3TSHA

Crystal structure of phl p 4, a grass pollen allergen with glucose dehydrogenase activity
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4
publication title Crystal structure and immunologic characterization of the major grass pollen allergen Phl p 4.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen, oxidoreductase
total genus 172
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tshA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tshA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 3tshA03
2Q4WA 1V97A 1FO4A 2GQUA 5FXFA 1I19A 1W1MA 3C0PA 3SR6B 1N62C 3W8ZA 3FW8A 4JAYA 5FXDA 1E0YA 5K8EA 4JB1A 3KJMA 1W1JA 3AM9A 2Q85A 5D79A 1W1SA 2VFTA 4PZFA 1AHVA 2VFRA 5HHZA 1WVFA 3VTEA 3PQBA 1N5WC 1WVEA 5HQXA 1N61C 1W1KA 2AXRA 1E8GA 3GSYA 1VDVA 4PWBA 4ZOHB 4PVKA 2Y08A 2Y3SA 3ETRB 1MBTA 1JROA 3NRZB 2MBRA 3D2DA 2QPMA 5L6FA 3S1DA 5L6GA 3D2HA 2Y4GA 1W1LA 3FW9A 2E3TA 5FXEA 3AMZA 2BVGA 4BBYA 2EXRA 3BW7A 3B9JB 1N5XA 3S1EA 4PVEA 3JS8A 2VFSA 5FXPA 2W3SA 4XLOA 1W1OA 5I1WA 3AN1A 4PVJA 1N63C 1HSKA 1T3QC 3FWAA 2VFUA 2W54A 1E8FA 1W1QA 2I0KA 4UD8A 1N60C 4ML8A 3I99A 5AE3A 1ZR6A 1FFUC 4PVHA 3S1CA 5ADZA 3W8XA 4OALA 3HSUA 1DZNA 1F0XA 2W3RA 1FIQB 1FFVC 3FW7A 1W1RA 2BVFA 5I1VA 4O95A 3EUB3 3W8WA 4BC7A 2BVHA 3DQ0A 4MLAA 4DNSA 1DIIA 2Y3RA 5HMRA 4PWCA 1MBBA 2VFVA 3TSJA 4BC9A 3S1FA 1WYGA 3NVZB 1E8HA 1VAOA 1AHZA 3POPA 3RJAA 3TSHA 1UXYA 2W55A 2QKNA 2VAOA 5AE1A 5AE2A 1DIQA 3D2JA 3TX1A 4EC3A 2GQTA 1QLUA 3NS1B 1AHUA 1QLTA 1ZXIC 4PYTA 4BCAA 3PM9A 3RJ8A 5AWVA 2WDWA 2IPIA
chains in the Genus database with same CATH superfamily
2Q4WA 1V97A 2RK5A 1FO4A 2GQUA 3NVVB 5FXFA 1I19A 1W1MA 3C0PA 3SR6B 1SB3B 1N62C 3W8ZA 3FW8A 4JAYA 5FXDA 2PLSA 1E0YA 5K8EA 4JB1A 3KJMA 1W1JA 3AM9A 2Q85A 5D79A 1W1SA 2VFTA 4PZFA 1AHVA 2VFRA 5HHZA 1WVFA 3VTEA 3PQBA 1N5WC 1WVEA 5HQXA 1N61C 1W1KA 2AXRA 3DEDA 1E8GA 3GSYA 1JRPA 1VDVA 4PWBA 4ZOHB 4PVKA 3LLBA 2Y08A 3LAEA 2Y3SA 3ETRB 1MBTA 4HG0A 1JROA 3NRZB 2MBRA 3D2DA 2QPMA 5L6FA 3S1DA 2P4PA 5L6GA 3D2HA 2Y4GA 2R8DA 2O3GA 1W1LA 3FW9A 1RM6B 2PLIA 2E3TA 5FXEA 3AMZA 2BVGA 4BBYA 2EXRA 3BW7A 3B9JB 1N5XA 3S1EA 4PVEA 3JS8A 2VFSA 5FXPA 2W3SA 4XLOA 1W1OA 5I1WA 3AN1A 2R2ZA 3EJBB 4PVJA 1N63C 1HSKA 2UUUA 1T3QC 3FWAA 2VFUA 2W54A 3NVWB 1E8FA 1W1QA 2I0KA 4UD8A 1N60C 4ML8A 3I99A 5AE3A 1ZR6A 1FFUC 4PVHA 3S1CA 5ADZA 3W8XA 4OALA 3HSUA 1DZNA 1F0XA 2W3RA 1FIQB 1FFVC 3FW7A 1W1RA 2BVFA 5I1VA 4O95A 3EUB3 3W8WA 4BC7A 2BVHA 2NQWA 3DQ0A 4MLAA 4DNSA 1DIIA 2Y3RA 5HMRA 4PWCA 1MBBA 2VFVA 3TSJA 4BC9A 3S1FA 1WYGA 3NVZB 2P3HA 2OAIA 1E8HA 1VAOA 1AHZA 3POPA 2UUVA 3RJAA 3TSHA 1UXYA 2W55A 2QKNA 2VAOA 5AE1A 5AE2A 1DIQA 3D2JA 3TX1A 4EC3A 2GQTA 2YVSA 1QLUA 3NS1B 1AHUA 3NVYB 1QLTA 1ZXIC 4PYTA 3EJEB 4BCAA 3HRDC 2P13A 3PM9A 5G5GB 5G5HB 3RJ8A 5AWVA 2WDWA 3EJDB 2IPIA
chains in the Genus database with same CATH topology
2Q4WA 1V97A 2RK5A 1FO4A 2GQUA 3NVVB 5FXFA 1I19A 1W1MA 3C0PA 3SR6B 1SB3B 1N62C 3W8ZA 3FW8A 4JAYA 5FXDA 2PLSA 1E0YA 5K8EA 4JB1A 3KJMA 1W1JA 3AM9A 2Q85A 5D79A 1W1SA 2VFTA 4PZFA 1AHVA 2VFRA 5HHZA 1WVFA 3VTEA 3PQBA 1N5WC 1WVEA 5HQXA 1N61C 1W1KA 2AXRA 3DEDA 1E8GA 3GSYA 1JRPA 1VDVA 4PWBA 4ZOHB 4PVKA 3LLBA 2Y08A 3LAEA 2Y3SA 3ETRB 1MBTA 4HG0A 1JROA 3NRZB 2MBRA 3D2DA 2QPMA 5L6FA 3S1DA 2P4PA 5L6GA 3D2HA 2Y4GA 2R8DA 2O3GA 1W1LA 3FW9A 1RM6B 2PLIA 2E3TA 5FXEA 3AMZA 2BVGA 4BBYA 2EXRA 3BW7A 3B9JB 1N5XA 3S1EA 4PVEA 3JS8A 2VFSA 5FXPA 2W3SA 4XLOA 1W1OA 5I1WA 3AN1A 2R2ZA 4PVJA 1N63C 1HSKA 2UUUA 1T3QC 3FWAA 2VFUA 2W54A 3NVWB 1E8FA 1W1QA 2I0KA 4UD8A 1N60C 4ML8A 3I99A 5AE3A 1ZR6A 1FFUC 4PVHA 3S1CA 5ADZA 3W8XA 4OALA 3HSUA 1DZNA 1F0XA 2W3RA 1FIQB 1FFVC 3FW7A 1W1RA 2BVFA 5I1VA 4O95A 3EUB3 3W8WA 4BC7A 2BVHA 2NQWA 3DQ0A 4MLAA 4DNSA 1DIIA 2Y3RA 5HMRA 4PWCA 1MBBA 2VFVA 3TSJA 4BC9A 3S1FA 1WYGA 3NVZB 2P3HA 2OAIA 1E8HA 1VAOA 1AHZA 3POPA 2UUVA 3RJAA 3TSHA 1UXYA 2W55A 2QKNA 2VAOA 5AE1A 5AE2A 1DIQA 3D2JA 3TX1A 4EC3A 2GQTA 2YVSA 1QLUA 3NS1B 1AHUA 3NVYB 1QLTA 1ZXIC 4PYTA 4BCAA 3HRDC 2P13A 3PM9A 5G5GB 5G5HB 3RJ8A 5AWVA 2WDWA 2IPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4W A;  1V97 A;  1FO4 A;  2GQU A;  5FXF A;  1I19 A;  1W1M A;  3C0P A;  3SR6 B;  1N62 C;  3W8Z A;  3FW8 A;  4JAY A;  5FXD A;  1E0Y A;  5K8E A;  4JB1 A;  3KJM A;  1W1J A;  3AM9 A;  2Q85 A;  5D79 A;  1W1S A;  2VFT A;  4PZF A;  1AHV A;  2VFR A;  5HHZ A;  1WVF A;  3VTE A;  3PQB A;  1N5W C;  1WVE A;  5HQX A;  1N61 C;  1W1K A;  2AXR A;  1E8G A;  3GSY A;  1VDV A;  4PWB A;  4ZOH B;  4PVK A;  2Y08 A;  2Y3S A;  3ETR B;  1MBT A;  1JRO A;  3NRZ B;  2MBR A;  3D2D A;  2QPM A;  5L6F A;  3S1D A;  5L6G A;  3D2H A;  2Y4G A;  1W1L A;  3FW9 A;  2E3T A;  5FXE A;  3AMZ A;  2BVG A;  4BBY A;  2EXR A;  3BW7 A;  3B9J B;  1N5X A;  3S1E A;  4PVE A;  3JS8 A;  2VFS A;  5FXP A;  2W3S A;  4XLO A;  1W1O A;  5I1W A;  3AN1 A;  4PVJ A;  1N63 C;  1HSK A;  1T3Q C;  3FWA A;  2VFU A;  2W54 A;  1E8F A;  1W1Q A;  2I0K A;  4UD8 A;  1N60 C;  4ML8 A;  3I99 A;  5AE3 A;  1ZR6 A;  1FFU C;  4PVH A;  3S1C A;  5ADZ A;  3W8X A;  4OAL A;  3HSU A;  1DZN A;  1F0X A;  2W3R A;  1FIQ B;  1FFV C;  3FW7 A;  1W1R A;  2BVF A;  5I1V A;  4O95 A;  3EUB 3;  3W8W A;  4BC7 A;  2BVH A;  3DQ0 A;  4MLA A;  4DNS A;  1DII A;  2Y3R A;  5HMR A;  4PWC A;  1MBB A;  2VFV A;  3TSJ A;  4BC9 A;  3S1F A;  1WYG A;  3NVZ B;  1E8H A;  1VAO A;  1AHZ A;  3POP A;  3RJA A;  3TSH A;  1UXY A;  2W55 A;  2QKN A;  2VAO A;  5AE1 A;  5AE2 A;  1DIQ A;  3D2J A;  3TX1 A;  4EC3 A;  2GQT A;  1QLU A;  3NS1 B;  1AHU A;  1QLT A;  1ZXI C;  4PYT A;  4BCA A;  3PM9 A;  3RJ8 A;  5AWV A;  2WDW A;  2IPI A; 
#chains in the Genus database with same CATH topology
 2Q4W A;  1V97 A;  2RK5 A;  1FO4 A;  2GQU A;  3NVV B;  5FXF A;  1I19 A;  1W1M A;  3C0P A;  3SR6 B;  1SB3 B;  1N62 C;  3W8Z A;  3FW8 A;  4JAY A;  5FXD A;  2PLS A;  1E0Y A;  5K8E A;  4JB1 A;  3KJM A;  1W1J A;  3AM9 A;  2Q85 A;  5D79 A;  1W1S A;  2VFT A;  4PZF A;  1AHV A;  2VFR A;  5HHZ A;  1WVF A;  3VTE A;  3PQB A;  1N5W C;  1WVE A;  5HQX A;  1N61 C;  1W1K A;  2AXR A;  3DED A;  1E8G A;  3GSY A;  1JRP A;  1VDV A;  4PWB A;  4ZOH B;  4PVK A;  3LLB A;  2Y08 A;  3LAE A;  2Y3S A;  3ETR B;  1MBT A;  4HG0 A;  1JRO A;  3NRZ B;  2MBR A;  3D2D A;  2QPM A;  5L6F A;  3S1D A;  2P4P A;  5L6G A;  3D2H A;  2Y4G A;  2R8D A;  2O3G A;  1W1L A;  3FW9 A;  1RM6 B;  2PLI A;  2E3T A;  5FXE A;  3AMZ A;  2BVG A;  4BBY A;  2EXR A;  3BW7 A;  3B9J B;  1N5X A;  3S1E A;  4PVE A;  3JS8 A;  2VFS A;  5FXP A;  2W3S A;  4XLO A;  1W1O A;  5I1W A;  3AN1 A;  2R2Z A;  3EJB B;  4PVJ A;  1N63 C;  1HSK A;  2UUU A;  1T3Q C;  3FWA A;  2VFU A;  2W54 A;  3NVW B;  1E8F A;  1W1Q A;  2I0K A;  4UD8 A;  1N60 C;  4ML8 A;  3I99 A;  5AE3 A;  1ZR6 A;  1FFU C;  4PVH A;  3S1C A;  5ADZ A;  3W8X A;  4OAL A;  3HSU A;  1DZN A;  1F0X A;  2W3R A;  1FIQ B;  1FFV C;  3FW7 A;  1W1R A;  2BVF A;  5I1V A;  4O95 A;  3EUB 3;  3W8W A;  4BC7 A;  2BVH A;  2NQW A;  3DQ0 A;  4MLA A;  4DNS A;  1DII A;  2Y3R A;  5HMR A;  4PWC A;  1MBB A;  2VFV A;  3TSJ A;  4BC9 A;  3S1F A;  1WYG A;  3NVZ B;  2P3H A;  2OAI A;  1E8H A;  1VAO A;  1AHZ A;  3POP A;  2UUV A;  3RJA A;  3TSH A;  1UXY A;  2W55 A;  2QKN A;  2VAO A;  5AE1 A;  5AE2 A;  1DIQ A;  3D2J A;  3TX1 A;  4EC3 A;  2GQT A;  2YVS A;  1QLU A;  3NS1 B;  1AHU A;  3NVY B;  1QLT A;  1ZXI C;  4PYT A;  3EJE B;  4BCA A;  3HRD C;  2P13 A;  3PM9 A;  5G5G B;  5G5H B;  3RJ8 A;  5AWV A;  2WDW A;  3EJD B;  2IPI A; 
#chains in the Genus database with same CATH homology
 2Q4W A;  1V97 A;  2RK5 A;  1FO4 A;  2GQU A;  3NVV B;  5FXF A;  1I19 A;  1W1M A;  3C0P A;  3SR6 B;  1SB3 B;  1N62 C;  3W8Z A;  3FW8 A;  4JAY A;  5FXD A;  2PLS A;  1E0Y A;  5K8E A;  4JB1 A;  3KJM A;  1W1J A;  3AM9 A;  2Q85 A;  5D79 A;  1W1S A;  2VFT A;  4PZF A;  1AHV A;  2VFR A;  5HHZ A;  1WVF A;  3VTE A;  3PQB A;  1N5W C;  1WVE A;  5HQX A;  1N61 C;  1W1K A;  2AXR A;  3DED A;  1E8G A;  3GSY A;  1JRP A;  1VDV A;  4PWB A;  4ZOH B;  4PVK A;  3LLB A;  2Y08 A;  3LAE A;  2Y3S A;  3ETR B;  1MBT A;  4HG0 A;  1JRO A;  3NRZ B;  2MBR A;  3D2D A;  2QPM A;  5L6F A;  3S1D A;  2P4P A;  5L6G A;  3D2H A;  2Y4G A;  2R8D A;  2O3G A;  1W1L A;  3FW9 A;  1RM6 B;  2PLI A;  2E3T A;  5FXE A;  3AMZ A;  2BVG A;  4BBY A;  2EXR A;  3BW7 A;  3B9J B;  1N5X A;  3S1E A;  4PVE A;  3JS8 A;  2VFS A;  5FXP A;  2W3S A;  4XLO A;  1W1O A;  5I1W A;  3AN1 A;  2R2Z A;  4PVJ A;  1N63 C;  1HSK A;  2UUU A;  1T3Q C;  3FWA A;  2VFU A;  2W54 A;  3NVW B;  1E8F A;  1W1Q A;  2I0K A;  4UD8 A;  1N60 C;  4ML8 A;  3I99 A;  5AE3 A;  1ZR6 A;  1FFU C;  4PVH A;  3S1C A;  5ADZ A;  3W8X A;  4OAL A;  3HSU A;  1DZN A;  1F0X A;  2W3R A;  1FIQ B;  1FFV C;  3FW7 A;  1W1R A;  2BVF A;  5I1V A;  4O95 A;  3EUB 3;  3W8W A;  4BC7 A;  2BVH A;  2NQW A;  3DQ0 A;  4MLA A;  4DNS A;  1DII A;  2Y3R A;  5HMR A;  4PWC A;  1MBB A;  2VFV A;  3TSJ A;  4BC9 A;  3S1F A;  1WYG A;  3NVZ B;  2P3H A;  2OAI A;  1E8H A;  1VAO A;  1AHZ A;  3POP A;  2UUV A;  3RJA A;  3TSH A;  1UXY A;  2W55 A;  2QKN A;  2VAO A;  5AE1 A;  5AE2 A;  1DIQ A;  3D2J A;  3TX1 A;  4EC3 A;  2GQT A;  2YVS A;  1QLU A;  3NS1 B;  1AHU A;  3NVY B;  1QLT A;  1ZXI C;  4PYT A;  4BCA A;  3HRD C;  2P13 A;  3PM9 A;  5G5G B;  5G5H B;  3RJ8 A;  5AWV A;  2WDW A;  2IPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...