3TSHA

Crystal structure of phl p 4, a grass pollen allergen with glucose dehydrogenase activity
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4
publication title Crystal structure and immunologic characterization of the major grass pollen allergen Phl p 4.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen, oxidoreductase
total genus 172
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tshA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tshA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 3tshA03
5L6FA 4XLOA 3RJ8A 1DIIA 2MBRA 1N5XA 4OALA 1N5WC 1FIQB 4PYTA 5ADZA 3NS1B 1UXYA 1E8GA 3W8XA 1VAOA 2VFVA 1W1OA 5FXFA 3S1EA 3PQBA 3BW7A 1E8HA 3EUB3 1E0YA 1W1SA 3TSHA 2VFTA 1FFVC 1WVFA 5FXDA 3GSYA 5D79A 2BVHA 4PVEA 2Q85A 2Y3SA 1W1KA 1QLUA 1AHVA 3NRZB 5HMRA 1DIQA 1W1JA 2W55A 1FO4A 5AWVA 1AHZA 4PZFA 5K8EA 1N60C 3B9JB 3SR6B 4ML8A 3HSUA 2BVFA 4PWCA 2EXRA 3NVZB 1F0XA 1MBTA 1W1RA 3AM9A 3POPA 5FXEA 5HHZA 4PVHA 2Q4WA 1V97A 1WYGA 1W1QA 3JS8A 3S1DA 1ZXIC 2IPIA 5I1VA 4MLAA 3D2HA 4JB1A 3S1CA 3VTEA 4BBYA 4PWBA 3FW8A 3TX1A 4JAYA 5L6GA 1DZNA 3AMZA 2Y08A 3D2JA 1WVEA 2AXRA 2VFSA 5HQXA 1QLTA 3W8ZA 3ETRB 5I1WA 2W3RA 4BC9A 2WDWA 1W1MA 1I19A 1JROA 1MBBA 4PVKA 2I0KA 1N63C 5AE1A 2Y4GA 1T3QC 3RJAA 4UD8A 4EC3A 4ZOHB 2BVGA 5FXPA 3D2DA 5AE3A 4DNSA 2W3SA 3I99A 3S1FA 1W1LA 1VDVA 3FW7A 2Y3RA 4BC7A 3C0PA 3FW9A 1ZR6A 3PM9A 4O95A 2E3TA 2GQUA 2GQTA 2QKNA 1N62C 3FWAA 3KJMA 3W8WA 2VFRA 3AN1A 2W54A 2QPMA 1AHUA 1FFUC 3DQ0A 1E8FA 2VFUA 5AE2A 4BCAA 1HSKA 3TSJA 2VAOA 4PVJA 1N61C
chains in the Genus database with same CATH superfamily
5L6FA 4XLOA 3RJ8A 1DIIA 2MBRA 1N5XA 4OALA 1N5WC 1FIQB 4PYTA 5ADZA 3NS1B 1UXYA 1E8GA 3W8XA 1VAOA 2VFVA 1W1OA 1JRPA 5FXFA 3S1EA 3PQBA 3NVWB 3BW7A 1E8HA 3EUB3 1E0YA 1W1SA 3TSHA 2VFTA 1FFVC 1RM6B 1WVFA 5FXDA 3EJDB 3GSYA 5D79A 2BVHA 4PVEA 2Q85A 2Y3SA 1W1KA 3EJEB 1QLUA 1AHVA 3NRZB 5HMRA 1DIQA 1W1JA 2W55A 1FO4A 5AWVA 1AHZA 4PZFA 5K8EA 1N60C 3NVYB 3B9JB 3SR6B 4ML8A 2P4PA 3HSUA 2BVFA 4PWCA 2EXRA 3NVZB 2UUUA 1F0XA 1MBTA 2RK5A 1W1RA 3AM9A 3POPA 5FXEA 5HHZA 3LAEA 4PVHA 2Q4WA 1V97A 1WYGA 2YVSA 1W1QA 3JS8A 3S1DA 5G5HB 1ZXIC 2IPIA 3EJBB 4MLAA 5I1VA 3D2HA 4JB1A 3S1CA 3VTEA 4BBYA 4PWBA 3FW8A 3TX1A 4JAYA 2NQWA 2P13A 5L6GA 1DZNA 3AMZA 2Y08A 3D2JA 1WVEA 2AXRA 2VFSA 5HQXA 1QLTA 3NVVB 3W8ZA 3ETRB 5I1WA 2W3RA 4BC9A 2WDWA 1W1MA 3DEDA 1I19A 1JROA 1MBBA 4PVKA 2I0KA 1N63C 5AE1A 2Y4GA 1T3QC 3RJAA 4UD8A 4EC3A 4ZOHB 5G5GB 2BVGA 5FXPA 3D2DA 5AE3A 4HG0A 4DNSA 3LLBA 2W3SA 3I99A 2R2ZA 3S1FA 1SB3B 1W1LA 1VDVA 3FW7A 2Y3RA 4BC7A 3HRDC 3C0PA 3FW9A 2O3GA 2PLIA 1ZR6A 3PM9A 4O95A 2E3TA 2GQUA 2GQTA 2QKNA 1N62C 2OAIA 3FWAA 2P3HA 3KJMA 3W8WA 2VFRA 2UUVA 3AN1A 2W54A 2QPMA 2PLSA 1AHUA 1FFUC 3DQ0A 1E8FA 2VFUA 2R8DA 5AE2A 4BCAA 1HSKA 3TSJA 2VAOA 4PVJA 1N61C
chains in the Genus database with same CATH topology
5L6FA 4XLOA 3RJ8A 1DIIA 2MBRA 1N5XA 4OALA 1N5WC 1FIQB 4PYTA 5ADZA 3NS1B 1UXYA 1E8GA 3W8XA 1VAOA 2VFVA 1W1OA 1JRPA 5FXFA 3S1EA 3PQBA 3NVWB 3BW7A 1E8HA 3EUB3 1E0YA 1W1SA 3TSHA 2VFTA 1FFVC 1RM6B 1WVFA 5FXDA 3GSYA 5D79A 2BVHA 4PVEA 2Q85A 2Y3SA 1W1KA 1QLUA 1AHVA 3NRZB 5HMRA 1DIQA 1W1JA 2W55A 1FO4A 5AWVA 1AHZA 4PZFA 5K8EA 1N60C 3NVYB 3B9JB 3SR6B 4ML8A 2P4PA 3HSUA 2BVFA 4PWCA 2EXRA 3NVZB 2UUUA 1F0XA 1MBTA 2RK5A 1W1RA 3AM9A 3POPA 5FXEA 5HHZA 3LAEA 4PVHA 2Q4WA 1V97A 1WYGA 2YVSA 1W1QA 3JS8A 3S1DA 5G5HB 1ZXIC 2IPIA 5I1VA 4MLAA 3D2HA 4JB1A 3S1CA 3VTEA 4BBYA 4PWBA 3FW8A 3TX1A 4JAYA 2NQWA 2P13A 5L6GA 1DZNA 3AMZA 2Y08A 3D2JA 1WVEA 2AXRA 2VFSA 5HQXA 1QLTA 3NVVB 3W8ZA 3ETRB 5I1WA 2W3RA 4BC9A 2WDWA 1W1MA 3DEDA 1I19A 1JROA 1MBBA 4PVKA 2I0KA 1N63C 5AE1A 2Y4GA 1T3QC 3RJAA 4UD8A 4EC3A 4ZOHB 5G5GB 2BVGA 5FXPA 3D2DA 5AE3A 4HG0A 4DNSA 3LLBA 2W3SA 3I99A 2R2ZA 3S1FA 1SB3B 1W1LA 1VDVA 3FW7A 2Y3RA 4BC7A 3HRDC 3C0PA 3FW9A 2O3GA 2PLIA 1ZR6A 3PM9A 4O95A 2E3TA 2GQUA 2GQTA 2QKNA 1N62C 2OAIA 3FWAA 2P3HA 3KJMA 3W8WA 2VFRA 2UUVA 3AN1A 2W54A 2QPMA 2PLSA 1AHUA 1FFUC 3DQ0A 1E8FA 2VFUA 2R8DA 5AE2A 4BCAA 1HSKA 3TSJA 2VAOA 4PVJA 1N61C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L6F A;  4XLO A;  3RJ8 A;  1DII A;  2MBR A;  1N5X A;  4OAL A;  1N5W C;  1FIQ B;  4PYT A;  5ADZ A;  3NS1 B;  1UXY A;  1E8G A;  3W8X A;  1VAO A;  2VFV A;  1W1O A;  5FXF A;  3S1E A;  3PQB A;  3BW7 A;  1E8H A;  3EUB 3;  1E0Y A;  1W1S A;  3TSH A;  2VFT A;  1FFV C;  1WVF A;  5FXD A;  3GSY A;  5D79 A;  2BVH A;  4PVE A;  2Q85 A;  2Y3S A;  1W1K A;  1QLU A;  1AHV A;  3NRZ B;  5HMR A;  1DIQ A;  1W1J A;  2W55 A;  1FO4 A;  5AWV A;  1AHZ A;  4PZF A;  5K8E A;  1N60 C;  3B9J B;  3SR6 B;  4ML8 A;  3HSU A;  2BVF A;  4PWC A;  2EXR A;  3NVZ B;  1F0X A;  1MBT A;  1W1R A;  3AM9 A;  3POP A;  5FXE A;  5HHZ A;  4PVH A;  2Q4W A;  1V97 A;  1WYG A;  1W1Q A;  3JS8 A;  3S1D A;  1ZXI C;  2IPI A;  5I1V A;  4MLA A;  3D2H A;  4JB1 A;  3S1C A;  3VTE A;  4BBY A;  4PWB A;  3FW8 A;  3TX1 A;  4JAY A;  5L6G A;  1DZN A;  3AMZ A;  2Y08 A;  3D2J A;  1WVE A;  2AXR A;  2VFS A;  5HQX A;  1QLT A;  3W8Z A;  3ETR B;  5I1W A;  2W3R A;  4BC9 A;  2WDW A;  1W1M A;  1I19 A;  1JRO A;  1MBB A;  4PVK A;  2I0K A;  1N63 C;  5AE1 A;  2Y4G A;  1T3Q C;  3RJA A;  4UD8 A;  4EC3 A;  4ZOH B;  2BVG A;  5FXP A;  3D2D A;  5AE3 A;  4DNS A;  2W3S A;  3I99 A;  3S1F A;  1W1L A;  1VDV A;  3FW7 A;  2Y3R A;  4BC7 A;  3C0P A;  3FW9 A;  1ZR6 A;  3PM9 A;  4O95 A;  2E3T A;  2GQU A;  2GQT A;  2QKN A;  1N62 C;  3FWA A;  3KJM A;  3W8W A;  2VFR A;  3AN1 A;  2W54 A;  2QPM A;  1AHU A;  1FFU C;  3DQ0 A;  1E8F A;  2VFU A;  5AE2 A;  4BCA A;  1HSK A;  3TSJ A;  2VAO A;  4PVJ A;  1N61 C; 
#chains in the Genus database with same CATH topology
 5L6F A;  4XLO A;  3RJ8 A;  1DII A;  2MBR A;  1N5X A;  4OAL A;  1N5W C;  1FIQ B;  4PYT A;  5ADZ A;  3NS1 B;  1UXY A;  1E8G A;  3W8X A;  1VAO A;  2VFV A;  1W1O A;  1JRP A;  5FXF A;  3S1E A;  3PQB A;  3NVW B;  3BW7 A;  1E8H A;  3EUB 3;  1E0Y A;  1W1S A;  3TSH A;  2VFT A;  1FFV C;  1RM6 B;  1WVF A;  5FXD A;  3EJD B;  3GSY A;  5D79 A;  2BVH A;  4PVE A;  2Q85 A;  2Y3S A;  1W1K A;  3EJE B;  1QLU A;  1AHV A;  3NRZ B;  5HMR A;  1DIQ A;  1W1J A;  2W55 A;  1FO4 A;  5AWV A;  1AHZ A;  4PZF A;  5K8E A;  1N60 C;  3NVY B;  3B9J B;  3SR6 B;  4ML8 A;  2P4P A;  3HSU A;  2BVF A;  4PWC A;  2EXR A;  3NVZ B;  2UUU A;  1F0X A;  1MBT A;  2RK5 A;  1W1R A;  3AM9 A;  3POP A;  5FXE A;  5HHZ A;  3LAE A;  4PVH A;  2Q4W A;  1V97 A;  1WYG A;  2YVS A;  1W1Q A;  3JS8 A;  3S1D A;  5G5H B;  1ZXI C;  2IPI A;  3EJB B;  4MLA A;  5I1V A;  3D2H A;  4JB1 A;  3S1C A;  3VTE A;  4BBY A;  4PWB A;  3FW8 A;  3TX1 A;  4JAY A;  2NQW A;  2P13 A;  5L6G A;  1DZN A;  3AMZ A;  2Y08 A;  3D2J A;  1WVE A;  2AXR A;  2VFS A;  5HQX A;  1QLT A;  3NVV B;  3W8Z A;  3ETR B;  5I1W A;  2W3R A;  4BC9 A;  2WDW A;  1W1M A;  3DED A;  1I19 A;  1JRO A;  1MBB A;  4PVK A;  2I0K A;  1N63 C;  5AE1 A;  2Y4G A;  1T3Q C;  3RJA A;  4UD8 A;  4EC3 A;  4ZOH B;  5G5G B;  2BVG A;  5FXP A;  3D2D A;  5AE3 A;  4HG0 A;  4DNS A;  3LLB A;  2W3S A;  3I99 A;  2R2Z A;  3S1F A;  1SB3 B;  1W1L A;  1VDV A;  3FW7 A;  2Y3R A;  4BC7 A;  3HRD C;  3C0P A;  3FW9 A;  2O3G A;  2PLI A;  1ZR6 A;  3PM9 A;  4O95 A;  2E3T A;  2GQU A;  2GQT A;  2QKN A;  1N62 C;  2OAI A;  3FWA A;  2P3H A;  3KJM A;  3W8W A;  2VFR A;  2UUV A;  3AN1 A;  2W54 A;  2QPM A;  2PLS A;  1AHU A;  1FFU C;  3DQ0 A;  1E8F A;  2VFU A;  2R8D A;  5AE2 A;  4BCA A;  1HSK A;  3TSJ A;  2VAO A;  4PVJ A;  1N61 C; 
#chains in the Genus database with same CATH homology
 5L6F A;  4XLO A;  3RJ8 A;  1DII A;  2MBR A;  1N5X A;  4OAL A;  1N5W C;  1FIQ B;  4PYT A;  5ADZ A;  3NS1 B;  1UXY A;  1E8G A;  3W8X A;  1VAO A;  2VFV A;  1W1O A;  1JRP A;  5FXF A;  3S1E A;  3PQB A;  3NVW B;  3BW7 A;  1E8H A;  3EUB 3;  1E0Y A;  1W1S A;  3TSH A;  2VFT A;  1FFV C;  1RM6 B;  1WVF A;  5FXD A;  3GSY A;  5D79 A;  2BVH A;  4PVE A;  2Q85 A;  2Y3S A;  1W1K A;  1QLU A;  1AHV A;  3NRZ B;  5HMR A;  1DIQ A;  1W1J A;  2W55 A;  1FO4 A;  5AWV A;  1AHZ A;  4PZF A;  5K8E A;  1N60 C;  3NVY B;  3B9J B;  3SR6 B;  4ML8 A;  2P4P A;  3HSU A;  2BVF A;  4PWC A;  2EXR A;  3NVZ B;  2UUU A;  1F0X A;  1MBT A;  2RK5 A;  1W1R A;  3AM9 A;  3POP A;  5FXE A;  5HHZ A;  3LAE A;  4PVH A;  2Q4W A;  1V97 A;  1WYG A;  2YVS A;  1W1Q A;  3JS8 A;  3S1D A;  5G5H B;  1ZXI C;  2IPI A;  5I1V A;  4MLA A;  3D2H A;  4JB1 A;  3S1C A;  3VTE A;  4BBY A;  4PWB A;  3FW8 A;  3TX1 A;  4JAY A;  2NQW A;  2P13 A;  5L6G A;  1DZN A;  3AMZ A;  2Y08 A;  3D2J A;  1WVE A;  2AXR A;  2VFS A;  5HQX A;  1QLT A;  3NVV B;  3W8Z A;  3ETR B;  5I1W A;  2W3R A;  4BC9 A;  2WDW A;  1W1M A;  3DED A;  1I19 A;  1JRO A;  1MBB A;  4PVK A;  2I0K A;  1N63 C;  5AE1 A;  2Y4G A;  1T3Q C;  3RJA A;  4UD8 A;  4EC3 A;  4ZOH B;  5G5G B;  2BVG A;  5FXP A;  3D2D A;  5AE3 A;  4HG0 A;  4DNS A;  3LLB A;  2W3S A;  3I99 A;  2R2Z A;  3S1F A;  1SB3 B;  1W1L A;  1VDV A;  3FW7 A;  2Y3R A;  4BC7 A;  3HRD C;  3C0P A;  3FW9 A;  2O3G A;  2PLI A;  1ZR6 A;  3PM9 A;  4O95 A;  2E3T A;  2GQU A;  2GQT A;  2QKN A;  1N62 C;  2OAI A;  3FWA A;  2P3H A;  3KJM A;  3W8W A;  2VFR A;  2UUV A;  3AN1 A;  2W54 A;  2QPM A;  2PLS A;  1AHU A;  1FFU C;  3DQ0 A;  1E8F A;  2VFU A;  2R8D A;  5AE2 A;  4BCA A;  1HSK A;  3TSJ A;  2VAO A;  4PVJ A;  1N61 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...