3TSJA

Crystal structure of phl p 4, a grass pollen allergen with glucose dehydrogenase activity
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
489
structure length
489
Chain Sequence
DFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and immunologic characterization of the major grass pollen allergen Phl p 4.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen, oxidoreductase
molecule keywords Pollen allergen Phl p 4
total genus 168
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tsjA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tsjA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 3tsjA03
2VFVA 3GSYA 1VAOA 2W55A 3AM9A 3RJ8A 4BBYA 5HMRA 5HHZA 1FFVC 5HQXA 2Y3SA 4UD8A 1W1JA 2I0KA 4MLAA 1AHVA 3D2DA 2BVHA 5I1VA 4PVEA 4EC3A 3PQBA 2Q85A 4PZFA 4BCAA 2AXRA 1QLUA 1HSKA 5L6GA 1E8GA 3W8XA 3FW8A 2Y3RA 2E3TA 2BVGA 2GQTA 1F0XA 1N61C 4PVHA 2WDWA 3FW9A 1JROA 5FXFA 1E0YA 2VFUA 3EUB3 4XLOA 3S1DA 1MBTA 3I99A 1N62C 1I19A 2MBRA 4PYTA 1N5XA 1V97A 4BC7A 3POPA 1QLTA 3NS1B 2BVFA 1VDVA 1AHZA 3FWAA 3FW7A 1E8FA 1FFUC 5AWVA 1UXYA 1W1QA 3TSJA 4PWBA 2VAOA 1N63C 1E8HA 5AE3A 4ZOHB 1W1LA 3ETRB 3KJMA 5I1WA 1N5WC 1N60C 4PWCA 5FXPA 3W8ZA 2VFTA 2VFRA 3NRZB 3TSHA 4PVJA 3SR6B 3VTEA 3JS8A 3HSUA 4JAYA 5AE2A 2Y08A 2EXRA 5AE1A 1W1SA 2Y4GA 3BW7A 3S1FA 1W1RA 1FO4A 1T3QC 3B9JB 5K8EA 3RJAA 4ML8A 1WVFA 5ADZA 3AN1A 3W8WA 4BC9A 2QPMA 1W1MA 2W54A 3NVZB 1DZNA 1ZXIC 3PM9A 2QKNA 2IPIA 5L6FA 3D2HA 2GQUA 3C0PA 4DNSA 4OALA 3AMZA 4JB1A 5D79A 1MBBA 1W1OA 2W3SA 3S1EA 5FXEA 2Q4WA 1WVEA 2W3RA 1FIQB 1DIQA 3DQ0A 4PVKA 3S1CA 1ZR6A 3D2JA 3TX1A 1AHUA 1W1KA 1WYGA 1DIIA 2VFSA 4O95A 5FXDA
chains in the Genus database with same CATH superfamily
2VFVA 2R2ZA 3GSYA 1VAOA 2W55A 3AM9A 3NVYB 3DEDA 3RJ8A 4BBYA 2P4PA 5HMRA 2P13A 5HHZA 2RK5A 3EJEB 1FFVC 5HQXA 2Y3SA 4UD8A 1W1JA 2I0KA 4MLAA 2PLIA 1AHVA 3D2DA 2PLSA 2BVHA 5I1VA 4PVEA 5G5GB 4EC3A 3PQBA 2Q85A 4PZFA 4BCAA 2AXRA 1QLUA 3NVVB 2R8DA 1HSKA 1JRPA 5L6GA 1E8GA 3W8XA 3FW8A 2Y3RA 2E3TA 2BVGA 2GQTA 1F0XA 1N61C 4PVHA 2WDWA 3FW9A 1JROA 5FXFA 1E0YA 2VFUA 3EUB3 4XLOA 3S1DA 1MBTA 2UUUA 3I99A 1N62C 1I19A 2MBRA 4PYTA 3LAEA 1N5XA 1V97A 4BC7A 3POPA 1QLTA 3NS1B 2BVFA 1VDVA 1AHZA 3FWAA 3FW7A 1E8FA 1FFUC 5AWVA 1UXYA 1W1QA 3TSJA 1RM6B 2OAIA 4PWBA 2VAOA 1N63C 1E8HA 5AE3A 4ZOHB 3LLBA 1W1LA 3ETRB 3KJMA 5I1WA 2UUVA 1SB3B 1N5WC 1N60C 4PWCA 5FXPA 3W8ZA 2VFTA 2VFRA 2YVSA 5G5HB 3NRZB 3TSHA 4PVJA 3HRDC 3SR6B 3VTEA 3JS8A 3HSUA 4JAYA 5AE2A 2O3GA 2Y08A 2EXRA 5AE1A 1W1SA 2Y4GA 2P3HA 3BW7A 3S1FA 1W1RA 1FO4A 1T3QC 3B9JB 5K8EA 3RJAA 4ML8A 1WVFA 4HG0A 5ADZA 3AN1A 3W8WA 4BC9A 2QPMA 1W1MA 2W54A 3NVZB 1DZNA 1ZXIC 3PM9A 2QKNA 2IPIA 5L6FA 3D2HA 2GQUA 3C0PA 4DNSA 4OALA 3AMZA 3EJDB 4JB1A 5D79A 1MBBA 1W1OA 2W3SA 3NVWB 3S1EA 5FXEA 2Q4WA 1WVEA 2W3RA 1FIQB 1DIQA 3EJBB 3DQ0A 4PVKA 3S1CA 1ZR6A 3D2JA 3TX1A 1AHUA 1W1KA 1WYGA 2NQWA 1DIIA 2VFSA 4O95A 5FXDA
chains in the Genus database with same CATH topology
2VFVA 2R2ZA 3GSYA 1VAOA 2W55A 3AM9A 3DEDA 3NVYB 3RJ8A 4BBYA 2P4PA 5HMRA 2P13A 5HHZA 2RK5A 1FFVC 5HQXA 2Y3SA 4UD8A 1W1JA 2I0KA 4MLAA 2PLIA 1AHVA 3D2DA 2PLSA 2BVHA 5I1VA 4PVEA 5G5GB 4EC3A 3PQBA 2Q85A 4PZFA 4BCAA 2AXRA 1QLUA 2R8DA 3NVVB 1HSKA 1JRPA 5L6GA 1E8GA 3W8XA 3FW8A 2Y3RA 2E3TA 2BVGA 2GQTA 1F0XA 1N61C 4PVHA 2WDWA 3FW9A 1JROA 5FXFA 1E0YA 2VFUA 3EUB3 4XLOA 3S1DA 1MBTA 2UUUA 3I99A 1N62C 1I19A 2MBRA 4PYTA 3LAEA 1N5XA 1V97A 4BC7A 3POPA 1QLTA 3NS1B 2BVFA 1VDVA 1AHZA 3FWAA 3FW7A 1E8FA 1FFUC 5AWVA 1UXYA 1W1QA 3TSJA 1RM6B 2OAIA 4PWBA 2VAOA 1N63C 1E8HA 5AE3A 4ZOHB 3LLBA 1W1LA 3ETRB 3KJMA 5I1WA 2UUVA 1SB3B 1N5WC 1N60C 4PWCA 5FXPA 3W8ZA 2VFTA 2VFRA 2YVSA 5G5HB 3NRZB 3TSHA 4PVJA 3HRDC 3SR6B 3VTEA 3JS8A 3HSUA 4JAYA 5AE2A 2O3GA 2Y08A 2EXRA 5AE1A 1W1SA 2Y4GA 2P3HA 3BW7A 3S1FA 1W1RA 1FO4A 1T3QC 3B9JB 5K8EA 3RJAA 4ML8A 1WVFA 4HG0A 5ADZA 3AN1A 3W8WA 4BC9A 2QPMA 1W1MA 2W54A 3NVZB 1DZNA 1ZXIC 3PM9A 2QKNA 2IPIA 5L6FA 3D2HA 2GQUA 3C0PA 4DNSA 4OALA 3AMZA 4JB1A 5D79A 1MBBA 1W1OA 2W3SA 3S1EA 3NVWB 5FXEA 2Q4WA 1WVEA 2W3RA 1FIQB 1DIQA 3DQ0A 4PVKA 3S1CA 1ZR6A 3D2JA 3TX1A 1AHUA 1W1KA 1WYGA 2NQWA 1DIIA 2VFSA 4O95A 5FXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFV A;  3GSY A;  1VAO A;  2W55 A;  3AM9 A;  3RJ8 A;  4BBY A;  5HMR A;  5HHZ A;  1FFV C;  5HQX A;  2Y3S A;  4UD8 A;  1W1J A;  2I0K A;  4MLA A;  1AHV A;  3D2D A;  2BVH A;  5I1V A;  4PVE A;  4EC3 A;  3PQB A;  2Q85 A;  4PZF A;  4BCA A;  2AXR A;  1QLU A;  1HSK A;  5L6G A;  1E8G A;  3W8X A;  3FW8 A;  2Y3R A;  2E3T A;  2BVG A;  2GQT A;  1F0X A;  1N61 C;  4PVH A;  2WDW A;  3FW9 A;  1JRO A;  5FXF A;  1E0Y A;  2VFU A;  3EUB 3;  4XLO A;  3S1D A;  1MBT A;  3I99 A;  1N62 C;  1I19 A;  2MBR A;  4PYT A;  1N5X A;  1V97 A;  4BC7 A;  3POP A;  1QLT A;  3NS1 B;  2BVF A;  1VDV A;  1AHZ A;  3FWA A;  3FW7 A;  1E8F A;  1FFU C;  5AWV A;  1UXY A;  1W1Q A;  3TSJ A;  4PWB A;  2VAO A;  1N63 C;  1E8H A;  5AE3 A;  4ZOH B;  1W1L A;  3ETR B;  3KJM A;  5I1W A;  1N5W C;  1N60 C;  4PWC A;  5FXP A;  3W8Z A;  2VFT A;  2VFR A;  3NRZ B;  3TSH A;  4PVJ A;  3SR6 B;  3VTE A;  3JS8 A;  3HSU A;  4JAY A;  5AE2 A;  2Y08 A;  2EXR A;  5AE1 A;  1W1S A;  2Y4G A;  3BW7 A;  3S1F A;  1W1R A;  1FO4 A;  1T3Q C;  3B9J B;  5K8E A;  3RJA A;  4ML8 A;  1WVF A;  5ADZ A;  3AN1 A;  3W8W A;  4BC9 A;  2QPM A;  1W1M A;  2W54 A;  3NVZ B;  1DZN A;  1ZXI C;  3PM9 A;  2QKN A;  2IPI A;  5L6F A;  3D2H A;  2GQU A;  3C0P A;  4DNS A;  4OAL A;  3AMZ A;  4JB1 A;  5D79 A;  1MBB A;  1W1O A;  2W3S A;  3S1E A;  5FXE A;  2Q4W A;  1WVE A;  2W3R A;  1FIQ B;  1DIQ A;  3DQ0 A;  4PVK A;  3S1C A;  1ZR6 A;  3D2J A;  3TX1 A;  1AHU A;  1W1K A;  1WYG A;  1DII A;  2VFS A;  4O95 A;  5FXD A; 
#chains in the Genus database with same CATH topology
 2VFV A;  2R2Z A;  3GSY A;  1VAO A;  2W55 A;  3AM9 A;  3NVY B;  3DED A;  3RJ8 A;  4BBY A;  2P4P A;  5HMR A;  2P13 A;  5HHZ A;  2RK5 A;  3EJE B;  1FFV C;  5HQX A;  2Y3S A;  4UD8 A;  1W1J A;  2I0K A;  4MLA A;  2PLI A;  1AHV A;  3D2D A;  2PLS A;  2BVH A;  5I1V A;  4PVE A;  5G5G B;  4EC3 A;  3PQB A;  2Q85 A;  4PZF A;  4BCA A;  2AXR A;  1QLU A;  3NVV B;  2R8D A;  1HSK A;  1JRP A;  5L6G A;  1E8G A;  3W8X A;  3FW8 A;  2Y3R A;  2E3T A;  2BVG A;  2GQT A;  1F0X A;  1N61 C;  4PVH A;  2WDW A;  3FW9 A;  1JRO A;  5FXF A;  1E0Y A;  2VFU A;  3EUB 3;  4XLO A;  3S1D A;  1MBT A;  2UUU A;  3I99 A;  1N62 C;  1I19 A;  2MBR A;  4PYT A;  3LAE A;  1N5X A;  1V97 A;  4BC7 A;  3POP A;  1QLT A;  3NS1 B;  2BVF A;  1VDV A;  1AHZ A;  3FWA A;  3FW7 A;  1E8F A;  1FFU C;  5AWV A;  1UXY A;  1W1Q A;  3TSJ A;  1RM6 B;  2OAI A;  4PWB A;  2VAO A;  1N63 C;  1E8H A;  5AE3 A;  4ZOH B;  3LLB A;  1W1L A;  3ETR B;  3KJM A;  5I1W A;  2UUV A;  1SB3 B;  1N5W C;  1N60 C;  4PWC A;  5FXP A;  3W8Z A;  2VFT A;  2VFR A;  2YVS A;  5G5H B;  3NRZ B;  3TSH A;  4PVJ A;  3HRD C;  3SR6 B;  3VTE A;  3JS8 A;  3HSU A;  4JAY A;  5AE2 A;  2O3G A;  2Y08 A;  2EXR A;  5AE1 A;  1W1S A;  2Y4G A;  2P3H A;  3BW7 A;  3S1F A;  1W1R A;  1FO4 A;  1T3Q C;  3B9J B;  5K8E A;  3RJA A;  4ML8 A;  1WVF A;  4HG0 A;  5ADZ A;  3AN1 A;  3W8W A;  4BC9 A;  2QPM A;  1W1M A;  2W54 A;  3NVZ B;  1DZN A;  1ZXI C;  3PM9 A;  2QKN A;  2IPI A;  5L6F A;  3D2H A;  2GQU A;  3C0P A;  4DNS A;  4OAL A;  3AMZ A;  3EJD B;  4JB1 A;  5D79 A;  1MBB A;  1W1O A;  2W3S A;  3NVW B;  3S1E A;  5FXE A;  2Q4W A;  1WVE A;  2W3R A;  1FIQ B;  1DIQ A;  3EJB B;  3DQ0 A;  4PVK A;  3S1C A;  1ZR6 A;  3D2J A;  3TX1 A;  1AHU A;  1W1K A;  1WYG A;  2NQW A;  1DII A;  2VFS A;  4O95 A;  5FXD A; 
#chains in the Genus database with same CATH homology
 2VFV A;  2R2Z A;  3GSY A;  1VAO A;  2W55 A;  3AM9 A;  3DED A;  3NVY B;  3RJ8 A;  4BBY A;  2P4P A;  5HMR A;  2P13 A;  5HHZ A;  2RK5 A;  1FFV C;  5HQX A;  2Y3S A;  4UD8 A;  1W1J A;  2I0K A;  4MLA A;  2PLI A;  1AHV A;  3D2D A;  2PLS A;  2BVH A;  5I1V A;  4PVE A;  5G5G B;  4EC3 A;  3PQB A;  2Q85 A;  4PZF A;  4BCA A;  2AXR A;  1QLU A;  2R8D A;  3NVV B;  1HSK A;  1JRP A;  5L6G A;  1E8G A;  3W8X A;  3FW8 A;  2Y3R A;  2E3T A;  2BVG A;  2GQT A;  1F0X A;  1N61 C;  4PVH A;  2WDW A;  3FW9 A;  1JRO A;  5FXF A;  1E0Y A;  2VFU A;  3EUB 3;  4XLO A;  3S1D A;  1MBT A;  2UUU A;  3I99 A;  1N62 C;  1I19 A;  2MBR A;  4PYT A;  3LAE A;  1N5X A;  1V97 A;  4BC7 A;  3POP A;  1QLT A;  3NS1 B;  2BVF A;  1VDV A;  1AHZ A;  3FWA A;  3FW7 A;  1E8F A;  1FFU C;  5AWV A;  1UXY A;  1W1Q A;  3TSJ A;  1RM6 B;  2OAI A;  4PWB A;  2VAO A;  1N63 C;  1E8H A;  5AE3 A;  4ZOH B;  3LLB A;  1W1L A;  3ETR B;  3KJM A;  5I1W A;  2UUV A;  1SB3 B;  1N5W C;  1N60 C;  4PWC A;  5FXP A;  3W8Z A;  2VFT A;  2VFR A;  2YVS A;  5G5H B;  3NRZ B;  3TSH A;  4PVJ A;  3HRD C;  3SR6 B;  3VTE A;  3JS8 A;  3HSU A;  4JAY A;  5AE2 A;  2O3G A;  2Y08 A;  2EXR A;  5AE1 A;  1W1S A;  2Y4G A;  2P3H A;  3BW7 A;  3S1F A;  1W1R A;  1FO4 A;  1T3Q C;  3B9J B;  5K8E A;  3RJA A;  4ML8 A;  1WVF A;  4HG0 A;  5ADZ A;  3AN1 A;  3W8W A;  4BC9 A;  2QPM A;  1W1M A;  2W54 A;  3NVZ B;  1DZN A;  1ZXI C;  3PM9 A;  2QKN A;  2IPI A;  5L6F A;  3D2H A;  2GQU A;  3C0P A;  4DNS A;  4OAL A;  3AMZ A;  4JB1 A;  5D79 A;  1MBB A;  1W1O A;  2W3S A;  3S1E A;  3NVW B;  5FXE A;  2Q4W A;  1WVE A;  2W3R A;  1FIQ B;  1DIQ A;  3DQ0 A;  4PVK A;  3S1C A;  1ZR6 A;  3D2J A;  3TX1 A;  1AHU A;  1W1K A;  1WYG A;  2NQW A;  1DII A;  2VFS A;  4O95 A;  5FXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...