3TSKA

Human mmp12 in complex with l-glutamate motif inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Simple pseudo-dipeptides with a P2' glutamate: a novel inhibitor family of matrix metalloproteases and other metzincins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3tskA00
3LEAA 1C3IA 3EWJA 1JIWP 2MLSA 2SRTA 4PKTA 1OO9A 3DNGA 1MMPA 2DW2A 4GWNA 1B3DA 3RTSA 1OMJA 4XCTA 4H3XA 1CGLA 3HDBA 3B92A 3DPEA 1KUHA 1PWWA 3HY7A 1XFUA 2DDFA 2YB9A 1QIBA 1QJJA 4EFSA 1GE7A 1AF0A 4DF9A 4WKEA 3LIKA 2KRJA 5CZMA 4QKZA 1I76A 1IACA 2MZEA 5D1TA 4AYKA 2TCLA 1K7IA 4WF6A 830CA 1QUAA 4Q1LA 1Z3JA 1ASTA 2J0TA 3LILA 1ZP5A 2DDYA 1FLSA 1JH1A 1D5JA 2K2GA 3LK8A 1QJIA 1MNCA 3F1AA 1G05A 1R54A 1MMQA 1Q3AA 2AIGP 3KMCA 4XM7A 2E2DA 4FXQA 1G12A 1B8YA 1C8TA 4ZR5A 2I47A 3VI1A 1JJ9A 1DTHA 4R3VA 4WZVA 4H49A 3USNA 3B8ZA 1ZTQA 1YOUA 3L0VA 3CKIA 4PKVA 1OS2A 2OI0A 3DWBA 3LQBA 4GR0A 1D7XA 1FBLA 1IAGA 1OM6A 2QPJA 1XUDA 2OY2A 3P24A 3G42A 1CXVA 1SLMA 4JP4A 1G49A 3EDZA 4GR3A 2OXZA 3HBUP 1BUVM 3KRYA 1XUCA 4I35A 1JK3A 2V4BA 1IABA 1Y0VA 4GR8A 2W0DA 2MLRA 4JIJA 4WKIA 1GO8P 4IN9A 1ROSA 1R1IA 2WOAA 3B2ZA 5BPAA 4L19A 3I7GA 3LUMA 2JT5A 3TT4A 2MZIA 4XM6A 3VTGA 1I1IP 3EHXA 3HY9A 4XM8A 1BUDA 2ERQA 4L6TA 1SLNA 2JNPA 3ELMA 1BSWA 2CLTA 1GO7P 1S4BP 3KEKA 4J4MA 1GKDA 3KWVC 1CAQA 1ZXVA 1G9KA 2OVZA 2FV5A 4ILWD 2AYKA 2FV9A 5CXAA 4PKWA 3NX7A 5LABA 1AKLA 1UTTA 456CA 1ATLA 4GUYA 1XURA 1PWPA 3SHIA 1BKCE 2WO9A 1HV5A 1HFSA 2A8HA 5B5PA 4WK7A 3LUNA 3BA0A 2W14A 2POJA 2XS4A 1BKCA 1JIZA 1PWQA 1CIZA 1BM6A 2D1OA 1RMZA 2OY4A 3AYKA 3DSLA 1EB6A 3F19A 1CGEA 3HBVP 1D8MA 2PJTA 4H30A 1JAQA 3DL1A 1K7QA 1JKYA 3K7LA 3KEJA 3F17A 3LKAA 4FVLA 4AIGA 1USNA 1A85A 1ZS0A 4DD8A 4PKQA 2USNA 2OXWA 1KBCA 5D3CA 1PWVA 1YQYA 4FXYP 4PKRA 1OM7A 1BQQM 5D7WA 1GKCA 1HFCA 1QICA 1HTDA 2X3AA 5I0LA 2RJPA 1GE5A 2EROA 4IUWA 2OW2A 2W12A 2ERPA 3LQ0A 1R1HA 1O0TA 4PKSA 2HU6A 1MMRA 4JQGA 4XBHA 2RJQA 4AXQA 3K7NA 1HOVA 2OVXA 1ZXCA 2MZHA 1RM8A 3HB2P 3I7IA 4HMAA 3Q2HA 1XFWA 3AIGA 1KUKA 3O64A 3ZUKA 1CGFA 3L0TA 4H2EA 3HYGA 1AYKA 1I73A 1XFYA 3P1VA 1D8FA 3DPFA 3AYUA 4AUOA 3LE9A 4G9LA 3N2UA 5B5OA 4DV8A 2OW0A 3O2XA 5I43A 3LGPA 3MA2A 1L6JA 3LJGA 1K7GA 1XFXA 1YCMA 2W15A 5CUHA 2X3BA 1IAEA 5I3MA 5I12A 5D1UA 3G5CA 3WV3A 2D1NA 3V96B 5L79A 5D2BA 2DW1A 3LIRA 4GQLA 2Z2DA 1ZVXA 1CK7A 1BQOA 1KUFA 5L7FA 4HX3A 3EDGA 2JSDA 2W13A 2X7MA 3GBOA 1SU3A 3TS4A 4A3WA 2JIHA 2L0RA 4JA1A 5D1SA 3HDAP 1SATA 2CKIA 1XFVA 3F15A 1JAPA 3E8RA 1QIAA 1SRPA 3ZVSA 1JAOA 1Y93A 1BZSA 3EDIA 2DW0A 5H8XA 1DMTA 4IJOA 1YP1A 4H76A 4JPAA 4A7BA 2OZRA 2E3XA 5BOTA 4PKUA 1UMTA 1R1JA 3U1RA 1MMBA 1UMSA 1GXDA 1UEAA 1UTZA 3KHIA 4H1QA 3F18A 3RTTA 1BIWA 1A86A 3LJZA 3UVCA 1C7KA 1GE6A 3EHYA 2OW1A 4CTHA 4I03A 3WV1A 3KECA 2K9CA 1OS9A 4G0DA 4GWMA 4ON1A 2YIGA 1G4KA 2O3EA 2Y6CA 1KUGA 3ZXHA 1JANA 3LJTA 3OHOA 1O0QA 2OXUA 5I4OA 1SMPA 1IAAA 1OM8A 2JT6A 4FU4A 1ND1A 966CA 3TSKA 2WO8A 2J83A 5I2ZA 1HY7A 5JMYA 2O36A 1FM1A 1WNIA 4L63A 4DPEA 3WV2A 1Y8JA 1CQRA 4GF1A 5BOYA 4H84A 3LMCA 3TVCA 1IADA 1J7NA 2N8RA 2X3CA 3EDHA 4H82A 1PWUA 3KMEA 1EAKA 1H71P 1KAPP 3Q2GA 3N2VA 1EUBA 1XFZA 1KUIA 3OHLA 3F16A 1R55A 1BKCI 2Y6DA 2XS3A 2OW9A
chains in the Genus database with same CATH superfamily
3LEAA 1C3IA 3EWJA 1JIWP 2MLSA 2SRTA 4PKTA 1OO9A 3DNGA 1MMPA 2DW2A 4GWNA 1B3DA 3RTSA 1OMJA 4XCTA 4H3XA 1CGLA 3HDBA 3B92A 3DPEA 1KUHA 1PWWA 3HY7A 1XFUA 2DDFA 2YB9A 1QIBA 1QJJA 4EFSA 1GE7A 1AF0A 4DF9A 4WKEA 3LIKA 2KRJA 5CZMA 4QKZA 1I76A 1IACA 2MZEA 5D1TA 4AYKA 2TCLA 1K7IA 4WF6A 830CA 1QUAA 4Q1LA 1Z3JA 1ASTA 2J0TA 3LILA 1ZP5A 2DDYA 1FLSA 1JH1A 1D5JA 2K2GA 3LK8A 1QJIA 1MNCA 3F1AA 1G05A 1R54A 1MMQA 1Q3AA 2AIGP 3KMCA 4XM7A 2E2DA 4FXQA 1G12A 1B8YA 1C8TA 4ZR5A 2I47A 3VI1A 1JJ9A 1DTHA 4R3VA 4WZVA 4H49A 3USNA 3B8ZA 1ZTQA 1YOUA 3L0VA 3CKIA 4PKVA 1OS2A 2OI0A 3DWBA 3LQBA 4GR0A 1D7XA 1FBLA 1IAGA 1OM6A 2QPJA 1XUDA 2OY2A 3P24A 3G42A 1CXVA 1SLMA 4JP4A 1G49A 3EDZA 4GR3A 2OXZA 3HBUP 1BUVM 3KRYA 1XUCA 4I35A 1JK3A 2V4BA 1IABA 1Y0VA 4GR8A 2W0DA 2MLRA 4JIJA 4WKIA 1GO8P 4IN9A 1ROSA 1R1IA 2WOAA 3B2ZA 5BPAA 4L19A 3I7GA 3LUMA 2JT5A 3TT4A 2MZIA 4XM6A 3VTGA 1I1IP 3EHXA 3HY9A 4XM8A 1BUDA 2ERQA 4L6TA 1SLNA 2JNPA 3ELMA 1BSWA 2CLTA 1GO7P 1S4BP 3KEKA 4J4MA 1GKDA 3KWVC 1CAQA 1ZXVA 1G9KA 2OVZA 2FV5A 4ILWD 2AYKA 2FV9A 5CXAA 4PKWA 3NX7A 5LABA 1AKLA 1UTTA 456CA 1ATLA 4GUYA 1XURA 1PWPA 3SHIA 1BKCE 2WO9A 1HV5A 1HFSA 2A8HA 5B5PA 4WK7A 3LUNA 3BA0A 2W14A 2POJA 2XS4A 1BKCA 1JIZA 1PWQA 1CIZA 1BM6A 2D1OA 1RMZA 2OY4A 3AYKA 3DSLA 1EB6A 3F19A 1CGEA 3HBVP 1D8MA 2PJTA 4H30A 1JAQA 3DL1A 1K7QA 1JKYA 3K7LA 3KEJA 3F17A 3LKAA 4FVLA 4AIGA 1USNA 1A85A 1ZS0A 4DD8A 4PKQA 2USNA 2OXWA 1KBCA 5D3CA 1PWVA 1YQYA 4FXYP 4PKRA 1OM7A 1BQQM 5D7WA 1GKCA 1HFCA 1TVIA 1QICA 1HTDA 2X3AA 5I0LA 2RJPA 4L7AA 1GE5A 2EROA 4IUWA 2OW2A 2W12A 2ERPA 3LQ0A 1R1HA 1O0TA 4PKSA 2HU6A 1MMRA 4JQGA 4XBHA 2RJQA 4AXQA 3K7NA 1HOVA 2OVXA 1ZXCA 2MZHA 1RM8A 3HB2P 3I7IA 4HMAA 3Q2HA 1XFWA 3AIGA 1KUKA 3O64A 3ZUKA 1CGFA 3L0TA 4H2EA 3HYGA 1AYKA 1I73A 3DTKA 1XFYA 3P1VA 1D8FA 3DPFA 3AYUA 4AUOA 3LE9A 4G9LA 3N2UA 5B5OA 4DV8A 2OW0A 3O2XA 5I43A 3LGPA 3MA2A 1L6JA 3LJGA 1K7GA 1XFXA 1YCMA 2W15A 5CUHA 2X3BA 1IAEA 5I3MA 5I12A 5D1UA 3G5CA 3WV3A 2D1NA 3V96B 5L79A 5D2BA 2DW1A 3LIRA 4GQLA 2Z2DA 1ZVXA 1CK7A 1BQOA 1KUFA 5L7FA 4HX3A 3EDGA 2JSDA 2W13A 2X7MA 3GBOA 1SU3A 3TS4A 4A3WA 2JIHA 2L0RA 4JA1A 5D1SA 3HDAP 1SATA 2CKIA 1XFVA 3F15A 1JAPA 3E8RA 1QIAA 1XAXA 1SRPA 3ZVSA 1JAOA 1Y93A 1BZSA 3EDIA 2DW0A 5H8XA 1DMTA 4IJOA 1YP1A 4H76A 4JPAA 4A7BA 2OZRA 2E3XA 5BOTA 4PKUA 1UMTA 1R1JA 3U1RA 1MMBA 1UMSA 1GXDA 1UEAA 1OZ9A 3KHIA 1UTZA 4H1QA 3F18A 3RTTA 1BIWA 1A86A 3LJZA 3UVCA 1C7KA 1GE6A 3EHYA 2OW1A 4CTHA 4I03A 3WV1A 3KECA 2K9CA 1OS9A 4G0DA 4GWMA 4ON1A 2YIGA 1G4KA 2O3EA 2Y6CA 2YUFA 1KUGA 3ZXHA 1JANA 3LJTA 3OHOA 1O0QA 2OXUA 5I4OA 1SMPA 1IAAA 1OM8A 2JT6A 4FU4A 1ND1A 966CA 3TSKA 2WO8A 2J83A 5I2ZA 1HY7A 1XM5A 5JMYA 2O36A 1FM1A 1WNIA 4L63A 4DPEA 3DTIA 3WV2A 1Y8JA 1CQRA 4GF1A 5BOYA 4H84A 3LMCA 3TVCA 1IADA 1J7NA 2N8RA 2X3CA 3EDHA 4H82A 1PWUA 3DTEA 3KMEA 1EAKA 1H71P 1KAPP 3Q2GA 3N2VA 1EUBA 1XFZA 1KUIA 3OHLA 3F16A 1R55A 1BKCI 2Y6DA 2XS3A 2OW9A
chains in the Genus database with same CATH topology
3LEAA 1C3IA 3EWJA 1JIWP 2MLSA 2SRTA 4PKTA 1OO9A 3DNGA 1MMPA 2DW2A 4GWNA 1B3DA 3RTSA 1OMJA 4XCTA 4H3XA 1CGLA 3HDBA 3B92A 3DPEA 1KUHA 1PWWA 3HY7A 1XFUA 2DDFA 2YB9A 1QIBA 1QJJA 4EFSA 1GE7A 1AF0A 4DF9A 4WKEA 3LIKA 2KRJA 5CZMA 4QKZA 1I76A 1IACA 2MZEA 5D1TA 4AYKA 2TCLA 1K7IA 4WF6A 830CA 1QUAA 4Q1LA 1Z3JA 1ASTA 2J0TA 3LILA 1ZP5A 2DDYA 1FLSA 1JH1A 1D5JA 2K2GA 3LK8A 1QJIA 1MNCA 3F1AA 1G05A 1R54A 1MMQA 1Q3AA 2AIGP 3KMCA 4XM7A 2E2DA 4FXQA 1G12A 1B8YA 1C8TA 4ZR5A 2I47A 3VI1A 1JJ9A 1DTHA 4R3VA 4WZVA 4H49A 3USNA 3B8ZA 1ZTQA 1YOUA 3L0VA 3CKIA 4PKVA 1OS2A 2OI0A 3DWBA 3LQBA 4GR0A 1D7XA 1FBLA 1IAGA 1OM6A 2QPJA 1XUDA 2OY2A 3P24A 3G42A 1CXVA 1SLMA 4JP4A 1G49A 3EDZA 4GR3A 2OXZA 3HBUP 1BUVM 3KRYA 1XUCA 4I35A 1JK3A 2V4BA 1IABA 1Y0VA 4GR8A 2W0DA 2MLRA 4JIJA 4WKIA 1GO8P 4IN9A 1ROSA 1R1IA 2WOAA 3B2ZA 5BPAA 4L19A 3I7GA 3LUMA 2JT5A 3TT4A 2MZIA 4XM6A 3VTGA 1I1IP 3EHXA 3HY9A 4XM8A 1BUDA 2ERQA 4L6TA 1SLNA 2JNPA 3ELMA 1BSWA 2CLTA 1GO7P 1S4BP 3KEKA 4J4MA 1GKDA 3KWVC 1CAQA 1ZXVA 1G9KA 2OVZA 2FV5A 4ILWD 2AYKA 2FV9A 5CXAA 4PKWA 3NX7A 5LABA 1AKLA 1UTTA 456CA 1ATLA 4GUYA 1XURA 1PWPA 3SHIA 1BKCE 2WO9A 1HV5A 1HFSA 2A8HA 5B5PA 4WK7A 3LUNA 3BA0A 2W14A 2POJA 2XS4A 1BKCA 1JIZA 1PWQA 1CIZA 1BM6A 2D1OA 1RMZA 2OY4A 3AYKA 3DSLA 1EB6A 3F19A 1CGEA 3HBVP 1D8MA 2PJTA 4H30A 1JAQA 3DL1A 1K7QA 1JKYA 3K7LA 3KEJA 3F17A 3LKAA 4FVLA 4AIGA 1USNA 1A85A 1ZS0A 4DD8A 4PKQA 2USNA 2OXWA 1KBCA 5D3CA 1PWVA 1YQYA 4FXYP 4PKRA 1OM7A 1BQQM 5D7WA 1GKCA 1HFCA 1QICA 1HTDA 2X3AA 5I0LA 2RJPA 4L7AA 1GE5A 2EROA 4IUWA 2OW2A 2W12A 2ERPA 3LQ0A 1R1HA 1O0TA 4PKSA 2HU6A 1MMRA 4JQGA 4XBHA 2RJQA 4AXQA 3K7NA 1HOVA 2OVXA 1ZXCA 2MZHA 1RM8A 3HB2P 3I7IA 4HMAA 3Q2HA 1XFWA 3AIGA 1KUKA 3O64A 3ZUKA 1CGFA 3L0TA 4H2EA 3HYGA 1AYKA 1I73A 3DTKA 1XFYA 3P1VA 1D8FA 3DPFA 3AYUA 4AUOA 3LE9A 4G9LA 3N2UA 5B5OA 4DV8A 2OW0A 3O2XA 5I43A 3LGPA 3MA2A 1L6JA 3LJGA 1K7GA 1XFXA 1YCMA 2W15A 5CUHA 2X3BA 1IAEA 5I3MA 5I12A 5D1UA 3G5CA 3WV3A 2D1NA 3V96B 5L79A 5D2BA 2DW1A 3LIRA 4GQLA 2Z2DA 1ZVXA 1CK7A 1BQOA 1KUFA 5L7FA 4HX3A 3EDGA 2JSDA 2W13A 2X7MA 3GBOA 1SU3A 3TS4A 4A3WA 2JIHA 2L0RA 4JA1A 5D1SA 3HDAP 1SATA 2CKIA 1XFVA 3F15A 1JAPA 3E8RA 1QIAA 1SRPA 3ZVSA 1JAOA 1Y93A 1BZSA 3EDIA 2DW0A 5H8XA 1DMTA 4IJOA 1YP1A 4H76A 4JPAA 4A7BA 2OZRA 2E3XA 5BOTA 4PKUA 1UMTA 1R1JA 3U1RA 1MMBA 1UMSA 1GXDA 1UEAA 1UTZA 3KHIA 4H1QA 3F18A 3RTTA 1BIWA 1A86A 3LJZA 3UVCA 1C7KA 1GE6A 3EHYA 2OW1A 4CTHA 4I03A 3WV1A 3KECA 2K9CA 1OS9A 4G0DA 4GWMA 4ON1A 2YIGA 1G4KA 2O3EA 2Y6CA 2YUFA 1KUGA 3ZXHA 1JANA 3LJTA 3OHOA 1O0QA 2OXUA 5I4OA 1SMPA 1IAAA 1OM8A 2JT6A 4FU4A 1ND1A 966CA 3TSKA 2WO8A 2J83A 5I2ZA 1HY7A 5JMYA 2O36A 1FM1A 1WNIA 4L63A 4DPEA 3DTIA 3WV2A 1Y8JA 1CQRA 4GF1A 5BOYA 4H84A 3LMCA 3TVCA 1IADA 1J7NA 2N8RA 2X3CA 3EDHA 4H82A 1PWUA 3DTEA 3KMEA 1EAKA 1H71P 1KAPP 3Q2GA 3N2VA 1EUBA 1XFZA 1KUIA 3OHLA 3F16A 1R55A 1BKCI 2Y6DA 2XS3A 2OW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEA A;  1C3I A;  3EWJ A;  1JIW P;  2MLS A;  2SRT A;  4PKT A;  1OO9 A;  3DNG A;  1MMP A;  2DW2 A;  4GWN A;  1B3D A;  3RTS A;  1OMJ A;  4XCT A;  4H3X A;  1CGL A;  3HDB A;  3B92 A;  3DPE A;  1KUH A;  1PWW A;  3HY7 A;  1XFU A;  2DDF A;  2YB9 A;  1QIB A;  1QJJ A;  4EFS A;  1GE7 A;  1AF0 A;  4DF9 A;  4WKE A;  3LIK A;  2KRJ A;  5CZM A;  4QKZ A;  1I76 A;  1IAC A;  2MZE A;  5D1T A;  4AYK A;  2TCL A;  1K7I A;  4WF6 A;  830C A;  1QUA A;  4Q1L A;  1Z3J A;  1AST A;  2J0T A;  3LIL A;  1ZP5 A;  2DDY A;  1FLS A;  1JH1 A;  1D5J A;  2K2G A;  3LK8 A;  1QJI A;  1MNC A;  3F1A A;  1G05 A;  1R54 A;  1MMQ A;  1Q3A A;  2AIG P;  3KMC A;  4XM7 A;  2E2D A;  4FXQ A;  1G12 A;  1B8Y A;  1C8T A;  4ZR5 A;  2I47 A;  3VI1 A;  1JJ9 A;  1DTH A;  4R3V A;  4WZV A;  4H49 A;  3USN A;  3B8Z A;  1ZTQ A;  1YOU A;  3L0V A;  3CKI A;  4PKV A;  1OS2 A;  2OI0 A;  3DWB A;  3LQB A;  4GR0 A;  1D7X A;  1FBL A;  1IAG A;  1OM6 A;  2QPJ A;  1XUD A;  2OY2 A;  3P24 A;  3G42 A;  1CXV A;  1SLM A;  4JP4 A;  1G49 A;  3EDZ A;  4GR3 A;  2OXZ A;  3HBU P;  1BUV M;  3KRY A;  1XUC A;  4I35 A;  1JK3 A;  2V4B A;  1IAB A;  1Y0V A;  4GR8 A;  2W0D A;  2MLR A;  4JIJ A;  4WKI A;  1GO8 P;  4IN9 A;  1ROS A;  1R1I A;  2WOA A;  3B2Z A;  5BPA A;  4L19 A;  3I7G A;  3LUM A;  2JT5 A;  3TT4 A;  2MZI A;  4XM6 A;  3VTG A;  1I1I P;  3EHX A;  3HY9 A;  4XM8 A;  1BUD A;  2ERQ A;  4L6T A;  1SLN A;  2JNP A;  3ELM A;  1BSW A;  2CLT A;  1GO7 P;  1S4B P;  3KEK A;  4J4M A;  1GKD A;  3KWV C;  1CAQ A;  1ZXV A;  1G9K A;  2OVZ A;  2FV5 A;  4ILW D;  2AYK A;  2FV9 A;  5CXA A;  4PKW A;  3NX7 A;  5LAB A;  1AKL A;  1UTT A;  456C A;  1ATL A;  4GUY A;  1XUR A;  1PWP A;  3SHI A;  1BKC E;  2WO9 A;  1HV5 A;  1HFS A;  2A8H A;  5B5P A;  4WK7 A;  3LUN A;  3BA0 A;  2W14 A;  2POJ A;  2XS4 A;  1BKC A;  1JIZ A;  1PWQ A;  1CIZ A;  1BM6 A;  2D1O A;  1RMZ A;  2OY4 A;  3AYK A;  3DSL A;  1EB6 A;  3F19 A;  1CGE A;  3HBV P;  1D8M A;  2PJT A;  4H30 A;  1JAQ A;  3DL1 A;  1K7Q A;  1JKY A;  3K7L A;  3KEJ A;  3F17 A;  3LKA A;  4FVL A;  4AIG A;  1USN A;  1A85 A;  1ZS0 A;  4DD8 A;  4PKQ A;  2USN A;  2OXW A;  1KBC A;  5D3C A;  1PWV A;  1YQY A;  4FXY P;  4PKR A;  1OM7 A;  1BQQ M;  5D7W A;  1GKC A;  1HFC A;  1QIC A;  1HTD A;  2X3A A;  5I0L A;  2RJP A;  1GE5 A;  2ERO A;  4IUW A;  2OW2 A;  2W12 A;  2ERP A;  3LQ0 A;  1R1H A;  1O0T A;  4PKS A;  2HU6 A;  1MMR A;  4JQG A;  4XBH A;  2RJQ A;  4AXQ A;  3K7N A;  1HOV A;  2OVX A;  1ZXC A;  2MZH A;  1RM8 A;  3HB2 P;  3I7I A;  4HMA A;  3Q2H A;  1XFW A;  3AIG A;  1KUK A;  3O64 A;  3ZUK A;  1CGF A;  3L0T A;  4H2E A;  3HYG A;  1AYK A;  1I73 A;  1XFY A;  3P1V A;  1D8F A;  3DPF A;  3AYU A;  4AUO A;  3LE9 A;  4G9L A;  3N2U A;  5B5O A;  4DV8 A;  2OW0 A;  3O2X A;  5I43 A;  3LGP A;  3MA2 A;  1L6J A;  3LJG A;  1K7G A;  1XFX A;  1YCM A;  2W15 A;  5CUH A;  2X3B A;  1IAE A;  5I3M A;  5I12 A;  5D1U A;  3G5C A;  3WV3 A;  2D1N A;  3V96 B;  5L79 A;  5D2B A;  2DW1 A;  3LIR A;  4GQL A;  2Z2D A;  1ZVX A;  1CK7 A;  1BQO A;  1KUF A;  5L7F A;  4HX3 A;  3EDG A;  2JSD A;  2W13 A;  2X7M A;  3GBO A;  1SU3 A;  3TS4 A;  4A3W A;  2JIH A;  2L0R A;  4JA1 A;  5D1S A;  3HDA P;  1SAT A;  2CKI A;  1XFV A;  3F15 A;  1JAP A;  3E8R A;  1QIA A;  1SRP A;  3ZVS A;  1JAO A;  1Y93 A;  1BZS A;  3EDI A;  2DW0 A;  5H8X A;  1DMT A;  4IJO A;  1YP1 A;  4H76 A;  4JPA A;  4A7B A;  2OZR A;  2E3X A;  5BOT A;  4PKU A;  1UMT A;  1R1J A;  3U1R A;  1MMB A;  1UMS A;  1GXD A;  1UEA A;  1UTZ A;  3KHI A;  4H1Q A;  3F18 A;  3RTT A;  1BIW A;  1A86 A;  3LJZ A;  3UVC A;  1C7K A;  1GE6 A;  3EHY A;  2OW1 A;  4CTH A;  4I03 A;  3WV1 A;  3KEC A;  2K9C A;  1OS9 A;  4G0D A;  4GWM A;  4ON1 A;  2YIG A;  1G4K A;  2O3E A;  2Y6C A;  1KUG A;  3ZXH A;  1JAN A;  3LJT A;  3OHO A;  1O0Q A;  2OXU A;  5I4O A;  1SMP A;  1IAA A;  1OM8 A;  2JT6 A;  4FU4 A;  1ND1 A;  966C A;  3TSK A;  2WO8 A;  2J83 A;  5I2Z A;  1HY7 A;  5JMY A;  2O36 A;  1FM1 A;  1WNI A;  4L63 A;  4DPE A;  3WV2 A;  1Y8J A;  1CQR A;  4GF1 A;  5BOY A;  4H84 A;  3LMC A;  3TVC A;  1IAD A;  1J7N A;  2N8R A;  2X3C A;  3EDH A;  4H82 A;  1PWU A;  3KME A;  1EAK A;  1H71 P;  1KAP P;  3Q2G A;  3N2V A;  1EUB A;  1XFZ A;  1KUI A;  3OHL A;  3F16 A;  1R55 A;  1BKC I;  2Y6D A;  2XS3 A;  2OW9 A; 
#chains in the Genus database with same CATH topology
 3LEA A;  1C3I A;  3EWJ A;  1JIW P;  2MLS A;  2SRT A;  4PKT A;  1OO9 A;  3DNG A;  1MMP A;  2DW2 A;  4GWN A;  1B3D A;  3RTS A;  1OMJ A;  4XCT A;  4H3X A;  1CGL A;  3HDB A;  3B92 A;  3DPE A;  1KUH A;  1PWW A;  3HY7 A;  1XFU A;  2DDF A;  2YB9 A;  1QIB A;  1QJJ A;  4EFS A;  1GE7 A;  1AF0 A;  4DF9 A;  4WKE A;  3LIK A;  2KRJ A;  5CZM A;  4QKZ A;  1I76 A;  1IAC A;  2MZE A;  5D1T A;  4AYK A;  2TCL A;  1K7I A;  4WF6 A;  830C A;  1QUA A;  4Q1L A;  1Z3J A;  1AST A;  2J0T A;  3LIL A;  1ZP5 A;  2DDY A;  1FLS A;  1JH1 A;  1D5J A;  2K2G A;  3LK8 A;  1QJI A;  1MNC A;  3F1A A;  1G05 A;  1R54 A;  1MMQ A;  1Q3A A;  2AIG P;  3KMC A;  4XM7 A;  2E2D A;  4FXQ A;  1G12 A;  1B8Y A;  1C8T A;  4ZR5 A;  2I47 A;  3VI1 A;  1JJ9 A;  1DTH A;  4R3V A;  4WZV A;  4H49 A;  3USN A;  3B8Z A;  1ZTQ A;  1YOU A;  3L0V A;  3CKI A;  4PKV A;  1OS2 A;  2OI0 A;  3DWB A;  3LQB A;  4GR0 A;  1D7X A;  1FBL A;  1IAG A;  1OM6 A;  2QPJ A;  1XUD A;  2OY2 A;  3P24 A;  3G42 A;  1CXV A;  1SLM A;  4JP4 A;  1G49 A;  3EDZ A;  4GR3 A;  2OXZ A;  3HBU P;  1BUV M;  3KRY A;  1XUC A;  4I35 A;  1JK3 A;  2V4B A;  1IAB A;  1Y0V A;  4GR8 A;  2W0D A;  2MLR A;  4JIJ A;  4WKI A;  1GO8 P;  4IN9 A;  1ROS A;  1R1I A;  2WOA A;  3B2Z A;  5BPA A;  4L19 A;  3I7G A;  3LUM A;  2JT5 A;  3TT4 A;  2MZI A;  4XM6 A;  3VTG A;  1I1I P;  3EHX A;  3HY9 A;  4XM8 A;  1BUD A;  2ERQ A;  4L6T A;  1SLN A;  2JNP A;  3ELM A;  1BSW A;  2CLT A;  1GO7 P;  1S4B P;  3KEK A;  4J4M A;  1GKD A;  3KWV C;  1CAQ A;  1ZXV A;  1G9K A;  2OVZ A;  2FV5 A;  4ILW D;  2AYK A;  2FV9 A;  5CXA A;  4PKW A;  3NX7 A;  5LAB A;  1AKL A;  1UTT A;  456C A;  1ATL A;  4GUY A;  1XUR A;  1PWP A;  3SHI A;  1BKC E;  2WO9 A;  1HV5 A;  1HFS A;  2A8H A;  5B5P A;  4WK7 A;  3LUN A;  3BA0 A;  2W14 A;  2POJ A;  2XS4 A;  1BKC A;  1JIZ A;  1PWQ A;  1CIZ A;  1BM6 A;  2D1O A;  1RMZ A;  2OY4 A;  3AYK A;  3DSL A;  1EB6 A;  3F19 A;  1CGE A;  3HBV P;  1D8M A;  2PJT A;  4H30 A;  1JAQ A;  3DL1 A;  1K7Q A;  1JKY A;  3K7L A;  3KEJ A;  3F17 A;  3LKA A;  4FVL A;  4AIG A;  1USN A;  1A85 A;  1ZS0 A;  4DD8 A;  4PKQ A;  2USN A;  2OXW A;  1KBC A;  5D3C A;  1PWV A;  1YQY A;  4FXY P;  4PKR A;  1OM7 A;  1BQQ M;  5D7W A;  1GKC A;  1HFC A;  1TVI A;  1QIC A;  1HTD A;  2X3A A;  5I0L A;  2RJP A;  4L7A A;  1GE5 A;  2ERO A;  4IUW A;  2OW2 A;  2W12 A;  2ERP A;  3LQ0 A;  1R1H A;  1O0T A;  4PKS A;  2HU6 A;  1MMR A;  4JQG A;  4XBH A;  2RJQ A;  4AXQ A;  3K7N A;  1HOV A;  2OVX A;  1ZXC A;  2MZH A;  1RM8 A;  3HB2 P;  3I7I A;  4HMA A;  3Q2H A;  1XFW A;  3AIG A;  1KUK A;  3O64 A;  3ZUK A;  1CGF A;  3L0T A;  4H2E A;  3HYG A;  1AYK A;  1I73 A;  3DTK A;  1XFY A;  3P1V A;  1D8F A;  3DPF A;  3AYU A;  4AUO A;  3LE9 A;  4G9L A;  3N2U A;  5B5O A;  4DV8 A;  2OW0 A;  3O2X A;  5I43 A;  3LGP A;  3MA2 A;  1L6J A;  3LJG A;  1K7G A;  1XFX A;  1YCM A;  2W15 A;  5CUH A;  2X3B A;  1IAE A;  5I3M A;  5I12 A;  5D1U A;  3G5C A;  3WV3 A;  2D1N A;  3V96 B;  5L79 A;  5D2B A;  2DW1 A;  3LIR A;  4GQL A;  2Z2D A;  1ZVX A;  1CK7 A;  1BQO A;  1KUF A;  5L7F A;  4HX3 A;  3EDG A;  2JSD A;  2W13 A;  2X7M A;  3GBO A;  1SU3 A;  3TS4 A;  4A3W A;  2JIH A;  2L0R A;  4JA1 A;  5D1S A;  3HDA P;  1SAT A;  2CKI A;  1XFV A;  3F15 A;  1JAP A;  3E8R A;  1QIA A;  1XAX A;  1SRP A;  3ZVS A;  1JAO A;  1Y93 A;  1BZS A;  3EDI A;  2DW0 A;  5H8X A;  1DMT A;  4IJO A;  1YP1 A;  4H76 A;  4JPA A;  4A7B A;  2OZR A;  2E3X A;  5BOT A;  4PKU A;  1UMT A;  1R1J A;  3U1R A;  1MMB A;  1UMS A;  1GXD A;  1UEA A;  1OZ9 A;  3KHI A;  1UTZ A;  4H1Q A;  3F18 A;  3RTT A;  1BIW A;  1A86 A;  3LJZ A;  3UVC A;  1C7K A;  1GE6 A;  3EHY A;  2OW1 A;  4CTH A;  4I03 A;  3WV1 A;  3KEC A;  2K9C A;  1OS9 A;  4G0D A;  4GWM A;  4ON1 A;  2YIG A;  1G4K A;  2O3E A;  2Y6C A;  2YUF A;  1KUG A;  3ZXH A;  1JAN A;  3LJT A;  3OHO A;  1O0Q A;  2OXU A;  5I4O A;  1SMP A;  1IAA A;  1OM8 A;  2JT6 A;  4FU4 A;  1ND1 A;  966C A;  3TSK A;  2WO8 A;  2J83 A;  5I2Z A;  1HY7 A;  1XM5 A;  5JMY A;  2O36 A;  1FM1 A;  1WNI A;  4L63 A;  4DPE A;  3DTI A;  3WV2 A;  1Y8J A;  1CQR A;  4GF1 A;  5BOY A;  4H84 A;  3LMC A;  3TVC A;  1IAD A;  1J7N A;  2N8R A;  2X3C A;  3EDH A;  4H82 A;  1PWU A;  3DTE A;  3KME A;  1EAK A;  1H71 P;  1KAP P;  3Q2G A;  3N2V A;  1EUB A;  1XFZ A;  1KUI A;  3OHL A;  3F16 A;  1R55 A;  1BKC I;  2Y6D A;  2XS3 A;  2OW9 A; 
#chains in the Genus database with same CATH homology
 3LEA A;  1C3I A;  3EWJ A;  1JIW P;  2MLS A;  2SRT A;  4PKT A;  1OO9 A;  3DNG A;  1MMP A;  2DW2 A;  4GWN A;  1B3D A;  3RTS A;  1OMJ A;  4XCT A;  4H3X A;  1CGL A;  3HDB A;  3B92 A;  3DPE A;  1KUH A;  1PWW A;  3HY7 A;  1XFU A;  2DDF A;  2YB9 A;  1QIB A;  1QJJ A;  4EFS A;  1GE7 A;  1AF0 A;  4DF9 A;  4WKE A;  3LIK A;  2KRJ A;  5CZM A;  4QKZ A;  1I76 A;  1IAC A;  2MZE A;  5D1T A;  4AYK A;  2TCL A;  1K7I A;  4WF6 A;  830C A;  1QUA A;  4Q1L A;  1Z3J A;  1AST A;  2J0T A;  3LIL A;  1ZP5 A;  2DDY A;  1FLS A;  1JH1 A;  1D5J A;  2K2G A;  3LK8 A;  1QJI A;  1MNC A;  3F1A A;  1G05 A;  1R54 A;  1MMQ A;  1Q3A A;  2AIG P;  3KMC A;  4XM7 A;  2E2D A;  4FXQ A;  1G12 A;  1B8Y A;  1C8T A;  4ZR5 A;  2I47 A;  3VI1 A;  1JJ9 A;  1DTH A;  4R3V A;  4WZV A;  4H49 A;  3USN A;  3B8Z A;  1ZTQ A;  1YOU A;  3L0V A;  3CKI A;  4PKV A;  1OS2 A;  2OI0 A;  3DWB A;  3LQB A;  4GR0 A;  1D7X A;  1FBL A;  1IAG A;  1OM6 A;  2QPJ A;  1XUD A;  2OY2 A;  3P24 A;  3G42 A;  1CXV A;  1SLM A;  4JP4 A;  1G49 A;  3EDZ A;  4GR3 A;  2OXZ A;  3HBU P;  1BUV M;  3KRY A;  1XUC A;  4I35 A;  1JK3 A;  2V4B A;  1IAB A;  1Y0V A;  4GR8 A;  2W0D A;  2MLR A;  4JIJ A;  4WKI A;  1GO8 P;  4IN9 A;  1ROS A;  1R1I A;  2WOA A;  3B2Z A;  5BPA A;  4L19 A;  3I7G A;  3LUM A;  2JT5 A;  3TT4 A;  2MZI A;  4XM6 A;  3VTG A;  1I1I P;  3EHX A;  3HY9 A;  4XM8 A;  1BUD A;  2ERQ A;  4L6T A;  1SLN A;  2JNP A;  3ELM A;  1BSW A;  2CLT A;  1GO7 P;  1S4B P;  3KEK A;  4J4M A;  1GKD A;  3KWV C;  1CAQ A;  1ZXV A;  1G9K A;  2OVZ A;  2FV5 A;  4ILW D;  2AYK A;  2FV9 A;  5CXA A;  4PKW A;  3NX7 A;  5LAB A;  1AKL A;  1UTT A;  456C A;  1ATL A;  4GUY A;  1XUR A;  1PWP A;  3SHI A;  1BKC E;  2WO9 A;  1HV5 A;  1HFS A;  2A8H A;  5B5P A;  4WK7 A;  3LUN A;  3BA0 A;  2W14 A;  2POJ A;  2XS4 A;  1BKC A;  1JIZ A;  1PWQ A;  1CIZ A;  1BM6 A;  2D1O A;  1RMZ A;  2OY4 A;  3AYK A;  3DSL A;  1EB6 A;  3F19 A;  1CGE A;  3HBV P;  1D8M A;  2PJT A;  4H30 A;  1JAQ A;  3DL1 A;  1K7Q A;  1JKY A;  3K7L A;  3KEJ A;  3F17 A;  3LKA A;  4FVL A;  4AIG A;  1USN A;  1A85 A;  1ZS0 A;  4DD8 A;  4PKQ A;  2USN A;  2OXW A;  1KBC A;  5D3C A;  1PWV A;  1YQY A;  4FXY P;  4PKR A;  1OM7 A;  1BQQ M;  5D7W A;  1GKC A;  1HFC A;  1QIC A;  1HTD A;  2X3A A;  5I0L A;  2RJP A;  4L7A A;  1GE5 A;  2ERO A;  4IUW A;  2OW2 A;  2W12 A;  2ERP A;  3LQ0 A;  1R1H A;  1O0T A;  4PKS A;  2HU6 A;  1MMR A;  4JQG A;  4XBH A;  2RJQ A;  4AXQ A;  3K7N A;  1HOV A;  2OVX A;  1ZXC A;  2MZH A;  1RM8 A;  3HB2 P;  3I7I A;  4HMA A;  3Q2H A;  1XFW A;  3AIG A;  1KUK A;  3O64 A;  3ZUK A;  1CGF A;  3L0T A;  4H2E A;  3HYG A;  1AYK A;  1I73 A;  3DTK A;  1XFY A;  3P1V A;  1D8F A;  3DPF A;  3AYU A;  4AUO A;  3LE9 A;  4G9L A;  3N2U A;  5B5O A;  4DV8 A;  2OW0 A;  3O2X A;  5I43 A;  3LGP A;  3MA2 A;  1L6J A;  3LJG A;  1K7G A;  1XFX A;  1YCM A;  2W15 A;  5CUH A;  2X3B A;  1IAE A;  5I3M A;  5I12 A;  5D1U A;  3G5C A;  3WV3 A;  2D1N A;  3V96 B;  5L79 A;  5D2B A;  2DW1 A;  3LIR A;  4GQL A;  2Z2D A;  1ZVX A;  1CK7 A;  1BQO A;  1KUF A;  5L7F A;  4HX3 A;  3EDG A;  2JSD A;  2W13 A;  2X7M A;  3GBO A;  1SU3 A;  3TS4 A;  4A3W A;  2JIH A;  2L0R A;  4JA1 A;  5D1S A;  3HDA P;  1SAT A;  2CKI A;  1XFV A;  3F15 A;  1JAP A;  3E8R A;  1QIA A;  1SRP A;  3ZVS A;  1JAO A;  1Y93 A;  1BZS A;  3EDI A;  2DW0 A;  5H8X A;  1DMT A;  4IJO A;  1YP1 A;  4H76 A;  4JPA A;  4A7B A;  2OZR A;  2E3X A;  5BOT A;  4PKU A;  1UMT A;  1R1J A;  3U1R A;  1MMB A;  1UMS A;  1GXD A;  1UEA A;  1UTZ A;  3KHI A;  4H1Q A;  3F18 A;  3RTT A;  1BIW A;  1A86 A;  3LJZ A;  3UVC A;  1C7K A;  1GE6 A;  3EHY A;  2OW1 A;  4CTH A;  4I03 A;  3WV1 A;  3KEC A;  2K9C A;  1OS9 A;  4G0D A;  4GWM A;  4ON1 A;  2YIG A;  1G4K A;  2O3E A;  2Y6C A;  2YUF A;  1KUG A;  3ZXH A;  1JAN A;  3LJT A;  3OHO A;  1O0Q A;  2OXU A;  5I4O A;  1SMP A;  1IAA A;  1OM8 A;  2JT6 A;  4FU4 A;  1ND1 A;  966C A;  3TSK A;  2WO8 A;  2J83 A;  5I2Z A;  1HY7 A;  5JMY A;  2O36 A;  1FM1 A;  1WNI A;  4L63 A;  4DPE A;  3DTI A;  3WV2 A;  1Y8J A;  1CQR A;  4GF1 A;  5BOY A;  4H84 A;  3LMC A;  3TVC A;  1IAD A;  1J7N A;  2N8R A;  2X3C A;  3EDH A;  4H82 A;  1PWU A;  3DTE A;  3KME A;  1EAK A;  1H71 P;  1KAP P;  3Q2G A;  3N2V A;  1EUB A;  1XFZ A;  1KUI A;  3OHL A;  3F16 A;  1R55 A;  1BKC I;  2Y6D A;  2XS3 A;  2OW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...