3TSPA

Crystal structure of e. coli hypf
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
646
structure length
646
Chain Sequence
b'QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
molecule tags Transferase
source organism Escherichia coli
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
total genus 212
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tspA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tspA01
3VF4A 3TTDA 3VEWA 3VETA 3TTCA 3VEOA 3TTFA 3VESA 3VEZA 3VERA 3TSQA 3VTHA 3VENA 3TSPA 3VF2A 3TSUA 3VEXA 3VTIA
chains in the Genus database with same CATH superfamily
4C8OA 1VQ7N 1ZBHA 2OZMA 1HRUA 3DLRA 5C2FA 1G15A 1RDDA 3OYEA 2CGKA 4YDUA 4CFDA 4DQSA 4F2SA 1NOYA 1KXPA 2ASOA 5M1PA 3QKBA 1BCOA 4M3WA 5KPTA 3H1VX 1MA9B 4DUZK 2D5RA 1EETA 3O4NA 5E26A 4CJ3A 4HUFA 3F9KA 3VPZA 3CMEN 2HHSA 5AQYA 4WFAL 3IFRA 3OBYA 2HNYA 3D6RA 4DFMA 2ZJRL 1OVQA 5MLCQ 4YFUA 4DSEA 1YHQN 3IG1A 1IBKK 4JS5A 4LF4K 3KK1A 3MXIA 1BU6O 4DHYA 1YI2N 1HJOA 4NXNK 4OGEA 4CJ4A 5C12A 1SKRA 4ILGB 3KK7A 2DPNA 1MDUB 3PSIA 1OVYA 3SNNA 3NF6A 4GKKK 1JCGA 4PKHA 1H0YA 3CC2N 4YOXA 3HL8A 4CZFA 1WAFA 1YJNN 1BWFO 2X74A 5LJWA 3ZX0A 1Z05A 5AQIA 4LD0A 1VQ8N 4H4OA 4FW1A 3OYAA 1MWKA 5AQLA 1CZ9A 3C6TA 4GVMA 1NBWA 5KGWA 4W5QA 4DFPA 4ZTJA 1GLFO 3ZCMA 4PQUA 4CK3A 1NJYA 4CJEA 2H3GX 4P6PA 4LF7K 3VQ8A 2V7YA 1QSYA 1HNWK 4AHSA 2WC9A 5AQUA 3M8SA 4CHNA 4FWRA 1JLBA 3THYA 2QTDA 3T1YK 4ZTFA 2CH5A 2F4VK 3W3DA 4CBUA 3VA3A 3GBTA 2JGUA 4KHYA 1VQON 4A61A 5KQDA 3SAFA 5FPEA 3L4QA 5AQXA 1RT2A 2E20A 4BRQA 4DUYK 3E1YA 4KBOA 4Z4CA 3THWA 4N76A 3VQ6A 1Y2IA 3U8XA 3HPOA 3KZBA 2KFZA 3SUQA 3VQCA 5BR9A 1VSMA 4HHTA 4A2AA 1S1TA 3ZEUB 3ATUA 1KVAA 3CCLN 1YTUA 4PY5A 4MDAA 3M8PA 2O8BB 3VF6A 1VQ5N 3KIOA 1I39A 3CG7A 2VG6A 3JSMA 5BPLA 4RW8A 3K2PA 3H3OB 3VTIA 5HRNA 1NGAA 4FPAA 3MDQA 4RTFD 3QESA 3HSTB 3HTVA 3RMBA 4BROA 2D4WA 1VSJA 4CF1A 3CM6A 3A5NC 1RDBA 1SNNA 2VQFK 2P9PA 2JLEA 3MMVA 3O9QA 1E4GT 2FSKA 1B9FA 4GMJB 1S9GA 2GELA 2F9WA 2X6NA 5F0XA 5HRRA 5AFUA 5EU7A 2YHXA 4YOWA 1K6YA 4BRDA 4ID5A 1JLCA 5HL7L 3C7NA 3V9XA 4FWMA 3J7YP 3P4IA 4CFAA 2E4LA 3THXA 4A5AA 1HPZA 3TABA 3QMLA 3CFRA 3AVBA 3OYBA 4QS7A 2V52B 5FRNA 2O4IA 1S1WA 1LWFA 4XH4A 4FLVA 2KW4A 1NJZA 1FXXA 1SS6A 2QWLA 4EHUA 4FCYA 3VEZA 4Y0WA 4FK0A 4OX9K 2ETJA 5CYQA 4WFNL 3O80A 2CH6A 4MQ3A 2O8FB 5FPDA 2PYLA 3MN7A 1JKHA 2P9UB 1RNHA 5AQFA 4FLZA 5HROA 4BE2A 4JKHA 4M3XA 2HNDA 3NMUA 4CE9A 4ISGA 1K8KA 4BR7A 1UDVA 1RTJA 4K8XA 1EP4A 5FDLA 2QWQA 3A5OC 3ZYYX 1SKSA 1W9HA 1RDUA 2YX6A 4FWLA 4NLCA 3PO5A 2D1KA 4DR7K 2RIUA 2HF4A 3AA4A 1JLAA 3SAHA 4KRFA 2VWJA 2QWNA 3WQUA 1VQ4N 1J6ZA 3QBXA 1T6DA 4Y1DA 2YNIA 2HOEA 4B9VA 1S22A 4LF8K 5GIPA 3HJFA 3PV8A 1BIZA 5M1QA 4MLEA 1NGJA 4E89A 1U48A 2FBYA 4QCLA 4CJ5A 1U2VB 3ZIGA 3G4SN 3BP8A 2A42A 4BG9A 4A2BA 3AAQA 2BKYX 4JV5K 2YNGA 4J2BA 4BRKA 2FBVA 1M90O 3T1AA 5HLFA 1REVA 4BG8A 3G25A 2F96A 2E2PA 2I7PA 4JD2A 3HYFA 4W5TA 4B1VA 3A5MC 1KRPA 4B1ZA 4EFHA 3MK6A 5KQ8A 2D0OA 2XY8A 4ILHA 2WFBA 2IC3A 4DF4A 1JLQA 2E88A 1UAXA 4JI4K 4JI8K 2RE2A 4JI5K 1S3XA 4JI0K 4WQ4A 3EN9A 1RDCA 2QWMA 1RT3A 4IG0A 2XY6A 4KHWA 4FPBA 2WONA 4I6MB 2O8CB 1XUPO 4DTSA 4OLFA 3DMJA 4M7XA 1TKUA 3K5LA 2R7YA 3AVJA 1C0GA 4IDHA 3DOKA 3E66A 4JNEA 1RCHA 4DG1A 1S8EA 4WFBL 1VQ9N 2VGNA 2E5LK 4M3TA 1ATSA 1A5XA 4HD0A 1KQSM 4YDUC 4AM6A 1L3VA 1RILA 1C1BA 3OBWA 4K43A 3KLFA 3JS6A 1QHTA 3SMPA 4DSFA 4CHYA 2Q36A 3HVTA 4DFKA 3LRJA 4IOCL 4Z0UA 3I0SA 1KTQA 3RSEA 2KZMA 1TAUA 3M6GA 3TANA 2Q97A 3ENHA 4CZJA 2HHWA 4FOEA 2IVNA 4CZKA 1TUUA 1TKZA 1CZAN 2HB5A 4CGFA 1VHXA 3KLEA 3KD1E 4NCXA 1SQKA 3LANA 3CCMN 1RGIA 5AZJA 1M1KO 4PKIA 2ZGYA 1ASVA 1OH7A 1HKBA 4FFJA 3Q7BA 2UUCK 2W41A 2B5JA 1XEZA 3EO3A 3AA3A 1LW2A 2PYJA 2AA4A 3EYZA 2NRZA 4A5BA 4GKJK 1NKBA 3I55N 3K0SA 1TIGA 2ASMA 1Y97A 2GTCA 3T1IA 3HM8A 4BRLA 4P8EA 4EZ6A 4BACA 3ZT3A 3OJSA 4KI6A 1NJ2A 1LOTB 3PSFA 3O3GA 1YAGA 1DTTA 3THYB 1HX1A 5AQQA 3DYAA 2D0CA 1HYVA 3TR8A 3L6QA 2YKMA 4YOYA 4BR4A 3BZKA 3WBMA 4PUOA 2EHGA 3QICA 2GWKA 4DF8A 3SUPA 4FLUA 1T8EA 1DT9A 4OKKA 3THWB 3WNHA 1ITGA 5JVGL 3KK3A 1XMOK 3VQ9A 3TAQA 3SBTA 3THVA 1TK0A 4C8MA 4L3QA 4DR3K 3IDHA 5CZ1A 5FRMA 1BG3A 4P6DA 4J2DA 3AVGA 3F2KA 2HSTA 4K86A 3K58A 2IAJA 5B8HA 4JN4A 1FW6A 4ELVA 1TKXA 3CCUN 2G8IA 1Y64A 3FE1A 2HMPA 2VWBA 3LL3A 4EIAA 1KAXA 3K5OA 3CCQN 1DLOA 5KI6A 3QBWA 1IKYA 1GLDG 4O5BA 4B9QA 2XY5A 4Z4IA 4DQRA 3O9SA 2LN3A 3HXMA 3O9TA 5I9EB 3MCPA 5AFUH 3G6EN 2Q2RA 1JCUA 4BRAA 4E0DA 1QZ5A 3AVNA 3EZWA 3ZT1A 3TPQA 3QO9A 4CECA 2QEXN 1SUQA 2RN2A 2IVPA 1HNIA 1JCFA 1EQYA 3H45C 3WUHA 2HVHA 2QXFA 4DTMA 1L3SA 2P51A 5DK5A 1NGIA 3CCRN 4P8JA 3V9UA 3OVNA 3TTCA 4Z4FA 3WXLA 4GVEA 3KJVA 2QXLA 1K49A 4P77A 1BI4A 3SK3A 3OS1A 1LWEA 3VQEA 4LF9K 1HNZK 3E9LA 5CY4A 4BC4A 3B8AX 5E41A 3P38A 4FWPA 4E19A 5I3UA 3VQBA 1NK9A 3QIOA 3MK5A 5C24A 2AP1A 2W6LA 3VOVA 3BGRA 3BF1A 4BWMA 4CJ7A 3ZETB 3U9ZA 4CGGA 1V4SA 2HMIA 1BO5O 4DSLA 4JKAA 3MAQA 1YT3A 5BRFA 3LDSA 5BN9A 5BR8K 4CHQA 4JK7A 3QIPA 3VMFB 4UY8O 2QKBA 1KVBA 3OY9A 1X3NA 1IO2A 1R59O 3AO4A 4DR1K 1TGOA 1XQSC 3ZX2A 4BGBA 4DTNA 1RTIA 3SMSA 1KFDA 3LALA 1FKPA 4DV3K 3U3GA 2IOCA 2GV9A 4FOIA 1U2VA 3DAWA 3O8MA 2XRIA 3FLCO 2E2NA 4IFYA 5F1XA 3CF5L 3QEPA 2O8EA 3H1QA 2OTLN 3AGKA 3DRSA 3FFKB 3L3VA 4FJ7A 1A5VA 3ULEA 2YHBA 3OYHA 2CRQA 3K9KA 4IFEA 2A5XA 1W2BM 5HP1A 4E7LA 2DFFA 5AR0A 1Q7YO 3NDKA 5HOOA 3D7EO 1RBRA 1WUAA 4JI6K 3D45A 4FYDA 1QQOA 4FZZA 3ZIIA 3PIOL 3V4IA 4HCBA 2F7TA 3WT0A 2GTDA 2HHUA 3SQ2A 3J81O 4YY3K 4FM2A 3DLGA 1S1UA 2PBDA 2FC0A 2O8DA 1YJ9N 3DJCA 1UA1A 4DS4A 4CJKA 1G58A 4IJAA 4JI7K 2BH1A 5A2QO 4FZXC 3WEEB 4KH5A 3O9RA 1KLNA 3S9HA 3M8RA 1J5EK 2Z1IA 1JXBA 5AQWA 5C15A 1IV0A 3OYDA 4KPYA 4F3TA 1K73O 2ZWHA 3J80O 2ZM6K 2HHQA 5JS2A 3EZ5A 3NH2A 4DQPA 3DOLA 3OYKA 1JLGA 1OH5A 1OH6A 3OYFA 3VESA 5KRTA 3CIPA 1BA1A 4GNIA 3A0IX 3FZMA 4E1JA 4C1NK 4E3SA 1KLMA 5ELZA 4F9OA 3QEWA 3BF3A 4CFCA 1NFHA 5C42A 4ICLA 1NOZA 2WTUA 2P9LA 1DKGD 4V19S 2XY7A 3ISNC 4OPKA 3L2UA 5BREA 3CYMA 4OKJA 4X62K 1LAWA 2HBJA 3CJ7A 4RW9A 3M1FA 3DRPA 1NJ5A 1H1VA 1P90A 3ZSOA 2QI2A 3TU5A 5KTQA 4ELTA 1VK0A 2QW9A 1PVYA 1Q81O 2QM1A 4YOVA 4CHZA 4JI2K 3BZCA 4OPHA 2ZF5O 3AAPA 1TKTA 3V1OA 1X1PA 3D2EA 2E2QA 2RPIA 3P83D 1NJ6A 3SQ1A 3H3NO 4B9SA 2FSNA 4KH6A 1S9EA 5C10A 4B8AB 3VQPA 3LPUA 3UKUB 2RISA 2KFNA 2DY4A 3LQUA 1RQ8A 2ITGA 1E3MA 5J2MA 3VENA 2XHBA 5CR4A 1KSPA 2P9SB 3S3MA 3G0ZA 3IS9A 1EWQA 1T44A 3S41A 1H4QA 1C1CA 1ZBUA 3HPHA 5D3GA 3A2FA 2YHYA 3VQ7A 3N4PA 4K8ZA 4OLAA 3DSCA 4PA1A 3V9ZA 3HO1A 1WNSA 2HBKA 2YJFA 4OPAA 4AHCA 3ZSWA 3PY8A 5FPNA 1DEJA 2OPRA 1R0AA 3ZSYA 1N34K 4B9LA 3EE9A 3WXMB 1BUPA 1QQMA 3LVKB 5CZ2A 1NJWA 1SZ2A 2QA4N 4C8KA 4R5PA 4CEOA 4LY7A 3CD6N 3ZSRA 1LAVA 4FWQA 2IFEA 1HLUA 3FGUA 4CVNE 3TAGA 4WF9L 1BDGA 3TAEA 1ZBFA 1QQNA 1ILYA 2VG7A 2WOMA 1GLLO 4IOXA 3VN5A 4H5TA 4F2RA 1IKVA 3CCJN 1BI4B 4IKFA 4BC5A 1X9MA 2V7ZA 1IG8A 4KTWA 2VG5A 3RTVA 1BQNA 1QSSA 5J1EA 4C8LA 1X3MA 2HW3A 5AQHA 3V81A 1H4SA 2P9IA 1K4IA 1HRHA 4AHTA 2XO7A 3QFUA 3R6MA 4PL8A 1CLQA 2OYQA 2A1SA 1KFSA 5TKWA 3ZT4A 4BR2A 4C1NI 4DLEA 4KKOA 4G1QA 1ASWA 1Z6RA 3QEXA 1OH8A 2GWJA 3KKSA 4WE1A 3QEVA 4BRIA 4RW6A 4NYFA 4AILC 1NKEA 4CJWA 5LJVA 5IWAK 3AV9A 2HHTA 3U9DA 3T7ZA 4JAXA 4EO0A 4BQZA 1RT4A 3LS6A 4GV3A 3WNGA 4A62A 3RRHA 2FBTA 3CCVN 1VSFA 1JO0A 4KB0A 2IDOA 1KCFA 2HHHK 1C0FA 1SAZA 4C8NA 4NZTM 4NLBA 3KLIA 1YTAA 4NB4A 5JLFA 3AVCA 1NGEA 2NZTA 4K87A 3S3OA 2UXBK 3KHYA 4DTOA 1HMVA 3QNNA 3E01A 1EKEA 1W0HA 2NRVA 3EL2A 3ZSXA 3R8EA 4NYNA 3I56N 1UWBA 2LSNA 2Q0UA 3L2RA 2H9UA 2ZQBA 4NO7A 4CGJA 4Q15A 4CJFA 4B3TK 4O4GA 1ZXOA 2A3ZA 2PFUA 4FVUA 4BVOA 3KVGA 4CIEA 3PUFA 4CK1A 2QWOA 4Y1CA 3O4WA 4CGHA 1XMQK 3HP6A 1RDAA 1VRUA 4B9TA 2O8DB 5C25A 1RT5A 4RW4A 1RTDA 3V9SA 3OJUA 4DTRA 1II7A 4KTQA 1Q82O 3NAEA 4CBWA 3QEIA 3NGZA 1B9DA 4B9NA 2DFHA 4JLHA 3MWPA 4KH4A 3J8AA 4JI3K 2D0AA 4PKGA 3MN6A 1XHZA 2EX3A 1WSGA 5AQSA 4IEEA 4JK8A 4JHDA 2QKKA 1HYSA 5FLXO 1D5AA 3A5LC 4H5WA 4FM1A 1GOBA 3D2FB 1VQ6N 2OA8A 3HSCA 5EX5A 1FKOA 1N8RO 1GLEG 4FWNA 2NRWA 4CGIA 1ATNA 2P9LB 4CK2A 2PZSA 1O1WA 5AZIB 1YUWA 1L3UA 4CD3A 4FK4A 3NF7A 1NKCA 2E1YA 4HVCA 3HPGA 4CZMA 5KGXA 1JCEA 2FSJA 4CCHA 1TYQA 5HBMA 4DV4K 1WBBA 4PL7A 4H0XB 3AA5X 3I8DA 1VSDA 3CJ1A 4BE1A 1JLFA 3OS2A 4ILJA 1HKGA 3LP1A 3QNOA 4YNQA 3NFAA 4RG8A 5ADXA 2HF3A 2DFEA 4E1MA 1C0MA 4QAGA 4IJNA 2V51B 4E7IA 2IIRA 1BISA 1BCMA 3SAGA 1RTHA 4H5NA 3VA0A 3AO1A 4FO0A 4WQ5A 3O3FA 3AO3A 4LSLA 4GY2B 3P5JA 4JI1K 3Q7CA 4DTXA 4DSIA 2M71A 1TL1A 2W40A 4DB3A 4JKGB 2A6AA 1S6PA 1NK6A 5C0YA 4IO8A 4NXMK 3QDKA 3KWIA 3L4IA 2PY5A 4PHTX 2W6KA 1NM1A 1WN7A 4GV9A 4HVZA 2OANA 1Z25A 2P1JA 2Y1JA 1F21A 3SJHA 4BRMA 4X65K 4CF8A 4BDZA 1SL0A 4KHUA 3ZT2A 2FBXA 3JYTA 2P9PB 1L3TA 2A2YA 3RMAA 4NCBA 1Q9XA 3ZSVA 4KHQA 4BRCA 3AGRA 4R79A 3LDLA 2CGLA 1NJXA 3MEDA 4LC9B 4OVLA 3AA2A 5GADP 3L2WA 4DR4K 1WSIA 2Z1HA 4BR0A 4WQ5C 3VGMA 2F9TA 3C7NB 1SKWA 4RCHA 3SYZA 5EXWA 2HHVA 1C1AA 4FSVA 1NGFA 3BUZB 5SZTA 4HTUA 2KZZA 4I2QA 5EVZA 1XI1A 2KLAA 4M3YA 2G8WA 4FZYA 5CE3A 4KFBA 1RBVA 4FJMA 4CZHA 1JLEA 1XHXA 1VQKN 2WBNA 1NGGA 1C0UA 4ID1A 4YDQA 4B3SK 2D0PA 2W42A 2Z1GA 1K8KB 2B4JA 3LZIA 3CMAN 4BDPA 3C65A 2QK9A 1O13A 1JL1A 4I14A 4BWJA 3SV3A 3LAMA 3M3ZA 3TWHA 4M3ZA 1Z26A 3DXKA 1RBUA 5IT9O 2YNHA 4BRPA 4FJXA 1YIJN 1T7PA 1NJ1A 1U47A 2FF6A 5JS1A 4JEPA 2ITMA 2GUPA 4FVMA 2HBMA 3EKSA 1QVGM 2VQEK 3HI0A 3U4LA 1K4OA 4ISFA 3WXKA 4DSJA 3ULDA 4E7JA 3W0LA 5F2RA 3DLLL 1Y9XA 4BREA 1VSLA 3NBPA 3MEGA 3O3HA 3OYMA 1ZBSA 2YNFA 4DCHA 4BVPA 1N6QA 3P04A 3UKRB 3ZSZA 4H0PA 4J8FA 3H46O 4MO5A 4CJSA 4Z4EA 4W5OA 4HCCA 5BN8A 4KO0A 3NVKA 4BE0A 3CQXA 2HBLA 1CXUA 5LY3A 3DXMA 4E1NA 2G8KA 5LMUK 3OYIA 1QVFM 2NUBA 3KLGA 3TSUA 4CI6A 1VRTA 1NH9A 4EHTA 4OLBA 4DTUA 2A41A 1RFQA 3AVAA 4CF0A 4I6MA 2O8CA 5AQTA 3CERA 1NK8A 1WAJA 2NRXA 3LM9A 2F8TA 4CJPA 2E6LA 5AQGA 2IVOA 2Q31A 2EK0A 1XNQK 4X64K 3DLHA 5TKYA 3FZHA 2NNWA 3LDQA 3PIPL 3FZKA 4K25A 4LFBK 2P9NA 4FJ9A 2Z1JA 3QB0A 1RBSA 3MWTA 2Q1NA 4B1YB 4CIGA 3RMDA 1QHAA 3V6DA 1TUYA 5JMVA 4GV6A 3MN9A 4H5VA 2BDPA 3QERA 3SQ4A 1DGKN 1JL2A 3TTDA 2G8HA 1VSKA 4H0OA 2YKNA 4N47A 3B6PA 4UQGA 4IZ9A 1C6VA 2A1RA 1RDWX 1Q9YA 3K5NA 2G8VA 3IUCA 4LH4A 4FJKA 4KTZA 4B8CA 4O8KA 5CYMA 2ZJPL 4FJ8A 1TK8A 3E9PA 4JHDB 5AQPA 3CPWM 2E1ZA 2G8FA 5KRSA 3VEOA 4TSXA 4YOUA 3FFIA 4QS8A 1EO1A 3CQYA 1TL3A 3D2FA 3OW2M 4CEBA 3VF2A 1QQCA 3NGIA 3SQ0A 3HVRA 3ENOA 3WXIA 3TAFA 3AO2A 4AF1A 2UUBK 1YXQA 2Y1BA 1TVRA 3ALYA 3O6WA 1TK5A 4IO9L 4E7KA 2Z7CA 3SUOA 5AZIA 3G71N 4DU3A 4ZHRA 4AHUA 3CQ8A 1HKCA 2E8AA 4GW6A 2Q3VA 5DMRA 1WBDA 4AQYK 4DSKA 2UUAK 3I0RA 2UYTA 2ZE2A 1SV5A 1GLCG 2I5JA 4WCEL 3FZLA 1J9AA 2E2OA 3FR0A 1HQUA 3MECA 4G9ZA 5K14A 1UOCA 2NRRA 4CERA 2EQAA 3TI0A 1GLAG 1S1XA 5BRHA 2OPPA 1I3AA 3OS0A 2ZGZA 1VAZA 3UKUA 1T05A 2P9KB 4K0KK 1GLBG 2ATQA 3F73A 3V1QA 1ZBIA 1ZBLA 2BUPA 4CBXA 3MN5A 1IG9A 2L8YA 4K88A 4CEEA 4DQ8A 4DV2K 4IG3A 5J2NA 4FWSA 3RRGA 3R3LA 4CJTA 5GAHP 2VGMA 3QFPA 1NGHA 4M63C 3UIQA 4DV6K 2J4RA 3OYLA 4DKWA 2QWPA 4H5RA 3T1HK 3CHWA 4CEZA 2P5GA 1UA0A 3C6UA 4Q0BA 4B1WB 2BGGA 1BIUA 4IDKA 4H8KA 1BQMA 4HTLA 1YJWN 3TSQA 3NCIA 3OTOK 4H4MA 2BE2A 5LMNK 1CZBA 4O0JA 5M1FA 3MX2A 2FXUA 1NJIO 1NFJA 3WEEA 3MEEA 1A5WA 5M1OA 3EY1A 4JKEA 3MX5A 2G8UA 3AARA 3NH0A 1WLJA 4CJUA 2NRHA 2YHWA 5GAEP 5HRSA 3THXB 1VQNN 3J7AP 1IBLK 1QTMA 1NG9A 3DSDA 3L0QA 3OYCA 3A8YA 3AVFA 3GG4A 3CC4N 2PAVA 3OA9A 3EE8A 2JWKA 3NGYA 4KB1A 4QOZB 3O08A 4FLYA 3PX6A 2IGIA 2O8FA 1HYZA 4FBKA 3IRXA 1JXEA 2A40A 4CIFA 1BL3A 2FLOA 4M41A 3DLBA 1CXQA 2IS3A 3HRGA 4FJ5A 5E84A 2VWKA 1NGBA 3C6AA 4CF2A 3LAKA 1NMNA 3VQAA 4Z94A 1S5JA 1N32K 4Z4GA 4JKCA 4FLTA 1U04A 4CEQA 4CZLA 3G10A 4XIUA 3K59A 4JYAK 3K57A 4DU1A 4DS5A 4TWAA 4O55A 2P9IB 3CC7N 3AVMA 1YVNA 3BEXA 3HBTA 4B08A 3LZJA 4OJRA 2Q3SA 3WXJA 5BRDA 4M42A 1TKSA 4JS4A 4AM7A 3QINA 4MLHA 4H0TB 1WOQA 3ZIEA 4CJRA 2GX9A 1ZYQA 1WSFA 1IEZA 5I42A 1JJ2M 5AQZA 1K9MO 4KI4A 4JKBA 4BRNA 5JICA 3PX4A 3T3FA 2UXDK 3ITHA 1RT6A 3RMCA 1YF5L 3HZ6A 3NF8A 3I33A 3UKRA 3ZT0A 3WQTA 1T03A 4DWIA 4Z4HA 4IWVA 4J2AA 3ZX3A 3CJCA 4FXDA 2P9SA 3QETA 2B6AA 4B1UB 3ID8A 1W97L 1J5OA 3L3UA 4CJLA 3L7VA 3DI6A 5JVHL 3GL1A 3HOSA 2NRTA 4QS9A 4DFJA 4FJIA 4F8RA 4Q5VA 3NE6A 4FWOA 4BRGA 2OPSA 1U6ZA 5HRPA 1J54A 3CETA 4BR5A 1GOAA 4CJQA 1EXQA 4CHPA 4XH5A 4W5RA 5AQKA 3LWLA 3CJAA 5DM7L 3O9UA 1NMDA 2GUIA 4KV8A 1G57A 2UXCK 4OGCA 1WB9A 1VQMN 3VQQA 3PLAA 5EOYA 5AQMA 1MWMA 4CZIA 3EKUA 1IKWA 3P1GA 2P9NB 3V1RA 4OO1J 1P8ZA 4FBWA 1BA0A 3O5BA 1I94K 2P9BA 1QSLA 4RWTA 4CHOA 4BGAA 3SJJA 3MGZA 4KHNA 3I8BA 2JWLA 3CI5A 4AHVA 3LWMA 3K5MA 1D9DA 4OPJA 3AY9A 2KQ2A 3TAMA 1S72N 3RSEB 3BY5A 2D0BA 4PWDA 4WI1A 4BRFA 1U4BA 3U6FA 4DLGA 1IBMK 4FJNA 1X9JA 2I7NA 3GE1A 4JK9A 5T7BA 5AJ3K 5J2PA 3K9JA 4FK2A 1X9WA 1WSJA 1ATRA 3VETA 3IAYA 3HP9A 4B9MA 4IBNA 3WNFA 3MXMA 3ASMA 1D4XA 3LVJC 1C0TA 3N4QA 3VERA 2UU9K 4HUEA 5BPMA 2F8SA 1VSIA 1ZC6A 1Q8IA 1ESVA 1BHLA 1HUXA 4YORA 2OCEA 2GBZA 4I7FA 3CCSN 2RF2A 3OYNA 4LFAK 1YITN 3SZ2A 3F9MA 3VEYA 3UE5A 4JRPA 2MX1A 3CXCM 1T3VA 2YJEA 1X9SA 4BR9A 3CCEN 3O1WA 3HOTA 1H0XA 1NU0A 1QZ6A 2BANA 3SLCA 4KHPK 3DM2A 1V4TA 3CFPA 4BRHA 1LV5A 3H07A 1VSEA 4DQIA 4FJLA 1D8YA 3D2EB 3RWUA 3TSPA 5AQOA 4CFBA 4A57A 2HVIA 4DMNA 1LW0A 1WSHA 3L2VA 3MCAB 4HUGA 1YVUA 3GDQA 2VYPA 1KD1O 3LDPA 3KKRA 4JD2B 1HC7A 4FJJA 4DR5K 3E9OA 2OTJN 5GIOA 3SCXA 3IABB 2FF3B 3VQ5A 2X78A 4MFBA 3KTQA 4CESA 4K42A 1T6CA 5AQRA 4EZ9A 1S1VA 4N5SA 4DU4A 3GOIA 1N33K 3SPZA 3CJ9A 4LF6K 3AJEA 3C95A 1GOCA 3VGKA 3ZIHA 1NK4A 3ZSQA 3CPEA 2X6SA 1BGXT 2YI1A 3AVLA 4H03B 2E6MA 2KHOA 4JKFA 3P39A 3AO5A 4O44A 3OYJA 4BC2A 4I2PA 4O8UA 5EY4A 3U6YA 2O4GA 5LL6Z 4FJGA 1QE1A 2YV0X 1TAQA 3VF4A 2AJQA 3RR8A 1LWCA 1W7AA 5FROA 1IJJA 1DTQA 3RR7A 1OKJA 1IKXA 5M1KA 3ID6A 2QWRA 1KK9A 1SL2A 3P31A 4B3MK 4DR2K 1NK5A 3H6EA 1HNXK 2KTQA 3EEQA 4ELUA 1KAZA 2BTFA 3OHRA 3VQ4A 4JRQA 1K4PA 3TTFA 4FW2A 4WYBA 1VSHA 4LFCK 5CHIA 1VR4A 1TKDA 1L5UA 2YHAA 3CFOA 1FJGK 3F5TA 3CM5A 4FM0A 3LDOA 3ZLJA 4MO4A 4EP5A 5AZJB 1Q86O 4XH1A 1GLJO 3CJBA 3O4QA 5C2DA 3V9WA 3C6HA 1XC9A 3AVHA 1MU2A 1XC3A 2ZD1A 4M3UA 2VCPA 1PAVA 4I9LA 4KAZA 4DR6K 3H08A 5KPRA 4IXCA 3RVCA 4YKEA 3DXKB 4B3OA 4YOTA 2P5OA 1RT7A 2Y1IA 2WUSA 1TV6A 4DQQA 4O0IA 4NZRM 5KPZA 1K7JA 1U49A 3SI6A 3TOEA 3KK2A 3C0BA 2HNZA 1NK0A 1LN4A 4LH5A 3LDNA 2RHKA 3SBGA 3HM9A 1Q18A 4LF5K 4E7HA 2YCHA 4HVJA 2RKIA 3AVKA 1HQEA 4CZGA 4KREA 4M45A 3ATVA 4NCGA 3BDPA 4CJVA 3ZEUA 3SPYA 1N5YA 3PX0A 4FCXA 4M7YA 1NWKA 5FPMA 1NK7A 2O8BA 1JDQA 3SV4A 3U3YA 1QS4A 4DTPA 1NNEA 4K41A 1J53A 1H4TA 3DRRA 2ASPA 4B9UA 1KVCA 4DV7K 4OKEA 4CEFA 4IOAL 5H1SQ 4DV0K 1PVWA 3LP2A 4IFVA 4FBQA 3WNEA 4IEIA 3OYGA 3HK2A 3DLEA 4L8RB 2EH1A 2LXRA 3QLHA 1K4LA 4WQ4C 4CF9A 1N36K 4AH9A 3KWGA 1G99A 3MIOA 4U7BA 3IALA 3NF9A 3VTHA 1XWLA 1ASUA 3TAPA 3T69A 3VGLA 3R9PA 3UB5A 3IKMA 1DCJA 4DV1K 1IH7A 1EX4A 1XNRK 2Q0RA 4BDYA 1E4FT 4CEDA 3AVIA 3KD5E 3NVMA 4BC3A 4ISEA 2HHXA 1KAYA 3PO4A 1NLVA 4N41A 4A59A 1RBTA 4W5NA 4I9QA 3D0PA 4Z9EA 1B92A 3JAMO 4NCAA 3M5RA 4EAHD 1NGCA 2P9UA 1NGDA 3M8QA 2EWSA 3MXJA 4MDBA 4N56A 2NLXA 3HZ7A 3VQDA 3L2QA 4AHRA 4U67L 1HPMA 3DLKA 5AQJA 4CZEA 2CGJA 3JXUA 4B1XB 4BY9C 1BOTO 4FJHA 3ZETA 5AQNA 2DTUA 4KHSA 3B6OA 4JKDA 4B3RK 5ADXH 3L8BA 3VEVA 5BPNA 4P6CA 4CGDA 2OZSA 1TYQB 1SL1A 1S6QA 4HWIA 4H0YB 4E1BA 1JE3A 5J2QA 4F4KA 4RW7A 5AQVA 3J7ZO 3S3NA 4YHHK 5JLHA 1VQLN 3KLHA 4FL9A 3T19A 4XEIA 4F3OA 1U45A 3O1BA 3DWLA 1NJ8A 2ZJQL 1LCUA 4BQLA 4CD1A 5DM6L 1RT1A 3NH1A 4LSNA 2O8EB 4FLWA 4CW7B 1FK9A 3VEWA 5GAGP 3C94A 4DV5K 3ENBA 4CEAA 3FZFA 3ULEB 3LP3A 5SWMA 3NHGA 1VM0A 5GINA 2P9KA 4FLXA 1HJRA 1KC8O 2GEMA 3IABA 1K8AO 3DXMB 4FWKA 4JKGA 4EP4A 2KKZA 4X66K 3LPTA 1VQPN 3LM2A 3HT3A 1HR0K 1HNVA 1D9FA 5M1NA 4C23A 1EWRA 3SUNA 3VEXA 3LP0A 4M3RA 4DTJA 4J2EA 1WSEA 3R1XA 2OPQA 4O5FA 3IMXA 4H0VB 3TARA
chains in the Genus database with same CATH topology
3TTCA 1YF5L 2E1YA 4GVEA 3WXLA 1VQ7N 3HZ6A 3I33A 4CZMA 2QXLA 3UKRA 1JCEA 1HRUA 2FSJA 1K49A 3WQTA 1TYQA 4P77A 4IWVA 3SK3A 3ZX3A 3CJCA 5C2FA 4PL7A 2CGKA 4YDUA 2P9SA 4H0XB 1KXPA 3CJ1A 2ASOA 5M1PA 4B1UB 3ID8A 1W97L 3E9LA 5KPTA 5JVGL 3H1VX 4BC4A 1MA9B 4ILJA 1HKGA 3B8AX 5E26A 3CMEN 3VPZA 3L7VA 5ADXA 3P38A 5AQYA 4FWPA 4WFAL 3IFRA 3OBYA 2HF3A 5JVHL 3GL1A 3D6RA 2NRTA 3HOSA 4QS9A 2ZJRL 3MK5A 5MLCQ 2AP1A 1YHQN 3VOVA 4FWOA 2V51B 4IJNA 4BRGA 3BF1A 2IIRA 1U6ZA 3ZETB 3U9ZA 4CJ7A 3SAGA 4H5NA 1BU6O 4DHYA 1V4SA 3CETA 4BR5A 4FO0A 4WQ5A 1YI2N 1BO5O 4JKAA 1HJOA 4XH5A 4GY2B 5BRFA 5C12A 4ILGB 3KK7A 2DPNA 5AQKA 3CJAA 3Q7CA 3O9UA 5BN9A 1MDUB 5DM7L 1NMDA 1OVYA 2W40A 4DB3A 4JKGB 2A6AA 1JCGA 4JK7A 4PKHA 1G57A 3VMFB 4UY8O 3CC2N 1VQMN 4YOXA 3PLAA 5EOYA 5C0YA 5AQMA 1X3NA 4IO8A 1R59O 4CZFA 1YJNN 1BWFO 1XQSC 3QDKA 1MWMA 4CZIA 3EKUA 3ZX2A 3KWIA 3L4IA 4BGBA 5LJWA 3ZX0A 1Z05A 5AQIA 3SMSA 1VQ8N 2P9NB 4OO1J 4PHTX 4FBWA 1BA0A 1MWKA 1P8ZA 3O5BA 2P9BA 5AQLA 1NM1A 4RWTA 1NBWA 4BGAA 4GV9A 1GLFO 3MGZA 3I8BA 2JWLA 4HVZA 1U2VA 2OANA 3CI5A 4FOIA 2H3GX 3DAWA 3SJHA 4P6PA 4BRMA 3O8MA 3AY9A 3FLCO 2E2NA 5F1XA 3CF5L 2V7YA 3H1QA 2OTLN 2WC9A 2P9PB 3AGKA 5AQUA 1S72N 3RSEB 3FFKB 4BRFA 4FWRA 1X9JA 3ULEA 2I7NA 3GE1A 4JK9A 3K9JA 3K9KA 4BRCA 3AGRA 2QTDA 3LDLA 2CGLA 4IFEA 4R79A 2A5XA 1ATRA 2CH5A 3VETA 3W3DA 4LC9B 4CBUA 3GBTA 5GADP 1W2BM 1VQON 4BR0A 4WQ5C 5AR0A 3VGMA 4A61A 1Q7YO 1D4XA 2F9TA 3C7NB 5KQDA 3N4QA 4RCHA 5EXWA 3VERA 3D7EO 5FPEA 3L4QA 3SAFA 5HOOA 5AQXA 2E20A 1WUAA 4BRQA 5BPMA 3E1YA 1QQOA 1ZC6A 4FSVA 1NGFA 4KBOA 1ESVA 3BUZB 3ZIIA 3PIOL 1HUXA 4YORA 3U8XA 5EVZA 3KZBA 3CCSN 2KLAA 2F7TA 5BR9A 3WT0A 2GTDA 1YITN 3F9MA 3VEYA 4A2AA 3UE5A 5CE3A 3ZEUB 3ATUA 2MX1A 3CXCM 2PBDA 1T3VA 2YJEA 1YJ9N 4BR9A 3CCLN 3CCEN 3DJCA 4CZHA 4MDAA 1VQKN 3VF6A 1VQ5N 2WBNA 3O1WA 3HOTA 1NGGA 1G58A 4IJAA 1QZ6A 2BH1A 3SLCA 5BPLA 3WEEB 1V4TA 3H3OB 4KH5A 4BRHA 3VTIA 1NGAA 3O9RA 3MDQA 4FPAA 4RTFD 3H07A 2D0PA 1K8KB 3D2EB 5AQWA 3CMAN 3HTVA 3TSPA 5AQOA 5C15A 3C65A 1O13A 4A57A 4BROA 1K73O 4I14A 2ZWHA 3MCAB 2D4WA 3M3ZA 3GDQA 2VYPA 3DXKA 1KD1O 3A5NC 1SNNA 3LDPA 2P9PA 4JD2B 3MMVA 3O9QA 4BRPA 1E4GT 1YIJN 2FSKA 3VESA 3CIPA 2GELA 3E9OA 2OTJN 1BA1A 2F9WA 5GIOA 5F0XA 4GNIA 2FF3B 2FF6A 3A0IX 3FZMA 4E1JA 4C1NK 4JEPA 5ELZA 2GUPA 2ITMA 4F9OA 5AFUA 4K42A 2HBMA 3EKSA 2YHXA 1T6CA 3BF3A 5AQRA 4YOWA 1QVGM 4BRDA 3HI0A 3GOIA 3U4LA 1K4OA 4ISFA 3WXKA 5HL7L 3CJ9A 3C7NA 3W0LA 2P9LA 4FWMA 5F2RA 1DKGD 3DLLL 3AJEA 3P4IA 3VGKA 4BREA 4A5AA 3ZIHA 3QMLA 1ZBSA 3CPEA 4QS7A 2V52B 2YI1A 4DCHA 4H03B 4BVPA 3P04A 4XH4A 2KHOA 3UKRB 5BREA 4JKFA 3P39A 2HBJA 3CJ7A 4H0PA 4J8FA 1SS6A 2QWLA 3H46O 3M1FA 4MO5A 4BC2A 4EHUA 4O8UA 5EY4A 1H1VA 3VEZA 4Y0WA 1P90A 2QI2A 4WFNL 3O80A 3TU5A 5BN8A 3VF4A 2CH6A 3NVKA 2QW9A 5FPDA 3CQXA 2HBLA 3MN7A 1PVYA 5LY3A 1Q81O 2QM1A 2P9UB 3DXMA 5AQFA 4YOVA 4JKHA 1IJJA 4OPHA 3NMUA 1OKJA 2ZF5O 4ISGA 3AAPA 1QVFM 5M1KA 1K8KA 3D2EA 2E2QA 3TSUA 3ID6A 4BR7A 4CI6A 2QWRA 3H3NO 1KK9A 3P31A 2QWQA 4EHTA 2FSNA 4KH6A 3A5OC 2A41A 1RFQA 3ZYYX 3H6EA 5C10A 4I6MA 5AQTA 3CERA 2NRXA 3LM9A 3UKUB 2RISA 3LQUA 1RDUA 1KAZA 2BTFA 3OHRA 2YX6A 5AQGA 2IVOA 4FWLA 2Q31A 4NLCA 2D1KA 2RIUA 2HF4A 1K4PA 3TTFA 4WYBA 3SAHA 3VENA 5TKYA 3FZHA 2QWNA 5CHIA 3WQUA 2NNWA 5CR4A 1VQ4N 1J6ZA 2P9SB 3QBXA 1T6DA 3LDQA 3F5TA 3PIPL 3FZKA 4K25A 2HOEA 3LDOA 1S22A 2P9NA 5GIPA 1T44A 4MO4A 3QB0A 3S41A 3MWTA 2Q1NA 5AZJB 5M1QA 4B1YB 1Q86O 1QHAA 4XH1A 1GLJO 3CJBA 1NGJA 4MLEA 5C2DA 2YHYA 1TUYA 1U2VB 3C6HA 5JMVA 4GV6A 3ZIGA 1XC3A 3N4PA 3MN9A 3G4SN 2VCPA 4H5VA 3BP8A 2A42A 4BG9A 4A2BA 1DGKN 3AAQA 3TTDA 5KPRA 4H0OA 4IXCA 2HBKA 4BRKA 1M90O 2YJFA 3RVCA 4BG8A 4YKEA 3DXKB 3G25A 4OPAA 2E2PA 4IZ9A 2I7PA 5FPNA 1DEJA 4JD2A 4YOTA 4B1VA 1RDWX 3A5MC 4B1ZA 4EFHA 3IUCA 2WUSA 3MK6A 5KQ8A 4O8KA 2ZJPL 2D0OA 4ILHA 3E9PA 3EE9A 2WFBA 4JHDB 5AQPA 3CPWM 2E1ZA 3WXMB 4NZRM 1BUPA 1QQMA 5KPZA 1K7JA 2E88A 3VEOA 1SZ2A 4YOUA 2QA4N 2RE2A 4QS8A 1S3XA 4WQ4A 1EO1A 3EN9A 3CQYA 3CD6N 2QWMA 3D2FA 3OW2M 3VF2A 4FWQA 4FPBA 1HLUA 3C0BA 3ENOA 3FGUA 3WXIA 3LDNA 2RHKA 1XUPO 4I6MB 3SBGA 4AF1A 1Q18A 1YXQA 4WF9L 1BDGA 2YCHA 3O6WA 4CZGA 4M7XA 4IO9L 1TKUA 1QQNA 3ATVA 5AZIA 3G71N 1C0GA 4IDHA 3ZEUA 1ILYA 4FCXA 4M7YA 1GLLO 1NWKA 4IOXA 1HKCA 3E66A 4H5TA 5FPMA 2E8AA 4JNEA 4WFBL 1VQ9N 2VGNA 3CCJN 4BC5A 2UYTA 4K41A 1GLCG 4WCEL 3FZLA 1ATSA 2ASPA 2V7ZA 1KQSM 1IG8A 4YDUC 2E2OA 4AM6A 3FR0A 4IOAL 5H1SQ 3OBWA 4K43A 1PVWA 3JS6A 4G9ZA 4FBQA 3SMPA 1X3MA 2NRRA 4IEIA 2EQAA 1GLAG 5BRHA 2Q36A 5AQHA 1K4LA 2ZGZA 1VAZA 4WQ4C 3LRJA 4IOCL 3UKUA 2P9KB 2P9IA 1GLBG 3KWGA 3RSEA 1K4IA 1G99A 3M6GA 3MIOA 2Q97A 3QFUA 3ENHA 3R6MA 4U7BA 4PL8A 4CZJA 3VTHA 4FOEA 2IVNA 4CZKA 1TUUA 2BUPA 1CZAN 4CBXA 5TKWA 4BR2A 3MN5A 4C1NI 3T69A 3VGLA 3R9PA 3UB5A 3IKMA 4DQ8A 2Q0RA 1SQKA 1E4FT 1Z6RA 4FWSA 2GWJA 3CCMN 1RGIA 3R3LA 3NVMA 4BC3A 5AZJA 4PKIA 4BRIA 4ISEA 2VGMA 2ZGYA 3QFPA 5GAHP 1M1KO 1HKBA 1NGHA 1KAYA 4M63C 5LJVA 4FFJA 3Q7BA 2J4RA 2W41A 4DKWA 1XEZA 2QWPA 4H5RA 3EO3A 3CHWA 1NLVA 3T7ZA 3U9DA 4JAXA 4EO0A 4BQZA 2AA4A 4B1WB 4A59A 3LS6A 2NRZA 4A5BA 4GV3A 4A62A 3I55N 2ASMA 3T1IA 3M5RA 4HTLA 3HM8A 3TSQA 4BRLA 4EAHD 3CCVN 1NGCA 2P9UA 1NGDA 1YJWN 4P8EA 2EWSA 4MDBA 2NLXA 1LOTB 1C0FA 1SAZA 5M1FA 4NZTM 3MX2A 4NLBA 1YAGA 1HPMA 2FXUA 4NB4A 4U67L 5JLFA 1NGEA 2NZTA 1HX1A 5AQQA 3WEEA 1NJIO 3KHYA 5M1OA 5AQJA 4CZEA 2CGJA 3JXUA 3L6QA 4JKEA 3MX5A 4YOYA 2NRVA 3EL2A 4B1XB 3AARA 4BR4A 3R8EA 4BY9C 1BOTO 3I56N 3ZETA 2NRHA 2YHWA 5AQNA 2Q0UA 5GAEP 1VQNN 3QICA 2GWKA 3L0QA 3A8YA 4JKDA 4NO7A 1DT9A 5ADXH 3GG4A 3CC4N 2PAVA 1ZXOA 2A3ZA 2PFUA 3OA9A 3VEVA 3KVGA 4BVOA 5BPNA 3EE8A 4FVUA 4P6CA 2JWKA 3SBTA 1TYQB 4HWIA 3O08A 4H0YB 2QWOA 4L3QA 3O4WA 4E1BA 3IDHA 4FBKA 1BG3A 4P6DA 5AQVA 3J7ZO 2A40A 3F2KA 2FLOA 5JLHA 1VQLN 2HSTA 3HRGA 4FL9A 4XEIA 5E84A 5B8HA 4JN4A 1Q82O 1NGBA 3C6AA 3O1BA 4Z94A 4CBWA 3CCUN 3DWLA 2ZJQL 1LCUA 4JKCA 4BQLA 4CD1A 1Y64A 3FE1A 2HMPA 2VWBA 5DM6L 3LL3A 3MWPA 4KH4A 4EIAA 3J8AA 4CZLA 1KAXA 3CCQN 3VEWA 5GAGP 4PKGA 3MN6A 3QBWA 1GLDG 3ENBA 4B9QA 5AQSA 3FZFA 3ULEB 4IEEA 3O9SA 4JK8A 4JHDA 5GINA 2LN3A 2P9IB 2P9KA 3CC7N 3O9TA 5I9EB 3MCPA 1YVNA 5AFUH 3BEXA 3HBTA 3G6EN 1KC8O 2GEMA 2Q2RA 1K8AO 1JCUA 4BRAA 3DXMB 3A5LC 4FWKA 4JKGA 2KKZA 4H5WA 3WXJA 5BRDA 1TKSA 1QZ5A 3EZWA 4AM7A 3TPQA 4MLHA 4H0TB 3LM2A 1VQPN 3D2FB 1WOQA 1VQ6N 3ZIEA 3HSCA 2QEXN 5EX5A 2IVPA 2GX9A 1N8RO 1GLEG 1JCFA 1EQYA 3H45C 3WUHA 1IEZA 4FWNA 1JJ2M 5AQZA 2NRWA 5M1NA 1K9MO 4C23A 1ATNA 4JKBA 2P9LB 4BRNA 3VEXA 5JICA 1NGIA 3R1XA 5AZIB 3CCRN 1YUWA 4O5FA 3IMXA 4H0VB 4P8JA 4CD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VF4 A;  3TTD A;  3VEW A;  3VET A;  3TTC A;  3VEO A;  3TTF A;  3VES A;  3VEZ A;  3VER A;  3TSQ A;  3VTH A;  3VEN A;  3TSP A;  3VF2 A;  3TSU A;  3VEX A;  3VTI A; 
#chains in the Genus database with same CATH topology
 4C8O A;  1VQ7 N;  1ZBH A;  2OZM A;  1HRU A;  3DLR A;  5C2F A;  1G15 A;  1RDD A;  3OYE A;  2CGK A;  4YDU A;  4CFD A;  4DQS A;  4F2S A;  1NOY A;  1KXP A;  2ASO A;  5M1P A;  3QKB A;  1BCO A;  4M3W A;  5KPT A;  3H1V X;  1MA9 B;  4DUZ K;  2D5R A;  1EET A;  3O4N A;  5E26 A;  4CJ3 A;  4HUF A;  3F9K A;  3VPZ A;  3CME N;  2HHS A;  5AQY A;  4WFA L;  3IFR A;  3OBY A;  2HNY A;  3D6R A;  4DFM A;  2ZJR L;  1OVQ A;  5MLC Q;  4YFU A;  4DSE A;  1YHQ N;  3IG1 A;  1IBK K;  4JS5 A;  4LF4 K;  3KK1 A;  3MXI A;  1BU6 O;  4DHY A;  1YI2 N;  1HJO A;  4NXN K;  4OGE A;  4CJ4 A;  5C12 A;  1SKR A;  4ILG B;  3KK7 A;  2DPN A;  1MDU B;  3PSI A;  1OVY A;  3SNN A;  3NF6 A;  4GKK K;  1JCG A;  4PKH A;  1H0Y A;  3CC2 N;  4YOX A;  3HL8 A;  4CZF A;  1WAF A;  1YJN N;  1BWF O;  2X74 A;  5LJW A;  3ZX0 A;  1Z05 A;  5AQI A;  4LD0 A;  1VQ8 N;  4H4O A;  4FW1 A;  3OYA A;  1MWK A;  5AQL A;  1CZ9 A;  3C6T A;  4GVM A;  1NBW A;  5KGW A;  4W5Q A;  4DFP A;  4ZTJ A;  1GLF O;  3ZCM A;  4PQU A;  4CK3 A;  1NJY A;  4CJE A;  2H3G X;  4P6P A;  4LF7 K;  3VQ8 A;  2V7Y A;  1QSY A;  1HNW K;  4AHS A;  2WC9 A;  5AQU A;  3M8S A;  4CHN A;  4FWR A;  1JLB A;  3THY A;  2QTD A;  3T1Y K;  4ZTF A;  2CH5 A;  2F4V K;  3W3D A;  4CBU A;  3VA3 A;  3GBT A;  2JGU A;  4KHY A;  1VQO N;  4A61 A;  5KQD A;  3SAF A;  5FPE A;  3L4Q A;  5AQX A;  1RT2 A;  2E20 A;  4BRQ A;  4DUY K;  3E1Y A;  4KBO A;  4Z4C A;  3THW A;  4N76 A;  3VQ6 A;  1Y2I A;  3U8X A;  3HPO A;  3KZB A;  2KFZ A;  3SUQ A;  3VQC A;  5BR9 A;  1VSM A;  4HHT A;  4A2A A;  1S1T A;  3ZEU B;  3ATU A;  1KVA A;  3CCL N;  1YTU A;  4PY5 A;  4MDA A;  3M8P A;  2O8B B;  3VF6 A;  1VQ5 N;  3KIO A;  1I39 A;  3CG7 A;  2VG6 A;  3JSM A;  5BPL A;  4RW8 A;  3K2P A;  3H3O B;  3VTI A;  5HRN A;  1NGA A;  4FPA A;  3MDQ A;  4RTF D;  3QES A;  3HST B;  3HTV A;  3RMB A;  4BRO A;  2D4W A;  1VSJ A;  4CF1 A;  3CM6 A;  3A5N C;  1RDB A;  1SNN A;  2VQF K;  2P9P A;  2JLE A;  3MMV A;  3O9Q A;  1E4G T;  2FSK A;  1B9F A;  4GMJ B;  1S9G A;  2GEL A;  2F9W A;  2X6N A;  5F0X A;  5HRR A;  5AFU A;  5EU7 A;  2YHX A;  4YOW A;  1K6Y A;  4BRD A;  4ID5 A;  1JLC A;  5HL7 L;  3C7N A;  3V9X A;  4FWM A;  3J7Y P;  3P4I A;  4CFA A;  2E4L A;  3THX A;  4A5A A;  1HPZ A;  3TAB A;  3QML A;  3CFR A;  3AVB A;  3OYB A;  4QS7 A;  2V52 B;  5FRN A;  2O4I A;  1S1W A;  1LWF A;  4XH4 A;  4FLV A;  2KW4 A;  1NJZ A;  1FXX A;  1SS6 A;  2QWL A;  4EHU A;  4FCY A;  3VEZ A;  4Y0W A;  4FK0 A;  4OX9 K;  2ETJ A;  5CYQ A;  4WFN L;  3O80 A;  2CH6 A;  4MQ3 A;  2O8F B;  5FPD A;  2PYL A;  3MN7 A;  1JKH A;  2P9U B;  1RNH A;  5AQF A;  4FLZ A;  5HRO A;  4BE2 A;  4JKH A;  4M3X A;  2HND A;  3NMU A;  4CE9 A;  4ISG A;  1K8K A;  4BR7 A;  1UDV A;  1RTJ A;  4K8X A;  1EP4 A;  5FDL A;  2QWQ A;  3A5O C;  3ZYY X;  1SKS A;  1W9H A;  1RDU A;  2YX6 A;  4FWL A;  4NLC A;  3PO5 A;  2D1K A;  4DR7 K;  2RIU A;  2HF4 A;  3AA4 A;  1JLA A;  3SAH A;  4KRF A;  2VWJ A;  2QWN A;  3WQU A;  1VQ4 N;  1J6Z A;  3QBX A;  1T6D A;  4Y1D A;  2YNI A;  2HOE A;  4B9V A;  1S22 A;  4LF8 K;  5GIP A;  3HJF A;  3PV8 A;  1BIZ A;  5M1Q A;  4MLE A;  1NGJ A;  4E89 A;  1U48 A;  2FBY A;  4QCL A;  4CJ5 A;  1U2V B;  3ZIG A;  3G4S N;  3BP8 A;  2A42 A;  4BG9 A;  4A2B A;  3AAQ A;  2BKY X;  4JV5 K;  2YNG A;  4J2B A;  4BRK A;  2FBV A;  1M90 O;  3T1A A;  5HLF A;  1REV A;  4BG8 A;  3G25 A;  2F96 A;  2E2P A;  2I7P A;  4JD2 A;  3HYF A;  4W5T A;  4B1V A;  3A5M C;  1KRP A;  4B1Z A;  4EFH A;  3MK6 A;  5KQ8 A;  2D0O A;  2XY8 A;  4ILH A;  2WFB A;  2IC3 A;  4DF4 A;  1JLQ A;  2E88 A;  1UAX A;  4JI4 K;  4JI8 K;  2RE2 A;  4JI5 K;  1S3X A;  4JI0 K;  4WQ4 A;  3EN9 A;  1RDC A;  2QWM A;  1RT3 A;  4IG0 A;  2XY6 A;  4KHW A;  4FPB A;  2WON A;  4I6M B;  2O8C B;  1XUP O;  4DTS A;  4OLF A;  3DMJ A;  4M7X A;  1TKU A;  3K5L A;  2R7Y A;  3AVJ A;  1C0G A;  4IDH A;  3DOK A;  3E66 A;  4JNE A;  1RCH A;  4DG1 A;  1S8E A;  4WFB L;  1VQ9 N;  2VGN A;  2E5L K;  4M3T A;  1ATS A;  1A5X A;  4HD0 A;  1KQS M;  4YDU C;  4AM6 A;  1L3V A;  1RIL A;  1C1B A;  3OBW A;  4K43 A;  3KLF A;  3JS6 A;  1QHT A;  3SMP A;  4DSF A;  4CHY A;  2Q36 A;  3HVT A;  4DFK A;  3LRJ A;  4IOC L;  4Z0U A;  3I0S A;  1KTQ A;  3RSE A;  2KZM A;  1TAU A;  3M6G A;  3TAN A;  2Q97 A;  3ENH A;  4CZJ A;  2HHW A;  4FOE A;  2IVN A;  4CZK A;  1TUU A;  1TKZ A;  1CZA N;  2HB5 A;  4CGF A;  1VHX A;  3KLE A;  3KD1 E;  4NCX A;  1SQK A;  3LAN A;  3CCM N;  1RGI A;  5AZJ A;  1M1K O;  4PKI A;  2ZGY A;  1ASV A;  1OH7 A;  1HKB A;  4FFJ A;  3Q7B A;  2UUC K;  2W41 A;  2B5J A;  1XEZ A;  3EO3 A;  3AA3 A;  1LW2 A;  2PYJ A;  2AA4 A;  3EYZ A;  2NRZ A;  4A5B A;  4GKJ K;  1NKB A;  3I55 N;  3K0S A;  1TIG A;  2ASM A;  1Y97 A;  2GTC A;  3T1I A;  3HM8 A;  4BRL A;  4P8E A;  4EZ6 A;  4BAC A;  3ZT3 A;  3OJS A;  4KI6 A;  1NJ2 A;  1LOT B;  3PSF A;  3O3G A;  1YAG A;  1DTT A;  3THY B;  1HX1 A;  5AQQ A;  3DYA A;  2D0C A;  1HYV A;  3TR8 A;  3L6Q A;  2YKM A;  4YOY A;  4BR4 A;  3BZK A;  3WBM A;  4PUO A;  2EHG A;  3QIC A;  2GWK A;  4DF8 A;  3SUP A;  4FLU A;  1T8E A;  1DT9 A;  4OKK A;  3THW B;  3WNH A;  1ITG A;  5JVG L;  3KK3 A;  1XMO K;  3VQ9 A;  3TAQ A;  3SBT A;  3THV A;  1TK0 A;  4C8M A;  4L3Q A;  4DR3 K;  3IDH A;  5CZ1 A;  5FRM A;  1BG3 A;  4P6D A;  4J2D A;  3AVG A;  3F2K A;  2HST A;  4K86 A;  3K58 A;  2IAJ A;  5B8H A;  4JN4 A;  1FW6 A;  4ELV A;  1TKX A;  3CCU N;  2G8I A;  1Y64 A;  3FE1 A;  2HMP A;  2VWB A;  3LL3 A;  4EIA A;  1KAX A;  3K5O A;  3CCQ N;  1DLO A;  5KI6 A;  3QBW A;  1IKY A;  1GLD G;  4O5B A;  4B9Q A;  2XY5 A;  4Z4I A;  4DQR A;  3O9S A;  2LN3 A;  3HXM A;  3O9T A;  5I9E B;  3MCP A;  5AFU H;  3G6E N;  2Q2R A;  1JCU A;  4BRA A;  4E0D A;  1QZ5 A;  3AVN A;  3EZW A;  3ZT1 A;  3TPQ A;  3QO9 A;  4CEC A;  2QEX N;  1SUQ A;  2RN2 A;  2IVP A;  1HNI A;  1JCF A;  1EQY A;  3H45 C;  3WUH A;  2HVH A;  2QXF A;  4DTM A;  1L3S A;  2P51 A;  5DK5 A;  1NGI A;  3CCR N;  4P8J A;  3V9U A;  3OVN A;  3TTC A;  4Z4F A;  3WXL A;  4GVE A;  3KJV A;  2QXL A;  1K49 A;  4P77 A;  1BI4 A;  3SK3 A;  3OS1 A;  1LWE A;  3VQE A;  4LF9 K;  1HNZ K;  3E9L A;  5CY4 A;  4BC4 A;  3B8A X;  5E41 A;  3P38 A;  4FWP A;  4E19 A;  5I3U A;  3VQB A;  1NK9 A;  3QIO A;  3MK5 A;  5C24 A;  2AP1 A;  2W6L A;  3VOV A;  3BGR A;  3BF1 A;  4BWM A;  4CJ7 A;  3ZET B;  3U9Z A;  4CGG A;  1V4S A;  2HMI A;  1BO5 O;  4DSL A;  4JKA A;  3MAQ A;  1YT3 A;  5BRF A;  3LDS A;  5BN9 A;  5BR8 K;  4CHQ A;  4JK7 A;  3QIP A;  3VMF B;  4UY8 O;  2QKB A;  1KVB A;  3OY9 A;  1X3N A;  1IO2 A;  1R59 O;  3AO4 A;  4DR1 K;  1TGO A;  1XQS C;  3ZX2 A;  4BGB A;  4DTN A;  1RTI A;  3SMS A;  1KFD A;  3LAL A;  1FKP A;  4DV3 K;  3U3G A;  2IOC A;  2GV9 A;  4FOI A;  1U2V A;  3DAW A;  3O8M A;  2XRI A;  3FLC O;  2E2N A;  4IFY A;  5F1X A;  3CF5 L;  3QEP A;  2O8E A;  3H1Q A;  2OTL N;  3AGK A;  3DRS A;  3FFK B;  3L3V A;  4FJ7 A;  1A5V A;  3ULE A;  2YHB A;  3OYH A;  2CRQ A;  3K9K A;  4IFE A;  2A5X A;  1W2B M;  5HP1 A;  4E7L A;  2DFF A;  5AR0 A;  1Q7Y O;  3NDK A;  5HOO A;  3D7E O;  1RBR A;  1WUA A;  4JI6 K;  3D45 A;  4FYD A;  1QQO A;  4FZZ A;  3ZII A;  3PIO L;  3V4I A;  4HCB A;  2F7T A;  3WT0 A;  2GTD A;  2HHU A;  3SQ2 A;  3J81 O;  4YY3 K;  4FM2 A;  3DLG A;  1S1U A;  2PBD A;  2FC0 A;  2O8D A;  1YJ9 N;  3DJC A;  1UA1 A;  4DS4 A;  4CJK A;  1G58 A;  4IJA A;  4JI7 K;  2BH1 A;  5A2Q O;  4FZX C;  3WEE B;  4KH5 A;  3O9R A;  1KLN A;  3S9H A;  3M8R A;  1J5E K;  2Z1I A;  1JXB A;  5AQW A;  5C15 A;  1IV0 A;  3OYD A;  4KPY A;  4F3T A;  1K73 O;  2ZWH A;  3J80 O;  2ZM6 K;  2HHQ A;  5JS2 A;  3EZ5 A;  3NH2 A;  4DQP A;  3DOL A;  3OYK A;  1JLG A;  1OH5 A;  1OH6 A;  3OYF A;  3VES A;  5KRT A;  3CIP A;  1BA1 A;  4GNI A;  3A0I X;  3FZM A;  4E1J A;  4C1N K;  4E3S A;  1KLM A;  5ELZ A;  4F9O A;  3QEW A;  3BF3 A;  4CFC A;  1NFH A;  5C42 A;  4ICL A;  1NOZ A;  2WTU A;  2P9L A;  1DKG D;  4V19 S;  2XY7 A;  3ISN C;  4OPK A;  3L2U A;  5BRE A;  3CYM A;  4OKJ A;  4X62 K;  1LAW A;  2HBJ A;  3CJ7 A;  4RW9 A;  3M1F A;  3DRP A;  1NJ5 A;  1H1V A;  1P90 A;  3ZSO A;  2QI2 A;  3TU5 A;  5KTQ A;  4ELT A;  1VK0 A;  2QW9 A;  1PVY A;  1Q81 O;  2QM1 A;  4YOV A;  4CHZ A;  4JI2 K;  3BZC A;  4OPH A;  2ZF5 O;  3AAP A;  1TKT A;  3V1O A;  1X1P A;  3D2E A;  2E2Q A;  2RPI A;  3P83 D;  1NJ6 A;  3SQ1 A;  3H3N O;  4B9S A;  2FSN A;  4KH6 A;  1S9E A;  5C10 A;  4B8A B;  3VQP A;  3LPU A;  3UKU B;  2RIS A;  2KFN A;  2DY4 A;  3LQU A;  1RQ8 A;  2ITG A;  1E3M A;  5J2M A;  3VEN A;  2XHB A;  5CR4 A;  1KSP A;  2P9S B;  3S3M A;  3G0Z A;  3IS9 A;  1EWQ A;  1T44 A;  3S41 A;  1H4Q A;  1C1C A;  1ZBU A;  3HPH A;  5D3G A;  3A2F A;  2YHY A;  3VQ7 A;  3N4P A;  4K8Z A;  4OLA A;  3DSC A;  4PA1 A;  3V9Z A;  3HO1 A;  1WNS A;  2HBK A;  2YJF A;  4OPA A;  4AHC A;  3ZSW A;  3PY8 A;  5FPN A;  1DEJ A;  2OPR A;  1R0A A;  3ZSY A;  1N34 K;  4B9L A;  3EE9 A;  3WXM B;  1BUP A;  1QQM A;  3LVK B;  5CZ2 A;  1NJW A;  1SZ2 A;  2QA4 N;  4C8K A;  4R5P A;  4CEO A;  4LY7 A;  3CD6 N;  3ZSR A;  1LAV A;  4FWQ A;  2IFE A;  1HLU A;  3FGU A;  4CVN E;  3TAG A;  4WF9 L;  1BDG A;  3TAE A;  1ZBF A;  1QQN A;  1ILY A;  2VG7 A;  2WOM A;  1GLL O;  4IOX A;  3VN5 A;  4H5T A;  4F2R A;  1IKV A;  3CCJ N;  1BI4 B;  4IKF A;  4BC5 A;  1X9M A;  2V7Z A;  1IG8 A;  4KTW A;  2VG5 A;  3RTV A;  1BQN A;  1QSS A;  5J1E A;  4C8L A;  1X3M A;  2HW3 A;  5AQH A;  3V81 A;  1H4S A;  2P9I A;  1K4I A;  1HRH A;  4AHT A;  2XO7 A;  3QFU A;  3R6M A;  4PL8 A;  1CLQ A;  2OYQ A;  2A1S A;  1KFS A;  5TKW A;  3ZT4 A;  4BR2 A;  4C1N I;  4DLE A;  4KKO A;  4G1Q A;  1ASW A;  1Z6R A;  3QEX A;  1OH8 A;  2GWJ A;  3KKS A;  4WE1 A;  3QEV A;  4BRI A;  4RW6 A;  4NYF A;  4AIL C;  1NKE A;  4CJW A;  5LJV A;  5IWA K;  3AV9 A;  2HHT A;  3U9D A;  3T7Z A;  4JAX A;  4EO0 A;  4BQZ A;  1RT4 A;  3LS6 A;  4GV3 A;  3WNG A;  4A62 A;  3RRH A;  2FBT A;  3CCV N;  1VSF A;  1JO0 A;  4KB0 A;  2IDO A;  1KCF A;  2HHH K;  1C0F A;  1SAZ A;  4C8N A;  4NZT M;  4NLB A;  3KLI A;  1YTA A;  4NB4 A;  5JLF A;  3AVC A;  1NGE A;  2NZT A;  4K87 A;  3S3O A;  2UXB K;  3KHY A;  4DTO A;  1HMV A;  3QNN A;  3E01 A;  1EKE A;  1W0H A;  2NRV A;  3EL2 A;  3ZSX A;  3R8E A;  4NYN A;  3I56 N;  1UWB A;  2LSN A;  2Q0U A;  3L2R A;  2H9U A;  2ZQB A;  4NO7 A;  4CGJ A;  4Q15 A;  4CJF A;  4B3T K;  4O4G A;  1ZXO A;  2A3Z A;  2PFU A;  4FVU A;  4BVO A;  3KVG A;  4CIE A;  3PUF A;  4CK1 A;  2QWO A;  4Y1C A;  3O4W A;  4CGH A;  1XMQ K;  3HP6 A;  1RDA A;  1VRU A;  4B9T A;  2O8D B;  5C25 A;  1RT5 A;  4RW4 A;  1RTD A;  3V9S A;  3OJU A;  4DTR A;  1II7 A;  4KTQ A;  1Q82 O;  3NAE A;  4CBW A;  3QEI A;  3NGZ A;  1B9D A;  4B9N A;  2DFH A;  4JLH A;  3MWP A;  4KH4 A;  3J8A A;  4JI3 K;  2D0A A;  4PKG A;  3MN6 A;  1XHZ A;  2EX3 A;  1WSG A;  5AQS A;  4IEE A;  4JK8 A;  4JHD A;  2QKK A;  1HYS A;  5FLX O;  1D5A A;  3A5L C;  4H5W A;  4FM1 A;  1GOB A;  3D2F B;  1VQ6 N;  2OA8 A;  3HSC A;  5EX5 A;  1FKO A;  1N8R O;  1GLE G;  4FWN A;  2NRW A;  4CGI A;  1ATN A;  2P9L B;  4CK2 A;  2PZS A;  1O1W A;  5AZI B;  1YUW A;  1L3U A;  4CD3 A;  4FK4 A;  3NF7 A;  1NKC A;  2E1Y A;  4HVC A;  3HPG A;  4CZM A;  5KGX A;  1JCE A;  2FSJ A;  4CCH A;  1TYQ A;  5HBM A;  4DV4 K;  1WBB A;  4PL7 A;  4H0X B;  3AA5 X;  3I8D A;  1VSD A;  3CJ1 A;  4BE1 A;  1JLF A;  3OS2 A;  4ILJ A;  1HKG A;  3LP1 A;  3QNO A;  4YNQ A;  3NFA A;  4RG8 A;  5ADX A;  2HF3 A;  2DFE A;  4E1M A;  1C0M A;  4QAG A;  4IJN A;  2V51 B;  4E7I A;  2IIR A;  1BIS A;  1BCM A;  3SAG A;  1RTH A;  4H5N A;  3VA0 A;  3AO1 A;  4FO0 A;  4WQ5 A;  3O3F A;  3AO3 A;  4LSL A;  4GY2 B;  3P5J A;  4JI1 K;  3Q7C A;  4DTX A;  4DSI A;  2M71 A;  1TL1 A;  2W40 A;  4DB3 A;  4JKG B;  2A6A A;  1S6P A;  1NK6 A;  5C0Y A;  4IO8 A;  4NXM K;  3QDK A;  3KWI A;  3L4I A;  2PY5 A;  4PHT X;  2W6K A;  1NM1 A;  1WN7 A;  4GV9 A;  4HVZ A;  2OAN A;  1Z25 A;  2P1J A;  2Y1J A;  1F21 A;  3SJH A;  4BRM A;  4X65 K;  4CF8 A;  4BDZ A;  1SL0 A;  4KHU A;  3ZT2 A;  2FBX A;  3JYT A;  2P9P B;  1L3T A;  2A2Y A;  3RMA A;  4NCB A;  1Q9X A;  3ZSV A;  4KHQ A;  4BRC A;  3AGR A;  4R79 A;  3LDL A;  2CGL A;  1NJX A;  3MED A;  4LC9 B;  4OVL A;  3AA2 A;  5GAD P;  3L2W A;  4DR4 K;  1WSI A;  2Z1H A;  4BR0 A;  4WQ5 C;  3VGM A;  2F9T A;  3C7N B;  1SKW A;  4RCH A;  3SYZ A;  5EXW A;  2HHV A;  1C1A A;  4FSV A;  1NGF A;  3BUZ B;  5SZT A;  4HTU A;  2KZZ A;  4I2Q A;  5EVZ A;  1XI1 A;  2KLA A;  4M3Y A;  2G8W A;  4FZY A;  5CE3 A;  4KFB A;  1RBV A;  4FJM A;  4CZH A;  1JLE A;  1XHX A;  1VQK N;  2WBN A;  1NGG A;  1C0U A;  4ID1 A;  4YDQ A;  4B3S K;  2D0P A;  2W42 A;  2Z1G A;  1K8K B;  2B4J A;  3LZI A;  3CMA N;  4BDP A;  3C65 A;  2QK9 A;  1O13 A;  1JL1 A;  4I14 A;  4BWJ A;  3SV3 A;  3LAM A;  3M3Z A;  3TWH A;  4M3Z A;  1Z26 A;  3DXK A;  1RBU A;  5IT9 O;  2YNH A;  4BRP A;  4FJX A;  1YIJ N;  1T7P A;  1NJ1 A;  1U47 A;  2FF6 A;  5JS1 A;  4JEP A;  2ITM A;  2GUP A;  4FVM A;  2HBM A;  3EKS A;  1QVG M;  2VQE K;  3HI0 A;  3U4L A;  1K4O A;  4ISF A;  3WXK A;  4DSJ A;  3ULD A;  4E7J A;  3W0L A;  5F2R A;  3DLL L;  1Y9X A;  4BRE A;  1VSL A;  3NBP A;  3MEG A;  3O3H A;  3OYM A;  1ZBS A;  2YNF A;  4DCH A;  4BVP A;  1N6Q A;  3P04 A;  3UKR B;  3ZSZ A;  4H0P A;  4J8F A;  3H46 O;  4MO5 A;  4CJS A;  4Z4E A;  4W5O A;  4HCC A;  5BN8 A;  4KO0 A;  3NVK A;  4BE0 A;  3CQX A;  2HBL A;  1CXU A;  5LY3 A;  3DXM A;  4E1N A;  2G8K A;  5LMU K;  3OYI A;  1QVF M;  2NUB A;  3KLG A;  3TSU A;  4CI6 A;  1VRT A;  1NH9 A;  4EHT A;  4OLB A;  4DTU A;  2A41 A;  1RFQ A;  3AVA A;  4CF0 A;  4I6M A;  2O8C A;  5AQT A;  3CER A;  1NK8 A;  1WAJ A;  2NRX A;  3LM9 A;  2F8T A;  4CJP A;  2E6L A;  5AQG A;  2IVO A;  2Q31 A;  2EK0 A;  1XNQ K;  4X64 K;  3DLH A;  5TKY A;  3FZH A;  2NNW A;  3LDQ A;  3PIP L;  3FZK A;  4K25 A;  4LFB K;  2P9N A;  4FJ9 A;  2Z1J A;  3QB0 A;  1RBS A;  3MWT A;  2Q1N A;  4B1Y B;  4CIG A;  3RMD A;  1QHA A;  3V6D A;  1TUY A;  5JMV A;  4GV6 A;  3MN9 A;  4H5V A;  2BDP A;  3QER A;  3SQ4 A;  1DGK N;  1JL2 A;  3TTD A;  2G8H A;  1VSK A;  4H0O A;  2YKN A;  4N47 A;  3B6P A;  4UQG A;  4IZ9 A;  1C6V A;  2A1R A;  1RDW X;  1Q9Y A;  3K5N A;  2G8V A;  3IUC A;  4LH4 A;  4FJK A;  4KTZ A;  4B8C A;  4O8K A;  5CYM A;  2ZJP L;  4FJ8 A;  1TK8 A;  3E9P A;  4JHD B;  5AQP A;  3CPW M;  2E1Z A;  2G8F A;  5KRS A;  3VEO A;  4TSX A;  4YOU A;  3FFI A;  4QS8 A;  1EO1 A;  3CQY A;  1TL3 A;  3D2F A;  3OW2 M;  4CEB A;  3VF2 A;  1QQC A;  3NGI A;  3SQ0 A;  3HVR A;  3ENO A;  3WXI A;  3TAF A;  3AO2 A;  4AF1 A;  2UUB K;  1YXQ A;  2Y1B A;  1TVR A;  3ALY A;  3O6W A;  1TK5 A;  4IO9 L;  4E7K A;  2Z7C A;  3SUO A;  5AZI A;  3G71 N;  4DU3 A;  4ZHR A;  4AHU A;  3CQ8 A;  1HKC A;  2E8A A;  4GW6 A;  2Q3V A;  5DMR A;  1WBD A;  4AQY K;  4DSK A;  2UUA K;  3I0R A;  2UYT A;  2ZE2 A;  1SV5 A;  1GLC G;  2I5J A;  4WCE L;  3FZL A;  1J9A A;  2E2O A;  3FR0 A;  1HQU A;  3MEC A;  4G9Z A;  5K14 A;  1UOC A;  2NRR A;  4CER A;  2EQA A;  3TI0 A;  1GLA G;  1S1X A;  5BRH A;  2OPP A;  1I3A A;  3OS0 A;  2ZGZ A;  1VAZ A;  3UKU A;  1T05 A;  2P9K B;  4K0K K;  1GLB G;  2ATQ A;  3F73 A;  3V1Q A;  1ZBI A;  1ZBL A;  2BUP A;  4CBX A;  3MN5 A;  1IG9 A;  2L8Y A;  4K88 A;  4CEE A;  4DQ8 A;  4DV2 K;  4IG3 A;  5J2N A;  4FWS A;  3RRG A;  3R3L A;  4CJT A;  5GAH P;  2VGM A;  3QFP A;  1NGH A;  4M63 C;  3UIQ A;  4DV6 K;  2J4R A;  3OYL A;  4DKW A;  2QWP A;  4H5R A;  3T1H K;  3CHW A;  4CEZ A;  2P5G A;  1UA0 A;  3C6U A;  4Q0B A;  4B1W B;  2BGG A;  1BIU A;  4IDK A;  4H8K A;  1BQM A;  4HTL A;  1YJW N;  3TSQ A;  3NCI A;  3OTO K;  4H4M A;  2BE2 A;  5LMN K;  1CZB A;  4O0J A;  5M1F A;  3MX2 A;  2FXU A;  1NJI O;  1NFJ A;  3WEE A;  3MEE A;  1A5W A;  5M1O A;  3EY1 A;  4JKE A;  3MX5 A;  2G8U A;  3AAR A;  3NH0 A;  1WLJ A;  4CJU A;  2NRH A;  2YHW A;  5GAE P;  5HRS A;  3THX B;  1VQN N;  3J7A P;  1IBL K;  1QTM A;  1NG9 A;  3DSD A;  3L0Q A;  3OYC A;  3A8Y A;  3AVF A;  3GG4 A;  3CC4 N;  2PAV A;  3OA9 A;  3EE8 A;  2JWK A;  3NGY A;  4KB1 A;  4QOZ B;  3O08 A;  4FLY A;  3PX6 A;  2IGI A;  2O8F A;  1HYZ A;  4FBK A;  3IRX A;  1JXE A;  2A40 A;  4CIF A;  1BL3 A;  2FLO A;  4M41 A;  3DLB A;  1CXQ A;  2IS3 A;  3HRG A;  4FJ5 A;  5E84 A;  2VWK A;  1NGB A;  3C6A A;  4CF2 A;  3LAK A;  1NMN A;  3VQA A;  4Z94 A;  1S5J A;  1N32 K;  4Z4G A;  4JKC A;  4FLT A;  1U04 A;  4CEQ A;  4CZL A;  3G10 A;  4XIU A;  3K59 A;  4JYA K;  3K57 A;  4DU1 A;  4DS5 A;  4TWA A;  4O55 A;  2P9I B;  3CC7 N;  3AVM A;  1YVN A;  3BEX A;  3HBT A;  4B08 A;  3LZJ A;  4OJR A;  2Q3S A;  3WXJ A;  5BRD A;  4M42 A;  1TKS A;  4JS4 A;  4AM7 A;  3QIN A;  4MLH A;  4H0T B;  1WOQ A;  3ZIE A;  4CJR A;  2GX9 A;  1ZYQ A;  1WSF A;  1IEZ A;  5I42 A;  1JJ2 M;  5AQZ A;  1K9M O;  4KI4 A;  4JKB A;  4BRN A;  5JIC A;  3PX4 A;  3T3F A;  2UXD K;  3ITH A;  1RT6 A;  3RMC A;  1YF5 L;  3HZ6 A;  3NF8 A;  3I33 A;  3UKR A;  3ZT0 A;  3WQT A;  1T03 A;  4DWI A;  4Z4H A;  4IWV A;  4J2A A;  3ZX3 A;  3CJC A;  4FXD A;  2P9S A;  3QET A;  2B6A A;  4B1U B;  3ID8 A;  1W97 L;  1J5O A;  3L3U A;  4CJL A;  3L7V A;  3DI6 A;  5JVH L;  3GL1 A;  3HOS A;  2NRT A;  4QS9 A;  4DFJ A;  4FJI A;  4F8R A;  4Q5V A;  3NE6 A;  4FWO A;  4BRG A;  2OPS A;  1U6Z A;  5HRP A;  1J54 A;  3CET A;  4BR5 A;  1GOA A;  4CJQ A;  1EXQ A;  4CHP A;  4XH5 A;  4W5R A;  5AQK A;  3LWL A;  3CJA A;  5DM7 L;  3O9U A;  1NMD A;  2GUI A;  4KV8 A;  1G57 A;  2UXC K;  4OGC A;  1WB9 A;  1VQM N;  3VQQ A;  3PLA A;  5EOY A;  5AQM A;  1MWM A;  4CZI A;  3EKU A;  1IKW A;  3P1G A;  2P9N B;  3V1R A;  4OO1 J;  1P8Z A;  4FBW A;  1BA0 A;  3O5B A;  1I94 K;  2P9B A;  1QSL A;  4RWT A;  4CHO A;  4BGA A;  3SJJ A;  3MGZ A;  4KHN A;  3I8B A;  2JWL A;  3CI5 A;  4AHV A;  3LWM A;  3K5M A;  1D9D A;  4OPJ A;  3AY9 A;  2KQ2 A;  3TAM A;  1S72 N;  3RSE B;  3BY5 A;  2D0B A;  4PWD A;  4WI1 A;  4BRF A;  1U4B A;  3U6F A;  4DLG A;  1IBM K;  4FJN A;  1X9J A;  2I7N A;  3GE1 A;  4JK9 A;  5T7B A;  5AJ3 K;  5J2P A;  3K9J A;  4FK2 A;  1X9W A;  1WSJ A;  1ATR A;  3VET A;  3IAY A;  3HP9 A;  4B9M A;  4IBN A;  3WNF A;  3MXM A;  3ASM A;  1D4X A;  3LVJ C;  1C0T A;  3N4Q A;  3VER A;  2UU9 K;  4HUE A;  5BPM A;  2F8S A;  1VSI A;  1ZC6 A;  1Q8I A;  1ESV A;  1BHL A;  1HUX A;  4YOR A;  2OCE A;  2GBZ A;  4I7F A;  3CCS N;  2RF2 A;  3OYN A;  4LFA K;  1YIT N;  3SZ2 A;  3F9M A;  3VEY A;  3UE5 A;  4JRP A;  2MX1 A;  3CXC M;  1T3V A;  2YJE A;  1X9S A;  4BR9 A;  3CCE N;  3O1W A;  3HOT A;  1H0X A;  1NU0 A;  1QZ6 A;  2BAN A;  3SLC A;  4KHP K;  3DM2 A;  1V4T A;  3CFP A;  4BRH A;  1LV5 A;  3H07 A;  1VSE A;  4DQI A;  4FJL A;  1D8Y A;  3D2E B;  3RWU A;  3TSP A;  5AQO A;  4CFB A;  4A57 A;  2HVI A;  4DMN A;  1LW0 A;  1WSH A;  3L2V A;  3MCA B;  4HUG A;  1YVU A;  3GDQ A;  2VYP A;  1KD1 O;  3LDP A;  3KKR A;  4JD2 B;  1HC7 A;  4FJJ A;  4DR5 K;  3E9O A;  2OTJ N;  5GIO A;  3SCX A;  3IAB B;  2FF3 B;  3VQ5 A;  2X78 A;  4MFB A;  3KTQ A;  4CES A;  4K42 A;  1T6C A;  5AQR A;  4EZ9 A;  1S1V A;  4N5S A;  4DU4 A;  3GOI A;  1N33 K;  3SPZ A;  3CJ9 A;  4LF6 K;  3AJE A;  3C95 A;  1GOC A;  3VGK A;  3ZIH A;  1NK4 A;  3ZSQ A;  3CPE A;  2X6S A;  1BGX T;  2YI1 A;  3AVL A;  4H03 B;  2E6M A;  2KHO A;  4JKF A;  3P39 A;  3AO5 A;  4O44 A;  3OYJ A;  4BC2 A;  4I2P A;  4O8U A;  5EY4 A;  3U6Y A;  2O4G A;  5LL6 Z;  4FJG A;  1QE1 A;  2YV0 X;  1TAQ A;  3VF4 A;  2AJQ A;  3RR8 A;  1LWC A;  1W7A A;  5FRO A;  1IJJ A;  1DTQ A;  3RR7 A;  1OKJ A;  1IKX A;  5M1K A;  3ID6 A;  2QWR A;  1KK9 A;  1SL2 A;  3P31 A;  4B3M K;  4DR2 K;  1NK5 A;  3H6E A;  1HNX K;  2KTQ A;  3EEQ A;  4ELU A;  1KAZ A;  2BTF A;  3OHR A;  3VQ4 A;  4JRQ A;  1K4P A;  3TTF A;  4FW2 A;  4WYB A;  1VSH A;  4LFC K;  5CHI A;  1VR4 A;  1TKD A;  1L5U A;  2YHA A;  3CFO A;  1FJG K;  3F5T A;  3CM5 A;  4FM0 A;  3LDO A;  3ZLJ A;  4MO4 A;  4EP5 A;  5AZJ B;  1Q86 O;  4XH1 A;  1GLJ O;  3CJB A;  3O4Q A;  5C2D A;  3V9W A;  3C6H A;  1XC9 A;  3AVH A;  1MU2 A;  1XC3 A;  2ZD1 A;  4M3U A;  2VCP A;  1PAV A;  4I9L A;  4KAZ A;  4DR6 K;  3H08 A;  5KPR A;  4IXC A;  3RVC A;  4YKE A;  3DXK B;  4B3O A;  4YOT A;  2P5O A;  1RT7 A;  2Y1I A;  2WUS A;  1TV6 A;  4DQQ A;  4O0I A;  4NZR M;  5KPZ A;  1K7J A;  1U49 A;  3SI6 A;  3TOE A;  3KK2 A;  3C0B A;  2HNZ A;  1NK0 A;  1LN4 A;  4LH5 A;  3LDN A;  2RHK A;  3SBG A;  3HM9 A;  1Q18 A;  4LF5 K;  4E7H A;  2YCH A;  4HVJ A;  2RKI A;  3AVK A;  1HQE A;  4CZG A;  4KRE A;  4M45 A;  3ATV A;  4NCG A;  3BDP A;  4CJV A;  3ZEU A;  3SPY A;  1N5Y A;  3PX0 A;  4FCX A;  4M7Y A;  1NWK A;  5FPM A;  1NK7 A;  2O8B A;  1JDQ A;  3SV4 A;  3U3Y A;  1QS4 A;  4DTP A;  1NNE A;  4K41 A;  1J53 A;  1H4T A;  3DRR A;  2ASP A;  4B9U A;  1KVC A;  4DV7 K;  4OKE A;  4CEF A;  4IOA L;  5H1S Q;  4DV0 K;  1PVW A;  3LP2 A;  4IFV A;  4FBQ A;  3WNE A;  4IEI A;  3OYG A;  3HK2 A;  3DLE A;  4L8R B;  2EH1 A;  2LXR A;  3QLH A;  1K4L A;  4WQ4 C;  4CF9 A;  1N36 K;  4AH9 A;  3KWG A;  1G99 A;  3MIO A;  4U7B A;  3IAL A;  3NF9 A;  3VTH A;  1XWL A;  1ASU A;  3TAP A;  3T69 A;  3VGL A;  3R9P A;  3UB5 A;  3IKM A;  1DCJ A;  4DV1 K;  1IH7 A;  1EX4 A;  1XNR K;  2Q0R A;  4BDY A;  1E4F T;  4CED A;  3AVI A;  3KD5 E;  3NVM A;  4BC3 A;  4ISE A;  2HHX A;  1KAY A;  3PO4 A;  1NLV A;  4N41 A;  4A59 A;  1RBT A;  4W5N A;  4I9Q A;  3D0P A;  4Z9E A;  1B92 A;  3JAM O;  4NCA A;  3M5R A;  4EAH D;  1NGC A;  2P9U A;  1NGD A;  3M8Q A;  2EWS A;  3MXJ A;  4MDB A;  4N56 A;  2NLX A;  3HZ7 A;  3VQD A;  3L2Q A;  4AHR A;  4U67 L;  1HPM A;  3DLK A;  5AQJ A;  4CZE A;  2CGJ A;  3JXU A;  4B1X B;  4BY9 C;  1BOT O;  4FJH A;  3ZET A;  5AQN A;  2DTU A;  4KHS A;  3B6O A;  4JKD A;  4B3R K;  5ADX H;  3L8B A;  3VEV A;  5BPN A;  4P6C A;  4CGD A;  2OZS A;  1TYQ B;  1SL1 A;  1S6Q A;  4HWI A;  4H0Y B;  4E1B A;  1JE3 A;  5J2Q A;  4F4K A;  4RW7 A;  5AQV A;  3J7Z O;  3S3N A;  4YHH K;  5JLH A;  1VQL N;  3KLH A;  4FL9 A;  3T19 A;  4XEI A;  4F3O A;  1U45 A;  3O1B A;  3DWL A;  1NJ8 A;  2ZJQ L;  1LCU A;  4BQL A;  4CD1 A;  5DM6 L;  1RT1 A;  3NH1 A;  4LSN A;  2O8E B;  4FLW A;  4CW7 B;  1FK9 A;  3VEW A;  5GAG P;  3C94 A;  4DV5 K;  3ENB A;  4CEA A;  3FZF A;  3ULE B;  3LP3 A;  5SWM A;  3NHG A;  1VM0 A;  5GIN A;  2P9K A;  4FLX A;  1HJR A;  1KC8 O;  2GEM A;  3IAB A;  1K8A O;  3DXM B;  4FWK A;  4JKG A;  4EP4 A;  2KKZ A;  4X66 K;  3LPT A;  1VQP N;  3LM2 A;  3HT3 A;  1HR0 K;  1HNV A;  1D9F A;  5M1N A;  4C23 A;  1EWR A;  3SUN A;  3VEX A;  3LP0 A;  4M3R A;  4DTJ A;  4J2E A;  1WSE A;  3R1X A;  2OPQ A;  4O5F A;  3IMX A;  4H0V B;  3TAR A; 
#chains in the Genus database with same CATH homology
 3TTC A;  1YF5 L;  2E1Y A;  4GVE A;  3WXL A;  1VQ7 N;  3HZ6 A;  3I33 A;  4CZM A;  2QXL A;  3UKR A;  1JCE A;  1HRU A;  2FSJ A;  1K49 A;  3WQT A;  1TYQ A;  4P77 A;  4IWV A;  3SK3 A;  3ZX3 A;  3CJC A;  5C2F A;  4PL7 A;  2CGK A;  4YDU A;  2P9S A;  4H0X B;  1KXP A;  3CJ1 A;  2ASO A;  5M1P A;  4B1U B;  3ID8 A;  1W97 L;  3E9L A;  5KPT A;  5JVG L;  3H1V X;  4BC4 A;  1MA9 B;  4ILJ A;  1HKG A;  3B8A X;  5E26 A;  3CME N;  3VPZ A;  3L7V A;  5ADX A;  3P38 A;  5AQY A;  4FWP A;  4WFA L;  3IFR A;  3OBY A;  2HF3 A;  5JVH L;  3GL1 A;  3D6R A;  2NRT A;  3HOS A;  4QS9 A;  2ZJR L;  3MK5 A;  5MLC Q;  2AP1 A;  1YHQ N;  3VOV A;  4FWO A;  2V51 B;  4IJN A;  4BRG A;  3BF1 A;  2IIR A;  1U6Z A;  3ZET B;  3U9Z A;  4CJ7 A;  3SAG A;  4H5N A;  1BU6 O;  4DHY A;  1V4S A;  3CET A;  4BR5 A;  4FO0 A;  4WQ5 A;  1YI2 N;  1BO5 O;  4JKA A;  1HJO A;  4XH5 A;  4GY2 B;  5BRF A;  5C12 A;  4ILG B;  3KK7 A;  2DPN A;  5AQK A;  3CJA A;  3Q7C A;  3O9U A;  5BN9 A;  1MDU B;  5DM7 L;  1NMD A;  1OVY A;  2W40 A;  4DB3 A;  4JKG B;  2A6A A;  1JCG A;  4JK7 A;  4PKH A;  1G57 A;  3VMF B;  4UY8 O;  3CC2 N;  1VQM N;  4YOX A;  3PLA A;  5EOY A;  5C0Y A;  5AQM A;  1X3N A;  4IO8 A;  1R59 O;  4CZF A;  1YJN N;  1BWF O;  1XQS C;  3QDK A;  1MWM A;  4CZI A;  3EKU A;  3ZX2 A;  3KWI A;  3L4I A;  4BGB A;  5LJW A;  3ZX0 A;  1Z05 A;  5AQI A;  3SMS A;  1VQ8 N;  2P9N B;  4OO1 J;  4PHT X;  4FBW A;  1BA0 A;  1MWK A;  1P8Z A;  3O5B A;  2P9B A;  5AQL A;  1NM1 A;  4RWT A;  1NBW A;  4BGA A;  4GV9 A;  1GLF O;  3MGZ A;  3I8B A;  2JWL A;  4HVZ A;  1U2V A;  2OAN A;  3CI5 A;  4FOI A;  2H3G X;  3DAW A;  3SJH A;  4P6P A;  4BRM A;  3O8M A;  3AY9 A;  3FLC O;  2E2N A;  5F1X A;  3CF5 L;  2V7Y A;  3H1Q A;  2OTL N;  2WC9 A;  2P9P B;  3AGK A;  5AQU A;  1S72 N;  3RSE B;  3FFK B;  4BRF A;  4FWR A;  1X9J A;  3ULE A;  2I7N A;  3GE1 A;  4JK9 A;  3K9J A;  3K9K A;  4BRC A;  3AGR A;  2QTD A;  3LDL A;  2CGL A;  4IFE A;  4R79 A;  2A5X A;  1ATR A;  2CH5 A;  3VET A;  3W3D A;  4LC9 B;  4CBU A;  3GBT A;  5GAD P;  1W2B M;  1VQO N;  4BR0 A;  4WQ5 C;  5AR0 A;  3VGM A;  4A61 A;  1Q7Y O;  1D4X A;  2F9T A;  3C7N B;  5KQD A;  3N4Q A;  4RCH A;  5EXW A;  3VER A;  3D7E O;  5FPE A;  3L4Q A;  3SAF A;  5HOO A;  5AQX A;  2E20 A;  1WUA A;  4BRQ A;  5BPM A;  3E1Y A;  1QQO A;  1ZC6 A;  4FSV A;  1NGF A;  4KBO A;  1ESV A;  3BUZ B;  3ZII A;  3PIO L;  1HUX A;  4YOR A;  3U8X A;  5EVZ A;  3KZB A;  3CCS N;  2KLA A;  2F7T A;  5BR9 A;  3WT0 A;  2GTD A;  1YIT N;  3F9M A;  3VEY A;  4A2A A;  3UE5 A;  5CE3 A;  3ZEU B;  3ATU A;  2MX1 A;  3CXC M;  2PBD A;  1T3V A;  2YJE A;  1YJ9 N;  4BR9 A;  3CCL N;  3CCE N;  3DJC A;  4CZH A;  4MDA A;  1VQK N;  3VF6 A;  1VQ5 N;  2WBN A;  3O1W A;  3HOT A;  1NGG A;  1G58 A;  4IJA A;  1QZ6 A;  2BH1 A;  3SLC A;  5BPL A;  3WEE B;  1V4T A;  3H3O B;  4KH5 A;  4BRH A;  3VTI A;  1NGA A;  3O9R A;  3MDQ A;  4FPA A;  4RTF D;  3H07 A;  2D0P A;  1K8K B;  3D2E B;  5AQW A;  3CMA N;  3HTV A;  3TSP A;  5AQO A;  5C15 A;  3C65 A;  1O13 A;  4A57 A;  4BRO A;  1K73 O;  4I14 A;  2ZWH A;  3MCA B;  2D4W A;  3M3Z A;  3GDQ A;  2VYP A;  3DXK A;  1KD1 O;  3A5N C;  1SNN A;  3LDP A;  2P9P A;  4JD2 B;  3MMV A;  3O9Q A;  4BRP A;  1E4G T;  1YIJ N;  2FSK A;  3VES A;  3CIP A;  2GEL A;  3E9O A;  2OTJ N;  1BA1 A;  2F9W A;  5GIO A;  5F0X A;  4GNI A;  2FF3 B;  2FF6 A;  3A0I X;  3FZM A;  4E1J A;  4C1N K;  4JEP A;  5ELZ A;  2GUP A;  2ITM A;  4F9O A;  5AFU A;  4K42 A;  2HBM A;  3EKS A;  2YHX A;  1T6C A;  3BF3 A;  5AQR A;  4YOW A;  1QVG M;  4BRD A;  3HI0 A;  3GOI A;  3U4L A;  1K4O A;  4ISF A;  3WXK A;  5HL7 L;  3CJ9 A;  3C7N A;  3W0L A;  2P9L A;  4FWM A;  5F2R A;  1DKG D;  3DLL L;  3AJE A;  3P4I A;  3VGK A;  4BRE A;  4A5A A;  3ZIH A;  3QML A;  1ZBS A;  3CPE A;  4QS7 A;  2V52 B;  2YI1 A;  4DCH A;  4H03 B;  4BVP A;  3P04 A;  4XH4 A;  2KHO A;  3UKR B;  5BRE A;  4JKF A;  3P39 A;  2HBJ A;  3CJ7 A;  4H0P A;  4J8F A;  1SS6 A;  2QWL A;  3H46 O;  3M1F A;  4MO5 A;  4BC2 A;  4EHU A;  4O8U A;  5EY4 A;  1H1V A;  3VEZ A;  4Y0W A;  1P90 A;  2QI2 A;  4WFN L;  3O80 A;  3TU5 A;  5BN8 A;  3VF4 A;  2CH6 A;  3NVK A;  2QW9 A;  5FPD A;  3CQX A;  2HBL A;  3MN7 A;  1PVY A;  5LY3 A;  1Q81 O;  2QM1 A;  2P9U B;  3DXM A;  5AQF A;  4YOV A;  4JKH A;  1IJJ A;  4OPH A;  3NMU A;  1OKJ A;  2ZF5 O;  4ISG A;  3AAP A;  1QVF M;  5M1K A;  1K8K A;  3D2E A;  2E2Q A;  3TSU A;  3ID6 A;  4BR7 A;  4CI6 A;  2QWR A;  3H3N O;  1KK9 A;  3P31 A;  2QWQ A;  4EHT A;  2FSN A;  4KH6 A;  3A5O C;  2A41 A;  1RFQ A;  3ZYY X;  3H6E A;  5C10 A;  4I6M A;  5AQT A;  3CER A;  2NRX A;  3LM9 A;  3UKU B;  2RIS A;  3LQU A;  1RDU A;  1KAZ A;  2BTF A;  3OHR A;  2YX6 A;  5AQG A;  2IVO A;  4FWL A;  2Q31 A;  4NLC A;  2D1K A;  2RIU A;  2HF4 A;  1K4P A;  3TTF A;  4WYB A;  3SAH A;  3VEN A;  5TKY A;  3FZH A;  2QWN A;  5CHI A;  3WQU A;  2NNW A;  5CR4 A;  1VQ4 N;  1J6Z A;  2P9S B;  3QBX A;  1T6D A;  3LDQ A;  3F5T A;  3PIP L;  3FZK A;  4K25 A;  2HOE A;  3LDO A;  1S22 A;  2P9N A;  5GIP A;  1T44 A;  4MO4 A;  3QB0 A;  3S41 A;  3MWT A;  2Q1N A;  5AZJ B;  5M1Q A;  4B1Y B;  1Q86 O;  1QHA A;  4XH1 A;  1GLJ O;  3CJB A;  1NGJ A;  4MLE A;  5C2D A;  2YHY A;  1TUY A;  1U2V B;  3C6H A;  5JMV A;  4GV6 A;  3ZIG A;  1XC3 A;  3N4P A;  3MN9 A;  3G4S N;  2VCP A;  4H5V A;  3BP8 A;  2A42 A;  4BG9 A;  4A2B A;  1DGK N;  3AAQ A;  3TTD A;  5KPR A;  4H0O A;  4IXC A;  2HBK A;  4BRK A;  1M90 O;  2YJF A;  3RVC A;  4BG8 A;  4YKE A;  3DXK B;  3G25 A;  4OPA A;  2E2P A;  4IZ9 A;  2I7P A;  5FPN A;  1DEJ A;  4JD2 A;  4YOT A;  4B1V A;  1RDW X;  3A5M C;  4B1Z A;  4EFH A;  3IUC A;  2WUS A;  3MK6 A;  5KQ8 A;  4O8K A;  2ZJP L;  2D0O A;  4ILH A;  3E9P A;  3EE9 A;  2WFB A;  4JHD B;  5AQP A;  3CPW M;  2E1Z A;  3WXM B;  4NZR M;  1BUP A;  1QQM A;  5KPZ A;  1K7J A;  2E88 A;  3VEO A;  1SZ2 A;  4YOU A;  2QA4 N;  2RE2 A;  4QS8 A;  1S3X A;  4WQ4 A;  1EO1 A;  3EN9 A;  3CQY A;  3CD6 N;  2QWM A;  3D2F A;  3OW2 M;  3VF2 A;  4FWQ A;  4FPB A;  1HLU A;  3C0B A;  3ENO A;  3FGU A;  3WXI A;  3LDN A;  2RHK A;  1XUP O;  4I6M B;  3SBG A;  4AF1 A;  1Q18 A;  1YXQ A;  4WF9 L;  1BDG A;  2YCH A;  3O6W A;  4CZG A;  4M7X A;  4IO9 L;  1TKU A;  1QQN A;  3ATV A;  5AZI A;  3G71 N;  1C0G A;  4IDH A;  3ZEU A;  1ILY A;  4FCX A;  4M7Y A;  1GLL O;  1NWK A;  4IOX A;  1HKC A;  3E66 A;  4H5T A;  5FPM A;  2E8A A;  4JNE A;  4WFB L;  1VQ9 N;  2VGN A;  3CCJ N;  4BC5 A;  2UYT A;  4K41 A;  1GLC G;  4WCE L;  3FZL A;  1ATS A;  2ASP A;  2V7Z A;  1KQS M;  1IG8 A;  4YDU C;  2E2O A;  4AM6 A;  3FR0 A;  4IOA L;  5H1S Q;  3OBW A;  4K43 A;  1PVW A;  3JS6 A;  4G9Z A;  4FBQ A;  3SMP A;  1X3M A;  2NRR A;  4IEI A;  2EQA A;  1GLA G;  5BRH A;  2Q36 A;  5AQH A;  1K4L A;  2ZGZ A;  1VAZ A;  4WQ4 C;  3LRJ A;  4IOC L;  3UKU A;  2P9K B;  2P9I A;  1GLB G;  3KWG A;  3RSE A;  1K4I A;  1G99 A;  3M6G A;  3MIO A;  2Q97 A;  3QFU A;  3ENH A;  3R6M A;  4U7B A;  4PL8 A;  4CZJ A;  3VTH A;  4FOE A;  2IVN A;  4CZK A;  1TUU A;  2BUP A;  1CZA N;  4CBX A;  5TKW A;  4BR2 A;  3MN5 A;  4C1N I;  3T69 A;  3VGL A;  3R9P A;  3UB5 A;  3IKM A;  4DQ8 A;  2Q0R A;  1SQK A;  1E4F T;  1Z6R A;  4FWS A;  2GWJ A;  3CCM N;  1RGI A;  3R3L A;  3NVM A;  4BC3 A;  5AZJ A;  4PKI A;  4BRI A;  4ISE A;  2VGM A;  2ZGY A;  3QFP A;  5GAH P;  1M1K O;  1HKB A;  1NGH A;  1KAY A;  4M63 C;  5LJV A;  4FFJ A;  3Q7B A;  2J4R A;  2W41 A;  4DKW A;  1XEZ A;  2QWP A;  4H5R A;  3EO3 A;  3CHW A;  1NLV A;  3T7Z A;  3U9D A;  4JAX A;  4EO0 A;  4BQZ A;  2AA4 A;  4B1W B;  4A59 A;  3LS6 A;  2NRZ A;  4A5B A;  4GV3 A;  4A62 A;  3I55 N;  2ASM A;  3T1I A;  3M5R A;  4HTL A;  3HM8 A;  3TSQ A;  4BRL A;  4EAH D;  3CCV N;  1NGC A;  2P9U A;  1NGD A;  1YJW N;  4P8E A;  2EWS A;  4MDB A;  2NLX A;  1LOT B;  1C0F A;  1SAZ A;  5M1F A;  4NZT M;  3MX2 A;  4NLB A;  1YAG A;  1HPM A;  2FXU A;  4NB4 A;  4U67 L;  5JLF A;  1NGE A;  2NZT A;  1HX1 A;  5AQQ A;  3WEE A;  1NJI O;  3KHY A;  5M1O A;  5AQJ A;  4CZE A;  2CGJ A;  3JXU A;  3L6Q A;  4JKE A;  3MX5 A;  4YOY A;  2NRV A;  3EL2 A;  4B1X B;  3AAR A;  4BR4 A;  3R8E A;  4BY9 C;  1BOT O;  3I56 N;  3ZET A;  2NRH A;  2YHW A;  5AQN A;  2Q0U A;  5GAE P;  1VQN N;  3QIC A;  2GWK A;  3L0Q A;  3A8Y A;  4JKD A;  4NO7 A;  1DT9 A;  5ADX H;  3GG4 A;  3CC4 N;  2PAV A;  1ZXO A;  2A3Z A;  2PFU A;  3OA9 A;  3VEV A;  3KVG A;  4BVO A;  5BPN A;  3EE8 A;  4FVU A;  4P6C A;  2JWK A;  3SBT A;  1TYQ B;  4HWI A;  3O08 A;  4H0Y B;  2QWO A;  4L3Q A;  3O4W A;  4E1B A;  3IDH A;  4FBK A;  1BG3 A;  4P6D A;  5AQV A;  3J7Z O;  2A40 A;  3F2K A;  2FLO A;  5JLH A;  1VQL N;  2HST A;  3HRG A;  4FL9 A;  4XEI A;  5E84 A;  5B8H A;  4JN4 A;  1Q82 O;  1NGB A;  3C6A A;  3O1B A;  4Z94 A;  4CBW A;  3CCU N;  3DWL A;  2ZJQ L;  1LCU A;  4JKC A;  4BQL A;  4CD1 A;  1Y64 A;  3FE1 A;  2HMP A;  2VWB A;  5DM6 L;  3LL3 A;  3MWP A;  4KH4 A;  4EIA A;  3J8A A;  4CZL A;  1KAX A;  3CCQ N;  3VEW A;  5GAG P;  4PKG A;  3MN6 A;  3QBW A;  1GLD G;  3ENB A;  4B9Q A;  5AQS A;  3FZF A;  3ULE B;  4IEE A;  3O9S A;  4JK8 A;  4JHD A;  5GIN A;  2LN3 A;  2P9I B;  2P9K A;  3CC7 N;  3O9T A;  5I9E B;  3MCP A;  1YVN A;  5AFU H;  3BEX A;  3HBT A;  3G6E N;  1KC8 O;  2GEM A;  2Q2R A;  1K8A O;  1JCU A;  4BRA A;  3DXM B;  3A5L C;  4FWK A;  4JKG A;  2KKZ A;  4H5W A;  3WXJ A;  5BRD A;  1TKS A;  1QZ5 A;  3EZW A;  4AM7 A;  3TPQ A;  4MLH A;  4H0T B;  3LM2 A;  1VQP N;  3D2F B;  1WOQ A;  1VQ6 N;  3ZIE A;  3HSC A;  2QEX N;  5EX5 A;  2IVP A;  2GX9 A;  1N8R O;  1GLE G;  1JCF A;  1EQY A;  3H45 C;  3WUH A;  1IEZ A;  4FWN A;  1JJ2 M;  5AQZ A;  2NRW A;  5M1N A;  1K9M O;  4C23 A;  1ATN A;  4JKB A;  2P9L B;  4BRN A;  3VEX A;  5JIC A;  1NGI A;  3R1X A;  5AZI B;  3CCR N;  1YUW A;  4O5F A;  3IMX A;  4H0V B;  4P8J A;  4CD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...