AE3 A;  1JRO A;  2Y4G A;  4BBY A;  1UXY A;  3NRZ B;  3RJA A;  3D2H A;  3AN1 A;  3FWA A;  1SB3 B;  1W1K A;  2GQU A;  2I0K A;  4JAY A;  2VAO A;  1QLU A;  2BVF A;  1ZR6 A;  2GQT A;  3D2D A;  4O95 A;  1FO4 A;  3PM9 A;  2P4P A;  3AMZ A;  1I19 A;  5G5H B;  3NVW B;  1E0Y A;  2VFV A;  2W54 A;  4BCA A;  1RM6 B;  3RJ8 A;  4JB1 A;  4MLA A;  2E3T A;  1ZXI C;  2W3R A;  3W8X A;  1E8F A;  3C0P A;  3NVZ B;  3BW7 A;  4PVJ A;  2RK5 A;  2EXR A;  1W1O A;  1N5X A;  4PVE A;  3AM9 A;  5FXP A;  2QPM A;  2O3G A;  1N63 C;  2Y08 A;  1HSK A;  1N60 C;  1W1J A;  5L6F A;  1W1Q A;  4PVK A;  1W1S A;  2BVG A;  1AHU A;  1FFU C;  1N5W C;  1E8G A;  2W55 A;  2VFT A;  3EJD B;  3GSY A;  4BC7 A;  1WVE A;  4OAL A;  2IPI A;  3I99 A;  5HQX A;  3B9J B;  1N62 C;  2Q4W A;  4ZOH B;  3TX1 A;  1F0X A;  5AWV A;  4PWB A;  4PYT A;  4PWC A;  2W3S A; 
#chains in the Genus database with same CATH homology
 1FFV C;  3SR6 B;  5AE2 A;  3LAE A;  4ML8 A;  5L6G A;  5FXE A;  4XLO A;  1WYG A;  1W1L A;  2Y3S A;  1W1R A;  5K8E A;  5FXF A;  2P13 A;  3NVV B;  1AHV A;  5HMR A;  2R8D A;  2PLI A;  3JS8 A;  4EC3 A;  1W1M A;  1V97 A;  3FW9 A;  4UD8 A;  5HHZ A;  3S1E A;  2P3H A;  3HSU A;  3NS1 B;  4PZF A;  3POP A;  1JRP A;  2BVH A;  3ETR B;  5I1W A;  3FW8 A;  4BC9 A;  1VAO A;  3DQ0 A;  2Q85 A;  2PLS A;  3W8Z A;  3EUB 3;  1MBB A;  3TSJ A;  5ADZ A;  2MBR A;  2VFR A;  3HRD C;  5G5G B;  1N61 C;  1QLT A;  2Y3R A;  3KJM A;  3PQB A;  1DII A;  1AHZ A;  1WVF A;  3S1D A;  4HG0 A;  1FIQ B;  3NVY B;  3D2J A;  5AE1 A;  2OAI A;  2UUU A;  1DZN A;  2VFS A;  2WDW A;  1DIQ A;  1T3Q C;  2AXR A;  4PVH A;  3S1C A;  2UUV A;  3S1F A;  3VTE A;  2QKN A;  5I1V A;  1E8H A;  1MBT A;  4DNS A;  3LLB A;  2R2Z A;  3TSH A;  2YVS A;  5FXD A;  2VFU A;  5D79 A;  1VDV A;  3W8W A;  2NQW A;  3FW7 A;  3DED A;  5AE3 A;  1JRO A;  2Y4G A;  4BBY A;  1UXY A;  3NRZ B;  3RJA A;  3D2H A;  3AN1 A;  3FWA A;  1SB3 B;  1W1K A;  2GQU A;  2I0K A;  4JAY A;  2VAO A;  1QLU A;  2BVF A;  1ZR6 A;  2GQT A;  3D2D A;  4O95 A;  1FO4 A;  3PM9 A;  2P4P A;  3AMZ A;  1I19 A;  5G5H B;  3NVW B;  1E0Y A;  2VFV A;  2W54 A;  4BCA A;  1RM6 B;  3RJ8 A;  4JB1 A;  4MLA A;  2E3T A;  1ZXI C;  2W3R A;  3W8X A;  1E8F A;  3C0P A;  3NVZ B;  3BW7 A;  4PVJ A;  2RK5 A;  2EXR A;  1W1O A;  1N5X A;  4PVE A;  3AM9 A;  5FXP A;  2QPM A;  2O3G A;  1N63 C;  2Y08 A;  1HSK A;  1N60 C;  1W1J A;  5L6F A;  1W1Q A;  4PVK A;  1W1S A;  2BVG A;  1AHU A;  1FFU C;  1N5W C;  1E8G A;  2W55 A;  2VFT A;  3GSY A;  4BC7 A;  1WVE A;  4OAL A;  2IPI A;  3I99 A;  5HQX A;  3B9J B;  1N62 C;  2Q4W A;  4ZOH B;  3TX1 A;  1F0X A;  5AWV A;  4PWB A;  4PYT A;  4PWC A;  2W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...