3TSJA

Crystal structure of phl p 4, a grass pollen allergen with glucose dehydrogenase activity
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
489
structure length
489
Chain Sequence
DFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4
publication title Crystal structure and immunologic characterization of the major grass pollen allergen Phl p 4.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen, oxidoreductase
total genus 168
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tsjA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tsjA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 3tsjA03
2WDWA 2MBRA 1WVFA 1QLTA 3W8XA 1ZXIC 3FW9A 2VFSA 4PZFA 2AXRA 1DZNA 2E3TA 5AE3A 1WYGA 1W1KA 2GQTA 2VFTA 2Y3RA 4PVHA 4PVKA 3FW8A 2VAOA 3TX1A 2I0KA 5AE1A 5FXFA 2W55A 3SR6B 4PVEA 1N5WC 1MBTA 1T3QC 4JAYA 2W3SA 1AHUA 1E8FA 4OALA 4BC9A 4BC7A 4DNSA 2Q4WA 5I1VA 3JS8A 1AHZA 3PQBA 5I1WA 2QPMA 1VAOA 3AM9A 5FXDA 5ADZA 3HSUA 2Y08A 2Y4GA 1QLUA 3DQ0A 3GSYA 3NS1B 3B9JB 5K8EA 2BVGA 3TSHA 3BW7A 2W3RA 1WVEA 1JROA 1UXYA 3W8ZA 3I99A 2VFVA 1E8HA 2BVFA 3S1DA 4ML8A 4JB1A 2IPIA 2Q85A 2QKNA 3NVZB 5AWVA 2GQUA 3ETRB 1N61C 4UD8A 2Y3SA 1FFVC 1W1QA 4MLAA 4BCAA 4BBYA 1N63C 3D2HA 4XLOA 2EXRA 5L6FA 4PYTA 3D2JA 1N62C 3AN1A 3NRZB 3FWAA 4EC3A 1W1JA 5D79A 3VTEA 4PWCA 1E0YA 4PWBA 1W1OA 5HQXA 1N5XA 5FXPA 1W1LA 1DIQA 1F0XA 1VDVA 5FXEA 3AMZA 1W1MA 3PM9A 5HHZA 4O95A 1FIQB 2BVHA 1W1RA 1V97A 3TSJA 4PVJA 3RJAA 1FO4A 1FFUC 3C0PA 4ZOHB 3FW7A 3W8WA 1MBBA 5HMRA 2VFUA 1ZR6A 3KJMA 3D2DA 3EUB3 3POPA 3RJ8A 3S1CA 5AE2A 5L6GA 2VFRA 1HSKA 1I19A 1N60C 1DIIA 1E8GA 2W54A 1W1SA 3S1EA 1AHVA 3S1FA
chains in the Genus database with same CATH superfamily
3EJEB 2WDWA 2MBRA 1WVFA 3EJBB 2P13A 1QLTA 3W8XA 1ZXIC 2P4PA 3FW9A 2VFSA 4PZFA 2AXRA 1DZNA 2E3TA 5AE3A 3HRDC 1WYGA 1W1KA 2GQTA 2VFTA 2Y3RA 4PVHA 4HG0A 4PVKA 3FW8A 2PLIA 2VAOA 3TX1A 3EJDB 2P3HA 2I0KA 5AE1A 5FXFA 2W55A 3NVYB 3SR6B 4PVEA 5G5HB 1N5WC 1MBTA 1T3QC 2UUVA 3NVVB 2W3SA 1AHUA 4JAYA 3LAEA 1E8FA 4OALA 4BC9A 4BC7A 4DNSA 1SB3B 2Q4WA 5I1VA 3JS8A 1AHZA 3PQBA 5I1WA 2QPMA 1VAOA 3AM9A 5FXDA 5ADZA 3HSUA 2Y08A 2Y4GA 1QLUA 3DQ0A 3GSYA 3NS1B 3B9JB 5K8EA 2BVGA 3TSHA 3BW7A 2W3RA 2NQWA 1WVEA 1JROA 1UXYA 3W8ZA 3I99A 2VFVA 1E8HA 2BVFA 3S1DA 4ML8A 4JB1A 2IPIA 2Q85A 2QKNA 3NVZB 5AWVA 2GQUA 3ETRB 1N61C 4UD8A 2Y3SA 1FFVC 1W1QA 4MLAA 4BCAA 4BBYA 1N63C 3D2HA 4XLOA 2EXRA 5L6FA 4PYTA 2PLSA 3D2JA 1N62C 3AN1A 3NRZB 3FWAA 4EC3A 1W1JA 3NVWB 5D79A 2RK5A 3VTEA 4PWCA 2O3GA 1E0YA 4PWBA 1W1OA 5HQXA 1N5XA 2UUUA 5FXPA 1W1LA 1RM6B 1DIQA 2YVSA 2OAIA 1F0XA 1VDVA 1JRPA 5FXEA 3AMZA 1W1MA 3PM9A 5HHZA 4O95A 1FIQB 2BVHA 1W1RA 1V97A 3TSJA 2R2ZA 4PVJA 3RJAA 1FO4A 1FFUC 3C0PA 4ZOHB 3FW7A 3W8WA 1MBBA 5HMRA 2VFUA 3LLBA 1ZR6A 3KJMA 3D2DA 3EUB3 3POPA 3RJ8A 3S1CA 5AE2A 5L6GA 2VFRA 5G5GB 1HSKA 2R8DA 1I19A 1N60C 1DIIA 1E8GA 2W54A 3DEDA 1W1SA 3S1EA 1AHVA 3S1FA
chains in the Genus database with same CATH topology
2WDWA 2MBRA 1WVFA 2P13A 1QLTA 3W8XA 1ZXIC 2P4PA 3FW9A 2VFSA 4PZFA 2AXRA 1DZNA 2E3TA 5AE3A 3HRDC 1WYGA 1W1KA 2GQTA 2VFTA 2Y3RA 4PVHA 4HG0A 4PVKA 3FW8A 2PLIA 2VAOA 3TX1A 2P3HA 2I0KA 5AE1A 5FXFA 2W55A 3NVYB 3SR6B 4PVEA 5G5HB 1N5WC 1MBTA 1T3QC 2UUVA 4JAYA 2W3SA 1AHUA 3LAEA 3NVVB 1E8FA 4OALA 4BC9A 4BC7A 4DNSA 1SB3B 2Q4WA 5I1VA 3JS8A 1AHZA 3PQBA 5I1WA 2QPMA 1VAOA 3AM9A 5FXDA 5ADZA 3HSUA 2Y08A 2Y4GA 1QLUA 3DQ0A 3GSYA 3NS1B 3B9JB 5K8EA 2BVGA 3TSHA 3BW7A 2W3RA 2NQWA 1WVEA 1JROA 1UXYA 3W8ZA 3I99A 2VFVA 1E8HA 2BVFA 3S1DA 4ML8A 4JB1A 2IPIA 2Q85A 2QKNA 3NVZB 5AWVA 2GQUA 3ETRB 1N61C 4UD8A 2Y3SA 1FFVC 1W1QA 4MLAA 4BCAA 4BBYA 1N63C 3D2HA 4XLOA 2EXRA 5L6FA 4PYTA 2PLSA 3D2JA 1N62C 3AN1A 3NRZB 3FWAA 4EC3A 1W1JA 5D79A 3NVWB 2RK5A 3VTEA 4PWCA 2O3GA 1E0YA 4PWBA 1W1OA 5HQXA 1N5XA 2UUUA 5FXPA 1W1LA 1RM6B 1DIQA 2YVSA 2OAIA 1F0XA 1VDVA 1JRPA 5FXEA 3AMZA 1W1MA 3PM9A 5HHZA 4O95A 1FIQB 2BVHA 1W1RA 1V97A 3TSJA 2R2ZA 4PVJA 3RJAA 1FO4A 1FFUC 3C0PA 4ZOHB 3FW7A 3W8WA 1MBBA 5HMRA 2VFUA 3LLBA 1ZR6A 3KJMA 3D2DA 3EUB3 3POPA 3RJ8A 3S1CA 5AE2A 5L6GA 2VFRA 5G5GB 1HSKA 2R8DA 1I19A 1N60C 1DIIA 1E8GA 2W54A 3DEDA 1W1SA 3S1EA 1AHVA 3S1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDW A;  2MBR A;  1WVF A;  1QLT A;  3W8X A;  1ZXI C;  3FW9 A;  2VFS A;  4PZF A;  2AXR A;  1DZN A;  2E3T A;  5AE3 A;  1WYG A;  1W1K A;  2GQT A;  2VFT A;  2Y3R A;  4PVH A;  4PVK A;  3FW8 A;  2VAO A;  3TX1 A;  2I0K A;  5AE1 A;  5FXF A;  2W55 A;  3SR6 B;  4PVE A;  1N5W C;  1MBT A;  1T3Q C;  4JAY A;  2W3S A;  1AHU A;  1E8F A;  4OAL A;  4BC9 A;  4BC7 A;  4DNS A;  2Q4W A;  5I1V A;  3JS8 A;  1AHZ A;  3PQB A;  5I1W A;  2QPM A;  1VAO A;  3AM9 A;  5FXD A;  5ADZ A;  3HSU A;  2Y08 A;  2Y4G A;  1QLU A;  3DQ0 A;  3GSY A;  3NS1 B;  3B9J B;  5K8E A;  2BVG A;  3TSH A;  3BW7 A;  2W3R A;  1WVE A;  1JRO A;  1UXY A;  3W8Z A;  3I99 A;  2VFV A;  1E8H A;  2BVF A;  3S1D A;  4ML8 A;  4JB1 A;  2IPI A;  2Q85 A;  2QKN A;  3NVZ B;  5AWV A;  2GQU A;  3ETR B;  1N61 C;  4UD8 A;  2Y3S A;  1FFV C;  1W1Q A;  4MLA A;  4BCA A;  4BBY A;  1N63 C;  3D2H A;  4XLO A;  2EXR A;  5L6F A;  4PYT A;  3D2J A;  1N62 C;  3AN1 A;  3NRZ B;  3FWA A;  4EC3 A;  1W1J A;  5D79 A;  3VTE A;  4PWC A;  1E0Y A;  4PWB A;  1W1O A;  5HQX A;  1N5X A;  5FXP A;  1W1L A;  1DIQ A;  1F0X A;  1VDV A;  5FXE A;  3AMZ A;  1W1M A;  3PM9 A;  5HHZ A;  4O95 A;  1FIQ B;  2BVH A;  1W1R A;  1V97 A;  3TSJ A;  4PVJ A;  3RJA A;  1FO4 A;  1FFU C;  3C0P A;  4ZOH B;  3FW7 A;  3W8W A;  1MBB A;  5HMR A;  2VFU A;  1ZR6 A;  3KJM A;  3D2D A;  3EUB 3;  3POP A;  3RJ8 A;  3S1C A;  5AE2 A;  5L6G A;  2VFR A;  1HSK A;  1I19 A;  1N60 C;  1DII A;  1E8G A;  2W54 A;  1W1S A;  3S1E A;  1AHV A;  3S1F A; 
#chains in the Genus database with same CATH topology
 3EJE B;  2WDW A;  2MBR A;  1WVF A;  3EJB B;  2P13 A;  1QLT A;  3W8X A;  1ZXI C;  2P4P A;  3FW9 A;  2VFS A;  4PZF A;  2AXR A;  1DZN A;  2E3T A;  5AE3 A;  3HRD C;  1WYG A;  1W1K A;  2GQT A;  2VFT A;  2Y3R A;  4PVH A;  4HG0 A;  4PVK A;  3FW8 A;  2PLI A;  2VAO A;  3TX1 A;  3EJD B;  2P3H A;  2I0K A;  5AE1 A;  5FXF A;  2W55 A;  3NVY B;  3SR6 B;  4PVE A;  5G5H B;  1N5W C;  1MBT A;  1T3Q C;  2UUV A;  3NVV B;  2W3S A;  1AHU A;  4JAY A;  3LAE A;  1E8F A;  4OAL A;  4BC9 A;  4BC7 A;  4DNS A;  1SB3 B;  2Q4W A;  5I1V A;  3JS8 A;  1AHZ A;  3PQB A;  5I1W A;  2QPM A;  1VAO A;  3AM9 A;  5FXD A;  5ADZ A;  3HSU A;  2Y08 A;  2Y4G A;  1QLU A;  3DQ0 A;  3GSY A;  3NS1 B;  3B9J B;  5K8E A;  2BVG A;  3TSH A;  3BW7 A;  2W3R A;  2NQW A;  1WVE A;  1JRO A;  1UXY A;  3W8Z A;  3I99 A;  2VFV A;  1E8H A;  2BVF A;  3S1D A;  4ML8 A;  4JB1 A;  2IPI A;  2Q85 A;  2QKN A;  3NVZ B;  5AWV A;  2GQU A;  3ETR B;  1N61 C;  4UD8 A;  2Y3S A;  1FFV C;  1W1Q A;  4MLA A;  4BCA A;  4BBY A;  1N63 C;  3D2H A;  4XLO A;  2EXR A;  5L6F A;  4PYT A;  2PLS A;  3D2J A;  1N62 C;  3AN1 A;  3NRZ B;  3FWA A;  4EC3 A;  1W1J A;  3NVW B;  5D79 A;  2RK5 A;  3VTE A;  4PWC A;  2O3G A;  1E0Y A;  4PWB A;  1W1O A;  5HQX A;  1N5X A;  2UUU A;  5FXP A;  1W1L A;  1RM6 B;  1DIQ A;  2YVS A;  2OAI A;  1F0X A;  1VDV A;  1JRP A;  5FXE A;  3AMZ A;  1W1M A;  3PM9 A;  5HHZ A;  4O95 A;  1FIQ B;  2BVH A;  1W1R A;  1V97 A;  3TSJ A;  2R2Z A;  4PVJ A;  3RJA A;  1FO4 A;  1FFU C;  3C0P A;  4ZOH B;  3FW7 A;  3W8W A;  1MBB A;  5HMR A;  2VFU A;  3LLB A;  1ZR6 A;  3KJM A;  3D2D A;  3EUB 3;  3POP A;  3RJ8 A;  3S1C A;  5AE2 A;  5L6G A;  2VFR A;  5G5G B;  1HSK A;  2R8D A;  1I19 A;  1N60 C;  1DII A;  1E8G A;  2W54 A;  3DED A;  1W1S A;  3S1E A;  1AHV A;  3S1F A; 
#chains in the Genus database with same CATH homology
 2WDW A;  2MBR A;  1WVF A;  2P13 A;  1QLT A;  3W8X A;  1ZXI C;  2P4P A;  3FW9 A;  2VFS A;  4PZF A;  2AXR A;  1DZN A;  2E3T A;  5AE3 A;  3HRD C;  1WYG A;  1W1K A;  2GQT A;  2VFT A;  2Y3R A;  4PVH A;  4HG0 A;  4PVK A;  3FW8 A;  2PLI A;  2VAO A;  3TX1 A;  2P3H A;  2I0K A;  5AE1 A;  5FXF A;  2W55 A;  3NVY B;  3SR6 B;  4PVE A;  5G5H B;  1N5W C;  1MBT A;  1T3Q C;  2UUV A;  4JAY A;  2W3S A;  1AHU A;  3LAE A;  3NVV B;  1E8F A;  4OAL A;  4BC9 A;  4BC7 A;  4DNS A;  1SB3 B;  2Q4W A;  5I1V A;  3JS8 A;  1AHZ A;  3PQB A;  5I1W A;  2QPM A;  1VAO A;  3AM9 A;  5FXD A;  5ADZ A;  3HSU A;  2Y08 A;  2Y4G A;  1QLU A;  3DQ0 A;  3GSY A;  3NS1 B;  3B9J B;  5K8E A;  2BVG A;  3TSH A;  3BW7 A;  2W3R A;  2NQW A;  1WVE A;  1JRO A;  1UXY A;  3W8Z A;  3I99 A;  2VFV A;  1E8H A;  2BVF A;  3S1D A;  4ML8 A;  4JB1 A;  2IPI A;  2Q85 A;  2QKN A;  3NVZ B;  5AWV A;  2GQU A;  3ETR B;  1N61 C;  4UD8 A;  2Y3S A;  1FFV C;  1W1Q A;  4MLA A;  4BCA A;  4BBY A;  1N63 C;  3D2H A;  4XLO A;  2EXR A;  5L6F A;  4PYT A;  2PLS A;  3D2J A;  1N62 C;  3AN1 A;  3NRZ B;  3FWA A;  4EC3 A;  1W1J A;  5D79 A;  3NVW B;  2RK5 A;  3VTE A;  4PWC A;  2O3G A;  1E0Y A;  4PWB A;  1W1O A;  5HQX A;  1N5X A;  2UUU A;  5FXP A;  1W1L A;  1RM6 B;  1DIQ A;  2YVS A;  2OAI A;  1F0X A;  1VDV A;  1JRP A;  5FXE A;  3AMZ A;  1W1M A;  3PM9 A;  5HHZ A;  4O95 A;  1FIQ B;  2BVH A;  1W1R A;  1V97 A;  3TSJ A;  2R2Z A;  4PVJ A;  3RJA A;  1FO4 A;  1FFU C;  3C0P A;  4ZOH B;  3FW7 A;  3W8W A;  1MBB A;  5HMR A;  2VFU A;  3LLB A;  1ZR6 A;  3KJM A;  3D2D A;  3EUB 3;  3POP A;  3RJ8 A;  3S1C A;  5AE2 A;  5L6G A;  2VFR A;  5G5G B;  1HSK A;  2R8D A;  1I19 A;  1N60 C;  1DII A;  1E8G A;  2W54 A;  3DED A;  1W1S A;  3S1E A;  1AHV A;  3S1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...