3TSPA

Crystal structure of e. coli hypf
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Transcriptional regulatory protein
total genus 212
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tspA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tspA01
3VEOA 3VETA 3TTFA 3VESA 3TTDA 3TSQA 3TTCA 3VTHA 3VEZA 3VEXA 3VERA 3VF2A 3TSPA 3VEWA 3VTIA 3VENA 3TSUA 3VF4A
chains in the Genus database with same CATH superfamily
4N5SA 2A41A 4H03B 5GADP 4DHYA 4I6MB 1J53A 3AO1A 4JV5K 1RDWX 4NO7A 4DFJA 3A5OC 1FKOA 4GV9A 3QETA 1J5EK 2VWKA 5EU7A 3SZ2A 1SQKA 2WFBA 4KV8A 1L3UA 4FJXA 4IBNA 1JLBA 3ENOA 1HQEA 3CHWA 2RF2A 3NHGA 1NM1A 1NOYA 2FSJA 4YDQA 2J4RA 4O0IA 1A5VA 2ZGYA 1NJ2A 4OJRA 3VESA 1BUPA 4ZHRA 3MCAB 3LDSA 1R59O 2HF4A 3MECA 5CZ2A 4CJ3A 3VGKA 3K2PA 3T1IA 2PAVA 5F1XA 3DRRA 1KAZA 3WXKA 4Y1DA 4FJHA 1YUWA 4BRFA 5AQGA 4NYFA 5F0XA 3SQ4A 4K42A 1U45A 2E5LK 1VQLN 4B1ZA 3CPWM 4BACA 2BGGA 1CZBA 5KRSA 1KRPA 1GLDG 4W5NA 4XH4A 5KPTA 5AQXA 4BRGA 1ZXOA 4FW1A 3CFPA 5JVHL 1XI1A 3I0SA 4PL8A 2ZJQL 1WOQA 1IBKK 4TWAA 3LVJC 4MLEA 3DXMA 4KHYA 3RSEB 1VRTA 3SJJA 4JK9A 5BN8A 3TAPA 3KVGA 4FLYA 3L0QA 3CQXA 1C1CA 4DR3K 1YHQN 5C24A 4JI2K 3BEXA 4IFYA 3EY1A 4BR2A 4BE2A 3QNNA 4WE1A 4CGFA 3O3FA 4JI8K 3VGMA 3SV4A 2G8KA 4DV0K 4K86A 3CMEN 1FKPA 1KLMA 2HBKA 4C8MA 5KQDA 1UA1A 1CLQA 1TK5A 4FWNA 2HNZA 4IEIA 2ZJRL 3OYFA 4PQUA 4F3OA 1QQOA 2GBZA 3T69A 4PKIA 4BRCA 3SBTA 4DQRA 4DV2K 4FCYA 4RW9A 4FPBA 4CJFA 3SQ0A 5KPZA 4AHUA 3TTCA 3VEWA 4K41A 3MGZA 5FRNA 2G8HA 4KBOA 2F4VK 5AQJA 5HRSA 3O4QA 1X3MA 4P77A 4IOCL 1NGCA 3JS6A 3WEEB 4OX9K 1EWQA 4CGGA 1YAGA 3NF7A 4NYNA 5AQUA 1NGHA 1W7AA 2ASMA 3OS0A 3BY5A 5C12A 2A40A 1S6QA 5AQLA 1GLFO 1QQNA 3I0RA 4LH5A 3L2RA 4DV1K 4B3TK 3HO1A 2HVHA 3THXB 1ZBLA 3K5MA 1X9SA 1JCUA 4CJKA 3V9SA 4DTXA 2R7YA 4FLTA 1NFHA 4AHSA 3A8YA 3AGRA 3JXUA 1SL2A 1Q86O 3B6OA 4DWIA 1HNIA 3KK2A 4N76A 3VQPA 4DV3K 1TK8A 1Q7YO 4E1NA 3AVMA 2HW3A 4FJIA 3B6PA 2E2QA 4M63C 4KHQA 4CEQA 3LALA 4FWOA 4M7XA 4MLHA 4EZ6A 5CR4A 4LF9K 1Z25A 4NXNK 4A59A 4JEPA 5KGWA 4JI4K 3K0SA 2FBYA 1XHZA 2YNIA 4BC5A 3AVJA 5ELZA 1LW0A 3NH0A 3IDHA 2Q1NA 4FJKA 2E6MA 2AP1A 4FJ7A 3HVRA 2PY5A 4QAGA 3TAQA 1IV0A 5AQQA 2EH1A 4I6MA 1N6QA 3EYZA 4FWPA 4C1NK 1VSIA 4V19S 3M6GA 3DAWA 4H5RA 4DV5K 1WSIA 2NLXA 3QERA 2NRHA 2NZTA 3LAKA 1J6ZA 4RG8A 5AQSA 1Z26A 2VQEK 2A1SA 1WUAA 1NGEA 3PO5A 2HSTA 4ILGB 4E0DA 4QOZB 2P9IB 1ZC6A 4M41A 1F21A 3WEEA 4BRMA 4L8RB 1QVFM 4M45A 3VEVA 1H4QA 3AVHA 4DUZK 4CEOA 1KD1O 4E7LA 1S1XA 2JLEA 3DMJA 3MN5A 2P9NB 4KAZA 3TARA 1HKCA 3NCIA 1VSLA 4B3SK 2P9SB 4H0VB 4JAXA 1C1BA 5DMRA 1KVAA 3ULEA 1S9EA 4LF7K 5KTQA 3P39A 1L3SA 1N32K 4B9LA 1XWLA 3RSEA 3OJUA 3MK6A 3WXLA 3OBYA 4LF5K 4B9QA 5AQFA 4FZXC 4RTFD 4R5PA 4YNQA 1NGFA 1P8ZA 1BISA 5FPDA 3ZIGA 3PSFA 4HD0A 2KQ2A 4YOYA 3FLCO 3CJ7A 4JKEA 3K5LA 4AQYK 2Q3SA 4KHSA 3A2FA 2E20A 1E4GT 3ENHA 4KI4A 1Q8IA 2QM1A 2Q31A 1XC3A 1J54A 1S3XA 3NFAA 4FJ9A 4CJSA 4E1BA 3S41A 5E26A 1U48A 4CHPA 3IRXA 4GV3A 4I14A 3F9KA 3ZIEA 1ZBUA 4BRKA 5EY4A 4A5BA 3LDPA 1LN4A 3LPUA 3TABA 3AAQA 4CZJA 1S8EA 3LM9A 2D0OA 3ZT4A 3AA5X 4GV6A 3H07A 4RW7A 1HKBA 2YJFA 3G6EN 2F96A 3FE1A 3C6AA 1T03A 1D9FA 1HLUA 4CD3A 3QESA 4EIAA 1JKHA 4CHQA 3ZSOA 1JCFA 1Q82O 3TAMA 4C8KA 2V52B 1HMVA 1S1UA 5GAEP 3HSTB 4LFCK 4ILHA 1SKSA 4CGJA 4F8RA 2DY4A 4WF9L 5M1FA 3R3LA 2O8CB 1T3VA 4JRPA 1IJJA 1YVUA 1YTAA 3CQ8A 2FXUA 3PIOL 4JI7K 2HOEA 1ASUA 5BRDA 3PUFA 3A5LC 3IABA 1JDQA 5C25A 3SUOA 3G71N 3I8BA 3D2FB 1J5OA 2PYJA 3G0ZA 2B6AA 2X6SA 4EP4A 3M8QA 4E19A 4ELUA 4Z0UA 2HF3A 3PX4A 5KQ8A 2OANA 2IIRA 4TSXA 4HUFA 1KXPA 4M3YA 1X1PA 1L3TA 3VF6A 4FJLA 3EN9A 1VQ4N 1VAZA 2HBMA 4E1JA 5BPMA 3AVFA 4A2AA 4BVOA 4DB3A 2GTCA 2F8SA 4PWDA 3JSMA 3OYNA 2YHBA 1JLQA 1YJWN 3FFIA 3DI6A 1HYVA 2OCEA 3DSDA 3THWA 1UDVA 5HP1A 1EX4A 1LCUA 2KKZA 2OTJN 3HZ6A 4M3RA 4H5TA 3WQUA 3CC7N 3ZYYX 1JL2A 3VEZA 2QW9A 2BH1A 3M5RA 5FROA 1KLNA 1YIJN 1BHLA 3AVGA 4OLBA 4CBXA 3RWUA 3OW2M 3ENBA 4GVEA 1DTTA 1A5XA 5IT9O 4P6DA 4BR9A 5SZTA 5BRFA 3C6UA 4BDZA 4YDUC 2CH6A 1UA0A 2A42A 5EOYA 3CFOA 3AAPA 3ALYA 4B9SA 4FLVA 5C2DA 4P6PA 2YJEA 2QTDA 2IAJA 1K9MO 3AV9A 4CK2A 1Z6RA 4JD2B 1ZBHA 2W6LA 4WQ5C 4F2SA 4B3RK 3FZHA 1VR4A 2HHVA 4ZTJA 2BE2A 2D1KA 4JK8A 4PKHA 1NJWA 4JHDB 2Y1JA 1KSPA 2FBVA 2FLOA 1VSEA 4CIFA 4JS5A 1G57A 1BCMA 4KHPK 3W0LA 3VGLA 1C0GA 1VSDA 4CW7B 1S72N 4CFCA 4KHWA 2ZM6K 3I8DA 2Z1JA 1KAXA 3DYAA 4JRQA 4MO5A 4K43A 4PY5A 2Z7CA 3ID8A 5I42A 3S3OA 3N4QA 5BR9A 4B1UB 1NK8A 3TSUA 2IC3A 1C1AA 3CETA 4IFEA 1Y97A 1TAUA 3DSCA 3CG7A 4NLBA 1K6YA 4YKEA 4FLWA 4DTRA 4QS9A 3RVCA 1MA9B 3EO3A 4RWTA 4WCEL 4YORA 1MDUB 4IWVA 4J2DA 1X9JA 1NJYA 1K8KB 4CIGA 4JI3K 3U9ZA 2UYTA 4H0OA 3UE5A 3D2EA 4EO0A 4BC3A 4DTSA 4H0XB 1N34K 1NJ1A 3CM5A 1ITGA 5J2PA 3KLHA 4KPYA 1PVYA 4CJ5A 3QMLA 2YNGA 4K88A 3C94A 5AFUH 1KFSA 2UUCK 3NE6A 5CYQA 4DSLA 4LD0A 1WAFA 3GDQA 1QTMA 3KK7A 3PX0A 3AARA 4XEIA 1BA1A 1M1KO 2D0AA 1U4BA 1O1WA 1P90A 1XQSC 2GX9A 1WSJA 1NGDA 1RT1A 1EETA 4FO0A 4OKKA 2HHWA 3ZT0A 3VEOA 3WNGA 1NGAA 3H08A 1GLCG 4IJNA 3OYJA 4DTPA 2CGKA 3OBWA 1EQYA 4FWQA 1RILA 2BTFA 1RT3A 3PIPL 4O44A 5GINA 3VA3A 4CBWA 1ATSA 3FZMA 3FR0A 3MX2A 4DR2K 4FYDA 1IG9A 3EKUA 3CCJN 3CD6N 3KWIA 1B92A 1VM0A 3F9MA 3H1QA 3LDNA 4M3ZA 5A2QO 1SNNA 4H4MA 4OPJA 2BKYX 1WBDA 3HI0A 3O6WA 3DLGA 3QIPA 4BROA 3VQBA 1W97L 3AVLA 4BRIA 4M3TA 2G8VA 3DXKB 3HTVA 4EHTA 2A1RA 1N5YA 1JLAA 1TYQB 4DQ8A 1DCJA 2ZD1A 5AQWA 4YHHK 1L5UA 1QS4A 3SBGA 3VETA 1NMDA 2V51B 2RPIA 1SZ2A 4FWSA 2P9PA 3U4LA 3MEEA 1HJRA 1D9DA 2P9NA 1LW2A 3P83D 4P8JA 2E2OA 4QCLA 1C0FA 4UY8O 3BF3A 4CFDA 3HP6A 1R0AA 3H46O 4CJ7A 1WSGA 4Z4IA 1NGJA 4OKEA 4FM0A 5AQKA 3U6YA 4OVLA 3ZEUB 4IZ9A 5CZ1A 4DSJA 2E2PA 4LFAK 1G15A 1Y9XA 4FFJA 4J8FA 3UKUB 4HCCA 4N41A 3P38A 1JCEA 3L2WA 2YHXA 4I9QA 1XNRK 5I3UA 1K4IA 2UXCK 2HMIA 4JNEA 4AH9A 5J2NA 1H0XA 1OH8A 3VF4A 4KO0A 5M1KA 2PZSA 5AJ3K 3LP1A 4YOTA 1FK9A 2Y1IA 4OGCA 3THYB 4G1QA 3O3GA 4IKFA 4CHYA 4MDAA 1U6ZA 2HHHK 3CI5A 3KK1A 3BUZB 3S3MA 5AZIB 4I2QA 3M8RA 4GVMA 3NMUA 2KFNA 3BF1A 1HPMA 2RE2A 3HM8A 3DLHA 1NGBA 3VPZA 4FLXA 1O13A 4IJAA 2YHYA 1QVGM 1YXQA 4R79A 3KIOA 5AZJB 3AVIA 4B3OA 3G4SN 1KVCA 4CZKA 1IKVA 1ZBFA 4DR5K 3MEGA 4AHCA 4KHNA 1B9FA 1WSHA 1MU2A 3RTVA 1BGXT 3CJ9A 3LWMA 1RBUA 3O9QA 4BWMA 4YY3K 3UIQA 3OVNA 2XHBA 1S22A 1BL3A 1VRUA 2QKBA 2KW4A 5HBMA 3OYAA 3NF9A 3DLRA 3ITHA 4CGHA 1G99A 3E9LA 4DTMA 4CECA 1TYQA 3C6TA 4B8AB 2PBDA 2YV0X 4CGDA 4MO4A 5B8HA 1JCGA 2Q0RA 3J7YP 2QEXN 3N4PA 3BZKA 3MEDA 3NGIA 3AA4A 3V81A 3SK3A 4DTJA 3ZT2A 3P4IA 2Q97A 3ZCMA 4K25A 3BZCA 4C23A 1JLGA 4BRPA 3M8PA 4EHUA 3MXMA 4J2BA 4FL9A 3HK2A 3UB5A 4ID1A 3V9WA 2E1ZA 2RN2A 3FFKB 2KZMA 2E8AA 5AR0A 3QFPA 1WSFA 2JGUA 2QWRA 1NFJA 2BANA 1DT9A 5AQPA 2ASOA 2WONA 3U8XA 4B1WB 1ASWA 4Z4HA 2CRQA 1NK6A 5LL6Z 4IG0A 3ZX3A 1GLJO 4E7KA 2IOCA 3SUNA 3WUHA 4FJ5A 2QI2A 4NCAA 3T1HK 4FWLA 4AILC 3OHRA 3MN7A 3MCPA 1T7PA 2OZSA 3HM9A 3ZSZA 3VQ9A 4CZIA 1TV6A 4F9OA 2O8DB 1GLEG 1Q9XA 4Z4GA 4DF8A 2D5RA 4O55A 3QBXA 1ZYQA 5KPRA 4DKWA 2NRWA 3SQ1A 2WTUA 4W5OA 2VWJA 2FSNA 1RBVA 3ZX0A 5M1OA 4DS5A 1YJNN 1NNEA 3O9RA 3VENA 3VQAA 1JJ2M 1WNSA 3MMVA 3OY9A 4N56A 4DF4A 3SMPA 4RW4A 4CEEA 1PVWA 3WXIA 3MK5A 4I7FA 4IEEA 2A2YA 5LY3A 4X66K 3RMDA 1TKSA 4FZZA 1HPZA 3VQ4A 4ISGA 3MWPA 1D8YA 3J80O 3DWLA 1HRHA 1BU6O 1K7JA 3MXIA 4ID5A 4IO8A 1MWKA 1WLJA 4O0JA 5CE3A 1HNWK 3F73A 4BE1A 1VQMN 2WOMA 1K8KA 5KRTA 4F2RA 4CJUA 2A5XA 3OYLA 3MDQA 2HNDA 3ULDA 4KHUA 4HVZA 1BI4B 3U3GA 2G8IA 1TVRA 1BO5O 5AQHA 4Y1CA 4CJTA 3OTOK 4DSEA 5GIOA 4CJWA 2LN3A 2QWMA 3AO5A 4JS4A 2Y1BA 4MFBA 2F8TA 1ZBSA 4CZMA 4A5AA 3O9TA 5E84A 1E3MA 2E2NA 2UXBK 1S9GA 1RDAA 2RKIA 2P9KA 3M3ZA 3VN5A 3FGUA 4CF9A 4HTLA 4CVNE 2LXRA 1GLLO 4DUYK 3RMBA 1CXQA 3CM6A 4CF0A 3NH2A 1V4TA 3OYKA 2I7PA 5MLCQ 1HYSA 1N36K 1VSKA 1Q9YA 3IG1A 2ZWHA 1REVA 4AHVA 4PL7A 1HRUA 4HVJA 2CH5A 3C65A 3O5BA 3GL1A 1IH7A 3C95A 4FPAA 2P9SA 3KJVA 3NH1A 1HNVA 2GEMA 4C1NI 1YVNA 3L4IA 4BRQA 2ZJPL 3HYFA 1KQSM 4O5BA 1IKXA 4YOVA 4B9NA 2B4JA 3ZSVA 3CMAN 1K4PA 3KD1E 2YKNA 5AQVA 2OZMA 2QK9A 1C0MA 3CJAA 1IKWA 1RBRA 3V6DA 1E4FT 1QSYA 3CJ1A 3NVMA 3T7ZA 3GOIA 2NRRA 1NJ5A 4FJ8A 4C8NA 4WQ4C 5ADXH 3VTIA 1NGIA 3DLKA 2GV9A 1KFDA 1XMQK 2QA4N 3DRPA 3RR8A 4LFBK 2HHTA 3THWB 1L3VA 2OPPA 3CF5L 3PV8A 1KC8O 5JICA 3LM2A 3KLGA 4BDPA 2OPRA 5AFUA 1JE3A 1K4OA 4CZHA 3KWGA 4BY9C 1S5JA 5HOOA 3TWHA 1X9MA 2IDOA 4EAHD 1KTQA 3A0IX 3JAMO 1IG8A 3AVKA 3VQ7A 4WFAL 4HTUA 4FOIA 3R9PA 1RDCA 3VQEA 1NG9A 2IFEA 3LPTA 5GAGP 2HBLA 4JI0K 2O8CA 2GTDA 4IOXA 1OVQA 3CPEA 2NNWA 4NCBA 3EL2A 1VSHA 3O8MA 4CJQA 3TOEA 3AA2A 3QEVA 4CBUA 1RT5A 3AY9A 4CEFA 3TAEA 2UUBK 1BWFO 4LY7A 1RNHA 4CF8A 1BIZA 3IS9A 2ZGZA 3M8SA 3SI6A 3E66A 4DV6K 4FCXA 4DQIA 1MWMA 3T1AA 3EKSA 1IBMK 2XY5A 1VQ8N 3ZSWA 1VQON 4PKGA 2VCPA 4RW6A 3SYZA 1X9WA 3VQDA 3K9JA 2VG5A 4H5VA 2O4GA 2W6KA 3EE8A 5JLHA 3IKMA 5DM6L 4CI6A 2OYQA 3SUQA 4LH4A 3W3DA 3WT0A 4FWRA 1NKCA 3D6RA 1UOCA 3SAGA 3ZIHA 5FPMA 3UKUA 1HKGA 4YOWA 4CHNA 4CEZA 3FZKA 4DSFA 3NF8A 4KKOA 3PLAA 3I55N 4JLHA 1U49A 5HLFA 4BRHA 3H3OB 4M3UA 1HUXA 3GE1A 4HUEA 4FK2A 1VK0A 3C7NA 1V4SA 4H5NA 3HOTA 5J2QA 3BDPA 2XY6A 4KFBA 2EQAA 3WQTA 4U67L 3NDKA 2P1JA 3L8BA 3LZJA 3DRSA 1C6VA 3M1FA 3RMAA 4JHDA 3ZT1A 5CYMA 3VQ8A 5M1PA 1BA0A 1H4SA 1WN7A 3MIOA 5AZIA 1BQNA 3UKRB 4BRLA 3SCXA 2ATQA 2CGJA 3V9XA 3V1QA 2MX1A 3K9KA 2FSKA 1II7A 2ASPA 1JXBA 4DS4A 1T05A 4GKKK 1HNZK 3L3VA 4PA1A 3KLFA 3THVA 4BQLA 2XRIA 5ADXA 1EXQA 3L2QA 1N33K 1S1TA 3SNNA 4X64K 4NCXA 4NZRM 2EWSA 4B8CA 5GAHP 4FBQA 3OYBA 5T7BA 2QWNA 1LOTB 4E1MA 3WNHA 4DQQA 4HWIA 3VTHA 4DV7K 1GOBA 1SKWA 3CCUN 3RRHA 2F7TA 3TSPA 5LMNK 4IDKA 1I39A 1SKRA 4WFNL 5M1NA 3DM2A 4AHRA 4FLZA 4GKJK 3HT3A 3ATUA 3V1RA 4CJPA 4FOEA 1ATNA 2P9LA 4JKGB 2FF6A 1NMNA 3SAFA 1Q81O 1EWRA 2UU9K 1W9HA 4H8KA 4RW8A 4BG9A 5KGXA 1S1WA 3TTDA 3VF2A 1TUUA 3UKRA 4WQ5A 3TR8A 5HROA 3HVTA 3DJCA 3HPHA 3HRGA 3ZSRA 3D2FA 3Q7CA 2VYPA 5EVZA 1W0HA 1QZ6A 4BRAA 2KFZA 3QICA 4CF2A 1H1VA 4IXCA 1H4TA 3ZSQA 1NBWA 4OPKA 1CZAN 3U3YA 1LWCA 4CEBA 5AQRA 1OH7A 1JLFA 3NBPA 1VQ7N 5BRHA 4CEDA 5AZJA 3ZETA 2DTUA 4BG8A 3WXJA 1DGKN 2IGIA 2HHUA 1JL1A 5AQOA 1GLBG 1DLOA 3SLCA 2Q2RA 1VQKN 3O4WA 2KTQA 3KLIA 2HVIA 2ZF5O 2EX3A 4ZTFA 3KLEA 1TK0A 2QKKA 3OYMA 1FJGK 4FXDA 4P8EA 4CZGA 2P5OA 3HBTA 4DFKA 3ZEUA 4MDBA 3OYHA 2A3ZA 1VSMA 3SUPA 1KCFA 3OYCA 1TAQA 1LWFA 2YHWA 3BP8A 1WSEA 2P9BA 2XO7A 4JKAA 3IALA 4A62A 4B9VA 5AQIA 4JI5K 3OYGA 4N47A 3D7EO 1YITN 1TGOA 4DG1A 1BIUA 2UUAK 1LWEA 5DM7L 4XIUA 3B8AX 1OKJA 1RCHA 3Q7BA 2W42A 2P9LB 5M1QA 3P31A 1S6PA 4O8UA 1VQNN 3G10A 3QB0A 1KK9A 1XEZA 3NVKA 2I5JA 5BREA 4CZFA 4FJMA 3H45C 4CZLA 4B9MA 1I3AA 4Z4EA 2DFEA 1C0TA 2EK0A 4OO1J 2VQFK 2YHAA 1TL3A 2DFFA 1UWBA 3KZBA 1TKDA 4DTUA 2Z1GA 1OH6A 4W5QA 4BR7A 1NKEA 4LSNA 1Y64A 3L4QA 2X74A 3O1WA 3K57A 4U7BA 5BPLA 1VQ9N 2E1YA 3R6MA 4NXMK 3SMSA 1N8RO 2IVOA 1TKUA 3CCSN 4E7HA 3TAGA 2PFUA 4A57A 4BR0A 3O9SA 3VEYA 3DXMB 1TKXA 3V9ZA 3O4NA 4BRNA 3QINA 4DR1K 3CCRN 5HRRA 3J81O 4CHZA 2RISA 1GLAG 1C0UA 3T19A 3P1GA 3GBTA 4ISFA 1K49A 5TKYA 2XY7A 3HOSA 4CK3A 5I9EB 3CQYA 3CJCA 2OPSA 2YNFA 2D0BA 1QQMA 5K14A 4PUOA 1RT2A 4DQPA 2RHKA 3P04A 2O8EA 4OGEA 4Y0WA 5SWMA 1A5WA 3AVCA 2P9UA 1NOZA 3CCMN 4KTWA 3ZSYA 3NAEA 2YI1A 3ZETB 3MAQA 2P51A 5BPNA 2X6NA 2HHXA 5FLXO 4BREA 3MWTA 4NLCA 4O8KA 3NF6A 1HR0K 4CEAA 4AM6A 5TKWA 4CESA 4GMJB 5BR8K 2QXFA 1HX1A 3K5OA 2Q0UA 2HB5A 3LAMA 3G25A 2P9PB 3R8EA 5JMVA 3LANA 4NB4A 1J9AA 3VMFB 1RQ8A 3K58A 1NH9A 3CFRA 1U2VA 3H6EA 4JKGA 4KTZA 2UXDK 3DLLL 4WI1A 4FW2A 3LVKB 4OPHA 5E41A 1VSJA 2BDPA 3ZIIA 2W41A 3FZLA 1ATRA 2FC0A 4BC4A 3RMCA 4DFPA 4A2BA 4C8LA 1TL1A 4K8ZA 1WB9A 3TPQA 4AM7A 1SS6A 4LC9B 4DQSA 3AVNA 5C2FA 4E7JA 1LAVA 3FZFA 4E7IA 1GOCA 3F5TA 3OA9A 3HPOA 4FM2A 3LZIA 4UQGA 1KAYA 4YOUA 1NLVA 3HL8A 4M3WA 2O4IA 2AJQA 4HVCA 3D2EB 2V7YA 1BG3A 4CF1A 3OJSA 4KH5A 4DLGA 4KB1A 4G9ZA 4DSIA 1RTIA 1ASVA 4XH5A 2NRVA 3VEXA 3T3FA 4F3TA 3AO4A 3PO4A 5AQZA 2GWKA 2ZQBA 3J7AP 5CHIA 3QLHA 4M7YA 4JI1K 2HMPA 5C42A 1ESVA 1RTDA 1SL0A 5BN9A 4HCBA 4LF8K 3U6FA 3WBMA 4RCHA 3TI0A 5JS1A 5FRMA 4OLFA 3KKRA 2QXLA 3R1XA 4CERA 5JVGL 3HSCA 4Q15A 3EE9A 3LL3A 5HRNA 4B9UA 2KLAA 1H0YA 3J8AA 4EFHA 4M3XA 4QS8A 2OTLN 5C0YA 1TUYA 2GUIA 4B9TA 4Q5VA 2NRXA 2O8DA 1FXXA 4H0YB 4BC2A 2GELA 4B1XB 2E4LA 3SJHA 5CY4A 3LS6A 1QE1A 4KREA 3EZWA 4Q0BA 2FBTA 4FJNA 2X78A 3ID6A 1NK5A 3K5NA 2Q36A 4JD2A 3LRJA 3DLBA 4K0KK 3CCQN 1D5AA 1WBBA 1QQCA 1M90O 2ZE2A 2GUPA 4DU3A 4ELTA 4OKJA 2DFHA 5LJWA 3KD5E 1TIGA 4CJVA 3QFUA 2PYLA 3QEWA 4DU1A 1QSLA 2IS3A 3HZ7A 5LMUK 4DSKA 3TU5A 3O08A 1NJ8A 2QWLA 2O8BB 4DTOA 5FDLA 4BE0A 1NJ6A 1VQPN 3KHYA 3A5MC 4KB0A 1IEZA 2D0PA 3KK3A 3IABB 4B1VA 1VSFA 3DOKA 4JKFA 2HBJA 4LSLA 1YF5L 3L6QA 3OS2A 4DU4A 3CCVN 1JLEA 3H1VX 1B9DA 4H4OA 3AO2A 5AQTA 4KI6A 3SQ2A 4BRDA 3PSIA 2NRTA 5D3GA 2YKMA 3L7VA 2VWBA 5JLFA 2E6LA 3TANA 1K8AO 1VQ6N 4O5FA 5C15A 1IBLK 1JO0A 3O9UA 1RDBA 4EZ9A 4DR6K 4MQ3A 1ILYA 2VGMA 4H0PA 3S3NA 1NJXA 2H9UA 3QEPA 1QSSA 3CYMA 2QWOA 3QKBA 1NGGA 4FK0A 3VQQA 4H0TB 3WXMB 4I2PA 4GNIA 1T6DA 4WQ4A 4PHTX 4OLAA 2V7ZA 4DFMA 3ZSXA 2F9WA 3SPZA 5J2MA 1T6CA 4QS7A 2P9KB 1EKEA 2JWLA 2P9IA 1DTQA 1U47A 2IVPA 3IAYA 1RGIA 4CJLA 2AA4A 4LF6K 5AQYA 4CJ4A 1EO1A 1HQUA 4CGIA 3O1BA 2B5JA 2H3GX 4BDYA 4FM1A 2Z1IA 5EXWA 3HXMA 3OS1A 5KI6A 4K87A 1QZ5A 2GWJA 4DTNA 2E88A 4CJRA 4B3MK 3OYEA 3BGRA 4FSVA 2IVNA 3D45A 4FJJA 1BOTO 2L8YA 3I56N 3HP9A 2YX6A 3HPGA 4FLUA 2A6AA 3MXJA 4L3QA 5FPNA 3THYA 4CE9A 4CIEA 3SAHA 3NGYA 4E3SA 3MX5A 3V4IA 1FW6A 2QWPA 1G58A 1Z05A 4BWJA 2ITGA 3E9PA 3A5NC 4KH4A 3LDQA 4J2EA 4X62K 1SL1A 2RIUA 2W40A 3IUCA 3L2UA 3P5JA 4YFUA 3CCEN 4XH1A 4I9LA 1RDUA 3CJBA 4NCGA 4DR7K 4CHOA 1NK4A 3MN6A 3H3NO 1YJ9N 1CXUA 3IFRA 3CXCM 5EX5A 3T1YK 1T8EA 2JWKA 1ZBIA 1KVBA 3QO9A 1HYZA 4DCHA 3CCLN 3VQ6A 1RTHA 3D0PA 3K59A 1NK0A 1XNQK 3RR7A 3EEQA 4OPAA 2I7NA 3RRGA 5AQMA 3VERA 4Z94A 4X65K 2DPNA 4Z9EA 1VHXA 4K8XA 1RT7A 3KKSA 4JKDA 3TTFA 5HRPA 1NJIO 2VGNA 3DLEA 1XC9A 3J7ZO 4CZEA 2XY8A 3ASMA 4CFAA 4FZYA 5IWAK 2VG6A 2KHOA 3LP0A 3AO3A 4HUGA 4NZTM 1NK7A 3AJEA 3VOVA 4FVMA 1YI2N 1TKZA 1DKGD 3SV3A 3E1YA 5J1EA 2HHQA 3AGKA 4ISEA 4BGBA 2EHGA 3L2VA 2O8EB 3VA0A 2Z1HA 3EZ5A 2Q3VA 3E01A 5JS2A 3LDLA 3WNFA 1W2BM 3KTQA 1TKTA 3VQCA 3V1OA 4M42A 3LQUA 1SUQA 1K4LA 3QBWA 4FBKA 2O8FA 4CD1A 1Y2IA 1HC7A 2LSNA 1RBTA 1RT4A 1RDDA 4ICLA 3O80A 4YOXA 3THXA 2ITMA 1Q18A 2D4WA 2YCHA 3ULEB 4HHTA 1JXEA 4JKCA 3AA3A 5DK5A 1IO2A 4DV4K 4WYBA 3IMXA 2HHSA 3ZLJA 4Z4FA 4IFVA 2OA8A 3L3UA 4ELVA 2WUSA 2ETJA 5AQNA 2FBXA 1RFQA 3ISNC 4BVPA 2KZZA 3ATVA 3LP2A 4FVUA 3OYDA 4CFBA 1YTUA 1SAZA 4AHTA 4JK7A 4FWMA 4F4KA 3CC4N 4FJGA 2O8FB 3DOLA 1I94K 4LF4K 2G8WA 3AVAA 3O3HA 3F2KA 4IO9L 1CZ9A 3OYIA 1RT6A 1HNXK 4DR4K 3CC2N 4B1YB 4E89A 2OPQA 2O8BA 2VG7A 2FF3B 1NK9A 5LJVA 4BR4A 3MN9A 3QEXA 3C6HA 2BUPA 4Z4CA 4WFBL 3V9UA 4KTQA 4BR5A 3E9OA 3ZX2A 3PX6A 1IKYA 3LDOA 2D0CA 5F2RA 4EP5A 1DEJA 4JN4A 1U04A 5C10A 3CERA 1UAXA 4YDUA 3S9HA 2HNYA 1GOAA 3AVBA 3LP3A 4P6CA 4IDHA 1PAVA 4W5TA 3WNEA 3ZT3A 3QEIA 2P5GA 4B08A 3TAFA 5FPEA 3LWLA 1JLCA 2CGLA 1QHAA 4GW6A 1BQMA 4AF1A 3SPYA 4KH6A 1X3NA 4JKHA 3TSQA 3HJFA 1BCOA 4JKBA 4ILJA 4W5RA 4CCHA 3DXKA 1NU0A 1RBSA 3C7NB 3NGZA 3I33A 4IG3A 1XHXA 4BGAA 2M71A 4J2AA 3U9DA 2P9UB 4FBWA 1D4XA 3QNOA 3JYTA 3C0BA 3CIPA 5HL7L 4H5WA 1RTJA 1OH5A 3QIOA 4DMNA 1BDGA 1EP4A 4JI6K 5H1SQ 1XMOK 3GG4A 3PY8A 4O4GA 4A61A 4KRFA 2NUBA 3VQ5A 1NKBA 3QDKA 4GY2B 1BI4A 4C8OA 2YNHA 2G8FA 2G8UA 1K73O 1LV5A 4FK4A 1U2VB 5GIPA 1YT3A 4IOAL 4BQZA 1NJZA 1QHTA 1SV5A 2WBNA 4FWKA 4CK1A 1S1VA 4JYAK 2WC9A 1T44A 1OVYA 1XUPO 4CJEA 1VQ5N 1WAJA 4DLEA 1LAWA 2NRZA 1HJOA 2F9TA 1NWKA 2QWQA
chains in the Genus database with same CATH topology
3F5TA 3OA9A 2D1KA 4FPAA 2A41A 4H03B 4JK8A 4PKHA 4JHDB 4DHYA 5GADP 4I6MB 1KAYA 1RDWX 2FLOA 2GEMA 4NO7A 1YVNA 4YOUA 4C1NI 3L4IA 4BRQA 2ZJPL 1NLVA 3A5OC 1G57A 1KQSM 3D2EB 4GV9A 2V7YA 1BG3A 4YOVA 4KH5A 3W0LA 3CMAN 3VGLA 4G9ZA 1C0GA 1K4PA 1SQKA 2WFBA 1S72N 5AQVA 3ENOA 4XH5A 2NRVA 3VEXA 3CJAA 3CHWA 1KAXA 1E4FT 4MO5A 1NM1A 3CJ1A 3NVMA 4K43A 5AQZA 2FSJA 3T7ZA 2J4RA 3ID8A 2GWKA 3GOIA 2NRRA 2ZGYA 5CHIA 3N4QA 5BR9A 4M7YA 3VESA 4B1UB 1BUPA 4WQ4C 2HMPA 5ADXH 3VTIA 1NGIA 3TSUA 3MCAB 1ESVA 1R59O 3CETA 4IFEA 5BN9A 2QA4N 2HF4A 3VGKA 4NLBA 4RCHA 3T1IA 2PAVA 1TKUA 4YKEA 5F1XA 3CF5L 2QXLA 1KAZA 3R1XA 3WXKA 4QS9A 3RVCA 5JVGL 1MA9B 1YUWA 3HSCA 3EO3A 4BRFA 4RWTA 3EE9A 3LL3A 5AQGA 3LM2A 4WCEL 5JICA 4YORA 1MDUB 4IWVA 1X9JA 1K8KB 2KLAA 5F0XA 3U9ZA 2UYTA 3J8AA 4H0OA 4K42A 3D2EA 3UE5A 4EFHA 5AFUA 1K4OA 4CZHA 3KWGA 1VQLN 4BY9C 4B1ZA 3CPWM 4QS8A 2OTLN 5HOOA 4EO0A 4BC3A 5C0YA 1TUYA 2NRXA 4H0YB 4EAHD 4BC2A 2GELA 1GLDG 3A0IX 4H0XB 4B1XB 1IG8A 4XH4A 3SJHA 5KPTA 5AQXA 3LS6A 4BRGA 1ZXOA 4WFAL 3EZWA 5JVHL 1PVYA 3QMLA 4FOIA 3ID6A 4PL8A 2ZJQL 3R9PA 1WOQA 3LRJA 2Q36A 4JD2A 5AFUH 3CCQN 5GAGP 1M90O 2GUPA 2HBLA 4MLEA 3DXMA 2GTDA 3RSEB 4IOXA 3CPEA 2NNWA 4JK9A 3GDQA 3EL2A 5LJWA 3KK7A 5BN8A 3KVGA 3O8MA 3QFUA 3AARA 4XEIA 1BA1A 1M1KO 3L0QA 3CQXA 4CBUA 1YHQN 3AY9A 1P90A 1BWFO 3BEXA 1XQSC 2GX9A 4BR2A 1NGDA 2ZGZA 3TU5A 3O08A 4FO0A 2QWLA 3E66A 4FCXA 3VEOA 1VQPN 3KHYA 1NGAA 1MWMA 3A5MC 1IEZA 3VGMA 4IJNA 1GLCG 3EKSA 2D0PA 3CMEN 4B1VA 2HBKA 2CGKA 3OBWA 4PKGA 1EQYA 4FWQA 1VQON 1VQ8N 4JKFA 2HBJA 2VCPA 5KQDA 2BTFA 3K9JA 1YF5L 3L6QA 4H5VA 3EE8A 4FWNA 5JLHA 3PIPL 3CCVN 3H1VX 4IEIA 3IKMA 5GINA 2ZJRL 5DM6L 5AQTA 4CI6A 4CBWA 1ATSA 3FZMA 3W3DA 3WT0A 1QQOA 4BRDA 3FR0A 4FWRA 4PKIA 3D6RA 3MX2A 2NRTA 3T69A 4BRCA 3SAGA 3SBTA 3ZIHA 5FPMA 3UKUA 1HKGA 3EKUA 4YOWA 2VWBA 5JLFA 3CCJN 1K8AO 3CD6N 3KWIA 3F9MA 3H1QA 3LDNA 3O5BA 4FPBA 3FZKA 4O5FA 5C15A 1VQ6N 3O9UA 5KPZA 3PLAA 3I55N 1SNNA 3TTCA 3VEWA 2VGMA 4H0PA 4K41A 4BRHA 1ILYA 3MGZA 3H3OB 1HUXA 2QWOA 3HI0A 1NGGA 3O6WA 3GE1A 4KBOA 4BROA 5AQJA 1W97L 4H0TB 4BRIA 4H5NA 3C7NA 1V4SA 4GNIA 1T6DA 4WQ4A 3WXMB 4PHTX 3DXKB 2V7ZA 1X3MA 3HTVA 3HOTA 4EHTA 2F9WA 2EQAA 1T6CA 4QS7A 3WQTA 4P77A 4IOCL 2P9KB 1NGCA 3JS6A 3WEEB 4U67L 2JWLA 2P9IA 1TYQB 4DQ8A 3M1FA 5AQWA 4JHDA 2IVPA 3SBGA 1YAGA 1RGIA 3VETA 5M1PA 1BA0A 1NMDA 5AQUA 2V51B 2AA4A 1NGHA 5AQYA 1SZ2A 4FWSA 1EO1A 3MIOA 2P9PA 2ASMA 3U4LA 3O1BA 2H3GX 5AZIA 3UKRB 2A40A 2P9NA 4BRLA 5EXWA 5AQLA 5C12A 4P8JA 1GLFO 1QQNA 2E2OA 1C0FA 4UY8O 3BF3A 1QZ5A 2GWJA 2CGJA 2E88A 3H46O 2MX1A 1JCUA 4CJ7A 4FSVA 3K9KA 2IVNA 2FSKA 1BOTO 1NGJA 2ASPA 3I56N 5AQKA 2YX6A 3A8YA 3AGRA 2A6AA 3JXUA 3ZEUB 4L3QA 5FPNA 1Q86O 4IZ9A 3SAHA 4BQLA 5ADXA 3MX5A 2E2PA 2QWPA 1G58A 1Z05A 1Q7YO 5GAHP 4NZRM 2EWSA 4FFJA 2E2QA 3E9PA 4FBQA 3A5NC 4M63C 4J8FA 3LDQA 4KH4A 3UKUB 2QWNA 3P38A 1LOTB 1JCEA 2YHXA 4FWOA 2RIUA 2W40A 3IUCA 4M7XA 4HWIA 3VTHA 1K4IA 4MLHA 5CR4A 3CCEN 4XH1A 4JNEA 4A59A 1RDUA 3CJBA 3CCUN 4JEPA 3VF4A 2F7TA 3TSPA 5M1KA 3MN6A 4WFNL 4YOTA 3H3NO 5M1NA 1YJ9N 4BC5A 3IFRA 3ATUA 3CXCM 5ELZA 4FOEA 5EX5A 1ATNA 1U6ZA 2P9LA 4JKGB 4MDAA 3IDHA 2Q1NA 3CI5A 2FF6A 2JWKA 3SAFA 1Q81O 3BUZB 2AP1A 5AZIB 4DCHA 3CCLN 3NMUA 4BG9A 3BF1A 4OPAA 5AQQA 4I6MA 4FWPA 4C1NK 1HPMA 2I7NA 3TTDA 5AQMA 3VF2A 3VERA 3M6GA 4Z94A 3DAWA 1TUUA 4H5RA 3UKRA 2DPNA 2RE2A 4WQ5A 4JKDA 2NLXA 3TTFA 2NRHA 3HM8A 3DJCA 2NZTA 1NJIO 1J6ZA 2VGNA 3HRGA 3D2FA 3J7ZO 5AQSA 4CZEA 1NGBA 3VPZA 1O13A 4IJAA 2YHYA 1WUAA 3Q7CA 1NGEA 1QVGM 2HSTA 2VYPA 1YXQA 4ILGB 5EVZA 4R79A 1QZ6A 2KHOA 4BRAA 5AZJB 3QICA 2P9IB 1ZC6A 1H1VA 4IXCA 1NBWA 3WEEA 4BRMA 4NZTM 1CZAN 3G4SN 1QVFM 4CZKA 3VEVA 1KD1O 3AJEA 5AQRA 3VOVA 1VQ7N 5BRHA 1YI2N 5AZJA 1DKGD 3CJ9A 3ZETA 3MN5A 4BG8A 3O9QA 3WXJA 1DGKN 3E1YA 2P9NB 5AQOA 1HKCA 1GLBG 2P9SB 3AGKA 3SLCA 4ISEA 1S22A 2Q2RA 4BGBA 1VQKN 3O4WA 4H0VB 4JAXA 2ZF5O 3LDLA 3ULEA 1W2BM 1G99A 3E9LA 3P39A 3RSEA 1TYQA 3LQUA 4P8EA 4CZGA 2PBDA 3HBTA 3MK6A 3OBYA 3WXLA 3ZEUA 4MO4A 4B9QA 4MDBA 3QBWA 5B8HA 4FBKA 1JCGA 2A3ZA 5AQFA 4CD1A 2Q0RA 4RTFD 2QEXN 3N4PA 2YHWA 3BP8A 2P9BA 1NGFA 1P8ZA 3O80A 4JKAA 3SK3A 4YOXA 5FPDA 4A62A 2ITMA 3P4IA 3ZIGA 1Q18A 4YOYA 2Q97A 2D4WA 4K25A 5AQIA 3FLCO 2YCHA 3CJ7A 4JKEA 4C23A 1YITN 3ULEB 3D7EO 4BRPA 4EHUA 4JKCA 4FL9A 3UB5A 2E20A 1E4GT 3ENHA 2E1ZA 5DM7L 4WYBA 3IMXA 3B8AX 3FFKB 2QM1A 2E8AA 2Q31A 1XC3A 5AR0A 1OKJA 3QFPA 1S3XA 3Q7BA 2P9LB 5M1QA 3P31A 2WUSA 4E1BA 3S41A 4O8UA 5AQNA 1VQNN 5E26A 3QB0A 1RFQA 2QWRA 4BVPA 1KK9A 3ATVA 1XEZA 4FVUA 4GV3A 4I14A 1SAZA 3NVKA 4JK7A 1DT9A 5AQPA 5BREA 2ASOA 3U8XA 4CZFA 3ZIEA 3H45C 4FWMA 4B1WB 4BRKA 5EY4A 4CZLA 3CC4N 4A5BA 3LDPA 1KC8O 3ZX3A 3AAQA 1GLJO 1NWKA 3F2KA 4CZJA 4IO9L 4OO1J 3LM9A 2D0OA 4GV6A 3CC2N 3WUHA 3H07A 3KZBA 4B1YB 2QI2A 1HKBA 2YJFA 3G6EN 2FF3B 4FWLA 5LJVA 3FE1A 3C6AA 4BR7A 3OHRA 3MN7A 3MCPA 4BR4A 1HLUA 4CD3A 3MN9A 4EIAA 1Y64A 3L4QA 4CZIA 1Q82O 1JCFA 4F9OA 1GLEG 2BUPA 3C6HA 2V52B 3O1WA 4WFBL 4U7BA 4BR5A 3E9OA 5BPLA 1VQ9N 3ZX2A 3QBXA 5GAEP 2E1YA 3R6MA 4ILHA 3SMSA 5KPRA 2IVOA 1N8RO 3LDOA 4DKWA 3CCSN 2NRWA 2PFUA 4A57A 4BR0A 5F2RA 3O9SA 3VEYA 3L7VA 2FSNA 4WF9L 3ZX0A 5M1FA 5M1OA 3R3LA 3DXMB 1YJNN 1T3VA 3O9RA 1IJJA 3VENA 4BRNA 1DEJA 2FXUA 4JN4A 5C10A 3PIOL 3CCRN 3CERA 1JJ2M 2HOEA 2RISA 3MMVA 4YDUA 3MK5A 3SMPA 1GLAG 1PVWA 3WXIA 4P6CA 5BRDA 4IDHA 3A5LC 3GBTA 4ISFA 4IEEA 5LY3A 1K49A 1TKSA 5TKYA 3G71N 3I8BA 3D2FB 5FPEA 3HOSA 4ISGA 2CGLA 5I9EB 3CQYA 3MWPA 3CJCA 2HF3A 3DWLA 1QHAA 5KQ8A 2OANA 2IIRA 1QQMA 1KXPA 1BU6O 1K7JA 4IO8A 1MWKA 4AF1A 3VF6A 2RHKA 3EN9A 3P04A 1X3NA 4KH6A 1VQ4N 5CE3A 4Y0WA 4JKHA 3TSQA 1VAZA 2HBMA 4E1JA 2P9UA 1VQMN 4JKBA 4ILJA 5BPMA 1K8KA 3CCMN 3DXKA 4A2AA 4BVOA 4DB3A 3C7NB 2YI1A 3ZETB 2A5XA 3I33A 3MDQA 5BPNA 1YJWN 4BGAA 4HVZA 4BREA 3U9DA 3MWTA 4NLCA 2P9UB 4O8KA 4FBWA 1BO5O 1D4XA 5AQHA 1LCUA 4AM6A 2KKZA 5TKWA 2OTJN 3HZ6A 3C0BA 3CIPA 4H5TA 5GIOA 3WQUA 5HL7L 3CC7N 3ZYYX 1HX1A 4H5WA 2Q0UA 3VEZA 2QW9A 2BH1A 3G25A 2LN3A 3M5RA 2QWMA 2P9PB 3R8EA 5H1SQ 1BDGA 1YIJN 1K4LA 5JMVA 4NB4A 3GG4A 4CBXA 4A61A 3OW2M 3VMFB 3ENBA 1ZBSA 4GVEA 4CZMA 4P6DA 1U2VA 4A5AA 3O9TA 4BR9A 3H6EA 4JKGA 5E84A 5BRFA 3DLLL 2E2NA 3QDKA 4GY2B 4OPHA 2P9KA 2CH6A 3M3ZA 4YDUC 3FGUA 2A42A 5EOYA 1K73O 3ZIIA 3AAPA 4HTLA 2W41A 3FZLA 1ATRA 1U2VB 4BC4A 1GLLO 5GIPA 5C2DA 4P6PA 2YJEA 4IOAL 2QTDA 4BQZA 1K9MO 4A2BA 2WBNA 4FWKA 3TPQA 4AM7A 2WC9A 1Z6RA 1T44A 1OVYA 4JD2B 1V4TA 1XUPO 1SS6A 4LC9B 1VQ5N 2I7PA 4WQ5C 5C2FA 5MLCQ 3FZHA 2ZWHA 4PL7A 2NRZA 1HRUA 3FZFA 1HJOA 2CH5A 2F9TA 3C65A 3GL1A 2QWQA 2P9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEO A;  3VET A;  3TTF A;  3VES A;  3TTD A;  3TSQ A;  3TTC A;  3VTH A;  3VEZ A;  3VEX A;  3VER A;  3VF2 A;  3TSP A;  3VEW A;  3VTI A;  3VEN A;  3TSU A;  3VF4 A; 
#chains in the Genus database with same CATH topology
 4N5S A;  2A41 A;  4H03 B;  5GAD P;  4DHY A;  4I6M B;  1J53 A;  3AO1 A;  4JV5 K;  1RDW X;  4NO7 A;  4DFJ A;  3A5O C;  1FKO A;  4GV9 A;  3QET A;  1J5E K;  2VWK A;  5EU7 A;  3SZ2 A;  1SQK A;  2WFB A;  4KV8 A;  1L3U A;  4FJX A;  4IBN A;  1JLB A;  3ENO A;  1HQE A;  3CHW A;  2RF2 A;  3NHG A;  1NM1 A;  1NOY A;  2FSJ A;  4YDQ A;  2J4R A;  4O0I A;  1A5V A;  2ZGY A;  1NJ2 A;  4OJR A;  3VES A;  1BUP A;  4ZHR A;  3MCA B;  3LDS A;  1R59 O;  2HF4 A;  3MEC A;  5CZ2 A;  4CJ3 A;  3VGK A;  3K2P A;  3T1I A;  2PAV A;  5F1X A;  3DRR A;  1KAZ A;  3WXK A;  4Y1D A;  4FJH A;  1YUW A;  4BRF A;  5AQG A;  4NYF A;  5F0X A;  3SQ4 A;  4K42 A;  1U45 A;  2E5L K;  1VQL N;  4B1Z A;  3CPW M;  4BAC A;  2BGG A;  1CZB A;  5KRS A;  1KRP A;  1GLD G;  4W5N A;  4XH4 A;  5KPT A;  5AQX A;  4BRG A;  1ZXO A;  4FW1 A;  3CFP A;  5JVH L;  1XI1 A;  3I0S A;  4PL8 A;  2ZJQ L;  1WOQ A;  1IBK K;  4TWA A;  3LVJ C;  4MLE A;  3DXM A;  4KHY A;  3RSE B;  1VRT A;  3SJJ A;  4JK9 A;  5BN8 A;  3TAP A;  3KVG A;  4FLY A;  3L0Q A;  3CQX A;  1C1C A;  4DR3 K;  1YHQ N;  5C24 A;  4JI2 K;  3BEX A;  4IFY A;  3EY1 A;  4BR2 A;  4BE2 A;  3QNN A;  4WE1 A;  4CGF A;  3O3F A;  4JI8 K;  3VGM A;  3SV4 A;  2G8K A;  4DV0 K;  4K86 A;  3CME N;  1FKP A;  1KLM A;  2HBK A;  4C8M A;  5KQD A;  1UA1 A;  1CLQ A;  1TK5 A;  4FWN A;  2HNZ A;  4IEI A;  2ZJR L;  3OYF A;  4PQU A;  4F3O A;  1QQO A;  2GBZ A;  3T69 A;  4PKI A;  4BRC A;  3SBT A;  4DQR A;  4DV2 K;  4FCY A;  4RW9 A;  4FPB A;  4CJF A;  3SQ0 A;  5KPZ A;  4AHU A;  3TTC A;  3VEW A;  4K41 A;  3MGZ A;  5FRN A;  2G8H A;  4KBO A;  2F4V K;  5AQJ A;  5HRS A;  3O4Q A;  1X3M A;  4P77 A;  4IOC L;  1NGC A;  3JS6 A;  3WEE B;  4OX9 K;  1EWQ A;  4CGG A;  1YAG A;  3NF7 A;  4NYN A;  5AQU A;  1NGH A;  1W7A A;  2ASM A;  3OS0 A;  3BY5 A;  5C12 A;  2A40 A;  1S6Q A;  5AQL A;  1GLF O;  1QQN A;  3I0R A;  4LH5 A;  3L2R A;  4DV1 K;  4B3T K;  3HO1 A;  2HVH A;  3THX B;  1ZBL A;  3K5M A;  1X9S A;  1JCU A;  4CJK A;  3V9S A;  4DTX A;  2R7Y A;  4FLT A;  1NFH A;  4AHS A;  3A8Y A;  3AGR A;  3JXU A;  1SL2 A;  1Q86 O;  3B6O A;  4DWI A;  1HNI A;  3KK2 A;  4N76 A;  3VQP A;  4DV3 K;  1TK8 A;  1Q7Y O;  4E1N A;  3AVM A;  2HW3 A;  4FJI A;  3B6P A;  2E2Q A;  4M63 C;  4KHQ A;  4CEQ A;  3LAL A;  4FWO A;  4M7X A;  4MLH A;  4EZ6 A;  5CR4 A;  4LF9 K;  1Z25 A;  4NXN K;  4A59 A;  4JEP A;  5KGW A;  4JI4 K;  3K0S A;  2FBY A;  1XHZ A;  2YNI A;  4BC5 A;  3AVJ A;  5ELZ A;  1LW0 A;  3NH0 A;  3IDH A;  2Q1N A;  4FJK A;  2E6M A;  2AP1 A;  4FJ7 A;  3HVR A;  2PY5 A;  4QAG A;  3TAQ A;  1IV0 A;  5AQQ A;  2EH1 A;  4I6M A;  1N6Q A;  3EYZ A;  4FWP A;  4C1N K;  1VSI A;  4V19 S;  3M6G A;  3DAW A;  4H5R A;  4DV5 K;  1WSI A;  2NLX A;  3QER A;  2NRH A;  2NZT A;  3LAK A;  1J6Z A;  4RG8 A;  5AQS A;  1Z26 A;  2VQE K;  2A1S A;  1WUA A;  1NGE A;  3PO5 A;  2HST A;  4ILG B;  4E0D A;  4QOZ B;  2P9I B;  1ZC6 A;  4M41 A;  1F21 A;  3WEE A;  4BRM A;  4L8R B;  1QVF M;  4M45 A;  3VEV A;  1H4Q A;  3AVH A;  4DUZ K;  4CEO A;  1KD1 O;  4E7L A;  1S1X A;  2JLE A;  3DMJ A;  3MN5 A;  2P9N B;  4KAZ A;  3TAR A;  1HKC A;  3NCI A;  1VSL A;  4B3S K;  2P9S B;  4H0V B;  4JAX A;  1C1B A;  5DMR A;  1KVA A;  3ULE A;  1S9E A;  4LF7 K;  5KTQ A;  3P39 A;  1L3S A;  1N32 K;  4B9L A;  1XWL A;  3RSE A;  3OJU A;  3MK6 A;  3WXL A;  3OBY A;  4LF5 K;  4B9Q A;  5AQF A;  4FZX C;  4RTF D;  4R5P A;  4YNQ A;  1NGF A;  1P8Z A;  1BIS A;  5FPD A;  3ZIG A;  3PSF A;  4HD0 A;  2KQ2 A;  4YOY A;  3FLC O;  3CJ7 A;  4JKE A;  3K5L A;  4AQY K;  2Q3S A;  4KHS A;  3A2F A;  2E20 A;  1E4G T;  3ENH A;  4KI4 A;  1Q8I A;  2QM1 A;  2Q31 A;  1XC3 A;  1J54 A;  1S3X A;  3NFA A;  4FJ9 A;  4CJS A;  4E1B A;  3S41 A;  5E26 A;  1U48 A;  4CHP A;  3IRX A;  4GV3 A;  4I14 A;  3F9K A;  3ZIE A;  1ZBU A;  4BRK A;  5EY4 A;  4A5B A;  3LDP A;  1LN4 A;  3LPU A;  3TAB A;  3AAQ A;  4CZJ A;  1S8E A;  3LM9 A;  2D0O A;  3ZT4 A;  3AA5 X;  4GV6 A;  3H07 A;  4RW7 A;  1HKB A;  2YJF A;  3G6E N;  2F96 A;  3FE1 A;  3C6A A;  1T03 A;  1D9F A;  1HLU A;  4CD3 A;  3QES A;  4EIA A;  1JKH A;  4CHQ A;  3ZSO A;  1JCF A;  1Q82 O;  3TAM A;  4C8K A;  2V52 B;  1HMV A;  1S1U A;  5GAE P;  3HST B;  4LFC K;  4ILH A;  1SKS A;  4CGJ A;  4F8R A;  2DY4 A;  4WF9 L;  5M1F A;  3R3L A;  2O8C B;  1T3V A;  4JRP A;  1IJJ A;  1YVU A;  1YTA A;  3CQ8 A;  2FXU A;  3PIO L;  4JI7 K;  2HOE A;  1ASU A;  5BRD A;  3PUF A;  3A5L C;  3IAB A;  1JDQ A;  5C25 A;  3SUO A;  3G71 N;  3I8B A;  3D2F B;  1J5O A;  2PYJ A;  3G0Z A;  2B6A A;  2X6S A;  4EP4 A;  3M8Q A;  4E19 A;  4ELU A;  4Z0U A;  2HF3 A;  3PX4 A;  5KQ8 A;  2OAN A;  2IIR A;  4TSX A;  4HUF A;  1KXP A;  4M3Y A;  1X1P A;  1L3T A;  3VF6 A;  4FJL A;  3EN9 A;  1VQ4 N;  1VAZ A;  2HBM A;  4E1J A;  5BPM A;  3AVF A;  4A2A A;  4BVO A;  4DB3 A;  2GTC A;  2F8S A;  4PWD A;  3JSM A;  3OYN A;  2YHB A;  1JLQ A;  1YJW N;  3FFI A;  3DI6 A;  1HYV A;  2OCE A;  3DSD A;  3THW A;  1UDV A;  5HP1 A;  1EX4 A;  1LCU A;  2KKZ A;  2OTJ N;  3HZ6 A;  4M3R A;  4H5T A;  3WQU A;  3CC7 N;  3ZYY X;  1JL2 A;  3VEZ A;  2QW9 A;  2BH1 A;  3M5R A;  5FRO A;  1KLN A;  1YIJ N;  1BHL A;  3AVG A;  4OLB A;  4CBX A;  3RWU A;  3OW2 M;  3ENB A;  4GVE A;  1DTT A;  1A5X A;  5IT9 O;  4P6D A;  4BR9 A;  5SZT A;  5BRF A;  3C6U A;  4BDZ A;  4YDU C;  2CH6 A;  1UA0 A;  2A42 A;  5EOY A;  3CFO A;  3AAP A;  3ALY A;  4B9S A;  4FLV A;  5C2D A;  4P6P A;  2YJE A;  2QTD A;  2IAJ A;  1K9M O;  3AV9 A;  4CK2 A;  1Z6R A;  4JD2 B;  1ZBH A;  2W6L A;  4WQ5 C;  4F2S A;  4B3R K;  3FZH A;  1VR4 A;  2HHV A;  4ZTJ A;  2BE2 A;  2D1K A;  4JK8 A;  4PKH A;  1NJW A;  4JHD B;  2Y1J A;  1KSP A;  2FBV A;  2FLO A;  1VSE A;  4CIF A;  4JS5 A;  1G57 A;  1BCM A;  4KHP K;  3W0L A;  3VGL A;  1C0G A;  1VSD A;  4CW7 B;  1S72 N;  4CFC A;  4KHW A;  2ZM6 K;  3I8D A;  2Z1J A;  1KAX A;  3DYA A;  4JRQ A;  4MO5 A;  4K43 A;  4PY5 A;  2Z7C A;  3ID8 A;  5I42 A;  3S3O A;  3N4Q A;  5BR9 A;  4B1U B;  1NK8 A;  3TSU A;  2IC3 A;  1C1A A;  3CET A;  4IFE A;  1Y97 A;  1TAU A;  3DSC A;  3CG7 A;  4NLB A;  1K6Y A;  4YKE A;  4FLW A;  4DTR A;  4QS9 A;  3RVC A;  1MA9 B;  3EO3 A;  4RWT A;  4WCE L;  4YOR A;  1MDU B;  4IWV A;  4J2D A;  1X9J A;  1NJY A;  1K8K B;  4CIG A;  4JI3 K;  3U9Z A;  2UYT A;  4H0O A;  3UE5 A;  3D2E A;  4EO0 A;  4BC3 A;  4DTS A;  4H0X B;  1N34 K;  1NJ1 A;  3CM5 A;  1ITG A;  5J2P A;  3KLH A;  4KPY A;  1PVY A;  4CJ5 A;  3QML A;  2YNG A;  4K88 A;  3C94 A;  5AFU H;  1KFS A;  2UUC K;  3NE6 A;  5CYQ A;  4DSL A;  4LD0 A;  1WAF A;  3GDQ A;  1QTM A;  3KK7 A;  3PX0 A;  3AAR A;  4XEI A;  1BA1 A;  1M1K O;  2D0A A;  1U4B A;  1O1W A;  1P90 A;  1XQS C;  2GX9 A;  1WSJ A;  1NGD A;  1RT1 A;  1EET A;  4FO0 A;  4OKK A;  2HHW A;  3ZT0 A;  3VEO A;  3WNG A;  1NGA A;  3H08 A;  1GLC G;  4IJN A;  3OYJ A;  4DTP A;  2CGK A;  3OBW A;  1EQY A;  4FWQ A;  1RIL A;  2BTF A;  1RT3 A;  3PIP L;  4O44 A;  5GIN A;  3VA3 A;  4CBW A;  1ATS A;  3FZM A;  3FR0 A;  3MX2 A;  4DR2 K;  4FYD A;  1IG9 A;  3EKU A;  3CCJ N;  3CD6 N;  3KWI A;  1B92 A;  1VM0 A;  3F9M A;  3H1Q A;  3LDN A;  4M3Z A;  5A2Q O;  1SNN A;  4H4M A;  4OPJ A;  2BKY X;  1WBD A;  3HI0 A;  3O6W A;  3DLG A;  3QIP A;  4BRO A;  3VQB A;  1W97 L;  3AVL A;  4BRI A;  4M3T A;  2G8V A;  3DXK B;  3HTV A;  4EHT A;  2A1R A;  1N5Y A;  1JLA A;  1TYQ B;  4DQ8 A;  1DCJ A;  2ZD1 A;  5AQW A;  4YHH K;  1L5U A;  1QS4 A;  3SBG A;  3VET A;  1NMD A;  2V51 B;  2RPI A;  1SZ2 A;  4FWS A;  2P9P A;  3U4L A;  3MEE A;  1HJR A;  1D9D A;  2P9N A;  1LW2 A;  3P83 D;  4P8J A;  2E2O A;  4QCL A;  1C0F A;  4UY8 O;  3BF3 A;  4CFD A;  3HP6 A;  1R0A A;  3H46 O;  4CJ7 A;  1WSG A;  4Z4I A;  1NGJ A;  4OKE A;  4FM0 A;  5AQK A;  3U6Y A;  4OVL A;  3ZEU B;  4IZ9 A;  5CZ1 A;  4DSJ A;  2E2P A;  4LFA K;  1G15 A;  1Y9X A;  4FFJ A;  4J8F A;  3UKU B;  4HCC A;  4N41 A;  3P38 A;  1JCE A;  3L2W A;  2YHX A;  4I9Q A;  1XNR K;  5I3U A;  1K4I A;  2UXC K;  2HMI A;  4JNE A;  4AH9 A;  5J2N A;  1H0X A;  1OH8 A;  3VF4 A;  4KO0 A;  5M1K A;  2PZS A;  5AJ3 K;  3LP1 A;  4YOT A;  1FK9 A;  2Y1I A;  4OGC A;  3THY B;  4G1Q A;  3O3G A;  4IKF A;  4CHY A;  4MDA A;  1U6Z A;  2HHH K;  3CI5 A;  3KK1 A;  3BUZ B;  3S3M A;  5AZI B;  4I2Q A;  3M8R A;  4GVM A;  3NMU A;  2KFN A;  3BF1 A;  1HPM A;  2RE2 A;  3HM8 A;  3DLH A;  1NGB A;  3VPZ A;  4FLX A;  1O13 A;  4IJA A;  2YHY A;  1QVG M;  1YXQ A;  4R79 A;  3KIO A;  5AZJ B;  3AVI A;  4B3O A;  3G4S N;  1KVC A;  4CZK A;  1IKV A;  1ZBF A;  4DR5 K;  3MEG A;  4AHC A;  4KHN A;  1B9F A;  1WSH A;  1MU2 A;  3RTV A;  1BGX T;  3CJ9 A;  3LWM A;  1RBU A;  3O9Q A;  4BWM A;  4YY3 K;  3UIQ A;  3OVN A;  2XHB A;  1S22 A;  1BL3 A;  1VRU A;  2QKB A;  2KW4 A;  5HBM A;  3OYA A;  3NF9 A;  3DLR A;  3ITH A;  4CGH A;  1G99 A;  3E9L A;  4DTM A;  4CEC A;  1TYQ A;  3C6T A;  4B8A B;  2PBD A;  2YV0 X;  4CGD A;  4MO4 A;  5B8H A;  1JCG A;  2Q0R A;  3J7Y P;  2QEX N;  3N4P A;  3BZK A;  3MED A;  3NGI A;  3AA4 A;  3V81 A;  3SK3 A;  4DTJ A;  3ZT2 A;  3P4I A;  2Q97 A;  3ZCM A;  4K25 A;  3BZC A;  4C23 A;  1JLG A;  4BRP A;  3M8P A;  4EHU A;  3MXM A;  4J2B A;  4FL9 A;  3HK2 A;  3UB5 A;  4ID1 A;  3V9W A;  2E1Z A;  2RN2 A;  3FFK B;  2KZM A;  2E8A A;  5AR0 A;  3QFP A;  1WSF A;  2JGU A;  2QWR A;  1NFJ A;  2BAN A;  1DT9 A;  5AQP A;  2ASO A;  2WON A;  3U8X A;  4B1W B;  1ASW A;  4Z4H A;  2CRQ A;  1NK6 A;  5LL6 Z;  4IG0 A;  3ZX3 A;  1GLJ O;  4E7K A;  2IOC A;  3SUN A;  3WUH A;  4FJ5 A;  2QI2 A;  4NCA A;  3T1H K;  4FWL A;  4AIL C;  3OHR A;  3MN7 A;  3MCP A;  1T7P A;  2OZS A;  3HM9 A;  3ZSZ A;  3VQ9 A;  4CZI A;  1TV6 A;  4F9O A;  2O8D B;  1GLE G;  1Q9X A;  4Z4G A;  4DF8 A;  2D5R A;  4O55 A;  3QBX A;  1ZYQ A;  5KPR A;  4DKW A;  2NRW A;  3SQ1 A;  2WTU A;  4W5O A;  2VWJ A;  2FSN A;  1RBV A;  3ZX0 A;  5M1O A;  4DS5 A;  1YJN N;  1NNE A;  3O9R A;  3VEN A;  3VQA A;  1JJ2 M;  1WNS A;  3MMV A;  3OY9 A;  4N56 A;  4DF4 A;  3SMP A;  4RW4 A;  4CEE A;  1PVW A;  3WXI A;  3MK5 A;  4I7F A;  4IEE A;  2A2Y A;  5LY3 A;  4X66 K;  3RMD A;  1TKS A;  4FZZ A;  1HPZ A;  3VQ4 A;  4ISG A;  3MWP A;  1D8Y A;  3J80 O;  3DWL A;  1HRH A;  1BU6 O;  1K7J A;  3MXI A;  4ID5 A;  4IO8 A;  1MWK A;  1WLJ A;  4O0J A;  5CE3 A;  1HNW K;  3F73 A;  4BE1 A;  1VQM N;  2WOM A;  1K8K A;  5KRT A;  4F2R A;  4CJU A;  2A5X A;  3OYL A;  3MDQ A;  2HND A;  3ULD A;  4KHU A;  4HVZ A;  1BI4 B;  3U3G A;  2G8I A;  1TVR A;  1BO5 O;  5AQH A;  4Y1C A;  4CJT A;  3OTO K;  4DSE A;  5GIO A;  4CJW A;  2LN3 A;  2QWM A;  3AO5 A;  4JS4 A;  2Y1B A;  4MFB A;  2F8T A;  1ZBS A;  4CZM A;  4A5A A;  3O9T A;  5E84 A;  1E3M A;  2E2N A;  2UXB K;  1S9G A;  1RDA A;  2RKI A;  2P9K A;  3M3Z A;  3VN5 A;  3FGU A;  4CF9 A;  4HTL A;  4CVN E;  2LXR A;  1GLL O;  4DUY K;  3RMB A;  1CXQ A;  3CM6 A;  4CF0 A;  3NH2 A;  1V4T A;  3OYK A;  2I7P A;  5MLC Q;  1HYS A;  1N36 K;  1VSK A;  1Q9Y A;  3IG1 A;  2ZWH A;  1REV A;  4AHV A;  4PL7 A;  1HRU A;  4HVJ A;  2CH5 A;  3C65 A;  3O5B A;  3GL1 A;  1IH7 A;  3C95 A;  4FPA A;  2P9S A;  3KJV A;  3NH1 A;  1HNV A;  2GEM A;  4C1N I;  1YVN A;  3L4I A;  4BRQ A;  2ZJP L;  3HYF A;  1KQS M;  4O5B A;  1IKX A;  4YOV A;  4B9N A;  2B4J A;  3ZSV A;  3CMA N;  1K4P A;  3KD1 E;  2YKN A;  5AQV A;  2OZM A;  2QK9 A;  1C0M A;  3CJA A;  1IKW A;  1RBR A;  3V6D A;  1E4F T;  1QSY A;  3CJ1 A;  3NVM A;  3T7Z A;  3GOI A;  2NRR A;  1NJ5 A;  4FJ8 A;  4C8N A;  4WQ4 C;  5ADX H;  3VTI A;  1NGI A;  3DLK A;  2GV9 A;  1KFD A;  1XMQ K;  2QA4 N;  3DRP A;  3RR8 A;  4LFB K;  2HHT A;  3THW B;  1L3V A;  2OPP A;  3CF5 L;  3PV8 A;  1KC8 O;  5JIC A;  3LM2 A;  3KLG A;  4BDP A;  2OPR A;  5AFU A;  1JE3 A;  1K4O A;  4CZH A;  3KWG A;  4BY9 C;  1S5J A;  5HOO A;  3TWH A;  1X9M A;  2IDO A;  4EAH D;  1KTQ A;  3A0I X;  3JAM O;  1IG8 A;  3AVK A;  3VQ7 A;  4WFA L;  4HTU A;  4FOI A;  3R9P A;  1RDC A;  3VQE A;  1NG9 A;  2IFE A;  3LPT A;  5GAG P;  2HBL A;  4JI0 K;  2O8C A;  2GTD A;  4IOX A;  1OVQ A;  3CPE A;  2NNW A;  4NCB A;  3EL2 A;  1VSH A;  3O8M A;  4CJQ A;  3TOE A;  3AA2 A;  3QEV A;  4CBU A;  1RT5 A;  3AY9 A;  4CEF A;  3TAE A;  2UUB K;  1BWF O;  4LY7 A;  1RNH A;  4CF8 A;  1BIZ A;  3IS9 A;  2ZGZ A;  3M8S A;  3SI6 A;  3E66 A;  4DV6 K;  4FCX A;  4DQI A;  1MWM A;  3T1A A;  3EKS A;  1IBM K;  2XY5 A;  1VQ8 N;  3ZSW A;  1VQO N;  4PKG A;  2VCP A;  4RW6 A;  3SYZ A;  1X9W A;  3VQD A;  3K9J A;  2VG5 A;  4H5V A;  2O4G A;  2W6K A;  3EE8 A;  5JLH A;  3IKM A;  5DM6 L;  4CI6 A;  2OYQ A;  3SUQ A;  4LH4 A;  3W3D A;  3WT0 A;  4FWR A;  1NKC A;  3D6R A;  1UOC A;  3SAG A;  3ZIH A;  5FPM A;  3UKU A;  1HKG A;  4YOW A;  4CHN A;  4CEZ A;  3FZK A;  4DSF A;  3NF8 A;  4KKO A;  3PLA A;  3I55 N;  4JLH A;  1U49 A;  5HLF A;  4BRH A;  3H3O B;  4M3U A;  1HUX A;  3GE1 A;  4HUE A;  4FK2 A;  1VK0 A;  3C7N A;  1V4S A;  4H5N A;  3HOT A;  5J2Q A;  3BDP A;  2XY6 A;  4KFB A;  2EQA A;  3WQT A;  4U67 L;  3NDK A;  2P1J A;  3L8B A;  3LZJ A;  3DRS A;  1C6V A;  3M1F A;  3RMA A;  4JHD A;  3ZT1 A;  5CYM A;  3VQ8 A;  5M1P A;  1BA0 A;  1H4S A;  1WN7 A;  3MIO A;  5AZI A;  1BQN A;  3UKR B;  4BRL A;  3SCX A;  2ATQ A;  2CGJ A;  3V9X A;  3V1Q A;  2MX1 A;  3K9K A;  2FSK A;  1II7 A;  2ASP A;  1JXB A;  4DS4 A;  1T05 A;  4GKK K;  1HNZ K;  3L3V A;  4PA1 A;  3KLF A;  3THV A;  4BQL A;  2XRI A;  5ADX A;  1EXQ A;  3L2Q A;  1N33 K;  1S1T A;  3SNN A;  4X64 K;  4NCX A;  4NZR M;  2EWS A;  4B8C A;  5GAH P;  4FBQ A;  3OYB A;  5T7B A;  2QWN A;  1LOT B;  4E1M A;  3WNH A;  4DQQ A;  4HWI A;  3VTH A;  4DV7 K;  1GOB A;  1SKW A;  3CCU N;  3RRH A;  2F7T A;  3TSP A;  5LMN K;  4IDK A;  1I39 A;  1SKR A;  4WFN L;  5M1N A;  3DM2 A;  4AHR A;  4FLZ A;  4GKJ K;  3HT3 A;  3ATU A;  3V1R A;  4CJP A;  4FOE A;  1ATN A;  2P9L A;  4JKG B;  2FF6 A;  1NMN A;  3SAF A;  1Q81 O;  1EWR A;  2UU9 K;  1W9H A;  4H8K A;  4RW8 A;  4BG9 A;  5KGX A;  1S1W A;  3TTD A;  3VF2 A;  1TUU A;  3UKR A;  4WQ5 A;  3TR8 A;  5HRO A;  3HVT A;  3DJC A;  3HPH A;  3HRG A;  3ZSR A;  3D2F A;  3Q7C A;  2VYP A;  5EVZ A;  1W0H A;  1QZ6 A;  4BRA A;  2KFZ A;  3QIC A;  4CF2 A;  1H1V A;  4IXC A;  1H4T A;  3ZSQ A;  1NBW A;  4OPK A;  1CZA N;  3U3Y A;  1LWC A;  4CEB A;  5AQR A;  1OH7 A;  1JLF A;  3NBP A;  1VQ7 N;  5BRH A;  4CED A;  5AZJ A;  3ZET A;  2DTU A;  4BG8 A;  3WXJ A;  1DGK N;  2IGI A;  2HHU A;  1JL1 A;  5AQO A;  1GLB G;  1DLO A;  3SLC A;  2Q2R A;  1VQK N;  3O4W A;  2KTQ A;  3KLI A;  2HVI A;  2ZF5 O;  2EX3 A;  4ZTF A;  3KLE A;  1TK0 A;  2QKK A;  3OYM A;  1FJG K;  4FXD A;  4P8E A;  4CZG A;  2P5O A;  3HBT A;  4DFK A;  3ZEU A;  4MDB A;  3OYH A;  2A3Z A;  1VSM A;  3SUP A;  1KCF A;  3OYC A;  1TAQ A;  1LWF A;  2YHW A;  3BP8 A;  1WSE A;  2P9B A;  2XO7 A;  4JKA A;  3IAL A;  4A62 A;  4B9V A;  5AQI A;  4JI5 K;  3OYG A;  4N47 A;  3D7E O;  1YIT N;  1TGO A;  4DG1 A;  1BIU A;  2UUA K;  1LWE A;  5DM7 L;  4XIU A;  3B8A X;  1OKJ A;  1RCH A;  3Q7B A;  2W42 A;  2P9L B;  5M1Q A;  3P31 A;  1S6P A;  4O8U A;  1VQN N;  3G10 A;  3QB0 A;  1KK9 A;  1XEZ A;  3NVK A;  2I5J A;  5BRE A;  4CZF A;  4FJM A;  3H45 C;  4CZL A;  4B9M A;  1I3A A;  4Z4E A;  2DFE A;  1C0T A;  2EK0 A;  4OO1 J;  2VQF K;  2YHA A;  1TL3 A;  2DFF A;  1UWB A;  3KZB A;  1TKD A;  4DTU A;  2Z1G A;  1OH6 A;  4W5Q A;  4BR7 A;  1NKE A;  4LSN A;  1Y64 A;  3L4Q A;  2X74 A;  3O1W A;  3K57 A;  4U7B A;  5BPL A;  1VQ9 N;  2E1Y A;  3R6M A;  4NXM K;  3SMS A;  1N8R O;  2IVO A;  1TKU A;  3CCS N;  4E7H A;  3TAG A;  2PFU A;  4A57 A;  4BR0 A;  3O9S A;  3VEY A;  3DXM B;  1TKX A;  3V9Z A;  3O4N A;  4BRN A;  3QIN A;  4DR1 K;  3CCR N;  5HRR A;  3J81 O;  4CHZ A;  2RIS A;  1GLA G;  1C0U A;  3T19 A;  3P1G A;  3GBT A;  4ISF A;  1K49 A;  5TKY A;  2XY7 A;  3HOS A;  4CK3 A;  5I9E B;  3CQY A;  3CJC A;  2OPS A;  2YNF A;  2D0B A;  1QQM A;  5K14 A;  4PUO A;  1RT2 A;  4DQP A;  2RHK A;  3P04 A;  2O8E A;  4OGE A;  4Y0W A;  5SWM A;  1A5W A;  3AVC A;  2P9U A;  1NOZ A;  3CCM N;  4KTW A;  3ZSY A;  3NAE A;  2YI1 A;  3ZET B;  3MAQ A;  2P51 A;  5BPN A;  2X6N A;  2HHX A;  5FLX O;  4BRE A;  3MWT A;  4NLC A;  4O8K A;  3NF6 A;  1HR0 K;  4CEA A;  4AM6 A;  5TKW A;  4CES A;  4GMJ B;  5BR8 K;  2QXF A;  1HX1 A;  3K5O A;  2Q0U A;  2HB5 A;  3LAM A;  3G25 A;  2P9P B;  3R8E A;  5JMV A;  3LAN A;  4NB4 A;  1J9A A;  3VMF B;  1RQ8 A;  3K58 A;  1NH9 A;  3CFR A;  1U2V A;  3H6E A;  4JKG A;  4KTZ A;  2UXD K;  3DLL L;  4WI1 A;  4FW2 A;  3LVK B;  4OPH A;  5E41 A;  1VSJ A;  2BDP A;  3ZII A;  2W41 A;  3FZL A;  1ATR A;  2FC0 A;  4BC4 A;  3RMC A;  4DFP A;  4A2B A;  4C8L A;  1TL1 A;  4K8Z A;  1WB9 A;  3TPQ A;  4AM7 A;  1SS6 A;  4LC9 B;  4DQS A;  3AVN A;  5C2F A;  4E7J A;  1LAV A;  3FZF A;  4E7I A;  1GOC A;  3F5T A;  3OA9 A;  3HPO A;  4FM2 A;  3LZI A;  4UQG A;  1KAY A;  4YOU A;  1NLV A;  3HL8 A;  4M3W A;  2O4I A;  2AJQ A;  4HVC A;  3D2E B;  2V7Y A;  1BG3 A;  4CF1 A;  3OJS A;  4KH5 A;  4DLG A;  4KB1 A;  4G9Z A;  4DSI A;  1RTI A;  1ASV A;  4XH5 A;  2NRV A;  3VEX A;  3T3F A;  4F3T A;  3AO4 A;  3PO4 A;  5AQZ A;  2GWK A;  2ZQB A;  3J7A P;  5CHI A;  3QLH A;  4M7Y A;  4JI1 K;  2HMP A;  5C42 A;  1ESV A;  1RTD A;  1SL0 A;  5BN9 A;  4HCB A;  4LF8 K;  3U6F A;  3WBM A;  4RCH A;  3TI0 A;  5JS1 A;  5FRM A;  4OLF A;  3KKR A;  2QXL A;  3R1X A;  4CER A;  5JVG L;  3HSC A;  4Q15 A;  3EE9 A;  3LL3 A;  5HRN A;  4B9U A;  2KLA A;  1H0Y A;  3J8A A;  4EFH A;  4M3X A;  4QS8 A;  2OTL N;  5C0Y A;  1TUY A;  2GUI A;  4B9T A;  4Q5V A;  2NRX A;  2O8D A;  1FXX A;  4H0Y B;  4BC2 A;  2GEL A;  4B1X B;  2E4L A;  3SJH A;  5CY4 A;  3LS6 A;  1QE1 A;  4KRE A;  3EZW A;  4Q0B A;  2FBT A;  4FJN A;  2X78 A;  3ID6 A;  1NK5 A;  3K5N A;  2Q36 A;  4JD2 A;  3LRJ A;  3DLB A;  4K0K K;  3CCQ N;  1D5A A;  1WBB A;  1QQC A;  1M90 O;  2ZE2 A;  2GUP A;  4DU3 A;  4ELT A;  4OKJ A;  2DFH A;  5LJW A;  3KD5 E;  1TIG A;  4CJV A;  3QFU A;  2PYL A;  3QEW A;  4DU1 A;  1QSL A;  2IS3 A;  3HZ7 A;  5LMU K;  4DSK A;  3TU5 A;  3O08 A;  1NJ8 A;  2QWL A;  2O8B B;  4DTO A;  5FDL A;  4BE0 A;  1NJ6 A;  1VQP N;  3KHY A;  3A5M C;  4KB0 A;  1IEZ A;  2D0P A;  3KK3 A;  3IAB B;  4B1V A;  1VSF A;  3DOK A;  4JKF A;  2HBJ A;  4LSL A;  1YF5 L;  3L6Q A;  3OS2 A;  4DU4 A;  3CCV N;  1JLE A;  3H1V X;  1B9D A;  4H4O A;  3AO2 A;  5AQT A;  4KI6 A;  3SQ2 A;  4BRD A;  3PSI A;  2NRT A;  5D3G A;  2YKM A;  3L7V A;  2VWB A;  5JLF A;  2E6L A;  3TAN A;  1K8A O;  1VQ6 N;  4O5F A;  5C15 A;  1IBL K;  1JO0 A;  3O9U A;  1RDB A;  4EZ9 A;  4DR6 K;  4MQ3 A;  1ILY A;  2VGM A;  4H0P A;  3S3N A;  1NJX A;  2H9U A;  3QEP A;  1QSS A;  3CYM A;  2QWO A;  3QKB A;  1NGG A;  4FK0 A;  3VQQ A;  4H0T B;  3WXM B;  4I2P A;  4GNI A;  1T6D A;  4WQ4 A;  4PHT X;  4OLA A;  2V7Z A;  4DFM A;  3ZSX A;  2F9W A;  3SPZ A;  5J2M A;  1T6C A;  4QS7 A;  2P9K B;  1EKE A;  2JWL A;  2P9I A;  1DTQ A;  1U47 A;  2IVP A;  3IAY A;  1RGI A;  4CJL A;  2AA4 A;  4LF6 K;  5AQY A;  4CJ4 A;  1EO1 A;  1HQU A;  4CGI A;  3O1B A;  2B5J A;  2H3G X;  4BDY A;  4FM1 A;  2Z1I A;  5EXW A;  3HXM A;  3OS1 A;  5KI6 A;  4K87 A;  1QZ5 A;  2GWJ A;  4DTN A;  2E88 A;  4CJR A;  4B3M K;  3OYE A;  3BGR A;  4FSV A;  2IVN A;  3D45 A;  4FJJ A;  1BOT O;  2L8Y A;  3I56 N;  3HP9 A;  2YX6 A;  3HPG A;  4FLU A;  2A6A A;  3MXJ A;  4L3Q A;  5FPN A;  3THY A;  4CE9 A;  4CIE A;  3SAH A;  3NGY A;  4E3S A;  3MX5 A;  3V4I A;  1FW6 A;  2QWP A;  1G58 A;  1Z05 A;  4BWJ A;  2ITG A;  3E9P A;  3A5N C;  4KH4 A;  3LDQ A;  4J2E A;  4X62 K;  1SL1 A;  2RIU A;  2W40 A;  3IUC A;  3L2U A;  3P5J A;  4YFU A;  3CCE N;  4XH1 A;  4I9L A;  1RDU A;  3CJB A;  4NCG A;  4DR7 K;  4CHO A;  1NK4 A;  3MN6 A;  3H3N O;  1YJ9 N;  1CXU A;  3IFR A;  3CXC M;  5EX5 A;  3T1Y K;  1T8E A;  2JWK A;  1ZBI A;  1KVB A;  3QO9 A;  1HYZ A;  4DCH A;  3CCL N;  3VQ6 A;  1RTH A;  3D0P A;  3K59 A;  1NK0 A;  1XNQ K;  3RR7 A;  3EEQ A;  4OPA A;  2I7N A;  3RRG A;  5AQM A;  3VER A;  4Z94 A;  4X65 K;  2DPN A;  4Z9E A;  1VHX A;  4K8X A;  1RT7 A;  3KKS A;  4JKD A;  3TTF A;  5HRP A;  1NJI O;  2VGN A;  3DLE A;  1XC9 A;  3J7Z O;  4CZE A;  2XY8 A;  3ASM A;  4CFA A;  4FZY A;  5IWA K;  2VG6 A;  2KHO A;  3LP0 A;  3AO3 A;  4HUG A;  4NZT M;  1NK7 A;  3AJE A;  3VOV A;  4FVM A;  1YI2 N;  1TKZ A;  1DKG D;  3SV3 A;  3E1Y A;  5J1E A;  2HHQ A;  3AGK A;  4ISE A;  4BGB A;  2EHG A;  3L2V A;  2O8E B;  3VA0 A;  2Z1H A;  3EZ5 A;  2Q3V A;  3E01 A;  5JS2 A;  3LDL A;  3WNF A;  1W2B M;  3KTQ A;  1TKT A;  3VQC A;  3V1O A;  4M42 A;  3LQU A;  1SUQ A;  1K4L A;  3QBW A;  4FBK A;  2O8F A;  4CD1 A;  1Y2I A;  1HC7 A;  2LSN A;  1RBT A;  1RT4 A;  1RDD A;  4ICL A;  3O80 A;  4YOX A;  3THX A;  2ITM A;  1Q18 A;  2D4W A;  2YCH A;  3ULE B;  4HHT A;  1JXE A;  4JKC A;  3AA3 A;  5DK5 A;  1IO2 A;  4DV4 K;  4WYB A;  3IMX A;  2HHS A;  3ZLJ A;  4Z4F A;  4IFV A;  2OA8 A;  3L3U A;  4ELV A;  2WUS A;  2ETJ A;  5AQN A;  2FBX A;  1RFQ A;  3ISN C;  4BVP A;  2KZZ A;  3ATV A;  3LP2 A;  4FVU A;  3OYD A;  4CFB A;  1YTU A;  1SAZ A;  4AHT A;  4JK7 A;  4FWM A;  4F4K A;  3CC4 N;  4FJG A;  2O8F B;  3DOL A;  1I94 K;  4LF4 K;  2G8W A;  3AVA A;  3O3H A;  3F2K A;  4IO9 L;  1CZ9 A;  3OYI A;  1RT6 A;  1HNX K;  4DR4 K;  3CC2 N;  4B1Y B;  4E89 A;  2OPQ A;  2O8B A;  2VG7 A;  2FF3 B;  1NK9 A;  5LJV A;  4BR4 A;  3MN9 A;  3QEX A;  3C6H A;  2BUP A;  4Z4C A;  4WFB L;  3V9U A;  4KTQ A;  4BR5 A;  3E9O A;  3ZX2 A;  3PX6 A;  1IKY A;  3LDO A;  2D0C A;  5F2R A;  4EP5 A;  1DEJ A;  4JN4 A;  1U04 A;  5C10 A;  3CER A;  1UAX A;  4YDU A;  3S9H A;  2HNY A;  1GOA A;  3AVB A;  3LP3 A;  4P6C A;  4IDH A;  1PAV A;  4W5T A;  3WNE A;  3ZT3 A;  3QEI A;  2P5G A;  4B08 A;  3TAF A;  5FPE A;  3LWL A;  1JLC A;  2CGL A;  1QHA A;  4GW6 A;  1BQM A;  4AF1 A;  3SPY A;  4KH6 A;  1X3N A;  4JKH A;  3TSQ A;  3HJF A;  1BCO A;  4JKB A;  4ILJ A;  4W5R A;  4CCH A;  3DXK A;  1NU0 A;  1RBS A;  3C7N B;  3NGZ A;  3I33 A;  4IG3 A;  1XHX A;  4BGA A;  2M71 A;  4J2A A;  3U9D A;  2P9U B;  4FBW A;  1D4X A;  3QNO A;  3JYT A;  3C0B A;  3CIP A;  5HL7 L;  4H5W A;  1RTJ A;  1OH5 A;  3QIO A;  4DMN A;  1BDG A;  1EP4 A;  4JI6 K;  5H1S Q;  1XMO K;  3GG4 A;  3PY8 A;  4O4G A;  4A61 A;  4KRF A;  2NUB A;  3VQ5 A;  1NKB A;  3QDK A;  4GY2 B;  1BI4 A;  4C8O A;  2YNH A;  2G8F A;  2G8U A;  1K73 O;  1LV5 A;  4FK4 A;  1U2V B;  5GIP A;  1YT3 A;  4IOA L;  4BQZ A;  1NJZ A;  1QHT A;  1SV5 A;  2WBN A;  4FWK A;  4CK1 A;  1S1V A;  4JYA K;  2WC9 A;  1T44 A;  1OVY A;  1XUP O;  4CJE A;  1VQ5 N;  1WAJ A;  4DLE A;  1LAW A;  2NRZ A;  1HJO A;  2F9T A;  1NWK A;  2QWQ A; 
#chains in the Genus database with same CATH homology
 3F5T A;  3OA9 A;  2D1K A;  4FPA A;  2A41 A;  4H03 B;  4JK8 A;  4PKH A;  4JHD B;  4DHY A;  5GAD P;  4I6M B;  1KAY A;  1RDW X;  2FLO A;  2GEM A;  4NO7 A;  1YVN A;  4YOU A;  4C1N I;  3L4I A;  4BRQ A;  2ZJP L;  1NLV A;  3A5O C;  1G57 A;  1KQS M;  3D2E B;  4GV9 A;  2V7Y A;  1BG3 A;  4YOV A;  4KH5 A;  3W0L A;  3CMA N;  3VGL A;  4G9Z A;  1C0G A;  1K4P A;  1SQK A;  2WFB A;  1S72 N;  5AQV A;  3ENO A;  4XH5 A;  2NRV A;  3VEX A;  3CJA A;  3CHW A;  1KAX A;  1E4F T;  4MO5 A;  1NM1 A;  3CJ1 A;  3NVM A;  4K43 A;  5AQZ A;  2FSJ A;  3T7Z A;  2J4R A;  3ID8 A;  2GWK A;  3GOI A;  2NRR A;  2ZGY A;  5CHI A;  3N4Q A;  5BR9 A;  4M7Y A;  3VES A;  4B1U B;  1BUP A;  4WQ4 C;  2HMP A;  5ADX H;  3VTI A;  1NGI A;  3TSU A;  3MCA B;  1ESV A;  1R59 O;  3CET A;  4IFE A;  5BN9 A;  2QA4 N;  2HF4 A;  3VGK A;  4NLB A;  4RCH A;  3T1I A;  2PAV A;  1TKU A;  4YKE A;  5F1X A;  3CF5 L;  2QXL A;  1KAZ A;  3R1X A;  3WXK A;  4QS9 A;  3RVC A;  5JVG L;  1MA9 B;  1YUW A;  3HSC A;  3EO3 A;  4BRF A;  4RWT A;  3EE9 A;  3LL3 A;  5AQG A;  3LM2 A;  4WCE L;  5JIC A;  4YOR A;  1MDU B;  4IWV A;  1X9J A;  1K8K B;  2KLA A;  5F0X A;  3U9Z A;  2UYT A;  3J8A A;  4H0O A;  4K42 A;  3D2E A;  3UE5 A;  4EFH A;  5AFU A;  1K4O A;  4CZH A;  3KWG A;  1VQL N;  4BY9 C;  4B1Z A;  3CPW M;  4QS8 A;  2OTL N;  5HOO A;  4EO0 A;  4BC3 A;  5C0Y A;  1TUY A;  2NRX A;  4H0Y B;  4EAH D;  4BC2 A;  2GEL A;  1GLD G;  3A0I X;  4H0X B;  4B1X B;  1IG8 A;  4XH4 A;  3SJH A;  5KPT A;  5AQX A;  3LS6 A;  4BRG A;  1ZXO A;  4WFA L;  3EZW A;  5JVH L;  1PVY A;  3QML A;  4FOI A;  3ID6 A;  4PL8 A;  2ZJQ L;  3R9P A;  1WOQ A;  3LRJ A;  2Q36 A;  4JD2 A;  5AFU H;  3CCQ N;  5GAG P;  1M90 O;  2GUP A;  2HBL A;  4MLE A;  3DXM A;  2GTD A;  3RSE B;  4IOX A;  3CPE A;  2NNW A;  4JK9 A;  3GDQ A;  3EL2 A;  5LJW A;  3KK7 A;  5BN8 A;  3KVG A;  3O8M A;  3QFU A;  3AAR A;  4XEI A;  1BA1 A;  1M1K O;  3L0Q A;  3CQX A;  4CBU A;  1YHQ N;  3AY9 A;  1P90 A;  1BWF O;  3BEX A;  1XQS C;  2GX9 A;  4BR2 A;  1NGD A;  2ZGZ A;  3TU5 A;  3O08 A;  4FO0 A;  2QWL A;  3E66 A;  4FCX A;  3VEO A;  1VQP N;  3KHY A;  1NGA A;  1MWM A;  3A5M C;  1IEZ A;  3VGM A;  4IJN A;  1GLC G;  3EKS A;  2D0P A;  3CME N;  4B1V A;  2HBK A;  2CGK A;  3OBW A;  4PKG A;  1EQY A;  4FWQ A;  1VQO N;  1VQ8 N;  4JKF A;  2HBJ A;  2VCP A;  5KQD A;  2BTF A;  3K9J A;  1YF5 L;  3L6Q A;  4H5V A;  3EE8 A;  4FWN A;  5JLH A;  3PIP L;  3CCV N;  3H1V X;  4IEI A;  3IKM A;  5GIN A;  2ZJR L;  5DM6 L;  5AQT A;  4CI6 A;  4CBW A;  1ATS A;  3FZM A;  3W3D A;  3WT0 A;  1QQO A;  4BRD A;  3FR0 A;  4FWR A;  4PKI A;  3D6R A;  3MX2 A;  2NRT A;  3T69 A;  4BRC A;  3SAG A;  3SBT A;  3ZIH A;  5FPM A;  3UKU A;  1HKG A;  3EKU A;  4YOW A;  2VWB A;  5JLF A;  3CCJ N;  1K8A O;  3CD6 N;  3KWI A;  3F9M A;  3H1Q A;  3LDN A;  3O5B A;  4FPB A;  3FZK A;  4O5F A;  5C15 A;  1VQ6 N;  3O9U A;  5KPZ A;  3PLA A;  3I55 N;  1SNN A;  3TTC A;  3VEW A;  2VGM A;  4H0P A;  4K41 A;  4BRH A;  1ILY A;  3MGZ A;  3H3O B;  1HUX A;  2QWO A;  3HI0 A;  1NGG A;  3O6W A;  3GE1 A;  4KBO A;  4BRO A;  5AQJ A;  1W97 L;  4H0T B;  4BRI A;  4H5N A;  3C7N A;  1V4S A;  4GNI A;  1T6D A;  4WQ4 A;  3WXM B;  4PHT X;  3DXK B;  2V7Z A;  1X3M A;  3HTV A;  3HOT A;  4EHT A;  2F9W A;  2EQA A;  1T6C A;  4QS7 A;  3WQT A;  4P77 A;  4IOC L;  2P9K B;  1NGC A;  3JS6 A;  3WEE B;  4U67 L;  2JWL A;  2P9I A;  1TYQ B;  4DQ8 A;  3M1F A;  5AQW A;  4JHD A;  2IVP A;  3SBG A;  1YAG A;  1RGI A;  3VET A;  5M1P A;  1BA0 A;  1NMD A;  5AQU A;  2V51 B;  2AA4 A;  1NGH A;  5AQY A;  1SZ2 A;  4FWS A;  1EO1 A;  3MIO A;  2P9P A;  2ASM A;  3U4L A;  3O1B A;  2H3G X;  5AZI A;  3UKR B;  2A40 A;  2P9N A;  4BRL A;  5EXW A;  5AQL A;  5C12 A;  4P8J A;  1GLF O;  1QQN A;  2E2O A;  1C0F A;  4UY8 O;  3BF3 A;  1QZ5 A;  2GWJ A;  2CGJ A;  2E88 A;  3H46 O;  2MX1 A;  1JCU A;  4CJ7 A;  4FSV A;  3K9K A;  2IVN A;  2FSK A;  1BOT O;  1NGJ A;  2ASP A;  3I56 N;  5AQK A;  2YX6 A;  3A8Y A;  3AGR A;  2A6A A;  3JXU A;  3ZEU B;  4L3Q A;  5FPN A;  1Q86 O;  4IZ9 A;  3SAH A;  4BQL A;  5ADX A;  3MX5 A;  2E2P A;  2QWP A;  1G58 A;  1Z05 A;  1Q7Y O;  5GAH P;  4NZR M;  2EWS A;  4FFJ A;  2E2Q A;  3E9P A;  4FBQ A;  3A5N C;  4M63 C;  4J8F A;  3LDQ A;  4KH4 A;  3UKU B;  2QWN A;  3P38 A;  1LOT B;  1JCE A;  2YHX A;  4FWO A;  2RIU A;  2W40 A;  3IUC A;  4M7X A;  4HWI A;  3VTH A;  1K4I A;  4MLH A;  5CR4 A;  3CCE N;  4XH1 A;  4JNE A;  4A59 A;  1RDU A;  3CJB A;  3CCU N;  4JEP A;  3VF4 A;  2F7T A;  3TSP A;  5M1K A;  3MN6 A;  4WFN L;  4YOT A;  3H3N O;  5M1N A;  1YJ9 N;  4BC5 A;  3IFR A;  3ATU A;  3CXC M;  5ELZ A;  4FOE A;  5EX5 A;  1ATN A;  1U6Z A;  2P9L A;  4JKG B;  4MDA A;  3IDH A;  2Q1N A;  3CI5 A;  2FF6 A;  2JWK A;  3SAF A;  1Q81 O;  3BUZ B;  2AP1 A;  5AZI B;  4DCH A;  3CCL N;  3NMU A;  4BG9 A;  3BF1 A;  4OPA A;  5AQQ A;  4I6M A;  4FWP A;  4C1N K;  1HPM A;  2I7N A;  3TTD A;  5AQM A;  3VF2 A;  3VER A;  3M6G A;  4Z94 A;  3DAW A;  1TUU A;  4H5R A;  3UKR A;  2DPN A;  2RE2 A;  4WQ5 A;  4JKD A;  2NLX A;  3TTF A;  2NRH A;  3HM8 A;  3DJC A;  2NZT A;  1NJI O;  1J6Z A;  2VGN A;  3HRG A;  3D2F A;  3J7Z O;  5AQS A;  4CZE A;  1NGB A;  3VPZ A;  1O13 A;  4IJA A;  2YHY A;  1WUA A;  3Q7C A;  1NGE A;  1QVG M;  2HST A;  2VYP A;  1YXQ A;  4ILG B;  5EVZ A;  4R79 A;  1QZ6 A;  2KHO A;  4BRA A;  5AZJ B;  3QIC A;  2P9I B;  1ZC6 A;  1H1V A;  4IXC A;  1NBW A;  3WEE A;  4BRM A;  4NZT M;  1CZA N;  3G4S N;  1QVF M;  4CZK A;  3VEV A;  1KD1 O;  3AJE A;  5AQR A;  3VOV A;  1VQ7 N;  5BRH A;  1YI2 N;  5AZJ A;  1DKG D;  3CJ9 A;  3ZET A;  3MN5 A;  4BG8 A;  3O9Q A;  3WXJ A;  1DGK N;  3E1Y A;  2P9N B;  5AQO A;  1HKC A;  1GLB G;  2P9S B;  3AGK A;  3SLC A;  4ISE A;  1S22 A;  2Q2R A;  4BGB A;  1VQK N;  3O4W A;  4H0V B;  4JAX A;  2ZF5 O;  3LDL A;  3ULE A;  1W2B M;  1G99 A;  3E9L A;  3P39 A;  3RSE A;  1TYQ A;  3LQU A;  4P8E A;  4CZG A;  2PBD A;  3HBT A;  3MK6 A;  3OBY A;  3WXL A;  3ZEU A;  4MO4 A;  4B9Q A;  4MDB A;  3QBW A;  5B8H A;  4FBK A;  1JCG A;  2A3Z A;  5AQF A;  4CD1 A;  2Q0R A;  4RTF D;  2QEX N;  3N4P A;  2YHW A;  3BP8 A;  2P9B A;  1NGF A;  1P8Z A;  3O80 A;  4JKA A;  3SK3 A;  4YOX A;  5FPD A;  4A62 A;  2ITM A;  3P4I A;  3ZIG A;  1Q18 A;  4YOY A;  2Q97 A;  2D4W A;  4K25 A;  5AQI A;  3FLC O;  2YCH A;  3CJ7 A;  4JKE A;  4C23 A;  1YIT N;  3ULE B;  3D7E O;  4BRP A;  4EHU A;  4JKC A;  4FL9 A;  3UB5 A;  2E20 A;  1E4G T;  3ENH A;  2E1Z A;  5DM7 L;  4WYB A;  3IMX A;  3B8A X;  3FFK B;  2QM1 A;  2E8A A;  2Q31 A;  1XC3 A;  5AR0 A;  1OKJ A;  3QFP A;  1S3X A;  3Q7B A;  2P9L B;  5M1Q A;  3P31 A;  2WUS A;  4E1B A;  3S41 A;  4O8U A;  5AQN A;  1VQN N;  5E26 A;  3QB0 A;  1RFQ A;  2QWR A;  4BVP A;  1KK9 A;  3ATV A;  1XEZ A;  4FVU A;  4GV3 A;  4I14 A;  1SAZ A;  3NVK A;  4JK7 A;  1DT9 A;  5AQP A;  5BRE A;  2ASO A;  3U8X A;  4CZF A;  3ZIE A;  3H45 C;  4FWM A;  4B1W B;  4BRK A;  5EY4 A;  4CZL A;  3CC4 N;  4A5B A;  3LDP A;  1KC8 O;  3ZX3 A;  3AAQ A;  1GLJ O;  1NWK A;  3F2K A;  4CZJ A;  4IO9 L;  4OO1 J;  3LM9 A;  2D0O A;  4GV6 A;  3CC2 N;  3WUH A;  3H07 A;  3KZB A;  4B1Y B;  2QI2 A;  1HKB A;  2YJF A;  3G6E N;  2FF3 B;  4FWL A;  5LJV A;  3FE1 A;  3C6A A;  4BR7 A;  3OHR A;  3MN7 A;  3MCP A;  4BR4 A;  1HLU A;  4CD3 A;  3MN9 A;  4EIA A;  1Y64 A;  3L4Q A;  4CZI A;  1Q82 O;  1JCF A;  4F9O A;  1GLE G;  2BUP A;  3C6H A;  2V52 B;  3O1W A;  4WFB L;  4U7B A;  4BR5 A;  3E9O A;  5BPL A;  1VQ9 N;  3ZX2 A;  3QBX A;  5GAE P;  2E1Y A;  3R6M A;  4ILH A;  3SMS A;  5KPR A;  2IVO A;  1N8R O;  3LDO A;  4DKW A;  3CCS N;  2NRW A;  2PFU A;  4A57 A;  4BR0 A;  5F2R A;  3O9S A;  3VEY A;  3L7V A;  2FSN A;  4WF9 L;  3ZX0 A;  5M1F A;  5M1O A;  3R3L A;  3DXM B;  1YJN N;  1T3V A;  3O9R A;  1IJJ A;  3VEN A;  4BRN A;  1DEJ A;  2FXU A;  4JN4 A;  5C10 A;  3PIO L;  3CCR N;  3CER A;  1JJ2 M;  2HOE A;  2RIS A;  3MMV A;  4YDU A;  3MK5 A;  3SMP A;  1GLA G;  1PVW A;  3WXI A;  4P6C A;  5BRD A;  4IDH A;  3A5L C;  3GBT A;  4ISF A;  4IEE A;  5LY3 A;  1K49 A;  1TKS A;  5TKY A;  3G71 N;  3I8B A;  3D2F B;  5FPE A;  3HOS A;  4ISG A;  2CGL A;  5I9E B;  3CQY A;  3MWP A;  3CJC A;  2HF3 A;  3DWL A;  1QHA A;  5KQ8 A;  2OAN A;  2IIR A;  1QQM A;  1KXP A;  1BU6 O;  1K7J A;  4IO8 A;  1MWK A;  4AF1 A;  3VF6 A;  2RHK A;  3EN9 A;  3P04 A;  1X3N A;  4KH6 A;  1VQ4 N;  5CE3 A;  4Y0W A;  4JKH A;  3TSQ A;  1VAZ A;  2HBM A;  4E1J A;  2P9U A;  1VQM N;  4JKB A;  4ILJ A;  5BPM A;  1K8K A;  3CCM N;  3DXK A;  4A2A A;  4BVO A;  4DB3 A;  3C7N B;  2YI1 A;  3ZET B;  2A5X A;  3I33 A;  3MDQ A;  5BPN A;  1YJW N;  4BGA A;  4HVZ A;  4BRE A;  3U9D A;  3MWT A;  4NLC A;  2P9U B;  4O8K A;  4FBW A;  1BO5 O;  1D4X A;  5AQH A;  1LCU A;  4AM6 A;  2KKZ A;  5TKW A;  2OTJ N;  3HZ6 A;  3C0B A;  3CIP A;  4H5T A;  5GIO A;  3WQU A;  5HL7 L;  3CC7 N;  3ZYY X;  1HX1 A;  4H5W A;  2Q0U A;  3VEZ A;  2QW9 A;  2BH1 A;  3G25 A;  2LN3 A;  3M5R A;  2QWM A;  2P9P B;  3R8E A;  5H1S Q;  1BDG A;  1YIJ N;  1K4L A;  5JMV A;  4NB4 A;  3GG4 A;  4CBX A;  4A61 A;  3OW2 M;  3VMF B;  3ENB A;  1ZBS A;  4GVE A;  4CZM A;  4P6D A;  1U2V A;  4A5A A;  3O9T A;  4BR9 A;  3H6E A;  4JKG A;  5E84 A;  5BRF A;  3DLL L;  2E2N A;  3QDK A;  4GY2 B;  4OPH A;  2P9K A;  2CH6 A;  3M3Z A;  4YDU C;  3FGU A;  2A42 A;  5EOY A;  1K73 O;  3ZII A;  3AAP A;  4HTL A;  2W41 A;  3FZL A;  1ATR A;  1U2V B;  4BC4 A;  1GLL O;  5GIP A;  5C2D A;  4P6P A;  2YJE A;  4IOA L;  2QTD A;  4BQZ A;  1K9M O;  4A2B A;  2WBN A;  4FWK A;  3TPQ A;  4AM7 A;  2WC9 A;  1Z6R A;  1T44 A;  1OVY A;  4JD2 B;  1V4T A;  1XUP O;  1SS6 A;  4LC9 B;  1VQ5 N;  2I7P A;  4WQ5 C;  5C2F A;  5MLC Q;  3FZH A;  2ZWH A;  4PL7 A;  2NRZ A;  1HRU A;  3FZF A;  1HJO A;  2CH5 A;  2F9T A;  3C65 A;  3GL1 A;  2QWQ A;  2P9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...