3TSPA

Crystal structure of e. coli hypf
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 212
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tspA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tspA01
3VTHA 3TTCA 3VESA 3VERA 3VEWA 3TTDA 3VTIA 3VEOA 3TSPA 3TSUA 3TSQA 3VENA 3VEZA 3VF2A 3VF4A 3TTFA 3VEXA 3VETA
chains in the Genus database with same CATH superfamily
2PAVA 3U8XA 1ZBFA 1Z25A 3AAPA 3OS0A 2IFEA 2FSNA 4CEFA 4NO7A 5HBMA 2ETJA 3CXCM 1JL1A 3VQ9A 2HHUA 1JCGA 4N41A 1HQUA 1YJ9N 3ZSQA 4Z9EA 1LWFA 1NKEA 4B3SK 3VEWA 4H0VB 4A59A 1XHXA 1SV5A 4IXCA 4BG8A 4X62K 2R7YA 2V7ZA 3CCVN 2HBJA 2QA4N 4DWIA 2OPSA 3I0SA 4FJLA 4B1XB 5C25A 3NFAA 4E3SA 4OKEA 4Y1DA 4CD3A 1JCFA 1Y2IA 2IAJA 3K2PA 4AHTA 3OYIA 3SAFA 3THXB 1E3MA 1SQKA 4CEBA 4GKJK 2D0BA 3K57A 4JI2K 4BRHA 3CC2N 1LAWA 1NGIA 4KKOA 3HZ6A 3LZIA 1UA0A 4B9SA 2OPRA 3VQ6A 2Z1HA 4BC2A 1SAZA 4NCBA 1EO1A 3DOLA 4FVUA 3F9MA 3MEGA 3NH1A 4FZZA 4JV5K 3OBWA 4DMNA 4C8OA 4CEQA 2YNFA 3AO1A 1TKZA 4LD0A 4IEEA 5CZ2A 4C8KA 1G58A 5AQYA 3O4QA 5JS2A 4RW7A 4IBNA 2WONA 4ILHA 1NWKA 2Q0UA 3OYNA 4GNIA 4JKGA 4K41A 2G8WA 4TWAA 4B9TA 2D1KA 4DR4K 1BUPA 1WSJA 3M8RA 4FZYA 4MFBA 1OH6A 3LS6A 4FLXA 1LW0A 5AQQA 1ZYQA 1GOCA 3RR8A 1WSGA 2NNWA 3SQ0A 3KK1A 1C1AA 5AQHA 4PUOA 1TK0A 4DLEA 4NXMK 2O8DB 1KCFA 1RTDA 4PA1A 1BO5O 2HBKA 3I0RA 5HLFA 2QWRA 3HVTA 1KVBA 3AAQA 2E2OA 4DLGA 4FJNA 3MN7A 4N56A 4B9QA 5F0XA 4F3TA 3GG4A 2Q36A 4YDUA 4CK3A 3SYZA 4A62A 4ISFA 1BU6O 1XC9A 1S8EA 1FW6A 4LFAK 2NRRA 4E7LA 3QEXA 3ID6A 3ITHA 3QNOA 3A5LC 3A8YA 4WQ5C 1JLBA 3ZT4A 4CW7B 4CEDA 1GLJO 3SCXA 1WAFA 3TU5A 1TL3A 2UU9K 4FO0A 3VQ5A 4CGFA 1NK7A 3JXUA 4J2EA 4OPAA 2G8FA 2P9UA 4NZRM 4FJ7A 3BF3A 3H3NO 5C24A 2UXBK 1XNRK 3FZKA 3JAMO 3AVNA 1RT2A 4YDQA 1EP4A 4OKJA 1TVRA 2E2PA 1S1UA 3C6AA 5GADP 4BC5A 2ZE2A 4B1WB 3GBTA 1C1CA 1EWQA 3VF6A 3VQEA 4M3XA 4JKDA 4CJWA 4P6PA 3AVIA 1N34K 5GINA 2BKYX 4IFYA 4H8KA 1NJ2A 3VESA 3EKSA 2D5RA 1S1VA 4BWJA 1E4GT 1JLQA 1KRPA 2P9LA 2ASMA 4CJPA 3S3OA 1NG9A 1RT5A 4V19S 3QB0A 1IBMK 2HW3A 4LFBK 2ASPA 2E1YA 3AO3A 4B9LA 1GLDG 5FPDA 3AVAA 1XQSC 4H4OA 5TKYA 1HNVA 3HPHA 1T03A 2KW4A 4RW8A 2JGUA 3A5OC 1IKXA 4DHYA 5GAGP 1RDCA 1NBWA 4FPAA 4MO5A 4BWMA 2P5OA 2NRXA 1DEJA 1RT7A 4KH6A 2IVNA 5J2PA 4NYNA 4DU4A 1S22A 3AO2A 3TAPA 1HPZA 1II7A 5I3UA 1NGAA 1EX4A 1SL0A 3MWTA 3LM2A 3S3NA 3SBTA 2ITGA 4FYDA 3EZ5A 1WNSA 3ZIEA 4CZGA 4YORA 3TTDA 1BWFO 3HOTA 3LDQA 4H0XB 4B1VA 4YOYA 3IAYA 4P6CA 1CZBA 3F73A 1VQ4N 3ZETA 3HM8A 3KJVA 3K9JA 3EO3A 3H08A 1NOZA 5J1EA 3LVKB 3LPUA 4GVMA 2CRQA 4M3RA 3CC7N 3M3ZA 4OLBA 4JHDB 4O5BA 2YCHA 4WF9L 1U48A 1ASUA 3ASMA 4BRPA 4FCYA 1R59O 4Y0WA 4KI6A 1BIZA 4FW1A 3OYGA 3KK2A 3B6PA 4CZKA 2FBYA 2KZMA 4JI1K 5AZIB 4DTOA 4M42A 2YNHA 4FLYA 2GTCA 4KHYA 1F21A 4AHCA 1P8ZA 4M7XA 2O8BB 2YX6A 2CGLA 3NF9A 3MWPA 1VAZA 1U2VA 4H0YB 2KZZA 3O80A 2G8VA 1J53A 3TAEA 5MLCQ 3MN9A 4H0TB 2Y1IA 1QZ6A 1B9FA 2IVOA 2WFBA 4WQ5A 3VQ4A 1KSPA 4AH9A 1K7JA 1QS4A 4DF8A 4L3QA 3H07A 3P4IA 1RBTA 4BRMA 3CC4N 1BI4A 4CESA 4IDHA 1TKDA 3MCPA 4IWVA 2F7TA 2HF4A 3R8EA 4CFDA 1WSEA 4WCEL 1WSHA 4CGDA 5LMUK 4O0IA 3AVBA 4LF6K 5CHIA 1QQOA 1X3MA 5C2DA 1N32K 4H5TA 4IDKA 3CCUN 1U49A 1WAJA 4CECA 2ASOA 3O9TA 4F2SA 2DPNA 3OYAA 5KRTA 1JLCA 2W6KA 5AQOA 4E7IA 1HR0K 2BE2A 5HOOA 3O3FA 3RRGA 4HVCA 1QVFM 3WXJA 3K5LA 5ADXA 4O44A 4FJ8A 4H5RA 4M45A 1J5EK 2F9WA 1YF5L 4Z4FA 3J7ZO 1SL2A 3UB5A 2VCPA 2GBZA 1JCUA 1ASWA 2KKZA 2BUPA 2GELA 5AQLA 1O13A 1X1PA 1HKCA 2P9PB 1LW2A 2YHWA 1KC8O 2QWLA 1D9DA 4IO8A 4U7BA 3AVLA 1IV0A 1MWMA 3IKMA 2NRWA 4E1NA 1IBKK 1NKCA 2KFNA 4BG9A 4FL9A 3DXKB 5AQPA 1S5JA 4FVMA 4IG3A 5JVHL 2O8EA 3VGMA 2IIRA 2ZJRL 4BRKA 3CCLN 4QS9A 3P83D 1NJZA 3CCJN 2BANA 4CJ7A 1KK9A 3M8SA 1C0MA 4FM2A 1WN7A 3ZSXA 3ZCMA 2ZGZA 1NJWA 3QKBA 1X9MA 4JI5K 1KTQA 4H5NA 3LDSA 3T1IA 2UXDK 1XC3A 3THWA 3O1BA 3DI6A 3G10A 1V4SA 4N76A 4LF7K 1W2BM 3CQ8A 4BDPA 3DRRA 3MMVA 1S6PA 5EY4A 4EIAA 3LP0A 4HUFA 4CK2A 4BVOA 4DV2K 4OLAA 4CIGA 3HSCA 3KD1E 4JKAA 2I7PA 2D0PA 2L8YA 1IBLK 4CJQA 3CD6N 4JI6K 1ZBUA 3T69A 3ZIGA 4OPKA 1LN4A 3DSDA 4FSVA 4CERA 2RIUA 1DTQA 1PAVA 2AJQA 2FXUA 3CG7A 5D3GA 3D2FB 4DFPA 1YJWN 3A5NC 4P8EA 2KQ2A 4WE1A 5AQWA 4O0JA 3VTHA 5CY4A 1K8KA 4EP4A 1M1KO 2A1RA 1VRUA 4JYAK 1NM1A 5GIPA 3RMCA 3T1HK 1NKBA 3T7ZA 4CBUA 3NH2A 3C95A 3UKUB 2F4VK 4CF1A 4IFEA 1J54A 1L3SA 3SV3A 3WNFA 1K8AO 3TSUA 1VSLA 2NRHA 1NNEA 5M1QA 4W5RA 1NK5A 1K4OA 3AO5A 4CHQA 4DTRA 1B92A 4J2AA 1S6QA 4Z4HA 2QKBA 3CPWM 4ELTA 4XEIA 5M1NA 4EHTA 3RSEA 1WBDA 3LP1A 1TYQB 3VQDA 4OPHA 3ZIIA 1GOBA 3KWIA 1UOCA 3O8MA 4W5OA 3PSIA 3CFOA 2YI1A 3L8BA 3V9WA 3CJ9A 3KIOA 3KKRA 4OX9K 4YOWA 1VHXA 5KQDA 4X64K 3OYFA 4HCCA 3T1AA 1D5AA 4CZFA 5E26A 2PYJA 3QNNA 1YVUA 5DM6L 3MAQA 2HNYA 3HI0A 4HWIA 1RDAA 4KHUA 4DUZK 3CM5A 4MDAA 5BN9A 2QWNA 2P9SA 1H0XA 2XRIA 2HVIA 4CZEA 2OA8A 3MGZA 3IALA 1H4QA 4CIEA 3U4LA 2DFHA 4Z4IA 4DQPA 4GY2B 4ID1A 4NCGA 4BRLA 2W6LA 4DR3K 2A41A 2ZM6K 1YTAA 3U3YA 1BL3A 1YTUA 1KVAA 5H1SQ 4GMJB 4RW9A 1T3VA 4CF8A 3PV8A 1OH8A 1T6CA 4JLHA 4YFUA 3UKRA 4IOCL 3Q7BA 5KGWA 1OH7A 3UE5A 3SK3A 3CMEN 1NGHA 5I42A 3CJ1A 4JAXA 2Q1NA 4Q15A 3H46O 4P6DA 4DSIA 1BISA 4CD1A 1VSHA 1MA9B 4IO9L 4TSXA 2CH6A 3SQ4A 2IGIA 3K0SA 1S9GA 4E0DA 1HQEA 2ITMA 2RHKA 5F1XA 3E1YA 4M41A 4O8UA 4BRNA 3K9KA 1W9HA 4QS7A 2OPPA 4JK7A 4C8NA 1IG9A 1LWEA 3RR7A 4FFJA 4M3ZA 3QLHA 3VGLA 5FLXO 4X65K 3WNHA 1HYVA 4LSLA 4JKGB 4DR5K 3QEVA 4DSJA 4FWOA 3C6HA 1W0HA 1FKOA 4BRIA 4KB1A 3HXMA 1IKWA 3ENBA 2I7NA 3C0BA 5CYMA 4CHYA 1ILYA 2PBDA 1BA0A 2P9NA 2PY5A 4B1UB 3HP9A 2QK9A 1L5UA 2XO7A 4R5PA 1VQ8N 3IFRA 3SUQA 2FLOA 4CF9A 3MN5A 3FFKB 1H4TA 1VQON 2BH1A 5EOYA 4BGAA 2B4JA 3U6FA 1DCJA 3ULDA 4FJXA 1RBVA 3FZHA 5C42A 4E19A 3KLEA 3QEWA 3L7VA 4UY8O 4PWDA 3ULEA 1RT1A 1QTMA 4BR4A 4B3TK 3LL3A 3CQXA 2KHOA 2P9KA 3E9OA 1NK0A 1RDDA 2YV0X 1VQKN 3JSMA 2OTJN 4FBQA 3L2VA 4ELVA 1GLAG 3OYJA 1G99A 3CJ7A 1K4PA 1HPMA 4BRCA 4F4KA 4I9LA 4BR5A 3IDHA 4G9ZA 4N47A 2QTDA 1REVA 3O5BA 5EX5A 3O9RA 2GWJA 3P5JA 2VQFK 3ALYA 4KPYA 1TAUA 4CVNE 4AF1A 4YNQA 4DV7K 3LDLA 5C10A 3LVJC 3P1GA 3M5RA 2OTLN 4FWMA 2LSNA 2Q97A 2XY8A 3R1XA 3HPOA 3SBGA 4FLVA 2P9UB 3DSCA 4FOIA 3QERA 1LAVA 2ATQA 1QZ5A 1HMVA 2LN3A 4BE2A 2OYQA 4CZHA 4KHSA 1NK8A 4DV0K 3HBTA 4E7JA 5AFUA 2HF3A 5HRSA 5KPRA 2GTDA 2YHAA 4LY7A 4FWPA 4C1NK 2NRZA 3MXJA 1VSJA 2HHQA 1SKSA 4AM6A 1CXUA 2HOEA 3MK6A 4JKEA 3AVGA 3CF5L 3LDPA 2VWBA 3KD5E 5AR0A 2FBVA 3AGKA 4K88A 5AQJA 2P9LB 1JXBA 3LALA 4A5BA 1Z05A 4ICLA 1CZ9A 5CR4A 1LWCA 2E2QA 4GV6A 3PY8A 1IKYA 1NU0A 3G6EN 4C8LA 1GLCG 4ID5A 4XH5A 3ZX3A 4B9UA 4FWLA 4M3TA 3LDNA 1C0FA 4I6MA 3L4QA 4DV4K 5KPZA 3ZEUB 2JWKA 5AJ3K 4CHPA 1TV6A 4DQSA 4I14A 4BE1A 3N4PA 5HRNA 3AO4A 4FK4A 5HROA 4FLWA 3J80O 1X3NA 3ZT1A 2IDOA 3U3GA 4CJKA 1EETA 3ZYYX 3NF7A 4BACA 1RTIA 3NHGA 4IJAA 2W42A 2VWJA 2Q0RA 2QWPA 4LH5A 1SZ2A 4BGBA 2VG7A 1SKWA 1YUWA 1HYSA 3D2EB 1DT9A 4ISEA 2O8DA 1VSDA 3ZSWA 3CI5A 2Y1JA 1L3TA 1QHAA 3ZETB 5BPLA 4OKKA 3BGRA 4DTNA 4FK2A 2JWLA 3V1QA 4Q0BA 2F8TA 3V6DA 2EH1A 2QXFA 1ATNA 1JL2A 3DWLA 1VSMA 1CLQA 4DTUA 3ATVA 4PKHA 5EXWA 3VEYA 3SMSA 4WFBL 3I8DA 3LQUA 2FBTA 3IABA 3EE8A 3HM9A 1GLEG 3HP6A 4JKCA 2HHVA 4P77A 2X78A 4H0PA 2G8IA 4U67L 4I9QA 1TGOA 1U2VB 4BE0A 3ATUA 2CGJA 1TK5A 4AHVA 3GDQA 2HMIA 4DQ8A 4B9VA 4J2BA 4YKEA 4DSLA 1K4LA 3FLCO 4BREA 1VQ9N 5AZJB 4LF9K 3FE1A 3KLIA 3SV4A 3AA5X 4BR9A 2QW9A 3O6WA 4K43A 1UWBA 1S1XA 4CEOA 4DR6K 4DFMA 1NGDA 4A2AA 3OW2M 1UA1A 5LL6Z 1A5XA 4DR7K 3TAMA 3PX4A 3QICA 3OY9A 1HJRA 1KAXA 4IFVA 4O55A 2YKNA 1GLFO 4AILC 3EE9A 4B1YB 4GVEA 4M3WA 3O9SA 4XH4A 3MK5A 2E4LA 4IG0A 3VEXA 2E20A 1KQSM 3M8QA 3L2RA 5K14A 1JKHA 3OYKA 1Q9XA 2A40A 4NLCA 4ZTFA 2V7YA 4HVJA 3QEIA 3JS6A 1XEZA 4KI4A 2P9BA 3BEXA 4H03B 3DMJA 1ZBIA 1Z26A 4ELUA 3ZSRA 4Z0UA 3K5OA 2KFZA 3THVA 3O4NA 2E2NA 3WXIA 4BROA 4YY3K 3VF2A 3VQQA 1VQNN 3LPTA 2HHWA 2O8FA 3CCMN 3G25A 4CZJA 1TKTA 1EKEA 1NFJA 3CCSN 3K5MA 2GV9A 1NGGA 3NCIA 2P51A 5FPMA 1HUXA 1HRHA 3E66A 4QAGA 1U45A 1NGBA 1YHQN 4JS4A 2O8EB 4I2QA 5AQKA 1NGCA 3J7YP 1WLJA 2HMPA 1T05A 3CFRA 5ELZA 3A0IX 3V81A 2Z1JA 4BDZA 1NLVA 4O4GA 3L2QA 4FLTA 4JRPA 5AQUA 5C12A 1TIGA 3PLAA 1QSSA 3TI0A 3ZSYA 3UIQA 1W7AA 3SI6A 1D8YA 2UYTA 1HKBA 2ZWHA 4DKWA 2QWMA 1QQCA 4JHDA 3SMPA 1R0AA 3VEVA 1WOQA 5AQNA 5BREA 2HNDA 3LAMA 4L8RB 1BQNA 5JLFA 4OO1J 5KGXA 1FJGK 5AQXA 4WYBA 1OVQA 2GEMA 1Q18A 3NDKA 5AZIA 3QO9A 1NOYA 4CJSA 3V9XA 3OYCA 3BDPA 3OYHA 5KTQA 4YHHK 1QE1A 3GE1A 5HP1A 3OYDA 3QDKA 1N6QA 1WBBA 4AHRA 2HBLA 2V51B 4LF5K 2H3GX 2YNIA 3CJCA 3O3HA 3RVCA 4LF4K 2O4IA 1Q86O 3KHYA 1H0YA 4Z4CA 3I33A 2P9IA 3CQYA 3ENOA 1HYZA 3I56N 3NGYA 1NJXA 3DLBA 1D4XA 3MXMA 1Q7YO 4K8ZA 4AHSA 2Z1GA 1QSLA 4LC9B 5AQZA 4K42A 2PZSA 1QSYA 4FJKA 2J4RA 3OVNA 4CJRA 2HSTA 4DSFA 4DG1A 3K58A 4DTXA 5KRSA 3ZX0A 3O3GA 1S72N 3G71N 1XI1A 4YOVA 3F5TA 3RSEB 3WT0A 4F3OA 4NLBA 3THYA 1VSIA 2NRTA 3K59A 2KLAA 3SUNA 5CYQA 5FRNA 5LJVA 4E1MA 2E6LA 3W0LA 1IO2A 5LY3A 1IJJA 3PX0A 4JKBA 1KD1O 1NFHA 1FXXA 3EKUA 4FWKA 3SAGA 3L6QA 3KZBA 3G4SN 4E89A 1N36K 4C23A 4K87A 1BCOA 3C7NB 3VTIA 1K4IA 4CFAA 2UUBK 2KTQA 3M6GA 5TKWA 4QOZB 3VQAA 3J81O 4DTJA 1C0UA 2M71A 1MU2A 4BQLA 4JI8K 1YVNA 3DM2A 4A5AA 5T7BA 1NMNA 4RTFD 4DV6K 4EO0A 2O8CA 4DS5A 3C94A 3PX6A 4FWRA 2F96A 1SS6A 3MXIA 3DLGA 3ZLJA 3MEEA 1HNWK 4GKKK 3TOEA 1RT3A 2Q3VA 3SZ2A 1VSFA 3HT3A 1HJOA 3HL8A 3E9PA 1LCUA 1VQMN 5J2NA 3LP2A 3AY9A 4CZMA 1DKGD 3OTOK 3DLRA 4JNEA 1NJIO 3SPZA 1Q8IA 5C15A 4K0KK 3VGKA 4LF8K 3NVMA 4NXNK 2VWKA 5FROA 3LM9A 4DV5K 2ZF5O 3ZSVA 3UKRB 3DJCA 3TSPA 1HLUA 5LJWA 5M1KA 3DXMA 1L3UA 2UUCK 3SUPA 5FPNA 1S1TA 3HYFA 2NLXA 3ZT2A 1TUYA 2O4GA 3PUFA 4CFBA 4PL8A 2F9TA 1RTJA 1HC7A 1LOTB 3EL2A 4NCAA 3IMXA 4E7KA 4FBWA 3IUCA 1VQ6N 3I55N 4IZ9A 2HHTA 3L4IA 1KFDA 3FZMA 3CJAA 3MEDA 4CGGA 3U6YA 1SKRA 1JLEA 4O5FA 2YHYA 1SUQA 4OGCA 3CETA 3FGUA 2VYPA 3RRHA 2FF3B 1J6ZA 4MO4A 1NJ1A 5M1PA 3HRGA 4CEZA 4JS5A 1OKJA 3DLLL 2ZD1A 4HCBA 4JN4A 2VGMA 4GV3A 3UKUA 4OPJA 1QQMA 4I2PA 4CBWA 1VQ5N 4YOXA 3EYZA 4UQGA 2WC9A 4IJNA 1HKGA 4HD0A 1ZBSA 3ZT3A 3OYEA 4DQRA 3AVHA 5AQFA 3AA2A 3RMDA 1H1VA 4FW2A 1ASVA 4FJJA 3BZCA 4M7YA 2NRVA 2HHXA 1DTTA 4FM1A 2HNZA 1WUAA 2QWOA 2YJFA 3ULEB 4CJUA 4CZIA 1N33K 4C8MA 5IT9O 2Z1IA 3BP8A 5B8HA 4KAZA 2E6MA 4H4MA 2P9KB 4CCHA 4IEIA 2AA4A 4CIFA 3AVKA 4BRQA 3U9ZA 3IG1A 4BR0A 1YI2N 3NF8A 4HTUA 1U6ZA 2PYLA 3PIPL 5GIOA 2EWSA 3AVJA 1EQYA 2LXRA 2E8AA 1QQNA 4DTSA 3VA0A 4DQQA 3VENA 1SNNA 2ZQBA 3OYLA 1W97L 4KREA 3K5NA 4HTLA 4LFCK 3NAEA 4YOUA 1IH7A 5BN8A 4FJ5A 4CJLA 4LH4A 3CIPA 3WEEA 5AQIA 3L2UA 4K8XA 3HPGA 4JI4K 3H1VX 1QHTA 1S3XA 4ILJA 5LMNK 1RDWX 1NJ6A 3L3VA 4XH1A 2CGKA 4KHPK 2X74A 5EVZA 5FRMA 2WOMA 3OBYA 4JD2A 3VF4A 4CF2A 3TANA 3FZFA 1C0GA 2W40A 3WNGA 3NMUA 1J5OA 4DB3A 1RBUA 4OLFA 3VETA 1K9MO 3NVKA 3KK3A 3OHRA 1FK9A 2RKIA 4OVLA 3WBMA 1NGEA 4AHUA 5AQVA 3H6EA 3ZT0A 3AA4A 3AGRA 2H9UA 5C0YA 4CJFA 1BG3A 2RF2A 3VEOA 5FPEA 3C6TA 3ID8A 4DR2K 3HO1A 3B6OA 3J8AA 1KLMA 4YOTA 4AQYK 4HUEA 4MDBA 4KTQA 3MCAB 1BQMA 4I6MB 1S1WA 3QFUA 1QVGM 4FBKA 1Z6RA 3QBXA 1NMDA 3CHWA 1C6VA 4FJMA 4JI7K 2WUSA 5JVGL 4E7HA 3O4WA 1RBRA 4WI1A 2E1ZA 1EWRA 5ADXH 4K86A 4A61A 4FJGA 1T6DA 2RE2A 2CH5A 4Z4GA 1HRUA 2FSJA 3P31A 1RDBA 4J8FA 1RT6A 3WXMB 1IG8A 2WBNA 1JO0A 4KB0A 4XIUA 4JRQA 4FJ9A 4CJEA 4PY5A 4BR7A 4BRFA 2D4WA 3VA3A 1UAXA 3ZSOA 2D0AA 2IS3A 4FWQA 3THXA 4JEPA 1YIJN 4FLUA 3D6RA 4EP5A 2A5XA 1ATSA 3HJFA 2ZJPL 3S3MA 1XHZA 4DU3A 2BDPA 3MN6A 3S41A 5BR9A 4CFCA 4CJ5A 4DTPA 3QINA 2GUIA 1Y9XA 1JLFA 1TKUA 5M1FA 4Y1CA 2FSKA 1DGKN 3SNNA 3LP3A 3SPYA 3CMAN 3OYMA 4M3YA 2A42A 3AVFA 2DFFA 3V9UA 1RCHA 1BA1A 3IABB 4RCHA 3SAHA 1T7PA 3AVMA 1C1BA 1PVWA 3WUHA 1TK8A 1YJNN 3U9DA 1Q81O 2P5GA 4Z4EA 1JLGA 1S9EA 4EAHD 3L2WA 5HRRA 2HBMA 1T8EA 4HUGA 1X9JA 4DV3K 2UUAK 2YNGA 3LAKA 4DTMA 2Z7CA 4CI6A 2UXCK 1ZBLA 1JE3A 3VQ8A 5E84A 2XY6A 4JK9A 3A5MC 4WFNL 2VG6A 4FZXC 1RILA 1D9FA 1Y97A 5SZTA 1XNQK 3T19A 1B9DA 4CBXA 4KV8A 2HHHK 1KFSA 5IWAK 3E9LA 4MQ3A 5HRPA 2OZMA 3PO5A 1HNIA 2IOCA 4Z94A 3G0ZA 4BC4A 2XY5A 5BRDA 1CZAN 4NZTM 3MECA 1WB9A 3FR0A 3S9HA 3PO4A 4CJTA 4FM0A 2FF6A 4B3MK 3SJHA 4W5NA 1BIUA 1I94K 5J2MA 1TUUA 3O08A 3FFIA 2VG5A 2A2YA 3NGZA 1KAZA 3C6UA 3H45C 4CE9A 1GLLO 1BOTO 2G8UA 1ESVA 4B9MA 4J2DA 2O8FB 4W5QA 4WQ4C 2P1JA 4DS4A 4R79A 3TAQA 3ZEUA 2DY4A 4CHNA 4DUYK 3TSQA 1BI4B 4EFHA 1HX1A 3DRPA 3CYMA 1NK6A 2BGGA 3GL1A 3RMAA 3TARA 2IC3A 4CJ3A 1YXQA 4CJVA 3KKSA 5F2RA 3ZSZA 2RISA 1KAYA 1WSFA 3LWMA 4NB4A 2W41A 3R9PA 1TKSA 4BRAA 5BR8K 1SL1A 3ISNC 3B8AX 2QI2A 3VMFB 3D2EA 4DFKA 1JCEA 1XWLA 4MLHA 3FZLA 4BRGA 3OJSA 4BY9C 1HNZK 1MWKA 3RTVA 3NBPA 3LDOA 3AVCA 4PKIA 2YJEA 2WTUA 5SWMA 3V9SA 3DYAA 2A1SA 5CE3A 3MX5A 4KO0A 4GV9A 3KTQA 1A5VA 3BY5A 3TAFA 1NK9A 3VN5A 4X66K 1JLAA 2FC0A 1E4FT 3PIOL 4JKFA 4HHTA 4ISGA 3KVGA 1BHLA 5JLHA 2FBXA 3N4QA 1JJ2M 3TAGA 4M3UA 3EN9A 3WQTA 5JS1A 5DM7L 1Y64A 2G8KA 3KK7A 1NGFA 1XUPO 3A2FA 3KWGA 3LRJA 4KFBA 3P04A 3OJUA 1M90O 4KRFA 3W3DA 1N8RO 3L3UA 1BDGA 1EXQA 5KQ8A 4B9NA 1IEZA 3NGIA 4JI0K 4FK0A 3TR8A 1JDQA 4DV1K 2ZJQL 2D0CA 3VQPA 4FPBA 5JICA 4P8JA 1T44A 3CCEN 3M8PA 4MLEA 3KLGA 1RTHA 1X9SA 4ZTJA 4OGEA 5AZJA 2RPIA 2P9IB 3WXLA 2NZTA 4IKFA 4KTZA 3BZKA 3HZ7A 4WFAL 2EQAA 1BGXT 2A6AA 3DLKA 2B6AA 3THWB 2Y1BA 3I8BA 1VRTA 3CCQN 1MDUB 3M1FA 4BC3A 4GW6A 1ZXOA 1GLBG 3VQBA 4Q5VA 3O1WA 2YHXA 4O8KA 3AV9A 1U47A 5EU7A 3SJJA 5E41A 4KBOA 3EY1A 5CZ1A 2QEXN 2RN2A 4DR1K 4FCXA 3QFPA 1VR4A 3MIOA 3IS9A 3THYB 5DMRA 5GAEP 3KLHA 2O8BA 5HL7L 5KPTA 1G15A 2QKKA 2V52B 3TPQA 4FWSA 3ZX2A 3D7EO 4QS8A 4LSNA 4DFJA 3OS1A 2MX1A 3LWLA 4PHTX 3MX2A 4PKGA 2D0OA 2Q2RA 3P39A 5BRFA 1O1WA 3QIPA 3DLEA 3F2KA 1K8KB 4EHUA 1LV5A 4CEEA 4BVPA 4JKHA 1VSKA 4CK1A 4CGJA 2QM1A 2YHBA 2EX3A 1NJYA 4WQ4A 5KI6A 4ZHRA 3HSTB 5BPMA 5DK5A 2G8HA 2ZGYA 4FOEA 2AP1A 2GX9A 2O8CB 1A5WA 1YITN 1NJ5A 3OS2A 3VEZA 4JI3K 1KLNA 3TTFA 3VPZA 3VQCA 2B5JA 2QWQA 1VK0A 2EK0A 3PSFA 1H4SA 1FKPA 3TABA 4KH5A 3SLCA 3SUOA 3GOIA 4BDYA 2BTFA 3VERA 1NH9A 4QCLA 2YKMA 4CF0A 3F9KA 3QIOA 3RWUA 1YAGA 3DXMB 1RQ8A 4H5VA 1XMQK 3WXKA 2A3ZA 3OYBA 3WNEA 3OA9A 4FWNA 3CFPA 1U4BA 2XY7A 1TL1A 5M1OA 5GAHP 2VQEK 1UDVA 4KTWA 4HVZA 2HB5A 4RWTA 2P9PA 4G1QA 3EEQA 4FJHA 5AFUH 4H5WA 1C0TA 1VQPN 3LZJA 1Q9YA 1V4TA 4EZ6A 3BUZB 4M63C 5JMVA 1ZC6A 3QBWA 5A2QO 2I5JA 3T3FA 5AQSA 4I7FA 1VQ7N 1CXQA 4F9OA 3DXKA 4PL7A 2Q31A 4IOXA 1HNXK 4DSKA 2P9SB 3P38A 1BCMA 3HTVA 3QESA 1RT4A 3R3LA 2DFEA 4W5TA 1KVCA 2IVPA 1U04A 5I9EB 4B8CA 1J9AA 1NJ8A 4C1NI 3E01A 4FXDA 4CJ4A 4A2BA 2HVHA 1NGJA 4FLZA 4PQUA 4E1JA 4DCHA 3TTCA 4H0OA 3V1RA 5J2QA 4B1ZA 3DAWA 4A57A 2X6SA 2X6NA 3AARA 5AQGA 3IRXA 4KH4A 3SQ2A 1RDUA 3LANA 4B3OA 4DQIA 3AJEA 1RBSA 4KHQA 3RMBA 3HOSA 3VQ7A 3BF1A 4BRDA 4DU1A 1Q82O 2JLEA 4B3RK 2OZSA 1RFQA 3Q7CA 1YT3A 3NH0A 4KHNA 3V9ZA 1L3VA 4IOAL 4NYFA 2GUPA 4DSEA 3D45A 2OCEA 3V4IA 3HK2A 2XHBA 1NK4A 3D0PA 4EZ9A 3CM6A 3CPEA 3AA3A 3CJBA 3QEPA 3D2FA 1K6YA 1XMOK 1KXPA 1IKVA 3DOKA 3CCRN 3C7NA 1OH5A 4CHOA 5AQRA 4AM7A 2Q3SA 2HHSA 1GOAA 1DLOA 4K25A 2QXLA 5AQMA 4KHWA 1X9WA 3HVRA 4RG8A 2P9NB 3TWHA 1PVYA 3ENHA 3EZWA 2GWKA 3WEEB 3L0QA 1N5YA 5BPNA 2VGNA 2OPQA 4F2RA 4F8RA 5FDLA 3CERA 4NCXA 1TKXA 3JYTA 1OVYA 5AQTA 1K49A 2OANA 1RNHA 1ATRA 5BRHA 4RW4A 4OJRA 4JD2B 4B08A 4CGIA 4YDUC 4JK8A 3QETA 2F8SA 1WSIA 3ZIHA 2E88A 3WQUA 1TYQA 1K73O 4BR2A 4N5SA 1ITGA 3DRSA 1G57A 3NF6A 1VQLN 1VSEA 4BQZA 3J7AP 4CHZA 3VOVA 3SQ1A 3O9UA 3O9QA 1ZBHA 2PFUA 4CEAA 3T1YK 1VM0A 4ILGB 4RW6A 3R6MA 1I3AA 3MDQA 2EHGA 4B8AB 3C65A 4FJIA 3DLHA 3V1OA 2DTUA 2E5LK 4CZLA 4CGHA 1I39A 3H1QA 3QMLA 1JXEA 1P90A 4DF4A 3KLFA 3H3OB 3NE6A 4E1BA 1RGIA 1TAQA 5C2FA 2NUBA
chains in the Genus database with same CATH topology
2PAVA 5AQWA 3VTHA 1K8KA 1M1KO 1NGBA 3U8XA 4CI6A 3AAPA 1YHQN 2FSNA 1NM1A 5GIPA 4NO7A 3CXCM 5AQKA 3T7ZA 1NGCA 4CBUA 2HMPA 1JCGA 5E84A 5ELZA 3A0IX 1YJ9N 3UKUB 4JK9A 4IFEA 3A5MC 4WFNL 3VEWA 4H0VB 1K8AO 1NLVA 3TSUA 4A59A 2NRHA 4IXCA 4BG8A 5AQUA 5C12A 2V7ZA 3CCVN 2HBJA 4CBXA 2QA4N 3PLAA 5M1QA 1K4OA 4B1XB 4CD3A 1JCFA 3SAFA 2UYTA 1HKBA 2ZWHA 3E9LA 4DKWA 3CPWM 4XEIA 1SQKA 4EHTA 5M1NA 2QWMA 4JHDA 3RSEA 3SMPA 3VEVA 1TYQB 1WOQA 4BRHA 3CC2N 5AQNA 1NGIA 4OPHA 5BREA 4Z94A 3HZ6A 4BC4A 5BRDA 3ZIIA 4BC2A 1CZAN 1SAZA 4NZTM 1EO1A 3KWIA 5JLFA 4FVUA 3O8MA 4OO1J 5AQXA 3F9MA 3FR0A 4WYBA 2YI1A 2GEMA 3CJ9A 3OBWA 1Q18A 2FF6A 4YOWA 5AZIA 5KQDA 3SJHA 4IEEA 4CZFA 1G58A 5E26A 5AQYA 1TUUA 5DM6L 3O08A 3GE1A 1KAZA 3H45C 3HI0A 1GLLO 1BOTO 4HWIA 4ILHA 1ESVA 1NWKA 2Q0UA 3QDKA 4GNIA 4JKGA 4K41A 2HBLA 4MDAA 4WQ4C 2V51B 5BN9A 2H3GX 3CJCA 4R79A 2D1KA 3RVCA 3ZEUA 1Q86O 2QWNA 1BUPA 3TSQA 2P9SA 3KHYA 3LS6A 4EFHA 1HX1A 4CZEA 5AQQA 3I33A 2P9IA 3MGZA 3GL1A 3CQYA 2NNWA 3ENOA 3U4LA 3I56N 1YXQA 1D4XA 5AQHA 1Q7YO 5F2RA 4GY2B 2RISA 1KAYA 4BRLA 4NB4A 2W41A 2A41A 3R9PA 1BO5O 2HBKA 4BRAA 4LC9B 1TKSA 5AQZA 4K42A 2QWRA 3B8AX 2QI2A 3VMFB 3D2EA 1JCEA 4MLHA 4BY9C 2J4RA 3FZLA 3AAQA 4BRGA 5H1SQ 2E2OA 1MWKA 1T3VA 2HSTA 1T6CA 3UKRA 3MN7A 3LDOA 4PKIA 2YJEA 4IOCL 3ZX0A 3Q7BA 1S72N 3G71N 4B9QA 5F0XA 3UE5A 3SK3A 3GG4A 2Q36A 3CMEN 5CE3A 4YDUA 1NGHA 3F5TA 3MX5A 4A62A 4ISFA 3CJ1A 4JAXA 2Q1NA 3RSEB 3WT0A 3H46O 4GV9A 1BU6O 4P6DA 4NLBA 4CD1A 2NRTA 2NRRA 1MA9B 4IO9L 1E4FT 3PIOL 2KLAA 4JKFA 5LJVA 2CH6A 3ID6A 4ISGA 3KVGA 5JLHA 3N4QA 1JJ2M 3W0LA 3EN9A 3WQTA 3A5LC 3A8YA 4WQ5C 5LY3A 1IJJA 5DM7L 4JKBA 1Y64A 2ITMA 1KD1O 3EKUA 2RHKA 3KK7A 4FWKA 5F1XA 3SAGA 3E1YA 3KZBA 1GLJO 1NGFA 1XUPO 3L6QA 3KWGA 4O8UA 3TU5A 3G4SN 3LRJA 4BRNA 3K9KA 4QS7A 4FO0A 3P04A 4JK7A 4C23A 3JXUA 3C7NB 4OPAA 1M90O 2P9UA 4NZRM 3W3DA 1N8RO 4FFJA 3VTIA 1K4IA 1BDGA 3BF3A 3H3NO 3VGLA 3FZKA 5KQ8A 3M6GA 4JKGB 1IEZA 5TKWA 4FWOA 3C6HA 4BRIA 4BQLA 2ZJQL 4P8JA 5JICA 4FPBA 1T44A 2E2PA 3CCEN 4MLEA 3ENBA 1YVNA 2I7NA 3C0BA 3C6AA 4A5AA 5GADP 4RTFD 4BC5A 1ILYA 5AZJA 2PBDA 1BA0A 4B1WB 2P9NA 4EO0A 2P9IB 3WXLA 2NZTA 3GBTA 4FWRA 4B1UB 1SS6A 1VQ8N 3IFRA 2FLOA 3VF6A 3MN5A 4JKDA 3FFKB 4WFAL 1VQON 2BH1A 2EQAA 4P6PA 2A6AA 5EOYA 1HJOA 4BGAA 3E9PA 1LCUA 1VQMN 3I8BA 3CCQN 5GINA 1MDUB 3M1FA 3AY9A 4BC3A 1DKGD 4CZMA 1ZXOA 1GLBG 3VESA 3EKSA 3FZHA 3O1WA 4JNEA 2YHXA 1NJIO 4O8KA 5C15A 1E4GT 3L7VA 3VGKA 2P9LA 3NVMA 4UY8O 2ASMA 3LM9A 4KBOA 2ZF5O 3UKRB 3DJCA 3TSPA 1HLUA 3ULEA 5LJWA 5M1KA 3DXMA 4BR4A 3LL3A 3CQXA 2KHOA 2QEXN 3QB0A 5FPNA 4FCXA 2P9KA 3E9OA 2NLXA 2ASPA 2E1YA 3QFPA 1VQKN 1TUYA 3MIOA 4PL8A 2OTJN 4FBQA 1GLDG 2F9TA 5FPDA 5GAEP 5HL7L 1LOTB 3EL2A 1GLAG 5KPTA 1G99A 1XQSC 3CJ7A 1HPMA 5TKYA 4BRCA 3IMXA 1K4PA 4BR5A 4FBWA 3IDHA 4G9ZA 2V52B 3IUCA 3TPQA 4FWSA 2QTDA 3A5OC 1VQ6N 3O5BA 3ZX2A 5EX5A 3O9RA 3D7EO 3I55N 4IZ9A 2GWJA 4QS8A 4DHYA 3L4IA 5GAGP 3FZMA 3CJAA 2MX1A 4YOVA 4AF1A 1NBWA 3LDLA 4FPAA 4MO5A 5C10A 2NRXA 4O5FA 2YHYA 4PHTX 1DEJA 3MX2A 3M5RA 2OTLN 4KH6A 4FWMA 3CETA 3FGUA 4PKGA 2D0OA 2Q2RA 2Q97A 2VYPA 2IVNA 3P39A 3R1XA 5BRFA 3SBGA 2FF3B 2P9UB 3F2KA 1K8KB 4EHUA 1J6ZA 4MO4A 1S22A 4FOIA 4BVPA 4JKHA 1QZ5A 2LN3A 1NGAA 3MWTA 3LM2A 2QM1A 5M1PA 4CZHA 3HRGA 4WQ4A 3SBTA 3HBTA 3ZIEA 4CZGA 5BPMA 4YORA 3TTDA 1BWFO 1OKJA 3DLLL 5AFUA 3HOTA 2HF3A 4JN4A 5KPRA 2GTDA 2VGMA 4GV3A 2ZGYA 3LDQA 4FOEA 3UKUA 2AP1A 2GX9A 4H0XB 4B1VA 1QQMA 4YOYA 1YITN 4P6CA 3VEZA 4FWPA 3TTFA 2NRZA 3VPZA 4C1NK 4CBWA 2QWQA 1VQ4N 1VQ5N 3ZETA 3HM8A 4YOXA 3K9JA 3EO3A 4AM6A 2WC9A 4IJNA 1HKGA 1ZBSA 2HOEA 3MK6A 4JKEA 4KH5A 3SLCA 3CC7N 3CF5L 3M3ZA 4JHDB 4WF9L 2YCHA 3GOIA 3LDPA 5AQFA 2VWBA 1H1VA 5AR0A 2BTFA 3AGKA 4BRPA 4M7YA 2NRVA 5AQJA 3VERA 1R59O 2P9LB 4A5BA 4Y0WA 1WUAA 2QWOA 2YJFA 3ULEB 1YAGA 1Z05A 3DXMB 4CZIA 4H5VA 5CR4A 3BP8A 4CZKA 5B8HA 3WXKA 2A3ZA 2E2QA 4GV6A 2P9KB 3OA9A 4FWNA 5AZIB 5M1OA 5GAHP 4IEIA 2AA4A 4HVZA 4RWTA 3G6EN 2P9PA 1P8ZA 4BRQA 3U9ZA 4M7XA 4BR0A 5AFUH 2YX6A 1YI2N 2CGLA 4H5WA 1GLCG 1VQPN 1U6ZA 4XH5A 3ZX3A 4FWLA 3LDNA 3MWPA 3PIPL 1V4TA 1U2VA 1VAZA 4H0YB 1C0FA 2EWSA 3BUZB 3O80A 4M63C 5JMVA 1EQYA 5GIOA 2E8AA 1ZC6A 3QBWA 4I6MA 1QQNA 3MN9A 4H0TB 5MLCQ 5AQSA 1QZ6A 3L4QA 2IVOA 2WFBA 4WQ5A 3VENA 1VQ7N 4F9OA 1SNNA 1K7JA 5KPZA 3DXKA 3ZEUB 4PL7A 2Q31A 4IOXA 4L3QA 2JWKA 3H07A 2P9SB 3P38A 1W97L 3P4IA 3HTVA 4I14A 4HTLA 3R3LA 4BRMA 3CC4N 4YOUA 3N4PA 5BN8A 4IDHA 3MCPA 4IWVA 1X3NA 2F7TA 3WEEA 3CIPA 2HF4A 3R8EA 2IVPA 4WCEL 5I9EB 3ZYYX 5AQIA 3H1VX 4C1NI 1S3XA 4ILJA 1QQOA 1X3MA 4IJAA 5C2DA 5CHIA 1RDWX 4H5TA 3CCUN 4A2BA 2ASOA 4XH1A 2CGKA 2Q0RA 2QWPA 3O9TA 1SZ2A 4BGBA 1NGJA 2DPNA 5EVZA 1YUWA 3D2EB 1DT9A 4ISEA 3OBYA 4JD2A 3VF4A 4E1JA 3FZFA 4DCHA 3TTCA 4H0OA 5AQOA 1C0GA 3CI5A 2W40A 5HOOA 1QHAA 3ZETB 4B1ZA 3DAWA 4A57A 3NMUA 4DB3A 5BPLA 1QVFM 3VETA 3WXJA 3AARA 1K9MO 5AQGA 3NVKA 4KH4A 5ADXA 1RDUA 3OHRA 3AJEA 2JWLA 4H5RA 1NGEA 5AQVA 3H6EA 3HOSA 2F9WA 3BF1A 4BRDA 3AGRA 1Q82O 1YF5L 3J7ZO 1ATNA 3UB5A 5C0YA 2VCPA 3DWLA 1RFQA 3Q7CA 1JCUA 3ATVA 4PKHA 5EXWA 1BG3A 2KKZA 3VEYA 3SMSA 4WFBL 4IOAL 3LQUA 2BUPA 2GUPA 2GELA 5AQLA 1O13A 3EE8A 3VEOA 5FPEA 1HKCA 2P9PB 1GLEG 3ID8A 4JKCA 4P77A 2YHWA 4H0PA 1KC8O 2QWLA 4U67L 3CPEA 4IO8A 3CJBA 1U2VB 3J8AA 4U7BA 3D2FA 4YOTA 4MDBA 1KXPA 1MWMA 3MCAB 4I6MB 3IKMA 3ATUA 3QFUA 1QVGM 4FBKA 2NRWA 3CCRN 3C7NA 1Z6RA 2CGJA 3QBXA 1NMDA 3CHWA 5AQRA 4FL9A 4BG9A 3DXKB 5AQPA 4AM7A 3GDQA 2WUSA 5JVGL 3O4WA 4DQ8A 5JVHL 2E1ZA 4YKEA 5ADXH 3VGMA 4A61A 3FLCO 1K4LA 2IIRA 1T6DA 4BREA 2ZJRL 2RE2A 2CH5A 2QXLA 4K25A 5AQMA 1VQ9N 1HRUA 5AZJB 2FSJA 3FE1A 2P9NB 4BRKA 3CCLN 3P31A 4QS9A 4BR9A 2QW9A 3O6WA 1PVYA 4K43A 3ENHA 4J8FA 3EZWA 2GWKA 3WEEB 3L0QA 3WXMB 3CCJN 1IG8A 2VGNA 4CJ7A 5BPNA 2WBNA 1KK9A 1NGDA 4A2AA 3OW2M 4BR7A 2ZGZA 4BRFA 2D4WA 3CERA 3QICA 1OVYA 5AQTA 1K49A 2OANA 4H5NA 1KAXA 3T1IA 1ATRA 5BRHA 1GLFO 1XC3A 3EE9A 4FWQA 4B1YB 4JEPA 4JD2B 4GVEA 1YIJN 3O1BA 4YDUC 4JK8A 3O9SA 4XH4A 1V4SA 3D6RA 3MK5A 3ZIHA 2A5XA 2E88A 3VEXA 2E20A 3WQUA 1KQSM 1TYQA 1W2BM 1ATSA 4BR2A 1K73O 2ZJPL 3MMVA 2A40A 1G57A 1VQLN 4NLCA 5EY4A 4EIAA 4BQZA 3MN6A 3S41A 4BVOA 5BR9A 2V7YA 3JS6A 1XEZA 3VOVA 2P9BA 3BEXA 3HSCA 1TKUA 5M1FA 3O9UA 2FSKA 2I7PA 4JKAA 1DGKN 4H03B 3O9QA 2D0PA 2PFUA 3CMAN 3CD6N 4ILGB 2A42A 3MDQA 3R6MA 3T69A 3ZIGA 3C65A 2E2NA 3WXIA 4BROA 1BA1A 3VF2A 1VQNN 4RCHA 3SAHA 4FSVA 2RIUA 4CZLA 1PVWA 3WUHA 3CCMN 1YJNN 3U9DA 3G25A 4CZJA 1Q81O 2FXUA 3H1QA 3QMLA 1P90A 3CCSN 3D2FB 1NGGA 3H3OB 4EAHD 1YJWN 3A5NC 5FPMA 4E1BA 4P8EA 1RGIA 2HBMA 1HUXA 5C2FA 1X9JA 3E66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTH A;  3TTC A;  3VES A;  3VER A;  3VEW A;  3TTD A;  3VTI A;  3VEO A;  3TSP A;  3TSU A;  3TSQ A;  3VEN A;  3VEZ A;  3VF2 A;  3VF4 A;  3TTF A;  3VEX A;  3VET A; 
#chains in the Genus database with same CATH topology
 2PAV A;  3U8X A;  1ZBF A;  1Z25 A;  3AAP A;  3OS0 A;  2IFE A;  2FSN A;  4CEF A;  4NO7 A;  5HBM A;  2ETJ A;  3CXC M;  1JL1 A;  3VQ9 A;  2HHU A;  1JCG A;  4N41 A;  1HQU A;  1YJ9 N;  3ZSQ A;  4Z9E A;  1LWF A;  1NKE A;  4B3S K;  3VEW A;  4H0V B;  4A59 A;  1XHX A;  1SV5 A;  4IXC A;  4BG8 A;  4X62 K;  2R7Y A;  2V7Z A;  3CCV N;  2HBJ A;  2QA4 N;  4DWI A;  2OPS A;  3I0S A;  4FJL A;  4B1X B;  5C25 A;  3NFA A;  4E3S A;  4OKE A;  4Y1D A;  4CD3 A;  1JCF A;  1Y2I A;  2IAJ A;  3K2P A;  4AHT A;  3OYI A;  3SAF A;  3THX B;  1E3M A;  1SQK A;  4CEB A;  4GKJ K;  2D0B A;  3K57 A;  4JI2 K;  4BRH A;  3CC2 N;  1LAW A;  1NGI A;  4KKO A;  3HZ6 A;  3LZI A;  1UA0 A;  4B9S A;  2OPR A;  3VQ6 A;  2Z1H A;  4BC2 A;  1SAZ A;  4NCB A;  1EO1 A;  3DOL A;  4FVU A;  3F9M A;  3MEG A;  3NH1 A;  4FZZ A;  4JV5 K;  3OBW A;  4DMN A;  4C8O A;  4CEQ A;  2YNF A;  3AO1 A;  1TKZ A;  4LD0 A;  4IEE A;  5CZ2 A;  4C8K A;  1G58 A;  5AQY A;  3O4Q A;  5JS2 A;  4RW7 A;  4IBN A;  2WON A;  4ILH A;  1NWK A;  2Q0U A;  3OYN A;  4GNI A;  4JKG A;  4K41 A;  2G8W A;  4TWA A;  4B9T A;  2D1K A;  4DR4 K;  1BUP A;  1WSJ A;  3M8R A;  4FZY A;  4MFB A;  1OH6 A;  3LS6 A;  4FLX A;  1LW0 A;  5AQQ A;  1ZYQ A;  1GOC A;  3RR8 A;  1WSG A;  2NNW A;  3SQ0 A;  3KK1 A;  1C1A A;  5AQH A;  4PUO A;  1TK0 A;  4DLE A;  4NXM K;  2O8D B;  1KCF A;  1RTD A;  4PA1 A;  1BO5 O;  2HBK A;  3I0R A;  5HLF A;  2QWR A;  3HVT A;  1KVB A;  3AAQ A;  2E2O A;  4DLG A;  4FJN A;  3MN7 A;  4N56 A;  4B9Q A;  5F0X A;  4F3T A;  3GG4 A;  2Q36 A;  4YDU A;  4CK3 A;  3SYZ A;  4A62 A;  4ISF A;  1BU6 O;  1XC9 A;  1S8E A;  1FW6 A;  4LFA K;  2NRR A;  4E7L A;  3QEX A;  3ID6 A;  3ITH A;  3QNO A;  3A5L C;  3A8Y A;  4WQ5 C;  1JLB A;  3ZT4 A;  4CW7 B;  4CED A;  1GLJ O;  3SCX A;  1WAF A;  3TU5 A;  1TL3 A;  2UU9 K;  4FO0 A;  3VQ5 A;  4CGF A;  1NK7 A;  3JXU A;  4J2E A;  4OPA A;  2G8F A;  2P9U A;  4NZR M;  4FJ7 A;  3BF3 A;  3H3N O;  5C24 A;  2UXB K;  1XNR K;  3FZK A;  3JAM O;  3AVN A;  1RT2 A;  4YDQ A;  1EP4 A;  4OKJ A;  1TVR A;  2E2P A;  1S1U A;  3C6A A;  5GAD P;  4BC5 A;  2ZE2 A;  4B1W B;  3GBT A;  1C1C A;  1EWQ A;  3VF6 A;  3VQE A;  4M3X A;  4JKD A;  4CJW A;  4P6P A;  3AVI A;  1N34 K;  5GIN A;  2BKY X;  4IFY A;  4H8K A;  1NJ2 A;  3VES A;  3EKS A;  2D5R A;  1S1V A;  4BWJ A;  1E4G T;  1JLQ A;  1KRP A;  2P9L A;  2ASM A;  4CJP A;  3S3O A;  1NG9 A;  1RT5 A;  4V19 S;  3QB0 A;  1IBM K;  2HW3 A;  4LFB K;  2ASP A;  2E1Y A;  3AO3 A;  4B9L A;  1GLD G;  5FPD A;  3AVA A;  1XQS C;  4H4O A;  5TKY A;  1HNV A;  3HPH A;  1T03 A;  2KW4 A;  4RW8 A;  2JGU A;  3A5O C;  1IKX A;  4DHY A;  5GAG P;  1RDC A;  1NBW A;  4FPA A;  4MO5 A;  4BWM A;  2P5O A;  2NRX A;  1DEJ A;  1RT7 A;  4KH6 A;  2IVN A;  5J2P A;  4NYN A;  4DU4 A;  1S22 A;  3AO2 A;  3TAP A;  1HPZ A;  1II7 A;  5I3U A;  1NGA A;  1EX4 A;  1SL0 A;  3MWT A;  3LM2 A;  3S3N A;  3SBT A;  2ITG A;  4FYD A;  3EZ5 A;  1WNS A;  3ZIE A;  4CZG A;  4YOR A;  3TTD A;  1BWF O;  3HOT A;  3LDQ A;  4H0X B;  4B1V A;  4YOY A;  3IAY A;  4P6C A;  1CZB A;  3F73 A;  1VQ4 N;  3ZET A;  3HM8 A;  3KJV A;  3K9J A;  3EO3 A;  3H08 A;  1NOZ A;  5J1E A;  3LVK B;  3LPU A;  4GVM A;  2CRQ A;  4M3R A;  3CC7 N;  3M3Z A;  4OLB A;  4JHD B;  4O5B A;  2YCH A;  4WF9 L;  1U48 A;  1ASU A;  3ASM A;  4BRP A;  4FCY A;  1R59 O;  4Y0W A;  4KI6 A;  1BIZ A;  4FW1 A;  3OYG A;  3KK2 A;  3B6P A;  4CZK A;  2FBY A;  2KZM A;  4JI1 K;  5AZI B;  4DTO A;  4M42 A;  2YNH A;  4FLY A;  2GTC A;  4KHY A;  1F21 A;  4AHC A;  1P8Z A;  4M7X A;  2O8B B;  2YX6 A;  2CGL A;  3NF9 A;  3MWP A;  1VAZ A;  1U2V A;  4H0Y B;  2KZZ A;  3O80 A;  2G8V A;  1J53 A;  3TAE A;  5MLC Q;  3MN9 A;  4H0T B;  2Y1I A;  1QZ6 A;  1B9F A;  2IVO A;  2WFB A;  4WQ5 A;  3VQ4 A;  1KSP A;  4AH9 A;  1K7J A;  1QS4 A;  4DF8 A;  4L3Q A;  3H07 A;  3P4I A;  1RBT A;  4BRM A;  3CC4 N;  1BI4 A;  4CES A;  4IDH A;  1TKD A;  3MCP A;  4IWV A;  2F7T A;  2HF4 A;  3R8E A;  4CFD A;  1WSE A;  4WCE L;  1WSH A;  4CGD A;  5LMU K;  4O0I A;  3AVB A;  4LF6 K;  5CHI A;  1QQO A;  1X3M A;  5C2D A;  1N32 K;  4H5T A;  4IDK A;  3CCU N;  1U49 A;  1WAJ A;  4CEC A;  2ASO A;  3O9T A;  4F2S A;  2DPN A;  3OYA A;  5KRT A;  1JLC A;  2W6K A;  5AQO A;  4E7I A;  1HR0 K;  2BE2 A;  5HOO A;  3O3F A;  3RRG A;  4HVC A;  1QVF M;  3WXJ A;  3K5L A;  5ADX A;  4O44 A;  4FJ8 A;  4H5R A;  4M45 A;  1J5E K;  2F9W A;  1YF5 L;  4Z4F A;  3J7Z O;  1SL2 A;  3UB5 A;  2VCP A;  2GBZ A;  1JCU A;  1ASW A;  2KKZ A;  2BUP A;  2GEL A;  5AQL A;  1O13 A;  1X1P A;  1HKC A;  2P9P B;  1LW2 A;  2YHW A;  1KC8 O;  2QWL A;  1D9D A;  4IO8 A;  4U7B A;  3AVL A;  1IV0 A;  1MWM A;  3IKM A;  2NRW A;  4E1N A;  1IBK K;  1NKC A;  2KFN A;  4BG9 A;  4FL9 A;  3DXK B;  5AQP A;  1S5J A;  4FVM A;  4IG3 A;  5JVH L;  2O8E A;  3VGM A;  2IIR A;  2ZJR L;  4BRK A;  3CCL N;  4QS9 A;  3P83 D;  1NJZ A;  3CCJ N;  2BAN A;  4CJ7 A;  1KK9 A;  3M8S A;  1C0M A;  4FM2 A;  1WN7 A;  3ZSX A;  3ZCM A;  2ZGZ A;  1NJW A;  3QKB A;  1X9M A;  4JI5 K;  1KTQ A;  4H5N A;  3LDS A;  3T1I A;  2UXD K;  1XC3 A;  3THW A;  3O1B A;  3DI6 A;  3G10 A;  1V4S A;  4N76 A;  4LF7 K;  1W2B M;  3CQ8 A;  4BDP A;  3DRR A;  3MMV A;  1S6P A;  5EY4 A;  4EIA A;  3LP0 A;  4HUF A;  4CK2 A;  4BVO A;  4DV2 K;  4OLA A;  4CIG A;  3HSC A;  3KD1 E;  4JKA A;  2I7P A;  2D0P A;  2L8Y A;  1IBL K;  4CJQ A;  3CD6 N;  4JI6 K;  1ZBU A;  3T69 A;  3ZIG A;  4OPK A;  1LN4 A;  3DSD A;  4FSV A;  4CER A;  2RIU A;  1DTQ A;  1PAV A;  2AJQ A;  2FXU A;  3CG7 A;  5D3G A;  3D2F B;  4DFP A;  1YJW N;  3A5N C;  4P8E A;  2KQ2 A;  4WE1 A;  5AQW A;  4O0J A;  3VTH A;  5CY4 A;  1K8K A;  4EP4 A;  1M1K O;  2A1R A;  1VRU A;  4JYA K;  1NM1 A;  5GIP A;  3RMC A;  3T1H K;  1NKB A;  3T7Z A;  4CBU A;  3NH2 A;  3C95 A;  3UKU B;  2F4V K;  4CF1 A;  4IFE A;  1J54 A;  1L3S A;  3SV3 A;  3WNF A;  1K8A O;  3TSU A;  1VSL A;  2NRH A;  1NNE A;  5M1Q A;  4W5R A;  1NK5 A;  1K4O A;  3AO5 A;  4CHQ A;  4DTR A;  1B92 A;  4J2A A;  1S6Q A;  4Z4H A;  2QKB A;  3CPW M;  4ELT A;  4XEI A;  5M1N A;  4EHT A;  3RSE A;  1WBD A;  3LP1 A;  1TYQ B;  3VQD A;  4OPH A;  3ZII A;  1GOB A;  3KWI A;  1UOC A;  3O8M A;  4W5O A;  3PSI A;  3CFO A;  2YI1 A;  3L8B A;  3V9W A;  3CJ9 A;  3KIO A;  3KKR A;  4OX9 K;  4YOW A;  1VHX A;  5KQD A;  4X64 K;  3OYF A;  4HCC A;  3T1A A;  1D5A A;  4CZF A;  5E26 A;  2PYJ A;  3QNN A;  1YVU A;  5DM6 L;  3MAQ A;  2HNY A;  3HI0 A;  4HWI A;  1RDA A;  4KHU A;  4DUZ K;  3CM5 A;  4MDA A;  5BN9 A;  2QWN A;  2P9S A;  1H0X A;  2XRI A;  2HVI A;  4CZE A;  2OA8 A;  3MGZ A;  3IAL A;  1H4Q A;  4CIE A;  3U4L A;  2DFH A;  4Z4I A;  4DQP A;  4GY2 B;  4ID1 A;  4NCG A;  4BRL A;  2W6L A;  4DR3 K;  2A41 A;  2ZM6 K;  1YTA A;  3U3Y A;  1BL3 A;  1YTU A;  1KVA A;  5H1S Q;  4GMJ B;  4RW9 A;  1T3V A;  4CF8 A;  3PV8 A;  1OH8 A;  1T6C A;  4JLH A;  4YFU A;  3UKR A;  4IOC L;  3Q7B A;  5KGW A;  1OH7 A;  3UE5 A;  3SK3 A;  3CME N;  1NGH A;  5I42 A;  3CJ1 A;  4JAX A;  2Q1N A;  4Q15 A;  3H46 O;  4P6D A;  4DSI A;  1BIS A;  4CD1 A;  1VSH A;  1MA9 B;  4IO9 L;  4TSX A;  2CH6 A;  3SQ4 A;  2IGI A;  3K0S A;  1S9G A;  4E0D A;  1HQE A;  2ITM A;  2RHK A;  5F1X A;  3E1Y A;  4M41 A;  4O8U A;  4BRN A;  3K9K A;  1W9H A;  4QS7 A;  2OPP A;  4JK7 A;  4C8N A;  1IG9 A;  1LWE A;  3RR7 A;  4FFJ A;  4M3Z A;  3QLH A;  3VGL A;  5FLX O;  4X65 K;  3WNH A;  1HYV A;  4LSL A;  4JKG B;  4DR5 K;  3QEV A;  4DSJ A;  4FWO A;  3C6H A;  1W0H A;  1FKO A;  4BRI A;  4KB1 A;  3HXM A;  1IKW A;  3ENB A;  2I7N A;  3C0B A;  5CYM A;  4CHY A;  1ILY A;  2PBD A;  1BA0 A;  2P9N A;  2PY5 A;  4B1U B;  3HP9 A;  2QK9 A;  1L5U A;  2XO7 A;  4R5P A;  1VQ8 N;  3IFR A;  3SUQ A;  2FLO A;  4CF9 A;  3MN5 A;  3FFK B;  1H4T A;  1VQO N;  2BH1 A;  5EOY A;  4BGA A;  2B4J A;  3U6F A;  1DCJ A;  3ULD A;  4FJX A;  1RBV A;  3FZH A;  5C42 A;  4E19 A;  3KLE A;  3QEW A;  3L7V A;  4UY8 O;  4PWD A;  3ULE A;  1RT1 A;  1QTM A;  4BR4 A;  4B3T K;  3LL3 A;  3CQX A;  2KHO A;  2P9K A;  3E9O A;  1NK0 A;  1RDD A;  2YV0 X;  1VQK N;  3JSM A;  2OTJ N;  4FBQ A;  3L2V A;  4ELV A;  1GLA G;  3OYJ A;  1G99 A;  3CJ7 A;  1K4P A;  1HPM A;  4BRC A;  4F4K A;  4I9L A;  4BR5 A;  3IDH A;  4G9Z A;  4N47 A;  2QTD A;  1REV A;  3O5B A;  5EX5 A;  3O9R A;  2GWJ A;  3P5J A;  2VQF K;  3ALY A;  4KPY A;  1TAU A;  4CVN E;  4AF1 A;  4YNQ A;  4DV7 K;  3LDL A;  5C10 A;  3LVJ C;  3P1G A;  3M5R A;  2OTL N;  4FWM A;  2LSN A;  2Q97 A;  2XY8 A;  3R1X A;  3HPO A;  3SBG A;  4FLV A;  2P9U B;  3DSC A;  4FOI A;  3QER A;  1LAV A;  2ATQ A;  1QZ5 A;  1HMV A;  2LN3 A;  4BE2 A;  2OYQ A;  4CZH A;  4KHS A;  1NK8 A;  4DV0 K;  3HBT A;  4E7J A;  5AFU A;  2HF3 A;  5HRS A;  5KPR A;  2GTD A;  2YHA A;  4LY7 A;  4FWP A;  4C1N K;  2NRZ A;  3MXJ A;  1VSJ A;  2HHQ A;  1SKS A;  4AM6 A;  1CXU A;  2HOE A;  3MK6 A;  4JKE A;  3AVG A;  3CF5 L;  3LDP A;  2VWB A;  3KD5 E;  5AR0 A;  2FBV A;  3AGK A;  4K88 A;  5AQJ A;  2P9L B;  1JXB A;  3LAL A;  4A5B A;  1Z05 A;  4ICL A;  1CZ9 A;  5CR4 A;  1LWC A;  2E2Q A;  4GV6 A;  3PY8 A;  1IKY A;  1NU0 A;  3G6E N;  4C8L A;  1GLC G;  4ID5 A;  4XH5 A;  3ZX3 A;  4B9U A;  4FWL A;  4M3T A;  3LDN A;  1C0F A;  4I6M A;  3L4Q A;  4DV4 K;  5KPZ A;  3ZEU B;  2JWK A;  5AJ3 K;  4CHP A;  1TV6 A;  4DQS A;  4I14 A;  4BE1 A;  3N4P A;  5HRN A;  3AO4 A;  4FK4 A;  5HRO A;  4FLW A;  3J80 O;  1X3N A;  3ZT1 A;  2IDO A;  3U3G A;  4CJK A;  1EET A;  3ZYY X;  3NF7 A;  4BAC A;  1RTI A;  3NHG A;  4IJA A;  2W42 A;  2VWJ A;  2Q0R A;  2QWP A;  4LH5 A;  1SZ2 A;  4BGB A;  2VG7 A;  1SKW A;  1YUW A;  1HYS A;  3D2E B;  1DT9 A;  4ISE A;  2O8D A;  1VSD A;  3ZSW A;  3CI5 A;  2Y1J A;  1L3T A;  1QHA A;  3ZET B;  5BPL A;  4OKK A;  3BGR A;  4DTN A;  4FK2 A;  2JWL A;  3V1Q A;  4Q0B A;  2F8T A;  3V6D A;  2EH1 A;  2QXF A;  1ATN A;  1JL2 A;  3DWL A;  1VSM A;  1CLQ A;  4DTU A;  3ATV A;  4PKH A;  5EXW A;  3VEY A;  3SMS A;  4WFB L;  3I8D A;  3LQU A;  2FBT A;  3IAB A;  3EE8 A;  3HM9 A;  1GLE G;  3HP6 A;  4JKC A;  2HHV A;  4P77 A;  2X78 A;  4H0P A;  2G8I A;  4U67 L;  4I9Q A;  1TGO A;  1U2V B;  4BE0 A;  3ATU A;  2CGJ A;  1TK5 A;  4AHV A;  3GDQ A;  2HMI A;  4DQ8 A;  4B9V A;  4J2B A;  4YKE A;  4DSL A;  1K4L A;  3FLC O;  4BRE A;  1VQ9 N;  5AZJ B;  4LF9 K;  3FE1 A;  3KLI A;  3SV4 A;  3AA5 X;  4BR9 A;  2QW9 A;  3O6W A;  4K43 A;  1UWB A;  1S1X A;  4CEO A;  4DR6 K;  4DFM A;  1NGD A;  4A2A A;  3OW2 M;  1UA1 A;  5LL6 Z;  1A5X A;  4DR7 K;  3TAM A;  3PX4 A;  3QIC A;  3OY9 A;  1HJR A;  1KAX A;  4IFV A;  4O55 A;  2YKN A;  1GLF O;  4AIL C;  3EE9 A;  4B1Y B;  4GVE A;  4M3W A;  3O9S A;  4XH4 A;  3MK5 A;  2E4L A;  4IG0 A;  3VEX A;  2E20 A;  1KQS M;  3M8Q A;  3L2R A;  5K14 A;  1JKH A;  3OYK A;  1Q9X A;  2A40 A;  4NLC A;  4ZTF A;  2V7Y A;  4HVJ A;  3QEI A;  3JS6 A;  1XEZ A;  4KI4 A;  2P9B A;  3BEX A;  4H03 B;  3DMJ A;  1ZBI A;  1Z26 A;  4ELU A;  3ZSR A;  4Z0U A;  3K5O A;  2KFZ A;  3THV A;  3O4N A;  2E2N A;  3WXI A;  4BRO A;  4YY3 K;  3VF2 A;  3VQQ A;  1VQN N;  3LPT A;  2HHW A;  2O8F A;  3CCM N;  3G25 A;  4CZJ A;  1TKT A;  1EKE A;  1NFJ A;  3CCS N;  3K5M A;  2GV9 A;  1NGG A;  3NCI A;  2P51 A;  5FPM A;  1HUX A;  1HRH A;  3E66 A;  4QAG A;  1U45 A;  1NGB A;  1YHQ N;  4JS4 A;  2O8E B;  4I2Q A;  5AQK A;  1NGC A;  3J7Y P;  1WLJ A;  2HMP A;  1T05 A;  3CFR A;  5ELZ A;  3A0I X;  3V81 A;  2Z1J A;  4BDZ A;  1NLV A;  4O4G A;  3L2Q A;  4FLT A;  4JRP A;  5AQU A;  5C12 A;  1TIG A;  3PLA A;  1QSS A;  3TI0 A;  3ZSY A;  3UIQ A;  1W7A A;  3SI6 A;  1D8Y A;  2UYT A;  1HKB A;  2ZWH A;  4DKW A;  2QWM A;  1QQC A;  4JHD A;  3SMP A;  1R0A A;  3VEV A;  1WOQ A;  5AQN A;  5BRE A;  2HND A;  3LAM A;  4L8R B;  1BQN A;  5JLF A;  4OO1 J;  5KGX A;  1FJG K;  5AQX A;  4WYB A;  1OVQ A;  2GEM A;  1Q18 A;  3NDK A;  5AZI A;  3QO9 A;  1NOY A;  4CJS A;  3V9X A;  3OYC A;  3BDP A;  3OYH A;  5KTQ A;  4YHH K;  1QE1 A;  3GE1 A;  5HP1 A;  3OYD A;  3QDK A;  1N6Q A;  1WBB A;  4AHR A;  2HBL A;  2V51 B;  4LF5 K;  2H3G X;  2YNI A;  3CJC A;  3O3H A;  3RVC A;  4LF4 K;  2O4I A;  1Q86 O;  3KHY A;  1H0Y A;  4Z4C A;  3I33 A;  2P9I A;  3CQY A;  3ENO A;  1HYZ A;  3I56 N;  3NGY A;  1NJX A;  3DLB A;  1D4X A;  3MXM A;  1Q7Y O;  4K8Z A;  4AHS A;  2Z1G A;  1QSL A;  4LC9 B;  5AQZ A;  4K42 A;  2PZS A;  1QSY A;  4FJK A;  2J4R A;  3OVN A;  4CJR A;  2HST A;  4DSF A;  4DG1 A;  3K58 A;  4DTX A;  5KRS A;  3ZX0 A;  3O3G A;  1S72 N;  3G71 N;  1XI1 A;  4YOV A;  3F5T A;  3RSE B;  3WT0 A;  4F3O A;  4NLB A;  3THY A;  1VSI A;  2NRT A;  3K59 A;  2KLA A;  3SUN A;  5CYQ A;  5FRN A;  5LJV A;  4E1M A;  2E6L A;  3W0L A;  1IO2 A;  5LY3 A;  1IJJ A;  3PX0 A;  4JKB A;  1KD1 O;  1NFH A;  1FXX A;  3EKU A;  4FWK A;  3SAG A;  3L6Q A;  3KZB A;  3G4S N;  4E89 A;  1N36 K;  4C23 A;  4K87 A;  1BCO A;  3C7N B;  3VTI A;  1K4I A;  4CFA A;  2UUB K;  2KTQ A;  3M6G A;  5TKW A;  4QOZ B;  3VQA A;  3J81 O;  4DTJ A;  1C0U A;  2M71 A;  1MU2 A;  4BQL A;  4JI8 K;  1YVN A;  3DM2 A;  4A5A A;  5T7B A;  1NMN A;  4RTF D;  4DV6 K;  4EO0 A;  2O8C A;  4DS5 A;  3C94 A;  3PX6 A;  4FWR A;  2F96 A;  1SS6 A;  3MXI A;  3DLG A;  3ZLJ A;  3MEE A;  1HNW K;  4GKK K;  3TOE A;  1RT3 A;  2Q3V A;  3SZ2 A;  1VSF A;  3HT3 A;  1HJO A;  3HL8 A;  3E9P A;  1LCU A;  1VQM N;  5J2N A;  3LP2 A;  3AY9 A;  4CZM A;  1DKG D;  3OTO K;  3DLR A;  4JNE A;  1NJI O;  3SPZ A;  1Q8I A;  5C15 A;  4K0K K;  3VGK A;  4LF8 K;  3NVM A;  4NXN K;  2VWK A;  5FRO A;  3LM9 A;  4DV5 K;  2ZF5 O;  3ZSV A;  3UKR B;  3DJC A;  3TSP A;  1HLU A;  5LJW A;  5M1K A;  3DXM A;  1L3U A;  2UUC K;  3SUP A;  5FPN A;  1S1T A;  3HYF A;  2NLX A;  3ZT2 A;  1TUY A;  2O4G A;  3PUF A;  4CFB A;  4PL8 A;  2F9T A;  1RTJ A;  1HC7 A;  1LOT B;  3EL2 A;  4NCA A;  3IMX A;  4E7K A;  4FBW A;  3IUC A;  1VQ6 N;  3I55 N;  4IZ9 A;  2HHT A;  3L4I A;  1KFD A;  3FZM A;  3CJA A;  3MED A;  4CGG A;  3U6Y A;  1SKR A;  1JLE A;  4O5F A;  2YHY A;  1SUQ A;  4OGC A;  3CET A;  3FGU A;  2VYP A;  3RRH A;  2FF3 B;  1J6Z A;  4MO4 A;  1NJ1 A;  5M1P A;  3HRG A;  4CEZ A;  4JS5 A;  1OKJ A;  3DLL L;  2ZD1 A;  4HCB A;  4JN4 A;  2VGM A;  4GV3 A;  3UKU A;  4OPJ A;  1QQM A;  4I2P A;  4CBW A;  1VQ5 N;  4YOX A;  3EYZ A;  4UQG A;  2WC9 A;  4IJN A;  1HKG A;  4HD0 A;  1ZBS A;  3ZT3 A;  3OYE A;  4DQR A;  3AVH A;  5AQF A;  3AA2 A;  3RMD A;  1H1V A;  4FW2 A;  1ASV A;  4FJJ A;  3BZC A;  4M7Y A;  2NRV A;  2HHX A;  1DTT A;  4FM1 A;  2HNZ A;  1WUA A;  2QWO A;  2YJF A;  3ULE B;  4CJU A;  4CZI A;  1N33 K;  4C8M A;  5IT9 O;  2Z1I A;  3BP8 A;  5B8H A;  4KAZ A;  2E6M A;  4H4M A;  2P9K B;  4CCH A;  4IEI A;  2AA4 A;  4CIF A;  3AVK A;  4BRQ A;  3U9Z A;  3IG1 A;  4BR0 A;  1YI2 N;  3NF8 A;  4HTU A;  1U6Z A;  2PYL A;  3PIP L;  5GIO A;  2EWS A;  3AVJ A;  1EQY A;  2LXR A;  2E8A A;  1QQN A;  4DTS A;  3VA0 A;  4DQQ A;  3VEN A;  1SNN A;  2ZQB A;  3OYL A;  1W97 L;  4KRE A;  3K5N A;  4HTL A;  4LFC K;  3NAE A;  4YOU A;  1IH7 A;  5BN8 A;  4FJ5 A;  4CJL A;  4LH4 A;  3CIP A;  3WEE A;  5AQI A;  3L2U A;  4K8X A;  3HPG A;  4JI4 K;  3H1V X;  1QHT A;  1S3X A;  4ILJ A;  5LMN K;  1RDW X;  1NJ6 A;  3L3V A;  4XH1 A;  2CGK A;  4KHP K;  2X74 A;  5EVZ A;  5FRM A;  2WOM A;  3OBY A;  4JD2 A;  3VF4 A;  4CF2 A;  3TAN A;  3FZF A;  1C0G A;  2W40 A;  3WNG A;  3NMU A;  1J5O A;  4DB3 A;  1RBU A;  4OLF A;  3VET A;  1K9M O;  3NVK A;  3KK3 A;  3OHR A;  1FK9 A;  2RKI A;  4OVL A;  3WBM A;  1NGE A;  4AHU A;  5AQV A;  3H6E A;  3ZT0 A;  3AA4 A;  3AGR A;  2H9U A;  5C0Y A;  4CJF A;  1BG3 A;  2RF2 A;  3VEO A;  5FPE A;  3C6T A;  3ID8 A;  4DR2 K;  3HO1 A;  3B6O A;  3J8A A;  1KLM A;  4YOT A;  4AQY K;  4HUE A;  4MDB A;  4KTQ A;  3MCA B;  1BQM A;  4I6M B;  1S1W A;  3QFU A;  1QVG M;  4FBK A;  1Z6R A;  3QBX A;  1NMD A;  3CHW A;  1C6V A;  4FJM A;  4JI7 K;  2WUS A;  5JVG L;  4E7H A;  3O4W A;  1RBR A;  4WI1 A;  2E1Z A;  1EWR A;  5ADX H;  4K86 A;  4A61 A;  4FJG A;  1T6D A;  2RE2 A;  2CH5 A;  4Z4G A;  1HRU A;  2FSJ A;  3P31 A;  1RDB A;  4J8F A;  1RT6 A;  3WXM B;  1IG8 A;  2WBN A;  1JO0 A;  4KB0 A;  4XIU A;  4JRQ A;  4FJ9 A;  4CJE A;  4PY5 A;  4BR7 A;  4BRF A;  2D4W A;  3VA3 A;  1UAX A;  3ZSO A;  2D0A A;  2IS3 A;  4FWQ A;  3THX A;  4JEP A;  1YIJ N;  4FLU A;  3D6R A;  4EP5 A;  2A5X A;  1ATS A;  3HJF A;  2ZJP L;  3S3M A;  1XHZ A;  4DU3 A;  2BDP A;  3MN6 A;  3S41 A;  5BR9 A;  4CFC A;  4CJ5 A;  4DTP A;  3QIN A;  2GUI A;  1Y9X A;  1JLF A;  1TKU A;  5M1F A;  4Y1C A;  2FSK A;  1DGK N;  3SNN A;  3LP3 A;  3SPY A;  3CMA N;  3OYM A;  4M3Y A;  2A42 A;  3AVF A;  2DFF A;  3V9U A;  1RCH A;  1BA1 A;  3IAB B;  4RCH A;  3SAH A;  1T7P A;  3AVM A;  1C1B A;  1PVW A;  3WUH A;  1TK8 A;  1YJN N;  3U9D A;  1Q81 O;  2P5G A;  4Z4E A;  1JLG A;  1S9E A;  4EAH D;  3L2W A;  5HRR A;  2HBM A;  1T8E A;  4HUG A;  1X9J A;  4DV3 K;  2UUA K;  2YNG A;  3LAK A;  4DTM A;  2Z7C A;  4CI6 A;  2UXC K;  1ZBL A;  1JE3 A;  3VQ8 A;  5E84 A;  2XY6 A;  4JK9 A;  3A5M C;  4WFN L;  2VG6 A;  4FZX C;  1RIL A;  1D9F A;  1Y97 A;  5SZT A;  1XNQ K;  3T19 A;  1B9D A;  4CBX A;  4KV8 A;  2HHH K;  1KFS A;  5IWA K;  3E9L A;  4MQ3 A;  5HRP A;  2OZM A;  3PO5 A;  1HNI A;  2IOC A;  4Z94 A;  3G0Z A;  4BC4 A;  2XY5 A;  5BRD A;  1CZA N;  4NZT M;  3MEC A;  1WB9 A;  3FR0 A;  3S9H A;  3PO4 A;  4CJT A;  4FM0 A;  2FF6 A;  4B3M K;  3SJH A;  4W5N A;  1BIU A;  1I94 K;  5J2M A;  1TUU A;  3O08 A;  3FFI A;  2VG5 A;  2A2Y A;  3NGZ A;  1KAZ A;  3C6U A;  3H45 C;  4CE9 A;  1GLL O;  1BOT O;  2G8U A;  1ESV A;  4B9M A;  4J2D A;  2O8F B;  4W5Q A;  4WQ4 C;  2P1J A;  4DS4 A;  4R79 A;  3TAQ A;  3ZEU A;  2DY4 A;  4CHN A;  4DUY K;  3TSQ A;  1BI4 B;  4EFH A;  1HX1 A;  3DRP A;  3CYM A;  1NK6 A;  2BGG A;  3GL1 A;  3RMA A;  3TAR A;  2IC3 A;  4CJ3 A;  1YXQ A;  4CJV A;  3KKS A;  5F2R A;  3ZSZ A;  2RIS A;  1KAY A;  1WSF A;  3LWM A;  4NB4 A;  2W41 A;  3R9P A;  1TKS A;  4BRA A;  5BR8 K;  1SL1 A;  3ISN C;  3B8A X;  2QI2 A;  3VMF B;  3D2E A;  4DFK A;  1JCE A;  1XWL A;  4MLH A;  3FZL A;  4BRG A;  3OJS A;  4BY9 C;  1HNZ K;  1MWK A;  3RTV A;  3NBP A;  3LDO A;  3AVC A;  4PKI A;  2YJE A;  2WTU A;  5SWM A;  3V9S A;  3DYA A;  2A1S A;  5CE3 A;  3MX5 A;  4KO0 A;  4GV9 A;  3KTQ A;  1A5V A;  3BY5 A;  3TAF A;  1NK9 A;  3VN5 A;  4X66 K;  1JLA A;  2FC0 A;  1E4F T;  3PIO L;  4JKF A;  4HHT A;  4ISG A;  3KVG A;  1BHL A;  5JLH A;  2FBX A;  3N4Q A;  1JJ2 M;  3TAG A;  4M3U A;  3EN9 A;  3WQT A;  5JS1 A;  5DM7 L;  1Y64 A;  2G8K A;  3KK7 A;  1NGF A;  1XUP O;  3A2F A;  3KWG A;  3LRJ A;  4KFB A;  3P04 A;  3OJU A;  1M90 O;  4KRF A;  3W3D A;  1N8R O;  3L3U A;  1BDG A;  1EXQ A;  5KQ8 A;  4B9N A;  1IEZ A;  3NGI A;  4JI0 K;  4FK0 A;  3TR8 A;  1JDQ A;  4DV1 K;  2ZJQ L;  2D0C A;  3VQP A;  4FPB A;  5JIC A;  4P8J A;  1T44 A;  3CCE N;  3M8P A;  4MLE A;  3KLG A;  1RTH A;  1X9S A;  4ZTJ A;  4OGE A;  5AZJ A;  2RPI A;  2P9I B;  3WXL A;  2NZT A;  4IKF A;  4KTZ A;  3BZK A;  3HZ7 A;  4WFA L;  2EQA A;  1BGX T;  2A6A A;  3DLK A;  2B6A A;  3THW B;  2Y1B A;  3I8B A;  1VRT A;  3CCQ N;  1MDU B;  3M1F A;  4BC3 A;  4GW6 A;  1ZXO A;  1GLB G;  3VQB A;  4Q5V A;  3O1W A;  2YHX A;  4O8K A;  3AV9 A;  1U47 A;  5EU7 A;  3SJJ A;  5E41 A;  4KBO A;  3EY1 A;  5CZ1 A;  2QEX N;  2RN2 A;  4DR1 K;  4FCX A;  3QFP A;  1VR4 A;  3MIO A;  3IS9 A;  3THY B;  5DMR A;  5GAE P;  3KLH A;  2O8B A;  5HL7 L;  5KPT A;  1G15 A;  2QKK A;  2V52 B;  3TPQ A;  4FWS A;  3ZX2 A;  3D7E O;  4QS8 A;  4LSN A;  4DFJ A;  3OS1 A;  2MX1 A;  3LWL A;  4PHT X;  3MX2 A;  4PKG A;  2D0O A;  2Q2R A;  3P39 A;  5BRF A;  1O1W A;  3QIP A;  3DLE A;  3F2K A;  1K8K B;  4EHU A;  1LV5 A;  4CEE A;  4BVP A;  4JKH A;  1VSK A;  4CK1 A;  4CGJ A;  2QM1 A;  2YHB A;  2EX3 A;  1NJY A;  4WQ4 A;  5KI6 A;  4ZHR A;  3HST B;  5BPM A;  5DK5 A;  2G8H A;  2ZGY A;  4FOE A;  2AP1 A;  2GX9 A;  2O8C B;  1A5W A;  1YIT N;  1NJ5 A;  3OS2 A;  3VEZ A;  4JI3 K;  1KLN A;  3TTF A;  3VPZ A;  3VQC A;  2B5J A;  2QWQ A;  1VK0 A;  2EK0 A;  3PSF A;  1H4S A;  1FKP A;  3TAB A;  4KH5 A;  3SLC A;  3SUO A;  3GOI A;  4BDY A;  2BTF A;  3VER A;  1NH9 A;  4QCL A;  2YKM A;  4CF0 A;  3F9K A;  3QIO A;  3RWU A;  1YAG A;  3DXM B;  1RQ8 A;  4H5V A;  1XMQ K;  3WXK A;  2A3Z A;  3OYB A;  3WNE A;  3OA9 A;  4FWN A;  3CFP A;  1U4B A;  2XY7 A;  1TL1 A;  5M1O A;  5GAH P;  2VQE K;  1UDV A;  4KTW A;  4HVZ A;  2HB5 A;  4RWT A;  2P9P A;  4G1Q A;  3EEQ A;  4FJH A;  5AFU H;  4H5W A;  1C0T A;  1VQP N;  3LZJ A;  1Q9Y A;  1V4T A;  4EZ6 A;  3BUZ B;  4M63 C;  5JMV A;  1ZC6 A;  3QBW A;  5A2Q O;  2I5J A;  3T3F A;  5AQS A;  4I7F A;  1VQ7 N;  1CXQ A;  4F9O A;  3DXK A;  4PL7 A;  2Q31 A;  4IOX A;  1HNX K;  4DSK A;  2P9S B;  3P38 A;  1BCM A;  3HTV A;  3QES A;  1RT4 A;  3R3L A;  2DFE A;  4W5T A;  1KVC A;  2IVP A;  1U04 A;  5I9E B;  4B8C A;  1J9A A;  1NJ8 A;  4C1N I;  3E01 A;  4FXD A;  4CJ4 A;  4A2B A;  2HVH A;  1NGJ A;  4FLZ A;  4PQU A;  4E1J A;  4DCH A;  3TTC A;  4H0O A;  3V1R A;  5J2Q A;  4B1Z A;  3DAW A;  4A57 A;  2X6S A;  2X6N A;  3AAR A;  5AQG A;  3IRX A;  4KH4 A;  3SQ2 A;  1RDU A;  3LAN A;  4B3O A;  4DQI A;  3AJE A;  1RBS A;  4KHQ A;  3RMB A;  3HOS A;  3VQ7 A;  3BF1 A;  4BRD A;  4DU1 A;  1Q82 O;  2JLE A;  4B3R K;  2OZS A;  1RFQ A;  3Q7C A;  1YT3 A;  3NH0 A;  4KHN A;  3V9Z A;  1L3V A;  4IOA L;  4NYF A;  2GUP A;  4DSE A;  3D45 A;  2OCE A;  3V4I A;  3HK2 A;  2XHB A;  1NK4 A;  3D0P A;  4EZ9 A;  3CM6 A;  3CPE A;  3AA3 A;  3CJB A;  3QEP A;  3D2F A;  1K6Y A;  1XMO K;  1KXP A;  1IKV A;  3DOK A;  3CCR N;  3C7N A;  1OH5 A;  4CHO A;  5AQR A;  4AM7 A;  2Q3S A;  2HHS A;  1GOA A;  1DLO A;  4K25 A;  2QXL A;  5AQM A;  4KHW A;  1X9W A;  3HVR A;  4RG8 A;  2P9N B;  3TWH A;  1PVY A;  3ENH A;  3EZW A;  2GWK A;  3WEE B;  3L0Q A;  1N5Y A;  5BPN A;  2VGN A;  2OPQ A;  4F2R A;  4F8R A;  5FDL A;  3CER A;  4NCX A;  1TKX A;  3JYT A;  1OVY A;  5AQT A;  1K49 A;  2OAN A;  1RNH A;  1ATR A;  5BRH A;  4RW4 A;  4OJR A;  4JD2 B;  4B08 A;  4CGI A;  4YDU C;  4JK8 A;  3QET A;  2F8S A;  1WSI A;  3ZIH A;  2E88 A;  3WQU A;  1TYQ A;  1K73 O;  4BR2 A;  4N5S A;  1ITG A;  3DRS A;  1G57 A;  3NF6 A;  1VQL N;  1VSE A;  4BQZ A;  3J7A P;  4CHZ A;  3VOV A;  3SQ1 A;  3O9U A;  3O9Q A;  1ZBH A;  2PFU A;  4CEA A;  3T1Y K;  1VM0 A;  4ILG B;  4RW6 A;  3R6M A;  1I3A A;  3MDQ A;  2EHG A;  4B8A B;  3C65 A;  4FJI A;  3DLH A;  3V1O A;  2DTU A;  2E5L K;  4CZL A;  4CGH A;  1I39 A;  3H1Q A;  3QML A;  1JXE A;  1P90 A;  4DF4 A;  3KLF A;  3H3O B;  3NE6 A;  4E1B A;  1RGI A;  1TAQ A;  5C2F A;  2NUB A; 
#chains in the Genus database with same CATH homology
 2PAV A;  5AQW A;  3VTH A;  1K8K A;  1M1K O;  1NGB A;  3U8X A;  4CI6 A;  3AAP A;  1YHQ N;  2FSN A;  1NM1 A;  5GIP A;  4NO7 A;  3CXC M;  5AQK A;  3T7Z A;  1NGC A;  4CBU A;  2HMP A;  1JCG A;  5E84 A;  5ELZ A;  3A0I X;  1YJ9 N;  3UKU B;  4JK9 A;  4IFE A;  3A5M C;  4WFN L;  3VEW A;  4H0V B;  1K8A O;  1NLV A;  3TSU A;  4A59 A;  2NRH A;  4IXC A;  4BG8 A;  5AQU A;  5C12 A;  2V7Z A;  3CCV N;  2HBJ A;  4CBX A;  2QA4 N;  3PLA A;  5M1Q A;  1K4O A;  4B1X B;  4CD3 A;  1JCF A;  3SAF A;  2UYT A;  1HKB A;  2ZWH A;  3E9L A;  4DKW A;  3CPW M;  4XEI A;  1SQK A;  4EHT A;  5M1N A;  2QWM A;  4JHD A;  3RSE A;  3SMP A;  3VEV A;  1TYQ B;  1WOQ A;  4BRH A;  3CC2 N;  5AQN A;  1NGI A;  4OPH A;  5BRE A;  4Z94 A;  3HZ6 A;  4BC4 A;  5BRD A;  3ZII A;  4BC2 A;  1CZA N;  1SAZ A;  4NZT M;  1EO1 A;  3KWI A;  5JLF A;  4FVU A;  3O8M A;  4OO1 J;  5AQX A;  3F9M A;  3FR0 A;  4WYB A;  2YI1 A;  2GEM A;  3CJ9 A;  3OBW A;  1Q18 A;  2FF6 A;  4YOW A;  5AZI A;  5KQD A;  3SJH A;  4IEE A;  4CZF A;  1G58 A;  5E26 A;  5AQY A;  1TUU A;  5DM6 L;  3O08 A;  3GE1 A;  1KAZ A;  3H45 C;  3HI0 A;  1GLL O;  1BOT O;  4HWI A;  4ILH A;  1ESV A;  1NWK A;  2Q0U A;  3QDK A;  4GNI A;  4JKG A;  4K41 A;  2HBL A;  4MDA A;  4WQ4 C;  2V51 B;  5BN9 A;  2H3G X;  3CJC A;  4R79 A;  2D1K A;  3RVC A;  3ZEU A;  1Q86 O;  2QWN A;  1BUP A;  3TSQ A;  2P9S A;  3KHY A;  3LS6 A;  4EFH A;  1HX1 A;  4CZE A;  5AQQ A;  3I33 A;  2P9I A;  3MGZ A;  3GL1 A;  3CQY A;  2NNW A;  3ENO A;  3U4L A;  3I56 N;  1YXQ A;  1D4X A;  5AQH A;  1Q7Y O;  5F2R A;  4GY2 B;  2RIS A;  1KAY A;  4BRL A;  4NB4 A;  2W41 A;  2A41 A;  3R9P A;  1BO5 O;  2HBK A;  4BRA A;  4LC9 B;  1TKS A;  5AQZ A;  4K42 A;  2QWR A;  3B8A X;  2QI2 A;  3VMF B;  3D2E A;  1JCE A;  4MLH A;  4BY9 C;  2J4R A;  3FZL A;  3AAQ A;  4BRG A;  5H1S Q;  2E2O A;  1MWK A;  1T3V A;  2HST A;  1T6C A;  3UKR A;  3MN7 A;  3LDO A;  4PKI A;  2YJE A;  4IOC L;  3ZX0 A;  3Q7B A;  1S72 N;  3G71 N;  4B9Q A;  5F0X A;  3UE5 A;  3SK3 A;  3GG4 A;  2Q36 A;  3CME N;  5CE3 A;  4YDU A;  1NGH A;  3F5T A;  3MX5 A;  4A62 A;  4ISF A;  3CJ1 A;  4JAX A;  2Q1N A;  3RSE B;  3WT0 A;  3H46 O;  4GV9 A;  1BU6 O;  4P6D A;  4NLB A;  4CD1 A;  2NRT A;  2NRR A;  1MA9 B;  4IO9 L;  1E4F T;  3PIO L;  2KLA A;  4JKF A;  5LJV A;  2CH6 A;  3ID6 A;  4ISG A;  3KVG A;  5JLH A;  3N4Q A;  1JJ2 M;  3W0L A;  3EN9 A;  3WQT A;  3A5L C;  3A8Y A;  4WQ5 C;  5LY3 A;  1IJJ A;  5DM7 L;  4JKB A;  1Y64 A;  2ITM A;  1KD1 O;  3EKU A;  2RHK A;  3KK7 A;  4FWK A;  5F1X A;  3SAG A;  3E1Y A;  3KZB A;  1GLJ O;  1NGF A;  1XUP O;  3L6Q A;  3KWG A;  4O8U A;  3TU5 A;  3G4S N;  3LRJ A;  4BRN A;  3K9K A;  4QS7 A;  4FO0 A;  3P04 A;  4JK7 A;  4C23 A;  3JXU A;  3C7N B;  4OPA A;  1M90 O;  2P9U A;  4NZR M;  3W3D A;  1N8R O;  4FFJ A;  3VTI A;  1K4I A;  1BDG A;  3BF3 A;  3H3N O;  3VGL A;  3FZK A;  5KQ8 A;  3M6G A;  4JKG B;  1IEZ A;  5TKW A;  4FWO A;  3C6H A;  4BRI A;  4BQL A;  2ZJQ L;  4P8J A;  5JIC A;  4FPB A;  1T44 A;  2E2P A;  3CCE N;  4MLE A;  3ENB A;  1YVN A;  2I7N A;  3C0B A;  3C6A A;  4A5A A;  5GAD P;  4RTF D;  4BC5 A;  1ILY A;  5AZJ A;  2PBD A;  1BA0 A;  4B1W B;  2P9N A;  4EO0 A;  2P9I B;  3WXL A;  2NZT A;  3GBT A;  4FWR A;  4B1U B;  1SS6 A;  1VQ8 N;  3IFR A;  2FLO A;  3VF6 A;  3MN5 A;  4JKD A;  3FFK B;  4WFA L;  1VQO N;  2BH1 A;  2EQA A;  4P6P A;  2A6A A;  5EOY A;  1HJO A;  4BGA A;  3E9P A;  1LCU A;  1VQM N;  3I8B A;  3CCQ N;  5GIN A;  1MDU B;  3M1F A;  3AY9 A;  4BC3 A;  1DKG D;  4CZM A;  1ZXO A;  1GLB G;  3VES A;  3EKS A;  3FZH A;  3O1W A;  4JNE A;  2YHX A;  1NJI O;  4O8K A;  5C15 A;  1E4G T;  3L7V A;  3VGK A;  2P9L A;  3NVM A;  4UY8 O;  2ASM A;  3LM9 A;  4KBO A;  2ZF5 O;  3UKR B;  3DJC A;  3TSP A;  1HLU A;  3ULE A;  5LJW A;  5M1K A;  3DXM A;  4BR4 A;  3LL3 A;  3CQX A;  2KHO A;  2QEX N;  3QB0 A;  5FPN A;  4FCX A;  2P9K A;  3E9O A;  2NLX A;  2ASP A;  2E1Y A;  3QFP A;  1VQK N;  1TUY A;  3MIO A;  4PL8 A;  2OTJ N;  4FBQ A;  1GLD G;  2F9T A;  5FPD A;  5GAE P;  5HL7 L;  1LOT B;  3EL2 A;  1GLA G;  5KPT A;  1G99 A;  1XQS C;  3CJ7 A;  1HPM A;  5TKY A;  4BRC A;  3IMX A;  1K4P A;  4BR5 A;  4FBW A;  3IDH A;  4G9Z A;  2V52 B;  3IUC A;  3TPQ A;  4FWS A;  2QTD A;  3A5O C;  1VQ6 N;  3O5B A;  3ZX2 A;  5EX5 A;  3O9R A;  3D7E O;  3I55 N;  4IZ9 A;  2GWJ A;  4QS8 A;  4DHY A;  3L4I A;  5GAG P;  3FZM A;  3CJA A;  2MX1 A;  4YOV A;  4AF1 A;  1NBW A;  3LDL A;  4FPA A;  4MO5 A;  5C10 A;  2NRX A;  4O5F A;  2YHY A;  4PHT X;  1DEJ A;  3MX2 A;  3M5R A;  2OTL N;  4KH6 A;  4FWM A;  3CET A;  3FGU A;  4PKG A;  2D0O A;  2Q2R A;  2Q97 A;  2VYP A;  2IVN A;  3P39 A;  3R1X A;  5BRF A;  3SBG A;  2FF3 B;  2P9U B;  3F2K A;  1K8K B;  4EHU A;  1J6Z A;  4MO4 A;  1S22 A;  4FOI A;  4BVP A;  4JKH A;  1QZ5 A;  2LN3 A;  1NGA A;  3MWT A;  3LM2 A;  2QM1 A;  5M1P A;  4CZH A;  3HRG A;  4WQ4 A;  3SBT A;  3HBT A;  3ZIE A;  4CZG A;  5BPM A;  4YOR A;  3TTD A;  1BWF O;  1OKJ A;  3DLL L;  5AFU A;  3HOT A;  2HF3 A;  4JN4 A;  5KPR A;  2GTD A;  2VGM A;  4GV3 A;  2ZGY A;  3LDQ A;  4FOE A;  3UKU A;  2AP1 A;  2GX9 A;  4H0X B;  4B1V A;  1QQM A;  4YOY A;  1YIT N;  4P6C A;  3VEZ A;  4FWP A;  3TTF A;  2NRZ A;  3VPZ A;  4C1N K;  4CBW A;  2QWQ A;  1VQ4 N;  1VQ5 N;  3ZET A;  3HM8 A;  4YOX A;  3K9J A;  3EO3 A;  4AM6 A;  2WC9 A;  4IJN A;  1HKG A;  1ZBS A;  2HOE A;  3MK6 A;  4JKE A;  4KH5 A;  3SLC A;  3CC7 N;  3CF5 L;  3M3Z A;  4JHD B;  4WF9 L;  2YCH A;  3GOI A;  3LDP A;  5AQF A;  2VWB A;  1H1V A;  5AR0 A;  2BTF A;  3AGK A;  4BRP A;  4M7Y A;  2NRV A;  5AQJ A;  3VER A;  1R59 O;  2P9L B;  4A5B A;  4Y0W A;  1WUA A;  2QWO A;  2YJF A;  3ULE B;  1YAG A;  1Z05 A;  3DXM B;  4CZI A;  4H5V A;  5CR4 A;  3BP8 A;  4CZK A;  5B8H A;  3WXK A;  2A3Z A;  2E2Q A;  4GV6 A;  2P9K B;  3OA9 A;  4FWN A;  5AZI B;  5M1O A;  5GAH P;  4IEI A;  2AA4 A;  4HVZ A;  4RWT A;  3G6E N;  2P9P A;  1P8Z A;  4BRQ A;  3U9Z A;  4M7X A;  4BR0 A;  5AFU H;  2YX6 A;  1YI2 N;  2CGL A;  4H5W A;  1GLC G;  1VQP N;  1U6Z A;  4XH5 A;  3ZX3 A;  4FWL A;  3LDN A;  3MWP A;  3PIP L;  1V4T A;  1U2V A;  1VAZ A;  4H0Y B;  1C0F A;  2EWS A;  3BUZ B;  3O80 A;  4M63 C;  5JMV A;  1EQY A;  5GIO A;  2E8A A;  1ZC6 A;  3QBW A;  4I6M A;  1QQN A;  3MN9 A;  4H0T B;  5MLC Q;  5AQS A;  1QZ6 A;  3L4Q A;  2IVO A;  2WFB A;  4WQ5 A;  3VEN A;  1VQ7 N;  4F9O A;  1SNN A;  1K7J A;  5KPZ A;  3DXK A;  3ZEU B;  4PL7 A;  2Q31 A;  4IOX A;  4L3Q A;  2JWK A;  3H07 A;  2P9S B;  3P38 A;  1W97 L;  3P4I A;  3HTV A;  4I14 A;  4HTL A;  3R3L A;  4BRM A;  3CC4 N;  4YOU A;  3N4P A;  5BN8 A;  4IDH A;  3MCP A;  4IWV A;  1X3N A;  2F7T A;  3WEE A;  3CIP A;  2HF4 A;  3R8E A;  2IVP A;  4WCE L;  5I9E B;  3ZYY X;  5AQI A;  3H1V X;  4C1N I;  1S3X A;  4ILJ A;  1QQO A;  1X3M A;  4IJA A;  5C2D A;  5CHI A;  1RDW X;  4H5T A;  3CCU N;  4A2B A;  2ASO A;  4XH1 A;  2CGK A;  2Q0R A;  2QWP A;  3O9T A;  1SZ2 A;  4BGB A;  1NGJ A;  2DPN A;  5EVZ A;  1YUW A;  3D2E B;  1DT9 A;  4ISE A;  3OBY A;  4JD2 A;  3VF4 A;  4E1J A;  3FZF A;  4DCH A;  3TTC A;  4H0O A;  5AQO A;  1C0G A;  3CI5 A;  2W40 A;  5HOO A;  1QHA A;  3ZET B;  4B1Z A;  3DAW A;  4A57 A;  3NMU A;  4DB3 A;  5BPL A;  1QVF M;  3VET A;  3WXJ A;  3AAR A;  1K9M O;  5AQG A;  3NVK A;  4KH4 A;  5ADX A;  1RDU A;  3OHR A;  3AJE A;  2JWL A;  4H5R A;  1NGE A;  5AQV A;  3H6E A;  3HOS A;  2F9W A;  3BF1 A;  4BRD A;  3AGR A;  1Q82 O;  1YF5 L;  3J7Z O;  1ATN A;  3UB5 A;  5C0Y A;  2VCP A;  3DWL A;  1RFQ A;  3Q7C A;  1JCU A;  3ATV A;  4PKH A;  5EXW A;  1BG3 A;  2KKZ A;  3VEY A;  3SMS A;  4WFB L;  4IOA L;  3LQU A;  2BUP A;  2GUP A;  2GEL A;  5AQL A;  1O13 A;  3EE8 A;  3VEO A;  5FPE A;  1HKC A;  2P9P B;  1GLE G;  3ID8 A;  4JKC A;  4P77 A;  2YHW A;  4H0P A;  1KC8 O;  2QWL A;  4U67 L;  3CPE A;  4IO8 A;  3CJB A;  1U2V B;  3J8A A;  4U7B A;  3D2F A;  4YOT A;  4MDB A;  1KXP A;  1MWM A;  3MCA B;  4I6M B;  3IKM A;  3ATU A;  3QFU A;  1QVG M;  4FBK A;  2NRW A;  3CCR N;  3C7N A;  1Z6R A;  2CGJ A;  3QBX A;  1NMD A;  3CHW A;  5AQR A;  4FL9 A;  4BG9 A;  3DXK B;  5AQP A;  4AM7 A;  3GDQ A;  2WUS A;  5JVG L;  3O4W A;  4DQ8 A;  5JVH L;  2E1Z A;  4YKE A;  5ADX H;  3VGM A;  4A61 A;  3FLC O;  1K4L A;  2IIR A;  1T6D A;  4BRE A;  2ZJR L;  2RE2 A;  2CH5 A;  2QXL A;  4K25 A;  5AQM A;  1VQ9 N;  1HRU A;  5AZJ B;  2FSJ A;  3FE1 A;  2P9N B;  4BRK A;  3CCL N;  3P31 A;  4QS9 A;  4BR9 A;  2QW9 A;  3O6W A;  1PVY A;  4K43 A;  3ENH A;  4J8F A;  3EZW A;  2GWK A;  3WEE B;  3L0Q A;  3WXM B;  3CCJ N;  1IG8 A;  2VGN A;  4CJ7 A;  5BPN A;  2WBN A;  1KK9 A;  1NGD A;  4A2A A;  3OW2 M;  4BR7 A;  2ZGZ A;  4BRF A;  2D4W A;  3CER A;  3QIC A;  1OVY A;  5AQT A;  1K49 A;  2OAN A;  4H5N A;  1KAX A;  3T1I A;  1ATR A;  5BRH A;  1GLF O;  1XC3 A;  3EE9 A;  4FWQ A;  4B1Y B;  4JEP A;  4JD2 B;  4GVE A;  1YIJ N;  3O1B A;  4YDU C;  4JK8 A;  3O9S A;  4XH4 A;  1V4S A;  3D6R A;  3MK5 A;  3ZIH A;  2A5X A;  2E88 A;  3VEX A;  2E20 A;  3WQU A;  1KQS M;  1TYQ A;  1W2B M;  1ATS A;  4BR2 A;  1K73 O;  2ZJP L;  3MMV A;  2A40 A;  1G57 A;  1VQL N;  4NLC A;  5EY4 A;  4EIA A;  4BQZ A;  3MN6 A;  3S41 A;  4BVO A;  5BR9 A;  2V7Y A;  3JS6 A;  1XEZ A;  3VOV A;  2P9B A;  3BEX A;  3HSC A;  1TKU A;  5M1F A;  3O9U A;  2FSK A;  2I7P A;  4JKA A;  1DGK N;  4H03 B;  3O9Q A;  2D0P A;  2PFU A;  3CMA N;  3CD6 N;  4ILG B;  2A42 A;  3MDQ A;  3R6M A;  3T69 A;  3ZIG A;  3C65 A;  2E2N A;  3WXI A;  4BRO A;  1BA1 A;  3VF2 A;  1VQN N;  4RCH A;  3SAH A;  4FSV A;  2RIU A;  4CZL A;  1PVW A;  3WUH A;  3CCM N;  1YJN N;  3U9D A;  3G25 A;  4CZJ A;  1Q81 O;  2FXU A;  3H1Q A;  3QML A;  1P90 A;  3CCS N;  3D2F B;  1NGG A;  3H3O B;  4EAH D;  1YJW N;  3A5N C;  5FPM A;  4E1B A;  4P8E A;  1RGI A;  2HBM A;  1HUX A;  5C2F A;  1X9J A;  3E66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...