3TSJA

Crystal structure of phl p 4, a grass pollen allergen with glucose dehydrogenase activity
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
489
structure length
489
Chain Sequence
DFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4
publication title Crystal structure and immunologic characterization of the major grass pollen allergen Phl p 4.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen, oxidoreductase
total genus 168
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tsjA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tsjA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 3tsjA03
3NVZB 1AHZA 1N62C 3AN1A 3AM9A 4PWBA 4OALA 4MLAA 5L6GA 2EXRA 5AE1A 1WYGA 1VDVA 3NRZB 3W8XA 5HQXA 5FXFA 2Y08A 5AWVA 3HSUA 1MBBA 2Q4WA 2W3RA 1I19A 1DIQA 4XLOA 1ZR6A 1FFVC 2VFTA 3AMZA 5I1VA 3DQ0A 5FXEA 1VAOA 4BBYA 4O95A 1QLTA 2W54A 1MBTA 2VFSA 3TSJA 4ZOHB 3ETRB 1JROA 4PYTA 5I1WA 3W8ZA 2Y3RA 1W1LA 1V97A 4JAYA 2VFUA 3SR6B 2Q85A 3VTEA 3EUB3 1QLUA 5AE3A 2QPMA 2BVFA 1N5WC 2GQTA 4EC3A 3FW9A 2VAOA 2VFRA 3TX1A 3JS8A 1W1KA 1UXYA 1E0YA 3S1DA 2W55A 3PQBA 5AE2A 3W8WA 1T3QC 1HSKA 3D2JA 1WVEA 3FW8A 4PVKA 3PM9A 1AHVA 1FO4A 3FWAA 3NS1B 3D2HA 5FXDA 2VFVA 1WVFA 2Y3SA 3S1EA 1W1OA 1E8FA 4UD8A 5D79A 3RJAA 1N61C 3KJMA 4JB1A 1ZXIC 4BC9A 1N5XA 3C0PA 4PVJA 5HMRA 2BVHA 1E8GA 3FW7A 2BVGA 3GSYA 4ML8A 1W1QA 2Y4GA 4BC7A 3B9JB 2QKNA 3S1CA 4BCAA 2E3TA 1E8HA 1AHUA 3RJ8A 2AXRA 1W1MA 1DIIA 2IPIA 1FFUC 1W1JA 4PZFA 2WDWA 3D2DA 4DNSA 1DZNA 2GQUA 1F0XA 3POPA 1N60C 5ADZA 2I0KA 1N63C 2MBRA 4PVEA 3S1FA 2W3SA 5FXPA 5HHZA 1W1SA 5K8EA 3BW7A 4PVHA 1FIQB 5L6FA 1W1RA 3TSHA 3I99A 4PWCA
chains in the Genus database with same CATH superfamily
3NVZB 1AHZA 1N62C 3AN1A 3AM9A 4PWBA 3NVWB 4OALA 4MLAA 5L6GA 2EXRA 5AE1A 2NQWA 5G5HB 1WYGA 1VDVA 3NRZB 3W8XA 5HQXA 5FXFA 2Y08A 5AWVA 3HSUA 1MBBA 2Q4WA 2P13A 2W3RA 1I19A 1DIQA 4XLOA 1ZR6A 1FFVC 2VFTA 3AMZA 5I1VA 3DQ0A 3LAEA 3EJDB 5FXEA 1VAOA 4BBYA 4O95A 1QLTA 2W54A 1MBTA 2VFSA 3TSJA 1SB3B 4ZOHB 3ETRB 1JROA 2P4PA 4PYTA 5I1WA 3W8ZA 2Y3RA 2UUVA 1W1LA 1V97A 3EJEB 4JAYA 2VFUA 3SR6B 2Q85A 3VTEA 3EUB3 1QLUA 5AE3A 2QPMA 3NVYB 2BVFA 1N5WC 2GQTA 4EC3A 3FW9A 2VAOA 2VFRA 3TX1A 3JS8A 1W1KA 1UXYA 1E0YA 3S1DA 2W55A 3PQBA 2R2ZA 5AE2A 3W8WA 1JRPA 1T3QC 1HSKA 3D2JA 2PLSA 1WVEA 3FW8A 4PVKA 3PM9A 2OAIA 1AHVA 1FO4A 3FWAA 3NS1B 3D2HA 5FXDA 2VFVA 1WVFA 2YVSA 2Y3SA 3S1EA 1W1OA 1E8FA 4UD8A 3HRDC 5D79A 3RJAA 1N61C 3KJMA 4JB1A 2O3GA 1ZXIC 4BC9A 1N5XA 3C0PA 4PVJA 5HMRA 2BVHA 1E8GA 3FW7A 2BVGA 3GSYA 4ML8A 1W1QA 3EJBB 2Y4GA 4BC7A 3B9JB 2QKNA 3S1CA 4BCAA 2E3TA 1E8HA 1AHUA 2PLIA 2UUUA 5G5GB 3RJ8A 2AXRA 1W1MA 3DEDA 1DIIA 3NVVB 1FFUC 1W1JA 4PZFA 2IPIA 3D2DA 2RK5A 2WDWA 4DNSA 1DZNA 2GQUA 1F0XA 2P3HA 3POPA 1N60C 5ADZA 2I0KA 1N63C 2MBRA 1RM6B 3LLBA 4PVEA 3S1FA 2W3SA 5FXPA 2R8DA 5HHZA 1W1SA 5K8EA 3BW7A 4PVHA 1FIQB 5L6FA 1W1RA 3TSHA 3I99A 4HG0A 4PWCA
chains in the Genus database with same CATH topology
3NVZB 1AHZA 1N62C 3AN1A 3AM9A 4PWBA 4OALA 3NVWB 4MLAA 5L6GA 2EXRA 5AE1A 2NQWA 5G5HB 1WYGA 1VDVA 3NRZB 3W8XA 5HQXA 5FXFA 2Y08A 5AWVA 3HSUA 1MBBA 2Q4WA 2P13A 2W3RA 1I19A 1DIQA 4XLOA 1ZR6A 1FFVC 2VFTA 3AMZA 5I1VA 3DQ0A 3LAEA 5FXEA 1VAOA 4BBYA 4O95A 1QLTA 2W54A 1MBTA 2VFSA 3TSJA 1SB3B 4ZOHB 3ETRB 1JROA 2P4PA 4PYTA 5I1WA 3W8ZA 2Y3RA 2UUVA 1W1LA 1V97A 4JAYA 2VFUA 3SR6B 2Q85A 3VTEA 3EUB3 1QLUA 5AE3A 2QPMA 3NVYB 2BVFA 1N5WC 2GQTA 4EC3A 3FW9A 2VAOA 2VFRA 3TX1A 3JS8A 1W1KA 1UXYA 1E0YA 3S1DA 2W55A 3PQBA 2R2ZA 5AE2A 3W8WA 1JRPA 1T3QC 1HSKA 3D2JA 2PLSA 1WVEA 3FW8A 4PVKA 3PM9A 2OAIA 1AHVA 1FO4A 3FWAA 3NS1B 3D2HA 5FXDA 2VFVA 1WVFA 2YVSA 2Y3SA 3S1EA 1W1OA 1E8FA 4UD8A 3HRDC 5D79A 3RJAA 1N61C 3KJMA 4JB1A 2O3GA 1ZXIC 4BC9A 1N5XA 3C0PA 4PVJA 5HMRA 2BVHA 1E8GA 3FW7A 2BVGA 3GSYA 4ML8A 1W1QA 2Y4GA 4BC7A 3B9JB 2QKNA 3S1CA 4BCAA 2E3TA 1E8HA 1AHUA 2PLIA 2UUUA 5G5GB 3RJ8A 2AXRA 1W1MA 3DEDA 1DIIA 2IPIA 1FFUC 1W1JA 4PZFA 2RK5A 3D2DA 2WDWA 3NVVB 4DNSA 1DZNA 2GQUA 1F0XA 2P3HA 3POPA 1N60C 5ADZA 2I0KA 1N63C 2MBRA 1RM6B 3LLBA 4PVEA 3S1FA 2W3SA 5FXPA 2R8DA 5HHZA 1W1SA 5K8EA 3BW7A 4PVHA 1FIQB 5L6FA 1W1RA 3TSHA 3I99A 4HG0A 4PWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVZ B;  1AHZ A;  1N62 C;  3AN1 A;  3AM9 A;  4PWB A;  4OAL A;  4MLA A;  5L6G A;  2EXR A;  5AE1 A;  1WYG A;  1VDV A;  3NRZ B;  3W8X A;  5HQX A;  5FXF A;  2Y08 A;  5AWV A;  3HSU A;  1MBB A;  2Q4W A;  2W3R A;  1I19 A;  1DIQ A;  4XLO A;  1ZR6 A;  1FFV C;  2VFT A;  3AMZ A;  5I1V A;  3DQ0 A;  5FXE A;  1VAO A;  4BBY A;  4O95 A;  1QLT A;  2W54 A;  1MBT A;  2VFS A;  3TSJ A;  4ZOH B;  3ETR B;  1JRO A;  4PYT A;  5I1W A;  3W8Z A;  2Y3R A;  1W1L A;  1V97 A;  4JAY A;  2VFU A;  3SR6 B;  2Q85 A;  3VTE A;  3EUB 3;  1QLU A;  5AE3 A;  2QPM A;  2BVF A;  1N5W C;  2GQT A;  4EC3 A;  3FW9 A;  2VAO A;  2VFR A;  3TX1 A;  3JS8 A;  1W1K A;  1UXY A;  1E0Y A;  3S1D A;  2W55 A;  3PQB A;  5AE2 A;  3W8W A;  1T3Q C;  1HSK A;  3D2J A;  1WVE A;  3FW8 A;  4PVK A;  3PM9 A;  1AHV A;  1FO4 A;  3FWA A;  3NS1 B;  3D2H A;  5FXD A;  2VFV A;  1WVF A;  2Y3S A;  3S1E A;  1W1O A;  1E8F A;  4UD8 A;  5D79 A;  3RJA A;  1N61 C;  3KJM A;  4JB1 A;  1ZXI C;  4BC9 A;  1N5X A;  3C0P A;  4PVJ A;  5HMR A;  2BVH A;  1E8G A;  3FW7 A;  2BVG A;  3GSY A;  4ML8 A;  1W1Q A;  2Y4G A;  4BC7 A;  3B9J B;  2QKN A;  3S1C A;  4BCA A;  2E3T A;  1E8H A;  1AHU A;  3RJ8 A;  2AXR A;  1W1M A;  1DII A;  2IPI A;  1FFU C;  1W1J A;  4PZF A;  2WDW A;  3D2D A;  4DNS A;  1DZN A;  2GQU A;  1F0X A;  3POP A;  1N60 C;  5ADZ A;  2I0K A;  1N63 C;  2MBR A;  4PVE A;  3S1F A;  2W3S A;  5FXP A;  5HHZ A;  1W1S A;  5K8E A;  3BW7 A;  4PVH A;  1FIQ B;  5L6F A;  1W1R A;  3TSH A;  3I99 A;  4PWC A; 
#chains in the Genus database with same CATH topology
 3NVZ B;  1AHZ A;  1N62 C;  3AN1 A;  3AM9 A;  4PWB A;  3NVW B;  4OAL A;  4MLA A;  5L6G A;  2EXR A;  5AE1 A;  2NQW A;  5G5H B;  1WYG A;  1VDV A;  3NRZ B;  3W8X A;  5HQX A;  5FXF A;  2Y08 A;  5AWV A;  3HSU A;  1MBB A;  2Q4W A;  2P13 A;  2W3R A;  1I19 A;  1DIQ A;  4XLO A;  1ZR6 A;  1FFV C;  2VFT A;  3AMZ A;  5I1V A;  3DQ0 A;  3LAE A;  3EJD B;  5FXE A;  1VAO A;  4BBY A;  4O95 A;  1QLT A;  2W54 A;  1MBT A;  2VFS A;  3TSJ A;  1SB3 B;  4ZOH B;  3ETR B;  1JRO A;  2P4P A;  4PYT A;  5I1W A;  3W8Z A;  2Y3R A;  2UUV A;  1W1L A;  1V97 A;  3EJE B;  4JAY A;  2VFU A;  3SR6 B;  2Q85 A;  3VTE A;  3EUB 3;  1QLU A;  5AE3 A;  2QPM A;  3NVY B;  2BVF A;  1N5W C;  2GQT A;  4EC3 A;  3FW9 A;  2VAO A;  2VFR A;  3TX1 A;  3JS8 A;  1W1K A;  1UXY A;  1E0Y A;  3S1D A;  2W55 A;  3PQB A;  2R2Z A;  5AE2 A;  3W8W A;  1JRP A;  1T3Q C;  1HSK A;  3D2J A;  2PLS A;  1WVE A;  3FW8 A;  4PVK A;  3PM9 A;  2OAI A;  1AHV A;  1FO4 A;  3FWA A;  3NS1 B;  3D2H A;  5FXD A;  2VFV A;  1WVF A;  2YVS A;  2Y3S A;  3S1E A;  1W1O A;  1E8F A;  4UD8 A;  3HRD C;  5D79 A;  3RJA A;  1N61 C;  3KJM A;  4JB1 A;  2O3G A;  1ZXI C;  4BC9 A;  1N5X A;  3C0P A;  4PVJ A;  5HMR A;  2BVH A;  1E8G A;  3FW7 A;  2BVG A;  3GSY A;  4ML8 A;  1W1Q A;  3EJB B;  2Y4G A;  4BC7 A;  3B9J B;  2QKN A;  3S1C A;  4BCA A;  2E3T A;  1E8H A;  1AHU A;  2PLI A;  2UUU A;  5G5G B;  3RJ8 A;  2AXR A;  1W1M A;  3DED A;  1DII A;  3NVV B;  1FFU C;  1W1J A;  4PZF A;  2IPI A;  3D2D A;  2RK5 A;  2WDW A;  4DNS A;  1DZN A;  2GQU A;  1F0X A;  2P3H A;  3POP A;  1N60 C;  5ADZ A;  2I0K A;  1N63 C;  2MBR A;  1RM6 B;  3LLB A;  4PVE A;  3S1F A;  2W3S A;  5FXP A;  2R8D A;  5HHZ A;  1W1S A;  5K8E A;  3BW7 A;  4PVH A;  1FIQ B;  5L6F A;  1W1R A;  3TSH A;  3I99 A;  4HG0 A;  4PWC A; 
#chains in the Genus database with same CATH homology
 3NVZ B;  1AHZ A;  1N62 C;  3AN1 A;  3AM9 A;  4PWB A;  4OAL A;  3NVW B;  4MLA A;  5L6G A;  2EXR A;  5AE1 A;  2NQW A;  5G5H B;  1WYG A;  1VDV A;  3NRZ B;  3W8X A;  5HQX A;  5FXF A;  2Y08 A;  5AWV A;  3HSU A;  1MBB A;  2Q4W A;  2P13 A;  2W3R A;  1I19 A;  1DIQ A;  4XLO A;  1ZR6 A;  1FFV C;  2VFT A;  3AMZ A;  5I1V A;  3DQ0 A;  3LAE A;  5FXE A;  1VAO A;  4BBY A;  4O95 A;  1QLT A;  2W54 A;  1MBT A;  2VFS A;  3TSJ A;  1SB3 B;  4ZOH B;  3ETR B;  1JRO A;  2P4P A;  4PYT A;  5I1W A;  3W8Z A;  2Y3R A;  2UUV A;  1W1L A;  1V97 A;  4JAY A;  2VFU A;  3SR6 B;  2Q85 A;  3VTE A;  3EUB 3;  1QLU A;  5AE3 A;  2QPM A;  3NVY B;  2BVF A;  1N5W C;  2GQT A;  4EC3 A;  3FW9 A;  2VAO A;  2VFR A;  3TX1 A;  3JS8 A;  1W1K A;  1UXY A;  1E0Y A;  3S1D A;  2W55 A;  3PQB A;  2R2Z A;  5AE2 A;  3W8W A;  1JRP A;  1T3Q C;  1HSK A;  3D2J A;  2PLS A;  1WVE A;  3FW8 A;  4PVK A;  3PM9 A;  2OAI A;  1AHV A;  1FO4 A;  3FWA A;  3NS1 B;  3D2H A;  5FXD A;  2VFV A;  1WVF A;  2YVS A;  2Y3S A;  3S1E A;  1W1O A;  1E8F A;  4UD8 A;  3HRD C;  5D79 A;  3RJA A;  1N61 C;  3KJM A;  4JB1 A;  2O3G A;  1ZXI C;  4BC9 A;  1N5X A;  3C0P A;  4PVJ A;  5HMR A;  2BVH A;  1E8G A;  3FW7 A;  2BVG A;  3GSY A;  4ML8 A;  1W1Q A;  2Y4G A;  4BC7 A;  3B9J B;  2QKN A;  3S1C A;  4BCA A;  2E3T A;  1E8H A;  1AHU A;  2PLI A;  2UUU A;  5G5G B;  3RJ8 A;  2AXR A;  1W1M A;  3DED A;  1DII A;  2IPI A;  1FFU C;  1W1J A;  4PZF A;  2RK5 A;  3D2D A;  2WDW A;  3NVV B;  4DNS A;  1DZN A;  2GQU A;  1F0X A;  2P3H A;  3POP A;  1N60 C;  5ADZ A;  2I0K A;  1N63 C;  2MBR A;  1RM6 B;  3LLB A;  4PVE A;  3S1F A;  2W3S A;  5FXP A;  2R8D A;  5HHZ A;  1W1S A;  5K8E A;  3BW7 A;  4PVH A;  1FIQ B;  5L6F A;  1W1R A;  3TSH A;  3I99 A;  4HG0 A;  4PWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...