3TSPA

Crystal structure of e. coli hypf
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Transcriptional regulatory protein
total genus 212
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tspA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tspA01
3TTCA 3VETA 3VF4A 3VTIA 3TTFA 3VTHA 3TTDA 3VESA 3VENA 3TSQA 3VEZA 3VEWA 3VEOA 3TSUA 3VF2A 3VERA 3VEXA 3TSPA
chains in the Genus database with same CATH superfamily
4I6MB 3PO5A 3EE9A 3EL2A 4P8JA 1SQKA 3P38A 3HOSA 1NWKA 4X62K 3TAGA 4CZIA 3VTHA 4YY3K 1OVQA 1A5XA 2QA4N 3ID8A 2OPRA 4H0YB 3SI6A 3AV9A 3CFPA 4WQ5C 1SUQA 2CH5A 3OYNA 2MX1A 3MN5A 1KVBA 1BCMA 1V4SA 3U8XA 3DRPA 4OPKA 2O8BA 2D5RA 2QW9A 1HJRA 1D4XA 2G8IA 1O1WA 1BOTO 5DM7L 1I3AA 2I5JA 4DSKA 3AAPA 3BDPA 4I9LA 4E7KA 2E1YA 4KHUA 1GLDG 2ZWHA 3UKRA 3SYZA 4M41A 3ASMA 4JD2A 3WEEB 4CJ4A 3HXMA 4FJ9A 3P83D 3DLLL 2Q2RA 5IT9O 1S1UA 1BWFO 1YI2N 4G9ZA 5FPNA 3OJSA 4DR7K 1T3VA 3P04A 5FPEA 1VQ4N 4HCCA 3VETA 4GMJB 1C0GA 3BF3A 4DSJA 4Z4FA 1C0FA 2GELA 4EFHA 4K42A 4CIEA 3EEQA 3PO4A 1QVFM 1QQCA 5SWMA 4H4OA 4B9NA 4AM6A 2XY7A 5H1SQ 3L6QA 4BVOA 2E6LA 3SMSA 1NGJA 1R59O 5JLHA 4BRCA 5GAHP 3SMPA 1OVYA 1J5OA 2OYQA 3TR8A 4CI6A 3C95A 3QDKA 2IGIA 3U3YA 2YKNA 4BRNA 3DXMB 4EO0A 4KFBA 4P6CA 4DTXA 4K43A 5LJWA 1WSJA 1RBSA 4A2BA 3AA4A 5HRSA 4LF6K 4BY9C 4BDZA 1S9EA 3OYFA 4OPHA 4OLAA 2AJQA 1LAWA 1E4FT 2GUPA 4IDKA 3G0ZA 3QBWA 4KBOA 4PY5A 4XIUA 4IWVA 4CHPA 5KGXA 4C8OA 3D2FB 4P6DA 1TKSA 1NGCA 4IOXA 4CJWA 4JK9A 4Z9EA 3O4NA 1HRUA 4JI0K 1SL0A 2EHGA 4K88A 1NJIO 1VQKN 2ASMA 3HPGA 5KRSA 1TK8A 3NH1A 4B9UA 3AVHA 1G57A 4U7BA 3H6EA 4KHPK 1UOCA 4KH6A 4CK3A 4LF7K 2ATQA 4ISEA 3TSQA 3QMLA 1YVUA 4FJ5A 3LANA 3I56N 2E8AA 1K49A 3RRHA 4CJFA 2O8DA 4IZ9A 3ZIGA 3G10A 1YVNA 4DV7K 4DFJA 4YOYA 2O8EA 2RISA 1VSDA 4I2QA 1DCJA 3LS6A 3WEEA 3M3ZA 1KXPA 2KHOA 3P5JA 3RMBA 1NJYA 2Z1IA 5HRPA 3A5LC 4E7IA 2PYJA 2FF3B 2HOEA 4E7LA 4B8CA 1EXQA 4FJGA 4B9MA 3ZSOA 3E66A 2J4RA 4E3SA 3GL1A 3T1HK 4HCBA 3MWTA 1KCFA 4I9QA 3MX5A 4W5TA 3HPHA 2KFNA 1WBBA 3ZCMA 4BGBA 1YTUA 1HUXA 4X66K 3TAFA 1TKZA 4BREA 4BACA 3LRJA 5FROA 4XH1A 1BI4A 4ISGA 2VG5A 3LDQA 2P1JA 4CEQA 4Q5VA 1HYSA 3SV4A 4F8RA 4Y1CA 4MFBA 3H45C 3VEYA 3ATVA 1YIJN 4AHTA 4CW7B 2IIRA 1VSKA 4H0VB 4CJLA 1KAXA 1SV5A 4B9LA 5AQXA 4DTPA 1ZC6A 3QERA 3CCLN 1T03A 3V1QA 4P77A 3VMFB 3CI5A 1Z05A 3U9DA 4DF8A 2PY5A 2HNYA 3CCMN 4KHSA 3P31A 1GLLO 3ENOA 2JWLA 2LXRA 4BE2A 3KK3A 4ZTFA 5AFUH 1KFDA 2YHWA 4C1NK 3QIPA 5CE3A 3HSTB 3J7ZO 1WSFA 5J2PA 3U4LA 3T1IA 4Z4GA 2YNHA 2Q1NA 2F7TA 1NJ6A 1B9FA 5LMNK 2RF2A 1S8EA 3L2QA 4DQSA 3QNOA 3SBGA 2DY4A 4OKJA 1SKSA 1DLOA 2D4WA 1BGXT 2O8DB 3VEOA 5AQRA 1WLJA 5HL7L 1NLVA 2G8HA 3LL3A 4CEZA 4FXDA 2YNFA 1JCGA 4YOUA 4BRHA 3OYJA 3WNHA 1BQNA 1HLUA 2QXFA 3WQUA 2NRHA 4ELVA 5CYMA 3IG1A 1K4IA 2BANA 3CG7A 1VQLN 3JAMO 1NJ2A 4DV5K 3R1XA 5BPLA 3AA5X 3F2KA 3SPYA 2G8VA 1YITN 4AHVA 5GAGP 1NJXA 5EU7A 4BVPA 4OGEA 2NRZA 2D1KA 2HW3A 1SL2A 3NVMA 5KPRA 4B1VA 4XEIA 4AHUA 1BHLA 3NCIA 3CCUN 4H0XB 3ZX2A 4N56A 1JLQA 5FRNA 1S1VA 5AFUA 1IBMK 3LAKA 1CXQA 4FZXC 1NJ1A 4M45A 2YHBA 2F4VK 4Z4HA 5HLFA 3D6RA 4DSLA 4CHNA 1XC9A 1J6ZA 4CGDA 2FBXA 4CD3A 4J2EA 4HVCA 3HP6A 1LOTB 5KPZA 2WBNA 1RGIA 5JICA 3EKSA 1TKTA 5M1KA 3BUZB 3EYZA 1U04A 1BCOA 1NG9A 3MN7A 1U2VA 1ZBIA 1ZBFA 4C8NA 3SQ0A 1HNVA 4BRDA 2LSNA 4IG0A 4EZ6A 3AVKA 2NRXA 3A5MC 4MLHA 3WXMB 3JS6A 4NCGA 1GLFO 2BH1A 4H5RA 3ULDA 1I94K 4DLGA 4JKBA 1XNQK 4K0KK 4JKFA 5ADXH 3NGIA 4DV6K 5C15A 4AQYK 4RW4A 3FE1A 1W0HA 5AQPA 5EX5A 5AQSA 4RW8A 2BKYX 3LWMA 3G4SN 1RTDA 1NK7A 3OJUA 3J81O 1H4SA 1IH7A 1NMNA 3I55N 4CJEA 3CERA 1YJ9N 1VQ5N 4B9VA 1VQ8N 1C6VA 4EAHD 4FW1A 4QS7A 4DQIA 5M1NA 2GV9A 5M1PA 4EZ9A 5KI6A 4NZRM 2DFHA 1HYVA 4MDBA 3VQAA 4BE1A 4DSEA 1TK0A 5BRFA 4CFCA 3O9SA 2ITMA 1Q86O 3PLAA 4FJXA 1TKUA 1JLBA 1ASUA 3GDQA 4FPBA 4KHYA 1YUWA 3K59A 4DF4A 3O5BA 4DG1A 4O5FA 3HVTA 4CJ7A 2EQAA 3ZT2A 5KGWA 4OPAA 4DCHA 3FZLA 4PUOA 1S22A 2VCPA 3N4QA 1GLBG 2X6NA 4IXCA 4FO0A 3VPZA 3CF5L 2OPPA 4J8FA 4O44A 4CF9A 4FVUA 3HYFA 3NF6A 4PKGA 1NU0A 3UKUB 4HUFA 1RT5A 3VEXA 3A8YA 3TTCA 4ISFA 3QEPA 3O1WA 1PAVA 5BRDA 3A5OC 2FSJA 1EWQA 4CJKA 2XO7A 4K41A 1JLCA 4HVJA 4JRQA 4JI1K 2A41A 4BRMA 4QCLA 3AGRA 4W5QA 4CIGA 4DR1K 2VQFK 3C7NA 1NOZA 3HI0A 4CBUA 1PVYA 1P8ZA 3V4IA 2P9SA 3ID6A 4FW2A 4MLEA 3PX4A 2NNWA 4JS5A 4CE9A 3HRGA 4G1QA 1N36K 1S1XA 1EQYA 2ZJQL 4YORA 4DSFA 1G58A 3CIPA 3L2VA 3L0QA 3HTVA 4Z94A 3MK5A 3AO5A 5AQYA 3ZT4A 4CFAA 4QS9A 3PIOL 3HZ7A 5I42A 3CPEA 2P5GA 4PHTX 1KVCA 1VSLA 4X64K 3OYHA 3CCVN 4IFEA 1NKBA 3O1BA 4LFAK 4FFJA 4JAXA 5HROA 1HC7A 1SAZA 3F5TA 4CEBA 1HNIA 3TWHA 4V19S 1WN7A 1JO0A 4FCXA 3LDLA 4GV6A 5CZ2A 2O8BB 1NKCA 2CGLA 1VM0A 4YDUC 1MWKA 3MK6A 2YJFA 3V1OA 5DK5A 2JLEA 1QE1A 3S41A 3NH2A 3CD6N 2F8SA 4KI4A 3OYBA 1IJJA 4FL9A 3G71N 1FKPA 3N4PA 1L3TA 4BRIA 3KHYA 3HO1A 1RT2A 3ZX3A 4JHDB 4RG8A 3H46O 4CFBA 4WF9L 3ZETA 3SQ2A 1YHQN 3AVGA 3E9LA 1RDBA 4CHQA 3CCQN 1Y64A 1HKBA 5CHIA 2XY5A 1BQMA 3V1RA 1YXQA 3A0IX 4JI5K 1WB9A 1IKWA 1SL1A 3MN6A 4NCAA 4JI3K 3BZCA 4B3OA 1NFHA 2HNDA 3FZHA 3OYKA 4PA1A 3CC7N 4FJNA 1NJZA 3SAHA 1KRPA 3CC2N 1VQ7N 2HBKA 2V52B 2HBMA 4F2RA 3U9ZA 4IOCL 3OYCA 2ASOA 1VSMA 1U4BA 1RBRA 2VYPA 1NBWA 5HP1A 4E1BA 1GLCG 3VEZA 4ELTA 4FCYA 2YHYA 4HUGA 4K86A 4CGHA 1GOCA 2IC3A 4ILJA 4O0IA 4CGJA 5BREA 4FJLA 5KQDA 4FJKA 3CJBA 2A42A 2W6LA 1T6CA 4Z4IA 1WNSA 2B4JA 3B6PA 4DV3K 2E5LK 2KW4A 3RR8A 2Z1JA 1NGGA 3VQ8A 4B1YB 3VQQA 3PSIA 4FLVA 2G8FA 4DFKA 4JV5K 4CJUA 1GLEG 1LW0A 3NE6A 3SUOA 3MEEA 5TKWA 2Q36A 3M8QA 1RT4A 1FK9A 4A57A 3MCAB 4F3TA 3WQTA 4JK8A 2FBTA 1CXUA 4JN4A 2UXBK 4HWIA 4W5OA 5E26A 2YV0X 4MO5A 3VQ4A 1J53A 4OVLA 2NRWA 3SJJA 3ATUA 3V6DA 1TV6A 3KK2A 4CIFA 3HPOA 2OPQA 3NHGA 4LD0A 4B08A 5F1XA 3QLHA 2QI2A 3HT3A 2KQ2A 1TIGA 1MWMA 2OANA 2VGNA 3ZIIA 1VAZA 2EX3A 3GOIA 5AQNA 5AQWA 3O3FA 3AVFA 3DMJA 3PUFA 4E1JA 1L3VA 5K14A 3CCRN 1L5UA 1NJ8A 2B5JA 4U67L 4JEPA 3NMUA 4J2BA 4JKGB 1IKVA 4A62A 1JCFA 4EHTA 1XHXA 1IG9A 2HHTA 2OTJN 4W5NA 5KPTA 4LC9B 2HB5A 3QO9A 1HQEA 1VSIA 1K73O 3HJFA 1W9HA 2YCHA 5E41A 1KK9A 3T19A 3ZIEA 4E89A 4EP5A 4ZHRA 1TAUA 4BGAA 3VGMA 5AQJA 3MGZA 2BUPA 5M1FA 1X9WA 1BA0A 3K9JA 1U47A 1LWFA 1IKXA 4BR0A 5E84A 3I8DA 4JYAK 3VQ9A 3VQEA 3SZ2A 2OCEA 3M6GA 4MDAA 1QSYA 1XHZA 3HP9A 1TVRA 2V7ZA 1HMVA 3M5RA 3ZT1A 1VSJA 2CRQA 3M8RA 4F3OA 1RBVA 4ILGB 4IEIA 3RVCA 2P9KB 3VESA 4CVNE 3ULEB 4CZEA 4I2PA 4DS4A 5AQQA 4WFBL 4KHNA 3CPWM 1BIUA 1QTMA 3H1QA 3V81A 2P9PA 2DFEA 5GIPA 3D2EB 4GY2B 3WNEA 1IG8A 3DSDA 4WFNL 4M3ZA 3B8AX 2ETJA 2E2PA 4C8LA 5C10A 3CJCA 3C6AA 4EHUA 4K8XA 3OA9A 2F9TA 4E7JA 1VQPN 4LFBK 4DV2K 1K4LA 1ILYA 3NBPA 4O8UA 2D0OA 4YNQA 4GKKK 1IO2A 4ILHA 3L2UA 3IMXA 3VGLA 5DMRA 1LWCA 5IWAK 5ELZA 2Y1JA 1Y9XA 1M1KO 2HHWA 4DR4K 1C1CA 4W5RA 4E7HA 1UDVA 3VQ6A 4DHYA 3FZKA 1WUAA 4FJHA 3C6UA 1HQUA 2A1RA 4XH4A 1DTTA 4CF8A 3OTOK 1XI1A 1T7PA 3NF9A 4P6PA 2ZF5O 3M8SA 2P51A 2F9WA 1JLAA 4F4KA 2FSNA 4AHRA 2P9IA 4IEEA 1RDCA 2ITGA 4FBWA 1N5YA 4JI2K 5AQMA 3FR0A 3EE8A 2L8YA 4CEOA 3E9PA 3OHRA 1X3MA 1ATNA 1P90A 2RPIA 1LAVA 3KD5E 3LM9A 4B1UB 4FK2A 2QKKA 4BWMA 1K8KB 2W6KA 1YJWN 2FC0A 4JKCA 4E0DA 1LCUA 4FJ8A 1JLGA 3DXKB 5BRHA 4LH4A 4LH5A 4WYBA 3CXCM 3ZT0A 1ZYQA 3EZWA 2ZQBA 3M8PA 3THXB 4DU3A 1XMOK 2QEXN 1JE3A 2NZTA 4FWQA 4WQ4A 4M7YA 2CGJA 4O0JA 1TL3A 3ITHA 1CZBA 4H0TB 4B1XB 2X78A 5AQKA 3DRSA 4FWRA 4KHWA 1TYQA 4FM1A 4CZFA 4BRKA 3NFAA 3L7VA 3DOLA 3NH0A 3AVBA 3L8BA 2XY6A 4FWNA 3SNNA 3OY9A 4H03B 3TSPA 4LF9K 2DFFA 4B8AB 2YJEA 1NK8A 4FWLA 3H08A 4RTFD 1NK0A 4AILC 1NH9A 3AY9A 5J2QA 3LDNA 1DGKN 2Z7CA 1NGIA 1WOQA 2IVNA 2NRRA 1QQMA 4FM0A 4DFPA 2HHXA 5KQ8A 1JCUA 3OYEA 1U2VB 3CQYA 4FWSA 4HUEA 3KTQA 5J2MA 3JXUA 4YOVA 4CBWA 4IFYA 1G99A 2YI1A 3K57A 1RTJA 5F0XA 3MIOA 3ALYA 2OZSA 3QB0A 3IDHA 5JLFA 3PSFA 4HTUA 4DTJA 1Q81O 4DU1A 3RMCA 2E4LA 4BR7A 5BR8K 2BE2A 4DTSA 4CHOA 3EO3A 2UUBK 4IJNA 3LM2A 4KH4A 2P9LB 1LV5A 2VG7A 3V9UA 1MDUB 3MWPA 3UIQA 2FBVA 2HMPA 1RILA 2QWRA 4FLYA 1IEZA 4KKOA 3HM8A 3AVJA 4DR3K 3EN9A 3ZX0A 1VRUA 2P9SB 2NRTA 3OBWA 3WXIA 3PY8A 2IDOA 3ZYYX 3CETA 1RDUA 4FBKA 4DUZK 4YOXA 5JS2A 1WBDA 3J80O 3PIPL 4DS5A 4JI8K 4DFMA 4A5AA 1HJOA 4N41A 3KLIA 4OGCA 1KQSM 5BPMA 1NGBA 3ZSWA 4ZTJA 4BRQA 4IDHA 3AVLA 3DYAA 3WT0A 2A2YA 1NGAA 1UAXA 2PZSA 3MEGA 3IAYA 1HKCA 1BG3A 4YOTA 3KLFA 1H4QA 4FK0A 3J7AP 3O3GA 5AR0A 1KAYA 4GW6A 1NKEA 2E1ZA 3TABA 3EKUA 5M1QA 2RKIA 3I8BA 3U3GA 3L4IA 1VR4A 2WUSA 4B9SA 1XNRK 4KTWA 4IKFA 4NXNK 3ZETB 3IFRA 2WFBA 1QQOA 2FSKA 3SAFA 3CYMA 3U6FA 1HKGA 4KAZA 2KTQA 3QBXA 1FW6A 1RCHA 3NDKA 2PYLA 2KKZA 4WCEL 1OH7A 5MLCQ 4Q0BA 1VSHA 3ISNC 4KH5A 4CESA 4LF8K 4O5BA 3FLCO 1SS6A 5C2DA 1ASWA 1RDAA 4JK7A 4PL8A 4EP4A 4BDPA 4FYDA 4CZMA 3ZLJA 3OBYA 1N8RO 1N32K 3L2WA 4JI6K 3DLGA 3HOTA 3JYTA 3K2PA 3E1YA 2PAVA 3C6TA 1D8YA 3ZSYA 4R5PA 4A61A 3G6EN 3RTVA 1T6DA 2JGUA 3I0SA 4KB1A 1N33K 4M3RA 4OJRA 4RW9A 4IG3A 5AQGA 4NCBA 4DV4K 2QWMA 2HNZA 4LFCK 3DLHA 4LF5K 2P9UB 4BRPA 3MDQA 1K4PA 2P9UA 3FGUA 3KVGA 4BC3A 1K4OA 4NCXA 4N76A 3LPUA 3K0SA 1QS4A 3KZBA 5FPDA 2A6AA 3VN5A 2ASPA 5EXWA 1EKEA 3V9SA 1VHXA 4H5WA 1BUPA 4DV1K 4MO4A 3TAEA 1VQ6N 3LP3A 5T7BA 3DLRA 1NK9A 3H3NO 3THVA 3R3LA 4NLCA 5FLXO 3TAPA 3CJ1A 5GADP 3OYIA 3KKRA 2FBYA 2DPNA 2IVPA 3BF1A 3C0BA 4AHSA 3P39A 1ZBLA 3ZSRA 4YFUA 1IKYA 4JLHA 4NZTM 1K6YA 4KTQA 1BO5O 2RN2A 1YT3A 3NGYA 2A3ZA 3OW2M 4AHCA 3TOEA 5HRNA 3TTFA 1KAZA 4LF4K 2NRVA 4O8KA 2W42A 2GEMA 3VQPA 1UA1A 4PKIA 5AQHA 3AVAA 3CCEN 2QKBA 3KKSA 3AVCA 3MEDA 3PX0A 3KIOA 1BI4B 2O4IA 1ZXOA 1NGDA 4XH5A 4FJJA 4CJQA 1MA9B 1B9DA 1J9AA 5GAEP 4F9OA 2IAJA 3G25A 2G8KA 4BRLA 2P9IB 3T7ZA 4M3TA 1TUUA 5J2NA 2BDPA 4IBNA 4BR5A 1CLQA 1RT6A 3S3NA 4DTUA 2YNGA 1KFSA 2XY8A 4CK2A 3C65A 3TAQA 4DQ8A 3THWA 1JLFA 4C1NI 4BC2A 2PBDA 1C1BA 3T1YK 1QZ6A 4YKEA 4DSIA 2WONA 3SJHA 4H0PA 3DOKA 1NK4A 4CHZA 4CJPA 4Z4EA 3R9PA 2UXDK 1H0YA 2V7YA 1X3NA 5KRTA 3DJCA 3B6OA 1JL1A 2G8WA 4DR5K 4R79A 5F2RA 3QEIA 1A5WA 4NO7A 5BR9A 4JRPA 2DTUA 3ULEA 4F2SA 3VERA 3VF6A 4FLUA 1VQMN 4KV8A 1S6QA 4IJAA 3VQ5A 3KWGA 3D0PA 5C2FA 5JMVA 5D3GA 1SKRA 4DUYK 4WE1A 3RRGA 1RQ8A 1S6PA 2P9PB 3LZIA 1W7AA 4FWOA 3O9RA 3QEVA 4B1ZA 3NF8A 3CQ8A 1VQ9N 2YX6A 3QFPA 2WC9A 1NJWA 1X9SA 3QETA 3CFOA 4EIAA 2HHSA 1U48A 2ZJPL 4QAGA 3MECA 2QWOA 1BIZA 3GE1A 3VA3A 3DXMA 3K9KA 2E2QA 3E01A 2CH6A 2VWKA 1NGHA 1GLAG 4I6MA 3SQ1A 3MXIA 4OLBA 2ZE2A 5HRRA 3RR7A 1SKWA 3FZMA 4I14A 1NM1A 4OLFA 4K8ZA 5LMUK 1VRTA 1WAJA 4CFDA 3LVJC 5B8HA 3WUHA 3AO4A 3IALA 4E19A 1E4GT 2Q31A 3ZSXA 3VF2A 4B9TA 4PL7A 2WOMA 4FLTA 5C12A 5CZ1A 2M71A 1Y2IA 4N47A 5LL6Z 3THYB 4CD1A 1BA1A 3DRRA 2BTFA 5AQZA 3HVRA 4JKHA 4AH9A 1II7A 2FLOA 1HNXK 4YDQA 3SCXA 1X9MA 3J7YP 5C0YA 4BDYA 1Y97A 3IABA 1N6QA 4FZYA 4Z0UA 4LSLA 3IKMA 3OVNA 5A2QO 3AO2A 3RSEB 2G8UA 4CCHA 4FJMA 1Q8IA 3AVIA 4FK4A 5AZJA 4PWDA 4Y0WA 3QNNA 1C1AA 1JXBA 3I0RA 1WSIA 1RDWX 4OKEA 4CECA 1SZ2A 1RFQA 3HL8A 5EY4A 3DLKA 3KK7A 5HOOA 2X74A 3QIOA 4N5SA 1YJNN 2QWLA 5CY4A 2EH1A 2OZMA 2QK9A 2HHVA 3SAGA 4B3SK 1RT3A 4BG9A 2GTCA 3LDOA 5LJVA 3QESA 3U6YA 3A2FA 4CK1A 5TKYA 4DR2K 3H07A 3LP1A 3LAMA 3DI6A 4UQGA 2WTUA 4WQ5A 4DU4A 4J2AA 3CJ7A 4CJSA 1KSPA 4IO9L 2GTDA 1Q9XA 1FXXA 4DQPA 3RWUA 4FPAA 5SZTA 4C8KA 3CCSN 3T3FA 1IBKK 5C42A 2YNIA 2XHBA 3CJAA 3BGRA 4BRFA 3P1GA 4OPJA 4KO0A 3FZFA 2O8FA 2HVIA 2IVOA 4A59A 4FZZA 1YTAA 4KPYA 4OKKA 1KLMA 5C24A 4CGIA 4CF0A 2ZM6K 4B3TK 1PVWA 1MU2A 3MX2A 4FBQA 2AA4A 3JSMA 3O9TA 3K5NA 1RTHA 1EETA 4CERA 4CGGA 4CZJA 3T1AA 4LY7A 1WAFA 1X1PA 4FJIA 3H1VX 5J1EA 3THYA 2F8TA 1ZBUA 3IRXA 4HHTA 1XMQK 1W2BM 1L3SA 3MXJA 4BC4A 4O55A 3AVNA 3W0LA 3WNGA 1V4TA 3NVKA 4CGFA 1NNEA 3RMAA 1QZ5A 3IABB 2H9UA 2QWPA 1LN4A 3O08A 1NMDA 1HR0K 2Y1IA 4JNEA 3NGZA 3AARA 3HSCA 4H5VA 2I7NA 2HF3A 1ZBSA 3V9WA 4PQUA 1NJ5A 4GVEA 4CHYA 1FKOA 2QM1A 1VSFA 2KZZA 1BISA 4BQLA 1KC8O 3AO1A 1QVGM 3F9MA 3IUCA 4MQ3A 3O6WA 4FLWA 2OPSA 1DKGD 3UB5A 4JKGA 2VG6A 1JKHA 1RBTA 5AZIA 3HBTA 1TKDA 2RHKA 3VEWA 4BC5A 4NYNA 4RWTA 3EZ5A 4H5NA 1C0TA 3QEWA 1D5AA 2A40A 2E6MA 4FWKA 4CBXA 5AQLA 5AQUA 1L3UA 1D9DA 4CEAA 3P4IA 5I9EB 1E3MA 4YOWA 4L3QA 3TARA 3K5MA 1U49A 1NGEA 4YDUA 3WXJA 3KJVA 4K25A 4DTOA 3DWLA 3QICA 3O4QA 4NLBA 3E9OA 4BG8A 1WSGA 3S3MA 1JCEA 3SBTA 3VQCA 3OS0A 4KI6A 3VTIA 3RMDA 2O4GA 4JKEA 3ZEUA 2XRIA 3A5NC 3EY1A 4JHDA 5M1OA 1S1TA 2ZJRL 2P9NA 1Q7YO 3C7NB 1XEZA 4NXMK 2E2NA 1BL3A 3DXKA 5AQIA 3D45A 3NF7A 3R8EA 5FDLA 4FLZA 1R0AA 4KHQA 2FF6A 5ADXA 1Q18A 3T69A 2A5XA 2RIUA 1TKXA 4DQRA 3SLCA 2VWJA 1K9MO 3I33A 1ASVA 2Z1GA 2UUAK 4BR2A 4KB0A 3MCPA 3LP0A 2RE2A 4X65K 4FWMA 3OYGA 1T44A 2P9LA 4FWPA 1ITGA 2HBLA 4M3XA 1IV0A 3DAWA 3VENA 1KLNA 3AVMA 2HHUA 4ID5A 1QSLA 4O4GA 1RT1A 4RCHA 4FJ7A 4E1NA 3O9UA 5LY3A 3OYLA 2Q3SA 3CM5A 2ZD1A 1TL1A 2R7YA 2HF4A 3UKRB 1BU6O 5CR4A 4CJVA 1XUPO 3TTDA 2W40A 2HHHK 1EP4A 3VEVA 2GUIA 2KLAA 3ZSQA 1ATRA 1HRHA 1XC3A 3ENBA 3BP8A 2HHQA 2HBJA 2NUBA 4B3MK 4BRGA 1SNNA 1VK0A 3OYAA 2GWJA 3VGKA 4M3WA 3HM9A 3QKBA 4DWIA 4TSXA 3IS9A 2NLXA 1JDQA 2EWSA 4Z4CA 4GVMA 3KD1E 1RDDA 4K87A 4M3YA 4DMNA 1QQNA 4B9QA 1S1WA 3MAQA 4H0OA 2F96A 3THWB 3CM6A 3FFKB 5EOYA 3LDSA 2O8CB 3F73A 5C25A 4FOEA 3QFUA 3ENHA 1EWRA 4A2AA 3TANA 2VQEK 3H3OB 4CEEA 4QOZB 5AQOA 4BE0A 3AA2A 3ZEUB 4CJ5A 1D9FA 1TAQA 4BQZA 1CZ9A 4B1WB 1GLJO 2YHAA 5HBMA 3KLGA 2Q3VA 3OS2A 3OYDA 5GIOA 2OA8A 4IFVA 1K8AO 1TUYA 4L8RB 1NFJA 4DKWA 3KWIA 3WBMA 3HZ6A 4HTLA 4GV3A 2HMIA 3D2FA 1REVA 2BGGA 1K7JA 4KREA 5JS1A 1X9JA 4NB4A 3VQDA 3VQ7A 3L2RA 3OYMA 1Q82O 4KRFA 1H4TA 3C94A 1U45A 4CF1A 4C23A 2HVHA 2FXUA 1FJGK 2E20A 2B6AA 3ZT3A 4HVZA 5GINA 3ZIHA 4DTRA 2GBZA 1JLEA 2Q97A 2PFUA 5AQTA 3DSCA 4FM2A 3AA3A 1OH5A 3KK1A 2E2OA 3KLEA 3Q7BA 1GOAA 2V51B 2O8EB 3LPTA 3DM2A 3TPQA 1HPMA 3BY5A 3PX6A 2X6SA 2UU9K 2UUCK 1HNWK 4WI1A 3D7EO 3O9QA 4E1MA 4C8MA 5AQFA 1OH6A 4IO8A 2D0CA 3K5LA 4DTNA 3W3DA 2Y1BA 1UWBA 3MXMA 3SUPA 2D0BA 5FPMA 5JVHL 4TWAA 3LP2A 3CCJN 4I7FA 2QWQA 4P8EA 1BDGA 3GG4A 4WQ4C 3LVKB 1J54A 2IFEA 4PKHA 1WSEA 1VQNN 4FOIA 1Z6RA 2UYTA 4DR6K 2QXLA 2ZGZA 3ZSZA 4IOAL 1KD1O 2I7PA 3KLHA 3PV8A 3AJEA 1S3XA 4RW7A 2P5OA 4JI7K 3LZJA 3LWLA 3RSEA 1Z26A 2VGMA 3OS1A 3AO3A 4FSVA 2W41A 1QHTA 3C6HA 1HYZA 3TI0A 4FLXA 5KTQA 4CEFA 4M3UA 1EO1A 3L3UA 2EK0A 3O80A 3L3VA 1W97L 4M7XA 4WFAL 3CQXA 1RBUA 5JVGL 5AQVA 3TU5A 1IBLK 3WXLA 1S9GA 1XQSC 5AZIB 1VSEA 4B3RK 3O8MA 2A1SA 4A5BA 1VQON 3CHWA 4ID1A 4CEDA 1QSSA 2CGKA 3VF4A 1TYQB 4BR9A 3UE5A 3VOVA 1DT9A 3TSUA 5EVZA 1HPZA 1O13A 2GWKA 2P9KA 3QINA 3SPZA 2Q0UA 1ZBHA 3CFRA 4DLEA 3O4WA 4OX9K 1TK5A 4JS4A 4DTMA 2OTLN 4OO1J 3K5OA 1G15A 1I39A 1NGFA 1ATSA 2KZMA 3SV3A 1YAGA 3L4QA 4DQQA 4CJ3A 4AF1A 1HX1A 3GBTA 4JD2B 1NOYA 3M1FA 1TGOA 1T8EA 2YHXA 2Q0RA 5DM6L 3MN9A 1K8KA 4AM7A 3ZSVA 4BR4A 3SUNA 4ELUA 2VWBA 4DV0K 4GV9A 1RTIA 2O8FB 4GKJK 3FFIA 4BRAA 2Z1HA 5AZJB 2KFZA 2QTDA 3V9ZA 3F9KA 1DEJA 4LSNA 4Q15A 1C0UA 4CF2A 3HK2A 1JXEA 4NYFA 4YHHK 1QHAA 4J2DA 3SK3A 3O3HA 3WXKA 1C0MA 4H4MA 3QEXA 2IOCA 3BEXA 2AP1A 3BZKA 1LWEA 2P9BA 1KTQA 2H3GX 2IS3A 2JWKA 4CJRA 1A5VA 3CJ9A 1JL2A 1XWLA 4Y1DA 4DB3A 3DLBA 4CJTA 3S9HA 4JKAA 1RNHA 4CZGA 1J5EK 1JJ2M 1KVAA 1GOBA 1OKJA 1CZAN 4H5TA 3R6MA 1RT7A 2D0AA 4KTZA 3J8AA 4JI4K 2E88A 4CZLA 3CMAN 4GNIA 1NK5A 1YF5L 3LQUA 1LW2A 3V9XA 3DLEA 5BN9A 5I3UA 5AJ3K 1OH8A 4JKDA 3CMEN 1T05A 2LN3A 4BWJA 4M63C 3VQBA 1S72N 4FVMA 1ESVA 1S5JA 3MMVA 2P9NB 3S3OA 1H1VA 1Z25A 1M90O 3SQ4A 3THXA 5CYQA 5FRMA 3SUQA 4M42A 2GX9A 2UXCK 1WSHA 3AGKA 2HSTA 3WNFA 1UA0A 3LDPA 3UKUA 2O8CA 4CZKA 3VA0A 4UY8O 1H0XA 2YKMA 3Q7CA 5BPNA 3NAEA 2QWNA 4CZHA 1NK6A 3TAMA 4BROA 4ICLA 3D2EA 1F21A 4HD0A 1B92A 3K58A 3LALA 2D0PA 2ZGYA 4RW6A 1DTQA 3AAQA 4QS8A 1HNZK 5BN8A 1EX4A 3CC4N 4H8KA 1N34K 1Q9YA 1U6ZA
chains in the Genus database with same CATH topology
4I6MB 4MLEA 3F9MA 2NNWA 3IUCA 3EE9A 3HRGA 3O6WA 3EL2A 3ZYYX 1DKGD 3CETA 1SQKA 4P8JA 3P38A 3HOSA 1NWKA 3UB5A 4JKGA 1EQYA 1RDUA 4CZIA 2ZJQL 4YORA 4FBKA 3VTHA 1G58A 3CIPA 4YOXA 3L0QA 2QA4N 3ID8A 3HTVA 3HBTA 5AZIA 4H0YB 4Z94A 2RHKA 3VEWA 5AQYA 4BC5A 3MK5A 3PIPL 4QS9A 3PIOL 4RWTA 3CPEA 4WQ5C 4PHTX 2CH5A 3CCVN 4H5NA 4IFEA 3O1BA 4A5AA 2MX1A 4FFJA 4JAXA 1HJOA 2A40A 3MN5A 4FWKA 1V4SA 5AQLA 3U8XA 4CBXA 1SAZA 3F5TA 2QW9A 1KQSM 4FCXA 5AQUA 5BPMA 3LDLA 4GV6A 1NGBA 1D4XA 3P4IA 5I9EB 4YOWA 4L3QA 2CGLA 4BRQA 4IDHA 1BOTO 4YDUC 5DM7L 1MWKA 3MK6A 3WT0A 2YJFA 1NGAA 1NGEA 3AAPA 4YDUA 3WXJA 4K25A 1HKCA 3DWLA 1BG3A 2E1YA 3QICA 3E9OA 4NLBA 4YOTA 3S41A 4BG8A 3CD6N 1GLDG 2ZWHA 3UKRA 4JD2A 1IJJA 3WEEB 1JCEA 3SBTA 4FL9A 3DLLL 3G71N 3VTIA 3N4PA 2Q2RA 4BRIA 3KHYA 5AR0A 1KAYA 1BWFO 4JKEA 2E1ZA 1YI2N 3ZX3A 4G9ZA 4JHDB 3ZEUA 3A5NC 3EKUA 5FPNA 5M1QA 3H46O 3I8BA 1T3VA 3P04A 4JHDA 5M1OA 2ZJRL 5FPEA 2P9NA 3L4IA 1VQ4N 4WF9L 3ZETA 1Q7YO 2WUSA 3C7NB 1XEZA 3VETA 1C0GA 2E2NA 3BF3A 1YHQN 3DXKA 3ZETB 1C0FA 3E9LA 2GELA 3IFRA 5AQIA 3R8EA 2WFBA 4EFHA 1QQOA 4K42A 2FSKA 3CCQN 3SAFA 2FF6A 1QVFM 5ADXA 1Q18A 1Y64A 1HKGA 1HKBA 3T69A 4AM6A 5CHIA 2A5XA 3QBXA 2RIUA 1YXQA 3SLCA 5H1SQ 2KKZA 3A0IX 4WCEL 1K9MO 3L6QA 4BVOA 3I33A 3MN6A 3SMSA 5MLCQ 1NGJA 1R59O 4BR2A 4KH5A 3MCPA 5JLHA 3FZHA 4BRCA 5GAHP 3SMPA 3CC7N 2RE2A 1OVYA 3FLCO 1SS6A 5C2DA 3SAHA 4CI6A 4FWMA 4JK7A 4PL8A 3QDKA 1T44A 2P9LA 4FWPA 2HBLA 4CZMA 3OBYA 1N8RO 4BRNA 1VQ7N 3CC2N 2HBKA 2V52B 3DXMB 4EO0A 3HOTA 3DAWA 3VENA 4P6CA 4K43A 5LJWA 2HBMA 3U9ZA 4A2BA 4IOCL 3E1YA 2PAVA 4BY9C 4OPHA 4RCHA 4A61A 3G6EN 3O9UA 1E4FT 5LY3A 2ASOA 2GUPA 1T6DA 2HF4A 3UKRB 2VYPA 3QBWA 4KBOA 1BU6O 5CR4A 4IWVA 1NBWA 4E1BA 1XUPO 3TTDA 1GLCG 2W40A 3VEZA 3D2FB 4P6DA 3VEVA 1TKSA 2YHYA 2KLAA 1NGCA 4IOXA 5AQGA 4JK9A 1HRUA 4ILJA 1ATRA 2QWMA 5BREA 5KQDA 3CJBA 2P9UB 1XC3A 4BRPA 2A42A 3MDQA 3ENBA 1K4PA 3BP8A 1T6CA 1NJIO 2P9UA 2HBJA 3FGUA 1VQKN 2ASMA 3KVGA 4BC3A 4BRGA 1K4OA 1SNNA 2GWJA 1G57A 1NGGA 3VGKA 4U7BA 3H6EA 4B1YB 3KZBA 5FPDA 4KH6A 2NLXA 2EWSA 2A6AA 1GLEG 4ISEA 3TSQA 3QMLA 2ASPA 5TKWA 3I56N 5EXWA 1QQNA 2E8AA 2Q36A 4B9QA 1K49A 4H0OA 4H5WA 1BUPA 3ZIGA 4IZ9A 4MO4A 4A57A 3MCAB 3FFKB 1YVNA 5EOYA 1VQ6N 2RISA 3WQTA 4YOYA 4JK8A 3H3NO 4FOEA 3R3LA 4JN4A 3QFUA 4BGBA 3ENHA 4NLCA 3LS6A 3CJ1A 4HWIA 3WEEA 4A2AA 5E26A 4MO5A 5GADP 3M3ZA 3H3OB 1KXPA 2NRWA 3BF1A 2DPNA 2IVPA 3C0BA 5AQOA 2KHOA 3P39A 3ZEUB 4NZTM 4BQZA 3ATUA 3A5LC 4B1WB 2FF3B 1GLJO 1BO5O 2HOEA 5GIOA 2A3ZA 1K8AO 3OW2M 1TUYA 3E66A 2J4RA 4DKWA 5F1XA 3GL1A 3MWTA 3TTFA 1KAZA 2QI2A 3MX5A 3KWIA 2NRVA 3HZ6A 4HTLA 4GV3A 3D2FA 1MWMA 2OANA 2VGNA 3ZIIA 1VAZA 2GEMA 3GOIA 4O8KA 5AQNA 5AQWA 1HUXA 1K7JA 4PKIA 1X9JA 5AQHA 4E1JA 3CCEN 4NB4A 3CCRN 4U67L 4JEPA 4BREA 1Q82O 3NMUA 4JKGB 4A62A 3LRJA 1JCFA 1ZXOA 1NGDA 4XH5A 4XH1A 4ISGA 4EHTA 3LDQA 4C23A 2OTJN 1MA9B 5GAEP 4F9OA 5KPTA 4LC9B 2FXUA 3G25A 3H45C 4BRLA 2P9IB 3T7ZA 1K73O 1TUUA 3VEYA 3ATVA 2E20A 2YCHA 5GINA 4HVZA 1YIJN 3ZIHA 4BR5A 1KK9A 2IIRA 2Q97A 4H0VB 3ZIEA 2PFUA 1KAXA 5AQTA 5AQXA 4BGAA 3VGMA 3C65A 1ZC6A 5AQJA 2BUPA 3CCLN 3MGZA 5M1FA 4DQ8A 2E2OA 1BA0A 3Q7BA 3K9JA 4C1NI 2V51B 4BR0A 4P77A 4BC2A 5E84A 2PBDA 3CI5A 3VMFB 1Z05A 3U9DA 4MDAA 3M6GA 3TPQA 1QZ6A 4YKEA 1HPMA 3CCMN 3P31A 3SJHA 1GLLO 4H0PA 3ENOA 2V7ZA 3M5RA 2JWLA 3R9PA 3D7EO 5AFUH 3O9QA 2YHWA 2V7YA 1X3NA 5AQFA 3DJCA 4C1NK 5CE3A 4IO8A 4R79A 3J7ZO 3W3DA 5F2RA 4ILGB 3U4LA 4IEIA 3T1IA 3RVCA 2P9KB 5FPMA 2Q1NA 4NO7A 3VESA 3ULEB 5BR9A 4CZEA 2F7TA 5AQQA 5JVHL 3CCJN 4WFBL 2QWQA 3ULEA 4P8EA 1BDGA 3VF6A 3VERA 1VQMN 3GG4A 4WQ4C 3CPWM 4IJAA 3KWGA 3H1QA 5C2FA 5JMVA 4PKHA 2P9PA 1VQNN 3SBGA 4FOIA 1Z6RA 2UYTA 5GIPA 2QXLA 3D2EB 2ZGZA 2D4WA 2P9PB 4GY2B 4IOAL 1IG8A 4WFNL 3VEOA 5AQRA 3B8AX 4FWOA 3O9RA 5HL7L 2I7PA 4B1ZA 1KD1O 3AJEA 2E2PA 1S3XA 5C10A 1NLVA 2YX6A 3QFPA 3CJCA 2WC9A 3C6AA 4EHUA 1VQ9N 3RSEA 3LL3A 2VGMA 3OA9A 4FSVA 2F9TA 1VQPN 4EIAA 2W41A 2ZJPL 1K4LA 1ILYA 1JCGA 3C6HA 2QWOA 4YOUA 3GE1A 4BRHA 4O8UA 2D0OA 3DXMA 1HLUA 3K9KA 3WQUA 2E2QA 2NRHA 2CH6A 3IMXA 4ILHA 3VGLA 1EO1A 1NGHA 1GLAG 3O80A 5ELZA 1W97L 4I6MA 1K4IA 1M1KO 4M7XA 4WFAL 1VQLN 3CQXA 3R1XA 3FZMA 5JVGL 5AQVA 4I14A 5BPLA 3TU5A 1NM1A 4DHYA 3FZKA 1WUAA 3WXLA 1XQSC 3F2KA 5AZIB 3O8MA 1YITN 4A5BA 1VQON 4XH4A 3CHWA 5GAGP 2CGKA 3VF4A 1TYQB 5B8HA 3WUHA 4BR9A 4BVPA 4P6PA 3UE5A 2ZF5O 3VOVA 1E4GT 1DT9A 3TSUA 2Q31A 2NRZA 2D1KA 5EVZA 3VF2A 1O13A 2F9WA 4PL7A 2GWKA 3NVMA 5C12A 2P9KA 5KPRA 4B1VA 2FSNA 2Q0UA 4XEIA 2P9IA 3O4WA 4IEEA 3CCUN 4H0XB 3ZX2A 4OO1J 2OTLN 4CD1A 5AFUA 1BA1A 5AQZA 2BTFA 1NGFA 4FBWA 1ATSA 4JKHA 2FLOA 1YAGA 3L4QA 5AQMA 3FR0A 1HX1A 3EE8A 3GBTA 4AF1A 4JD2B 3E9PA 3OHRA 1X3MA 3M1FA 1ATNA 3D6RA 5C0YA 1P90A 2YHXA 2Q0RA 1J6ZA 5DM6L 3MN9A 1K8KA 3LM9A 4AM7A 4B1UB 3IKMA 4CD3A 1LOTB 5KPZA 3RSEB 2WBNA 1K8KB 1RGIA 5JICA 3EKSA 4BR4A 5M1KA 3BUZB 1YJWN 2VWBA 4JKCA 5AZJA 1LCUA 4Y0WA 4GV9A 3MN7A 1U2VA 3DXKB 4BRAA 5BRHA 5AZJB 1RDWX 2QTDA 4WYBA 3CXCM 1SZ2A 1RFQA 3EZWA 4BRDA 1DEJA 5EY4A 2QEXN 2NRXA 3A5MC 4MLHA 3WXMB 2NZTA 3JS6A 1GLFO 2BH1A 3KK7A 4FWQA 4H5RA 5HOOA 1QHAA 4JKBA 4M7YA 2CGJA 4WQ4A 3SK3A 1YJNN 3WXKA 4JKFA 2QWLA 5ADXH 5C15A 4H0TB 4B1XB 3SAGA 5AQKA 3FE1A 4BG9A 5AQPA 4FWRA 5EX5A 3BEXA 5AQSA 1TYQA 2AP1A 2H3GX 2P9BA 3LDOA 5LJVA 4CZFA 2JWKA 4BRKA 3G4SN 3CJ9A 3H07A 5TKYA 4DB3A 3I55N 3CERA 3L7VA 4WQ5A 4JKAA 3CJ7A 1YJ9N 4FWNA 1VQ5N 4CZGA 1JJ2M 4H03B 1VQ8N 4IO9L 4EAHD 3TSPA 1CZAN 1OKJA 4H5TA 2GTDA 3R6MA 4QS7A 5M1NA 5M1PA 2YJEA 4FWLA 3J8AA 2E88A 4NZRM 4CZLA 3CMAN 4FPAA 4MDBA 4GNIA 4RTFD 1YF5L 3LQUA 5BRFA 3AY9A 3O9SA 3CCSN 5BN9A 3LDNA 2ITMA 4JKDA 1Q86O 3CMEN 3PLAA 1TKUA 2LN3A 1DGKN 3CJAA 3GDQA 1NGIA 1WOQA 4FPBA 4M63C 2IVNA 4BRFA 1S72N 2NRRA 1ESVA 1QQMA 1YUWA 3MMVA 5KQ8A 1JCUA 3FZFA 2P9NB 1U2VB 3O5BA 2IVOA 1H1VA 3CQYA 4FWSA 4A59A 4O5FA 3JXUA 1M90O 4YOVA 1PVWA 4CJ7A 2EQAA 4CBWA 1G99A 3MX2A 4FBQA 2AA4A 2YI1A 3O9TA 4OPAA 4DCHA 5F0XA 3FZLA 3MIOA 4CZJA 3QB0A 3IDHA 5JLFA 1S22A 2VCPA 3N4QA 2GX9A 3H1VX 3AGKA 1GLBG 2HSTA 4IXCA 1Q81O 4FO0A 3VPZA 3CF5L 3LDPA 3UKUA 4CZKA 4J8FA 1W2BM 4FVUA 4BR7A 4UY8O 4BC4A 3Q7CA 5BPNA 3UKUB 4PKGA 3W0LA 2QWNA 3VEXA 3A8YA 1V4TA 3TTCA 3EO3A 4ISFA 4IJNA 4CZHA 3O1WA 3NVKA 4BROA 3LM2A 4KH4A 1QZ5A 2P9LB 5BRDA 3A5OC 3D2EA 2FSJA 2QWPA 3O08A 1MDUB 1NMDA 4K41A 3MWPA 2A41A 2HMPA 4JNEA 4BRMA 2QWRA 2D0PA 2ZGYA 3AARA 3AGRA 3HSCA 4H5VA 1IEZA 2I7NA 3AAQA 3HM8A 2HF3A 4QS8A 5BN8A 1ZBSA 3CC4N 3C7NA 3EN9A 3ZX0A 4GVEA 2QM1A 3HI0A 2P9SB 4CBUA 1U6ZA 1PVYA 2NRTA 3OBWA 1P8ZA 4BQLA 1KC8O 2P9SA 1QVGM 3ID6A 3WXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTC A;  3VET A;  3VF4 A;  3VTI A;  3TTF A;  3VTH A;  3TTD A;  3VES A;  3VEN A;  3TSQ A;  3VEZ A;  3VEW A;  3VEO A;  3TSU A;  3VF2 A;  3VER A;  3VEX A;  3TSP A; 
#chains in the Genus database with same CATH topology
 4I6M B;  3PO5 A;  3EE9 A;  3EL2 A;  4P8J A;  1SQK A;  3P38 A;  3HOS A;  1NWK A;  4X62 K;  3TAG A;  4CZI A;  3VTH A;  4YY3 K;  1OVQ A;  1A5X A;  2QA4 N;  3ID8 A;  2OPR A;  4H0Y B;  3SI6 A;  3AV9 A;  3CFP A;  4WQ5 C;  1SUQ A;  2CH5 A;  3OYN A;  2MX1 A;  3MN5 A;  1KVB A;  1BCM A;  1V4S A;  3U8X A;  3DRP A;  4OPK A;  2O8B A;  2D5R A;  2QW9 A;  1HJR A;  1D4X A;  2G8I A;  1O1W A;  1BOT O;  5DM7 L;  1I3A A;  2I5J A;  4DSK A;  3AAP A;  3BDP A;  4I9L A;  4E7K A;  2E1Y A;  4KHU A;  1GLD G;  2ZWH A;  3UKR A;  3SYZ A;  4M41 A;  3ASM A;  4JD2 A;  3WEE B;  4CJ4 A;  3HXM A;  4FJ9 A;  3P83 D;  3DLL L;  2Q2R A;  5IT9 O;  1S1U A;  1BWF O;  1YI2 N;  4G9Z A;  5FPN A;  3OJS A;  4DR7 K;  1T3V A;  3P04 A;  5FPE A;  1VQ4 N;  4HCC A;  3VET A;  4GMJ B;  1C0G A;  3BF3 A;  4DSJ A;  4Z4F A;  1C0F A;  2GEL A;  4EFH A;  4K42 A;  4CIE A;  3EEQ A;  3PO4 A;  1QVF M;  1QQC A;  5SWM A;  4H4O A;  4B9N A;  4AM6 A;  2XY7 A;  5H1S Q;  3L6Q A;  4BVO A;  2E6L A;  3SMS A;  1NGJ A;  1R59 O;  5JLH A;  4BRC A;  5GAH P;  3SMP A;  1OVY A;  1J5O A;  2OYQ A;  3TR8 A;  4CI6 A;  3C95 A;  3QDK A;  2IGI A;  3U3Y A;  2YKN A;  4BRN A;  3DXM B;  4EO0 A;  4KFB A;  4P6C A;  4DTX A;  4K43 A;  5LJW A;  1WSJ A;  1RBS A;  4A2B A;  3AA4 A;  5HRS A;  4LF6 K;  4BY9 C;  4BDZ A;  1S9E A;  3OYF A;  4OPH A;  4OLA A;  2AJQ A;  1LAW A;  1E4F T;  2GUP A;  4IDK A;  3G0Z A;  3QBW A;  4KBO A;  4PY5 A;  4XIU A;  4IWV A;  4CHP A;  5KGX A;  4C8O A;  3D2F B;  4P6D A;  1TKS A;  1NGC A;  4IOX A;  4CJW A;  4JK9 A;  4Z9E A;  3O4N A;  1HRU A;  4JI0 K;  1SL0 A;  2EHG A;  4K88 A;  1NJI O;  1VQK N;  2ASM A;  3HPG A;  5KRS A;  1TK8 A;  3NH1 A;  4B9U A;  3AVH A;  1G57 A;  4U7B A;  3H6E A;  4KHP K;  1UOC A;  4KH6 A;  4CK3 A;  4LF7 K;  2ATQ A;  4ISE A;  3TSQ A;  3QML A;  1YVU A;  4FJ5 A;  3LAN A;  3I56 N;  2E8A A;  1K49 A;  3RRH A;  4CJF A;  2O8D A;  4IZ9 A;  3ZIG A;  3G10 A;  1YVN A;  4DV7 K;  4DFJ A;  4YOY A;  2O8E A;  2RIS A;  1VSD A;  4I2Q A;  1DCJ A;  3LS6 A;  3WEE A;  3M3Z A;  1KXP A;  2KHO A;  3P5J A;  3RMB A;  1NJY A;  2Z1I A;  5HRP A;  3A5L C;  4E7I A;  2PYJ A;  2FF3 B;  2HOE A;  4E7L A;  4B8C A;  1EXQ A;  4FJG A;  4B9M A;  3ZSO A;  3E66 A;  2J4R A;  4E3S A;  3GL1 A;  3T1H K;  4HCB A;  3MWT A;  1KCF A;  4I9Q A;  3MX5 A;  4W5T A;  3HPH A;  2KFN A;  1WBB A;  3ZCM A;  4BGB A;  1YTU A;  1HUX A;  4X66 K;  3TAF A;  1TKZ A;  4BRE A;  4BAC A;  3LRJ A;  5FRO A;  4XH1 A;  1BI4 A;  4ISG A;  2VG5 A;  3LDQ A;  2P1J A;  4CEQ A;  4Q5V A;  1HYS A;  3SV4 A;  4F8R A;  4Y1C A;  4MFB A;  3H45 C;  3VEY A;  3ATV A;  1YIJ N;  4AHT A;  4CW7 B;  2IIR A;  1VSK A;  4H0V B;  4CJL A;  1KAX A;  1SV5 A;  4B9L A;  5AQX A;  4DTP A;  1ZC6 A;  3QER A;  3CCL N;  1T03 A;  3V1Q A;  4P77 A;  3VMF B;  3CI5 A;  1Z05 A;  3U9D A;  4DF8 A;  2PY5 A;  2HNY A;  3CCM N;  4KHS A;  3P31 A;  1GLL O;  3ENO A;  2JWL A;  2LXR A;  4BE2 A;  3KK3 A;  4ZTF A;  5AFU H;  1KFD A;  2YHW A;  4C1N K;  3QIP A;  5CE3 A;  3HST B;  3J7Z O;  1WSF A;  5J2P A;  3U4L A;  3T1I A;  4Z4G A;  2YNH A;  2Q1N A;  2F7T A;  1NJ6 A;  1B9F A;  5LMN K;  2RF2 A;  1S8E A;  3L2Q A;  4DQS A;  3QNO A;  3SBG A;  2DY4 A;  4OKJ A;  1SKS A;  1DLO A;  2D4W A;  1BGX T;  2O8D B;  3VEO A;  5AQR A;  1WLJ A;  5HL7 L;  1NLV A;  2G8H A;  3LL3 A;  4CEZ A;  4FXD A;  2YNF A;  1JCG A;  4YOU A;  4BRH A;  3OYJ A;  3WNH A;  1BQN A;  1HLU A;  2QXF A;  3WQU A;  2NRH A;  4ELV A;  5CYM A;  3IG1 A;  1K4I A;  2BAN A;  3CG7 A;  1VQL N;  3JAM O;  1NJ2 A;  4DV5 K;  3R1X A;  5BPL A;  3AA5 X;  3F2K A;  3SPY A;  2G8V A;  1YIT N;  4AHV A;  5GAG P;  1NJX A;  5EU7 A;  4BVP A;  4OGE A;  2NRZ A;  2D1K A;  2HW3 A;  1SL2 A;  3NVM A;  5KPR A;  4B1V A;  4XEI A;  4AHU A;  1BHL A;  3NCI A;  3CCU N;  4H0X B;  3ZX2 A;  4N56 A;  1JLQ A;  5FRN A;  1S1V A;  5AFU A;  1IBM K;  3LAK A;  1CXQ A;  4FZX C;  1NJ1 A;  4M45 A;  2YHB A;  2F4V K;  4Z4H A;  5HLF A;  3D6R A;  4DSL A;  4CHN A;  1XC9 A;  1J6Z A;  4CGD A;  2FBX A;  4CD3 A;  4J2E A;  4HVC A;  3HP6 A;  1LOT B;  5KPZ A;  2WBN A;  1RGI A;  5JIC A;  3EKS A;  1TKT A;  5M1K A;  3BUZ B;  3EYZ A;  1U04 A;  1BCO A;  1NG9 A;  3MN7 A;  1U2V A;  1ZBI A;  1ZBF A;  4C8N A;  3SQ0 A;  1HNV A;  4BRD A;  2LSN A;  4IG0 A;  4EZ6 A;  3AVK A;  2NRX A;  3A5M C;  4MLH A;  3WXM B;  3JS6 A;  4NCG A;  1GLF O;  2BH1 A;  4H5R A;  3ULD A;  1I94 K;  4DLG A;  4JKB A;  1XNQ K;  4K0K K;  4JKF A;  5ADX H;  3NGI A;  4DV6 K;  5C15 A;  4AQY K;  4RW4 A;  3FE1 A;  1W0H A;  5AQP A;  5EX5 A;  5AQS A;  4RW8 A;  2BKY X;  3LWM A;  3G4S N;  1RTD A;  1NK7 A;  3OJU A;  3J81 O;  1H4S A;  1IH7 A;  1NMN A;  3I55 N;  4CJE A;  3CER A;  1YJ9 N;  1VQ5 N;  4B9V A;  1VQ8 N;  1C6V A;  4EAH D;  4FW1 A;  4QS7 A;  4DQI A;  5M1N A;  2GV9 A;  5M1P A;  4EZ9 A;  5KI6 A;  4NZR M;  2DFH A;  1HYV A;  4MDB A;  3VQA A;  4BE1 A;  4DSE A;  1TK0 A;  5BRF A;  4CFC A;  3O9S A;  2ITM A;  1Q86 O;  3PLA A;  4FJX A;  1TKU A;  1JLB A;  1ASU A;  3GDQ A;  4FPB A;  4KHY A;  1YUW A;  3K59 A;  4DF4 A;  3O5B A;  4DG1 A;  4O5F A;  3HVT A;  4CJ7 A;  2EQA A;  3ZT2 A;  5KGW A;  4OPA A;  4DCH A;  3FZL A;  4PUO A;  1S22 A;  2VCP A;  3N4Q A;  1GLB G;  2X6N A;  4IXC A;  4FO0 A;  3VPZ A;  3CF5 L;  2OPP A;  4J8F A;  4O44 A;  4CF9 A;  4FVU A;  3HYF A;  3NF6 A;  4PKG A;  1NU0 A;  3UKU B;  4HUF A;  1RT5 A;  3VEX A;  3A8Y A;  3TTC A;  4ISF A;  3QEP A;  3O1W A;  1PAV A;  5BRD A;  3A5O C;  2FSJ A;  1EWQ A;  4CJK A;  2XO7 A;  4K41 A;  1JLC A;  4HVJ A;  4JRQ A;  4JI1 K;  2A41 A;  4BRM A;  4QCL A;  3AGR A;  4W5Q A;  4CIG A;  4DR1 K;  2VQF K;  3C7N A;  1NOZ A;  3HI0 A;  4CBU A;  1PVY A;  1P8Z A;  3V4I A;  2P9S A;  3ID6 A;  4FW2 A;  4MLE A;  3PX4 A;  2NNW A;  4JS5 A;  4CE9 A;  3HRG A;  4G1Q A;  1N36 K;  1S1X A;  1EQY A;  2ZJQ L;  4YOR A;  4DSF A;  1G58 A;  3CIP A;  3L2V A;  3L0Q A;  3HTV A;  4Z94 A;  3MK5 A;  3AO5 A;  5AQY A;  3ZT4 A;  4CFA A;  4QS9 A;  3PIO L;  3HZ7 A;  5I42 A;  3CPE A;  2P5G A;  4PHT X;  1KVC A;  1VSL A;  4X64 K;  3OYH A;  3CCV N;  4IFE A;  1NKB A;  3O1B A;  4LFA K;  4FFJ A;  4JAX A;  5HRO A;  1HC7 A;  1SAZ A;  3F5T A;  4CEB A;  1HNI A;  3TWH A;  4V19 S;  1WN7 A;  1JO0 A;  4FCX A;  3LDL A;  4GV6 A;  5CZ2 A;  2O8B B;  1NKC A;  2CGL A;  1VM0 A;  4YDU C;  1MWK A;  3MK6 A;  2YJF A;  3V1O A;  5DK5 A;  2JLE A;  1QE1 A;  3S41 A;  3NH2 A;  3CD6 N;  2F8S A;  4KI4 A;  3OYB A;  1IJJ A;  4FL9 A;  3G71 N;  1FKP A;  3N4P A;  1L3T A;  4BRI A;  3KHY A;  3HO1 A;  1RT2 A;  3ZX3 A;  4JHD B;  4RG8 A;  3H46 O;  4CFB A;  4WF9 L;  3ZET A;  3SQ2 A;  1YHQ N;  3AVG A;  3E9L A;  1RDB A;  4CHQ A;  3CCQ N;  1Y64 A;  1HKB A;  5CHI A;  2XY5 A;  1BQM A;  3V1R A;  1YXQ A;  3A0I X;  4JI5 K;  1WB9 A;  1IKW A;  1SL1 A;  3MN6 A;  4NCA A;  4JI3 K;  3BZC A;  4B3O A;  1NFH A;  2HND A;  3FZH A;  3OYK A;  4PA1 A;  3CC7 N;  4FJN A;  1NJZ A;  3SAH A;  1KRP A;  3CC2 N;  1VQ7 N;  2HBK A;  2V52 B;  2HBM A;  4F2R A;  3U9Z A;  4IOC L;  3OYC A;  2ASO A;  1VSM A;  1U4B A;  1RBR A;  2VYP A;  1NBW A;  5HP1 A;  4E1B A;  1GLC G;  3VEZ A;  4ELT A;  4FCY A;  2YHY A;  4HUG A;  4K86 A;  4CGH A;  1GOC A;  2IC3 A;  4ILJ A;  4O0I A;  4CGJ A;  5BRE A;  4FJL A;  5KQD A;  4FJK A;  3CJB A;  2A42 A;  2W6L A;  1T6C A;  4Z4I A;  1WNS A;  2B4J A;  3B6P A;  4DV3 K;  2E5L K;  2KW4 A;  3RR8 A;  2Z1J A;  1NGG A;  3VQ8 A;  4B1Y B;  3VQQ A;  3PSI A;  4FLV A;  2G8F A;  4DFK A;  4JV5 K;  4CJU A;  1GLE G;  1LW0 A;  3NE6 A;  3SUO A;  3MEE A;  5TKW A;  2Q36 A;  3M8Q A;  1RT4 A;  1FK9 A;  4A57 A;  3MCA B;  4F3T A;  3WQT A;  4JK8 A;  2FBT A;  1CXU A;  4JN4 A;  2UXB K;  4HWI A;  4W5O A;  5E26 A;  2YV0 X;  4MO5 A;  3VQ4 A;  1J53 A;  4OVL A;  2NRW A;  3SJJ A;  3ATU A;  3V6D A;  1TV6 A;  3KK2 A;  4CIF A;  3HPO A;  2OPQ A;  3NHG A;  4LD0 A;  4B08 A;  5F1X A;  3QLH A;  2QI2 A;  3HT3 A;  2KQ2 A;  1TIG A;  1MWM A;  2OAN A;  2VGN A;  3ZII A;  1VAZ A;  2EX3 A;  3GOI A;  5AQN A;  5AQW A;  3O3F A;  3AVF A;  3DMJ A;  3PUF A;  4E1J A;  1L3V A;  5K14 A;  3CCR N;  1L5U A;  1NJ8 A;  2B5J A;  4U67 L;  4JEP A;  3NMU A;  4J2B A;  4JKG B;  1IKV A;  4A62 A;  1JCF A;  4EHT A;  1XHX A;  1IG9 A;  2HHT A;  2OTJ N;  4W5N A;  5KPT A;  4LC9 B;  2HB5 A;  3QO9 A;  1HQE A;  1VSI A;  1K73 O;  3HJF A;  1W9H A;  2YCH A;  5E41 A;  1KK9 A;  3T19 A;  3ZIE A;  4E89 A;  4EP5 A;  4ZHR A;  1TAU A;  4BGA A;  3VGM A;  5AQJ A;  3MGZ A;  2BUP A;  5M1F A;  1X9W A;  1BA0 A;  3K9J A;  1U47 A;  1LWF A;  1IKX A;  4BR0 A;  5E84 A;  3I8D A;  4JYA K;  3VQ9 A;  3VQE A;  3SZ2 A;  2OCE A;  3M6G A;  4MDA A;  1QSY A;  1XHZ A;  3HP9 A;  1TVR A;  2V7Z A;  1HMV A;  3M5R A;  3ZT1 A;  1VSJ A;  2CRQ A;  3M8R A;  4F3O A;  1RBV A;  4ILG B;  4IEI A;  3RVC A;  2P9K B;  3VES A;  4CVN E;  3ULE B;  4CZE A;  4I2P A;  4DS4 A;  5AQQ A;  4WFB L;  4KHN A;  3CPW M;  1BIU A;  1QTM A;  3H1Q A;  3V81 A;  2P9P A;  2DFE A;  5GIP A;  3D2E B;  4GY2 B;  3WNE A;  1IG8 A;  3DSD A;  4WFN L;  4M3Z A;  3B8A X;  2ETJ A;  2E2P A;  4C8L A;  5C10 A;  3CJC A;  3C6A A;  4EHU A;  4K8X A;  3OA9 A;  2F9T A;  4E7J A;  1VQP N;  4LFB K;  4DV2 K;  1K4L A;  1ILY A;  3NBP A;  4O8U A;  2D0O A;  4YNQ A;  4GKK K;  1IO2 A;  4ILH A;  3L2U A;  3IMX A;  3VGL A;  5DMR A;  1LWC A;  5IWA K;  5ELZ A;  2Y1J A;  1Y9X A;  1M1K O;  2HHW A;  4DR4 K;  1C1C A;  4W5R A;  4E7H A;  1UDV A;  3VQ6 A;  4DHY A;  3FZK A;  1WUA A;  4FJH A;  3C6U A;  1HQU A;  2A1R A;  4XH4 A;  1DTT A;  4CF8 A;  3OTO K;  1XI1 A;  1T7P A;  3NF9 A;  4P6P A;  2ZF5 O;  3M8S A;  2P51 A;  2F9W A;  1JLA A;  4F4K A;  2FSN A;  4AHR A;  2P9I A;  4IEE A;  1RDC A;  2ITG A;  4FBW A;  1N5Y A;  4JI2 K;  5AQM A;  3FR0 A;  3EE8 A;  2L8Y A;  4CEO A;  3E9P A;  3OHR A;  1X3M A;  1ATN A;  1P90 A;  2RPI A;  1LAV A;  3KD5 E;  3LM9 A;  4B1U B;  4FK2 A;  2QKK A;  4BWM A;  1K8K B;  2W6K A;  1YJW N;  2FC0 A;  4JKC A;  4E0D A;  1LCU A;  4FJ8 A;  1JLG A;  3DXK B;  5BRH A;  4LH4 A;  4LH5 A;  4WYB A;  3CXC M;  3ZT0 A;  1ZYQ A;  3EZW A;  2ZQB A;  3M8P A;  3THX B;  4DU3 A;  1XMO K;  2QEX N;  1JE3 A;  2NZT A;  4FWQ A;  4WQ4 A;  4M7Y A;  2CGJ A;  4O0J A;  1TL3 A;  3ITH A;  1CZB A;  4H0T B;  4B1X B;  2X78 A;  5AQK A;  3DRS A;  4FWR A;  4KHW A;  1TYQ A;  4FM1 A;  4CZF A;  4BRK A;  3NFA A;  3L7V A;  3DOL A;  3NH0 A;  3AVB A;  3L8B A;  2XY6 A;  4FWN A;  3SNN A;  3OY9 A;  4H03 B;  3TSP A;  4LF9 K;  2DFF A;  4B8A B;  2YJE A;  1NK8 A;  4FWL A;  3H08 A;  4RTF D;  1NK0 A;  4AIL C;  1NH9 A;  3AY9 A;  5J2Q A;  3LDN A;  1DGK N;  2Z7C A;  1NGI A;  1WOQ A;  2IVN A;  2NRR A;  1QQM A;  4FM0 A;  4DFP A;  2HHX A;  5KQ8 A;  1JCU A;  3OYE A;  1U2V B;  3CQY A;  4FWS A;  4HUE A;  3KTQ A;  5J2M A;  3JXU A;  4YOV A;  4CBW A;  4IFY A;  1G99 A;  2YI1 A;  3K57 A;  1RTJ A;  5F0X A;  3MIO A;  3ALY A;  2OZS A;  3QB0 A;  3IDH A;  5JLF A;  3PSF A;  4HTU A;  4DTJ A;  1Q81 O;  4DU1 A;  3RMC A;  2E4L A;  4BR7 A;  5BR8 K;  2BE2 A;  4DTS A;  4CHO A;  3EO3 A;  2UUB K;  4IJN A;  3LM2 A;  4KH4 A;  2P9L B;  1LV5 A;  2VG7 A;  3V9U A;  1MDU B;  3MWP A;  3UIQ A;  2FBV A;  2HMP A;  1RIL A;  2QWR A;  4FLY A;  1IEZ A;  4KKO A;  3HM8 A;  3AVJ A;  4DR3 K;  3EN9 A;  3ZX0 A;  1VRU A;  2P9S B;  2NRT A;  3OBW A;  3WXI A;  3PY8 A;  2IDO A;  3ZYY X;  3CET A;  1RDU A;  4FBK A;  4DUZ K;  4YOX A;  5JS2 A;  1WBD A;  3J80 O;  3PIP L;  4DS5 A;  4JI8 K;  4DFM A;  4A5A A;  1HJO A;  4N41 A;  3KLI A;  4OGC A;  1KQS M;  5BPM A;  1NGB A;  3ZSW A;  4ZTJ A;  4BRQ A;  4IDH A;  3AVL A;  3DYA A;  3WT0 A;  2A2Y A;  1NGA A;  1UAX A;  2PZS A;  3MEG A;  3IAY A;  1HKC A;  1BG3 A;  4YOT A;  3KLF A;  1H4Q A;  4FK0 A;  3J7A P;  3O3G A;  5AR0 A;  1KAY A;  4GW6 A;  1NKE A;  2E1Z A;  3TAB A;  3EKU A;  5M1Q A;  2RKI A;  3I8B A;  3U3G A;  3L4I A;  1VR4 A;  2WUS A;  4B9S A;  1XNR K;  4KTW A;  4IKF A;  4NXN K;  3ZET B;  3IFR A;  2WFB A;  1QQO A;  2FSK A;  3SAF A;  3CYM A;  3U6F A;  1HKG A;  4KAZ A;  2KTQ A;  3QBX A;  1FW6 A;  1RCH A;  3NDK A;  2PYL A;  2KKZ A;  4WCE L;  1OH7 A;  5MLC Q;  4Q0B A;  1VSH A;  3ISN C;  4KH5 A;  4CES A;  4LF8 K;  4O5B A;  3FLC O;  1SS6 A;  5C2D A;  1ASW A;  1RDA A;  4JK7 A;  4PL8 A;  4EP4 A;  4BDP A;  4FYD A;  4CZM A;  3ZLJ A;  3OBY A;  1N8R O;  1N32 K;  3L2W A;  4JI6 K;  3DLG A;  3HOT A;  3JYT A;  3K2P A;  3E1Y A;  2PAV A;  3C6T A;  1D8Y A;  3ZSY A;  4R5P A;  4A61 A;  3G6E N;  3RTV A;  1T6D A;  2JGU A;  3I0S A;  4KB1 A;  1N33 K;  4M3R A;  4OJR A;  4RW9 A;  4IG3 A;  5AQG A;  4NCB A;  4DV4 K;  2QWM A;  2HNZ A;  4LFC K;  3DLH A;  4LF5 K;  2P9U B;  4BRP A;  3MDQ A;  1K4P A;  2P9U A;  3FGU A;  3KVG A;  4BC3 A;  1K4O A;  4NCX A;  4N76 A;  3LPU A;  3K0S A;  1QS4 A;  3KZB A;  5FPD A;  2A6A A;  3VN5 A;  2ASP A;  5EXW A;  1EKE A;  3V9S A;  1VHX A;  4H5W A;  1BUP A;  4DV1 K;  4MO4 A;  3TAE A;  1VQ6 N;  3LP3 A;  5T7B A;  3DLR A;  1NK9 A;  3H3N O;  3THV A;  3R3L A;  4NLC A;  5FLX O;  3TAP A;  3CJ1 A;  5GAD P;  3OYI A;  3KKR A;  2FBY A;  2DPN A;  2IVP A;  3BF1 A;  3C0B A;  4AHS A;  3P39 A;  1ZBL A;  3ZSR A;  4YFU A;  1IKY A;  4JLH A;  4NZT M;  1K6Y A;  4KTQ A;  1BO5 O;  2RN2 A;  1YT3 A;  3NGY A;  2A3Z A;  3OW2 M;  4AHC A;  3TOE A;  5HRN A;  3TTF A;  1KAZ A;  4LF4 K;  2NRV A;  4O8K A;  2W42 A;  2GEM A;  3VQP A;  1UA1 A;  4PKI A;  5AQH A;  3AVA A;  3CCE N;  2QKB A;  3KKS A;  3AVC A;  3MED A;  3PX0 A;  3KIO A;  1BI4 B;  2O4I A;  1ZXO A;  1NGD A;  4XH5 A;  4FJJ A;  4CJQ A;  1MA9 B;  1B9D A;  1J9A A;  5GAE P;  4F9O A;  2IAJ A;  3G25 A;  2G8K A;  4BRL A;  2P9I B;  3T7Z A;  4M3T A;  1TUU A;  5J2N A;  2BDP A;  4IBN A;  4BR5 A;  1CLQ A;  1RT6 A;  3S3N A;  4DTU A;  2YNG A;  1KFS A;  2XY8 A;  4CK2 A;  3C65 A;  3TAQ A;  4DQ8 A;  3THW A;  1JLF A;  4C1N I;  4BC2 A;  2PBD A;  1C1B A;  3T1Y K;  1QZ6 A;  4YKE A;  4DSI A;  2WON A;  3SJH A;  4H0P A;  3DOK A;  1NK4 A;  4CHZ A;  4CJP A;  4Z4E A;  3R9P A;  2UXD K;  1H0Y A;  2V7Y A;  1X3N A;  5KRT A;  3DJC A;  3B6O A;  1JL1 A;  2G8W A;  4DR5 K;  4R79 A;  5F2R A;  3QEI A;  1A5W A;  4NO7 A;  5BR9 A;  4JRP A;  2DTU A;  3ULE A;  4F2S A;  3VER A;  3VF6 A;  4FLU A;  1VQM N;  4KV8 A;  1S6Q A;  4IJA A;  3VQ5 A;  3KWG A;  3D0P A;  5C2F A;  5JMV A;  5D3G A;  1SKR A;  4DUY K;  4WE1 A;  3RRG A;  1RQ8 A;  1S6P A;  2P9P B;  3LZI A;  1W7A A;  4FWO A;  3O9R A;  3QEV A;  4B1Z A;  3NF8 A;  3CQ8 A;  1VQ9 N;  2YX6 A;  3QFP A;  2WC9 A;  1NJW A;  1X9S A;  3QET A;  3CFO A;  4EIA A;  2HHS A;  1U48 A;  2ZJP L;  4QAG A;  3MEC A;  2QWO A;  1BIZ A;  3GE1 A;  3VA3 A;  3DXM A;  3K9K A;  2E2Q A;  3E01 A;  2CH6 A;  2VWK A;  1NGH A;  1GLA G;  4I6M A;  3SQ1 A;  3MXI A;  4OLB A;  2ZE2 A;  5HRR A;  3RR7 A;  1SKW A;  3FZM A;  4I14 A;  1NM1 A;  4OLF A;  4K8Z A;  5LMU K;  1VRT A;  1WAJ A;  4CFD A;  3LVJ C;  5B8H A;  3WUH A;  3AO4 A;  3IAL A;  4E19 A;  1E4G T;  2Q31 A;  3ZSX A;  3VF2 A;  4B9T A;  4PL7 A;  2WOM A;  4FLT A;  5C12 A;  5CZ1 A;  2M71 A;  1Y2I A;  4N47 A;  5LL6 Z;  3THY B;  4CD1 A;  1BA1 A;  3DRR A;  2BTF A;  5AQZ A;  3HVR A;  4JKH A;  4AH9 A;  1II7 A;  2FLO A;  1HNX K;  4YDQ A;  3SCX A;  1X9M A;  3J7Y P;  5C0Y A;  4BDY A;  1Y97 A;  3IAB A;  1N6Q A;  4FZY A;  4Z0U A;  4LSL A;  3IKM A;  3OVN A;  5A2Q O;  3AO2 A;  3RSE B;  2G8U A;  4CCH A;  4FJM A;  1Q8I A;  3AVI A;  4FK4 A;  5AZJ A;  4PWD A;  4Y0W A;  3QNN A;  1C1A A;  1JXB A;  3I0R A;  1WSI A;  1RDW X;  4OKE A;  4CEC A;  1SZ2 A;  1RFQ A;  3HL8 A;  5EY4 A;  3DLK A;  3KK7 A;  5HOO A;  2X74 A;  3QIO A;  4N5S A;  1YJN N;  2QWL A;  5CY4 A;  2EH1 A;  2OZM A;  2QK9 A;  2HHV A;  3SAG A;  4B3S K;  1RT3 A;  4BG9 A;  2GTC A;  3LDO A;  5LJV A;  3QES A;  3U6Y A;  3A2F A;  4CK1 A;  5TKY A;  4DR2 K;  3H07 A;  3LP1 A;  3LAM A;  3DI6 A;  4UQG A;  2WTU A;  4WQ5 A;  4DU4 A;  4J2A A;  3CJ7 A;  4CJS A;  1KSP A;  4IO9 L;  2GTD A;  1Q9X A;  1FXX A;  4DQP A;  3RWU A;  4FPA A;  5SZT A;  4C8K A;  3CCS N;  3T3F A;  1IBK K;  5C42 A;  2YNI A;  2XHB A;  3CJA A;  3BGR A;  4BRF A;  3P1G A;  4OPJ A;  4KO0 A;  3FZF A;  2O8F A;  2HVI A;  2IVO A;  4A59 A;  4FZZ A;  1YTA A;  4KPY A;  4OKK A;  1KLM A;  5C24 A;  4CGI A;  4CF0 A;  2ZM6 K;  4B3T K;  1PVW A;  1MU2 A;  3MX2 A;  4FBQ A;  2AA4 A;  3JSM A;  3O9T A;  3K5N A;  1RTH A;  1EET A;  4CER A;  4CGG A;  4CZJ A;  3T1A A;  4LY7 A;  1WAF A;  1X1P A;  4FJI A;  3H1V X;  5J1E A;  3THY A;  2F8T A;  1ZBU A;  3IRX A;  4HHT A;  1XMQ K;  1W2B M;  1L3S A;  3MXJ A;  4BC4 A;  4O55 A;  3AVN A;  3W0L A;  3WNG A;  1V4T A;  3NVK A;  4CGF A;  1NNE A;  3RMA A;  1QZ5 A;  3IAB B;  2H9U A;  2QWP A;  1LN4 A;  3O08 A;  1NMD A;  1HR0 K;  2Y1I A;  4JNE A;  3NGZ A;  3AAR A;  3HSC A;  4H5V A;  2I7N A;  2HF3 A;  1ZBS A;  3V9W A;  4PQU A;  1NJ5 A;  4GVE A;  4CHY A;  1FKO A;  2QM1 A;  1VSF A;  2KZZ A;  1BIS A;  4BQL A;  1KC8 O;  3AO1 A;  1QVG M;  3F9M A;  3IUC A;  4MQ3 A;  3O6W A;  4FLW A;  2OPS A;  1DKG D;  3UB5 A;  4JKG A;  2VG6 A;  1JKH A;  1RBT A;  5AZI A;  3HBT A;  1TKD A;  2RHK A;  3VEW A;  4BC5 A;  4NYN A;  4RWT A;  3EZ5 A;  4H5N A;  1C0T A;  3QEW A;  1D5A A;  2A40 A;  2E6M A;  4FWK A;  4CBX A;  5AQL A;  5AQU A;  1L3U A;  1D9D A;  4CEA A;  3P4I A;  5I9E B;  1E3M A;  4YOW A;  4L3Q A;  3TAR A;  3K5M A;  1U49 A;  1NGE A;  4YDU A;  3WXJ A;  3KJV A;  4K25 A;  4DTO A;  3DWL A;  3QIC A;  3O4Q A;  4NLB A;  3E9O A;  4BG8 A;  1WSG A;  3S3M A;  1JCE A;  3SBT A;  3VQC A;  3OS0 A;  4KI6 A;  3VTI A;  3RMD A;  2O4G A;  4JKE A;  3ZEU A;  2XRI A;  3A5N C;  3EY1 A;  4JHD A;  5M1O A;  1S1T A;  2ZJR L;  2P9N A;  1Q7Y O;  3C7N B;  1XEZ A;  4NXM K;  2E2N A;  1BL3 A;  3DXK A;  5AQI A;  3D45 A;  3NF7 A;  3R8E A;  5FDL A;  4FLZ A;  1R0A A;  4KHQ A;  2FF6 A;  5ADX A;  1Q18 A;  3T69 A;  2A5X A;  2RIU A;  1TKX A;  4DQR A;  3SLC A;  2VWJ A;  1K9M O;  3I33 A;  1ASV A;  2Z1G A;  2UUA K;  4BR2 A;  4KB0 A;  3MCP A;  3LP0 A;  2RE2 A;  4X65 K;  4FWM A;  3OYG A;  1T44 A;  2P9L A;  4FWP A;  1ITG A;  2HBL A;  4M3X A;  1IV0 A;  3DAW A;  3VEN A;  1KLN A;  3AVM A;  2HHU A;  4ID5 A;  1QSL A;  4O4G A;  1RT1 A;  4RCH A;  4FJ7 A;  4E1N A;  3O9U A;  5LY3 A;  3OYL A;  2Q3S A;  3CM5 A;  2ZD1 A;  1TL1 A;  2R7Y A;  2HF4 A;  3UKR B;  1BU6 O;  5CR4 A;  4CJV A;  1XUP O;  3TTD A;  2W40 A;  2HHH K;  1EP4 A;  3VEV A;  2GUI A;  2KLA A;  3ZSQ A;  1ATR A;  1HRH A;  1XC3 A;  3ENB A;  3BP8 A;  2HHQ A;  2HBJ A;  2NUB A;  4B3M K;  4BRG A;  1SNN A;  1VK0 A;  3OYA A;  2GWJ A;  3VGK A;  4M3W A;  3HM9 A;  3QKB A;  4DWI A;  4TSX A;  3IS9 A;  2NLX A;  1JDQ A;  2EWS A;  4Z4C A;  4GVM A;  3KD1 E;  1RDD A;  4K87 A;  4M3Y A;  4DMN A;  1QQN A;  4B9Q A;  1S1W A;  3MAQ A;  4H0O A;  2F96 A;  3THW B;  3CM6 A;  3FFK B;  5EOY A;  3LDS A;  2O8C B;  3F73 A;  5C25 A;  4FOE A;  3QFU A;  3ENH A;  1EWR A;  4A2A A;  3TAN A;  2VQE K;  3H3O B;  4CEE A;  4QOZ B;  5AQO A;  4BE0 A;  3AA2 A;  3ZEU B;  4CJ5 A;  1D9F A;  1TAQ A;  4BQZ A;  1CZ9 A;  4B1W B;  1GLJ O;  2YHA A;  5HBM A;  3KLG A;  2Q3V A;  3OS2 A;  3OYD A;  5GIO A;  2OA8 A;  4IFV A;  1K8A O;  1TUY A;  4L8R B;  1NFJ A;  4DKW A;  3KWI A;  3WBM A;  3HZ6 A;  4HTL A;  4GV3 A;  2HMI A;  3D2F A;  1REV A;  2BGG A;  1K7J A;  4KRE A;  5JS1 A;  1X9J A;  4NB4 A;  3VQD A;  3VQ7 A;  3L2R A;  3OYM A;  1Q82 O;  4KRF A;  1H4T A;  3C94 A;  1U45 A;  4CF1 A;  4C23 A;  2HVH A;  2FXU A;  1FJG K;  2E20 A;  2B6A A;  3ZT3 A;  4HVZ A;  5GIN A;  3ZIH A;  4DTR A;  2GBZ A;  1JLE A;  2Q97 A;  2PFU A;  5AQT A;  3DSC A;  4FM2 A;  3AA3 A;  1OH5 A;  3KK1 A;  2E2O A;  3KLE A;  3Q7B A;  1GOA A;  2V51 B;  2O8E B;  3LPT A;  3DM2 A;  3TPQ A;  1HPM A;  3BY5 A;  3PX6 A;  2X6S A;  2UU9 K;  2UUC K;  1HNW K;  4WI1 A;  3D7E O;  3O9Q A;  4E1M A;  4C8M A;  5AQF A;  1OH6 A;  4IO8 A;  2D0C A;  3K5L A;  4DTN A;  3W3D A;  2Y1B A;  1UWB A;  3MXM A;  3SUP A;  2D0B A;  5FPM A;  5JVH L;  4TWA A;  3LP2 A;  3CCJ N;  4I7F A;  2QWQ A;  4P8E A;  1BDG A;  3GG4 A;  4WQ4 C;  3LVK B;  1J54 A;  2IFE A;  4PKH A;  1WSE A;  1VQN N;  4FOI A;  1Z6R A;  2UYT A;  4DR6 K;  2QXL A;  2ZGZ A;  3ZSZ A;  4IOA L;  1KD1 O;  2I7P A;  3KLH A;  3PV8 A;  3AJE A;  1S3X A;  4RW7 A;  2P5O A;  4JI7 K;  3LZJ A;  3LWL A;  3RSE A;  1Z26 A;  2VGM A;  3OS1 A;  3AO3 A;  4FSV A;  2W41 A;  1QHT A;  3C6H A;  1HYZ A;  3TI0 A;  4FLX A;  5KTQ A;  4CEF A;  4M3U A;  1EO1 A;  3L3U A;  2EK0 A;  3O80 A;  3L3V A;  1W97 L;  4M7X A;  4WFA L;  3CQX A;  1RBU A;  5JVG L;  5AQV A;  3TU5 A;  1IBL K;  3WXL A;  1S9G A;  1XQS C;  5AZI B;  1VSE A;  4B3R K;  3O8M A;  2A1S A;  4A5B A;  1VQO N;  3CHW A;  4ID1 A;  4CED A;  1QSS A;  2CGK A;  3VF4 A;  1TYQ B;  4BR9 A;  3UE5 A;  3VOV A;  1DT9 A;  3TSU A;  5EVZ A;  1HPZ A;  1O13 A;  2GWK A;  2P9K A;  3QIN A;  3SPZ A;  2Q0U A;  1ZBH A;  3CFR A;  4DLE A;  3O4W A;  4OX9 K;  1TK5 A;  4JS4 A;  4DTM A;  2OTL N;  4OO1 J;  3K5O A;  1G15 A;  1I39 A;  1NGF A;  1ATS A;  2KZM A;  3SV3 A;  1YAG A;  3L4Q A;  4DQQ A;  4CJ3 A;  4AF1 A;  1HX1 A;  3GBT A;  4JD2 B;  1NOY A;  3M1F A;  1TGO A;  1T8E A;  2YHX A;  2Q0R A;  5DM6 L;  3MN9 A;  1K8K A;  4AM7 A;  3ZSV A;  4BR4 A;  3SUN A;  4ELU A;  2VWB A;  4DV0 K;  4GV9 A;  1RTI A;  2O8F B;  4GKJ K;  3FFI A;  4BRA A;  2Z1H A;  5AZJ B;  2KFZ A;  2QTD A;  3V9Z A;  3F9K A;  1DEJ A;  4LSN A;  4Q15 A;  1C0U A;  4CF2 A;  3HK2 A;  1JXE A;  4NYF A;  4YHH K;  1QHA A;  4J2D A;  3SK3 A;  3O3H A;  3WXK A;  1C0M A;  4H4M A;  3QEX A;  2IOC A;  3BEX A;  2AP1 A;  3BZK A;  1LWE A;  2P9B A;  1KTQ A;  2H3G X;  2IS3 A;  2JWK A;  4CJR A;  1A5V A;  3CJ9 A;  1JL2 A;  1XWL A;  4Y1D A;  4DB3 A;  3DLB A;  4CJT A;  3S9H A;  4JKA A;  1RNH A;  4CZG A;  1J5E K;  1JJ2 M;  1KVA A;  1GOB A;  1OKJ A;  1CZA N;  4H5T A;  3R6M A;  1RT7 A;  2D0A A;  4KTZ A;  3J8A A;  4JI4 K;  2E88 A;  4CZL A;  3CMA N;  4GNI A;  1NK5 A;  1YF5 L;  3LQU A;  1LW2 A;  3V9X A;  3DLE A;  5BN9 A;  5I3U A;  5AJ3 K;  1OH8 A;  4JKD A;  3CME N;  1T05 A;  2LN3 A;  4BWJ A;  4M63 C;  3VQB A;  1S72 N;  4FVM A;  1ESV A;  1S5J A;  3MMV A;  2P9N B;  3S3O A;  1H1V A;  1Z25 A;  1M90 O;  3SQ4 A;  3THX A;  5CYQ A;  5FRM A;  3SUQ A;  4M42 A;  2GX9 A;  2UXC K;  1WSH A;  3AGK A;  2HST A;  3WNF A;  1UA0 A;  3LDP A;  3UKU A;  2O8C A;  4CZK A;  3VA0 A;  4UY8 O;  1H0X A;  2YKM A;  3Q7C A;  5BPN A;  3NAE A;  2QWN A;  4CZH A;  1NK6 A;  3TAM A;  4BRO A;  4ICL A;  3D2E A;  1F21 A;  4HD0 A;  1B92 A;  3K58 A;  3LAL A;  2D0P A;  2ZGY A;  4RW6 A;  1DTQ A;  3AAQ A;  4QS8 A;  1HNZ K;  5BN8 A;  1EX4 A;  3CC4 N;  4H8K A;  1N34 K;  1Q9Y A;  1U6Z A; 
#chains in the Genus database with same CATH homology
 4I6M B;  4MLE A;  3F9M A;  2NNW A;  3IUC A;  3EE9 A;  3HRG A;  3O6W A;  3EL2 A;  3ZYY X;  1DKG D;  3CET A;  1SQK A;  4P8J A;  3P38 A;  3HOS A;  1NWK A;  3UB5 A;  4JKG A;  1EQY A;  1RDU A;  4CZI A;  2ZJQ L;  4YOR A;  4FBK A;  3VTH A;  1G58 A;  3CIP A;  4YOX A;  3L0Q A;  2QA4 N;  3ID8 A;  3HTV A;  3HBT A;  5AZI A;  4H0Y B;  4Z94 A;  2RHK A;  3VEW A;  5AQY A;  4BC5 A;  3MK5 A;  3PIP L;  4QS9 A;  3PIO L;  4RWT A;  3CPE A;  4WQ5 C;  4PHT X;  2CH5 A;  3CCV N;  4H5N A;  4IFE A;  3O1B A;  4A5A A;  2MX1 A;  4FFJ A;  4JAX A;  1HJO A;  2A40 A;  3MN5 A;  4FWK A;  1V4S A;  5AQL A;  3U8X A;  4CBX A;  1SAZ A;  3F5T A;  2QW9 A;  1KQS M;  4FCX A;  5AQU A;  5BPM A;  3LDL A;  4GV6 A;  1NGB A;  1D4X A;  3P4I A;  5I9E B;  4YOW A;  4L3Q A;  2CGL A;  4BRQ A;  4IDH A;  1BOT O;  4YDU C;  5DM7 L;  1MWK A;  3MK6 A;  3WT0 A;  2YJF A;  1NGA A;  1NGE A;  3AAP A;  4YDU A;  3WXJ A;  4K25 A;  1HKC A;  3DWL A;  1BG3 A;  2E1Y A;  3QIC A;  3E9O A;  4NLB A;  4YOT A;  3S41 A;  4BG8 A;  3CD6 N;  1GLD G;  2ZWH A;  3UKR A;  4JD2 A;  1IJJ A;  3WEE B;  1JCE A;  3SBT A;  4FL9 A;  3DLL L;  3G71 N;  3VTI A;  3N4P A;  2Q2R A;  4BRI A;  3KHY A;  5AR0 A;  1KAY A;  1BWF O;  4JKE A;  2E1Z A;  1YI2 N;  3ZX3 A;  4G9Z A;  4JHD B;  3ZEU A;  3A5N C;  3EKU A;  5FPN A;  5M1Q A;  3H46 O;  3I8B A;  1T3V A;  3P04 A;  4JHD A;  5M1O A;  2ZJR L;  5FPE A;  2P9N A;  3L4I A;  1VQ4 N;  4WF9 L;  3ZET A;  1Q7Y O;  2WUS A;  3C7N B;  1XEZ A;  3VET A;  1C0G A;  2E2N A;  3BF3 A;  1YHQ N;  3DXK A;  3ZET B;  1C0F A;  3E9L A;  2GEL A;  3IFR A;  5AQI A;  3R8E A;  2WFB A;  4EFH A;  1QQO A;  4K42 A;  2FSK A;  3CCQ N;  3SAF A;  2FF6 A;  1QVF M;  5ADX A;  1Q18 A;  1Y64 A;  1HKG A;  1HKB A;  3T69 A;  4AM6 A;  5CHI A;  2A5X A;  3QBX A;  2RIU A;  1YXQ A;  3SLC A;  5H1S Q;  2KKZ A;  3A0I X;  4WCE L;  1K9M O;  3L6Q A;  4BVO A;  3I33 A;  3MN6 A;  3SMS A;  5MLC Q;  1NGJ A;  1R59 O;  4BR2 A;  4KH5 A;  3MCP A;  5JLH A;  3FZH A;  4BRC A;  5GAH P;  3SMP A;  3CC7 N;  2RE2 A;  1OVY A;  3FLC O;  1SS6 A;  5C2D A;  3SAH A;  4CI6 A;  4FWM A;  4JK7 A;  4PL8 A;  3QDK A;  1T44 A;  2P9L A;  4FWP A;  2HBL A;  4CZM A;  3OBY A;  1N8R O;  4BRN A;  1VQ7 N;  3CC2 N;  2HBK A;  2V52 B;  3DXM B;  4EO0 A;  3HOT A;  3DAW A;  3VEN A;  4P6C A;  4K43 A;  5LJW A;  2HBM A;  3U9Z A;  4A2B A;  4IOC L;  3E1Y A;  2PAV A;  4BY9 C;  4OPH A;  4RCH A;  4A61 A;  3G6E N;  3O9U A;  1E4F T;  5LY3 A;  2ASO A;  2GUP A;  1T6D A;  2HF4 A;  3UKR B;  2VYP A;  3QBW A;  4KBO A;  1BU6 O;  5CR4 A;  4IWV A;  1NBW A;  4E1B A;  1XUP O;  3TTD A;  1GLC G;  2W40 A;  3VEZ A;  3D2F B;  4P6D A;  3VEV A;  1TKS A;  2YHY A;  2KLA A;  1NGC A;  4IOX A;  5AQG A;  4JK9 A;  1HRU A;  4ILJ A;  1ATR A;  2QWM A;  5BRE A;  5KQD A;  3CJB A;  2P9U B;  1XC3 A;  4BRP A;  2A42 A;  3MDQ A;  3ENB A;  1K4P A;  3BP8 A;  1T6C A;  1NJI O;  2P9U A;  2HBJ A;  3FGU A;  1VQK N;  2ASM A;  3KVG A;  4BC3 A;  4BRG A;  1K4O A;  1SNN A;  2GWJ A;  1G57 A;  1NGG A;  3VGK A;  4U7B A;  3H6E A;  4B1Y B;  3KZB A;  5FPD A;  4KH6 A;  2NLX A;  2EWS A;  2A6A A;  1GLE G;  4ISE A;  3TSQ A;  3QML A;  2ASP A;  5TKW A;  3I56 N;  5EXW A;  1QQN A;  2E8A A;  2Q36 A;  4B9Q A;  1K49 A;  4H0O A;  4H5W A;  1BUP A;  3ZIG A;  4IZ9 A;  4MO4 A;  4A57 A;  3MCA B;  3FFK B;  1YVN A;  5EOY A;  1VQ6 N;  2RIS A;  3WQT A;  4YOY A;  4JK8 A;  3H3N O;  4FOE A;  3R3L A;  4JN4 A;  3QFU A;  4BGB A;  3ENH A;  4NLC A;  3LS6 A;  3CJ1 A;  4HWI A;  3WEE A;  4A2A A;  5E26 A;  4MO5 A;  5GAD P;  3M3Z A;  3H3O B;  1KXP A;  2NRW A;  3BF1 A;  2DPN A;  2IVP A;  3C0B A;  5AQO A;  2KHO A;  3P39 A;  3ZEU B;  4NZT M;  4BQZ A;  3ATU A;  3A5L C;  4B1W B;  2FF3 B;  1GLJ O;  1BO5 O;  2HOE A;  5GIO A;  2A3Z A;  1K8A O;  3OW2 M;  1TUY A;  3E66 A;  2J4R A;  4DKW A;  5F1X A;  3GL1 A;  3MWT A;  3TTF A;  1KAZ A;  2QI2 A;  3MX5 A;  3KWI A;  2NRV A;  3HZ6 A;  4HTL A;  4GV3 A;  3D2F A;  1MWM A;  2OAN A;  2VGN A;  3ZII A;  1VAZ A;  2GEM A;  3GOI A;  4O8K A;  5AQN A;  5AQW A;  1HUX A;  1K7J A;  4PKI A;  1X9J A;  5AQH A;  4E1J A;  3CCE N;  4NB4 A;  3CCR N;  4U67 L;  4JEP A;  4BRE A;  1Q82 O;  3NMU A;  4JKG B;  4A62 A;  3LRJ A;  1JCF A;  1ZXO A;  1NGD A;  4XH5 A;  4XH1 A;  4ISG A;  4EHT A;  3LDQ A;  4C23 A;  2OTJ N;  1MA9 B;  5GAE P;  4F9O A;  5KPT A;  4LC9 B;  2FXU A;  3G25 A;  3H45 C;  4BRL A;  2P9I B;  3T7Z A;  1K73 O;  1TUU A;  3VEY A;  3ATV A;  2E20 A;  2YCH A;  5GIN A;  4HVZ A;  1YIJ N;  3ZIH A;  4BR5 A;  1KK9 A;  2IIR A;  2Q97 A;  4H0V B;  3ZIE A;  2PFU A;  1KAX A;  5AQT A;  5AQX A;  4BGA A;  3VGM A;  3C65 A;  1ZC6 A;  5AQJ A;  2BUP A;  3CCL N;  3MGZ A;  5M1F A;  4DQ8 A;  2E2O A;  1BA0 A;  3Q7B A;  3K9J A;  4C1N I;  2V51 B;  4BR0 A;  4P77 A;  4BC2 A;  5E84 A;  2PBD A;  3CI5 A;  3VMF B;  1Z05 A;  3U9D A;  4MDA A;  3M6G A;  3TPQ A;  1QZ6 A;  4YKE A;  1HPM A;  3CCM N;  3P31 A;  3SJH A;  1GLL O;  4H0P A;  3ENO A;  2V7Z A;  3M5R A;  2JWL A;  3R9P A;  3D7E O;  5AFU H;  3O9Q A;  2YHW A;  2V7Y A;  1X3N A;  5AQF A;  3DJC A;  4C1N K;  5CE3 A;  4IO8 A;  4R79 A;  3J7Z O;  3W3D A;  5F2R A;  4ILG B;  3U4L A;  4IEI A;  3T1I A;  3RVC A;  2P9K B;  5FPM A;  2Q1N A;  4NO7 A;  3VES A;  3ULE B;  5BR9 A;  4CZE A;  2F7T A;  5AQQ A;  5JVH L;  3CCJ N;  4WFB L;  2QWQ A;  3ULE A;  4P8E A;  1BDG A;  3VF6 A;  3VER A;  1VQM N;  3GG4 A;  4WQ4 C;  3CPW M;  4IJA A;  3KWG A;  3H1Q A;  5C2F A;  5JMV A;  4PKH A;  2P9P A;  1VQN N;  3SBG A;  4FOI A;  1Z6R A;  2UYT A;  5GIP A;  2QXL A;  3D2E B;  2ZGZ A;  2D4W A;  2P9P B;  4GY2 B;  4IOA L;  1IG8 A;  4WFN L;  3VEO A;  5AQR A;  3B8A X;  4FWO A;  3O9R A;  5HL7 L;  2I7P A;  4B1Z A;  1KD1 O;  3AJE A;  2E2P A;  1S3X A;  5C10 A;  1NLV A;  2YX6 A;  3QFP A;  3CJC A;  2WC9 A;  3C6A A;  4EHU A;  1VQ9 N;  3RSE A;  3LL3 A;  2VGM A;  3OA9 A;  4FSV A;  2F9T A;  1VQP N;  4EIA A;  2W41 A;  2ZJP L;  1K4L A;  1ILY A;  1JCG A;  3C6H A;  2QWO A;  4YOU A;  3GE1 A;  4BRH A;  4O8U A;  2D0O A;  3DXM A;  1HLU A;  3K9K A;  3WQU A;  2E2Q A;  2NRH A;  2CH6 A;  3IMX A;  4ILH A;  3VGL A;  1EO1 A;  1NGH A;  1GLA G;  3O80 A;  5ELZ A;  1W97 L;  4I6M A;  1K4I A;  1M1K O;  4M7X A;  4WFA L;  1VQL N;  3CQX A;  3R1X A;  3FZM A;  5JVG L;  5AQV A;  4I14 A;  5BPL A;  3TU5 A;  1NM1 A;  4DHY A;  3FZK A;  1WUA A;  3WXL A;  1XQS C;  3F2K A;  5AZI B;  3O8M A;  1YIT N;  4A5B A;  1VQO N;  4XH4 A;  3CHW A;  5GAG P;  2CGK A;  3VF4 A;  1TYQ B;  5B8H A;  3WUH A;  4BR9 A;  4BVP A;  4P6P A;  3UE5 A;  2ZF5 O;  3VOV A;  1E4G T;  1DT9 A;  3TSU A;  2Q31 A;  2NRZ A;  2D1K A;  5EVZ A;  3VF2 A;  1O13 A;  2F9W A;  4PL7 A;  2GWK A;  3NVM A;  5C12 A;  2P9K A;  5KPR A;  4B1V A;  2FSN A;  2Q0U A;  4XEI A;  2P9I A;  3O4W A;  4IEE A;  3CCU N;  4H0X B;  3ZX2 A;  4OO1 J;  2OTL N;  4CD1 A;  5AFU A;  1BA1 A;  5AQZ A;  2BTF A;  1NGF A;  4FBW A;  1ATS A;  4JKH A;  2FLO A;  1YAG A;  3L4Q A;  5AQM A;  3FR0 A;  1HX1 A;  3EE8 A;  3GBT A;  4AF1 A;  4JD2 B;  3E9P A;  3OHR A;  1X3M A;  3M1F A;  1ATN A;  3D6R A;  5C0Y A;  1P90 A;  2YHX A;  2Q0R A;  1J6Z A;  5DM6 L;  3MN9 A;  1K8K A;  3LM9 A;  4AM7 A;  4B1U B;  3IKM A;  4CD3 A;  1LOT B;  5KPZ A;  3RSE B;  2WBN A;  1K8K B;  1RGI A;  5JIC A;  3EKS A;  4BR4 A;  5M1K A;  3BUZ B;  1YJW N;  2VWB A;  4JKC A;  5AZJ A;  1LCU A;  4Y0W A;  4GV9 A;  3MN7 A;  1U2V A;  3DXK B;  4BRA A;  5BRH A;  5AZJ B;  1RDW X;  2QTD A;  4WYB A;  3CXC M;  1SZ2 A;  1RFQ A;  3EZW A;  4BRD A;  1DEJ A;  5EY4 A;  2QEX N;  2NRX A;  3A5M C;  4MLH A;  3WXM B;  2NZT A;  3JS6 A;  1GLF O;  2BH1 A;  3KK7 A;  4FWQ A;  4H5R A;  5HOO A;  1QHA A;  4JKB A;  4M7Y A;  2CGJ A;  4WQ4 A;  3SK3 A;  1YJN N;  3WXK A;  4JKF A;  2QWL A;  5ADX H;  5C15 A;  4H0T B;  4B1X B;  3SAG A;  5AQK A;  3FE1 A;  4BG9 A;  5AQP A;  4FWR A;  5EX5 A;  3BEX A;  5AQS A;  1TYQ A;  2AP1 A;  2H3G X;  2P9B A;  3LDO A;  5LJV A;  4CZF A;  2JWK A;  4BRK A;  3G4S N;  3CJ9 A;  3H07 A;  5TKY A;  4DB3 A;  3I55 N;  3CER A;  3L7V A;  4WQ5 A;  4JKA A;  3CJ7 A;  1YJ9 N;  4FWN A;  1VQ5 N;  4CZG A;  1JJ2 M;  4H03 B;  1VQ8 N;  4IO9 L;  4EAH D;  3TSP A;  1CZA N;  1OKJ A;  4H5T A;  2GTD A;  3R6M A;  4QS7 A;  5M1N A;  5M1P A;  2YJE A;  4FWL A;  3J8A A;  2E88 A;  4NZR M;  4CZL A;  3CMA N;  4FPA A;  4MDB A;  4GNI A;  4RTF D;  1YF5 L;  3LQU A;  5BRF A;  3AY9 A;  3O9S A;  3CCS N;  5BN9 A;  3LDN A;  2ITM A;  4JKD A;  1Q86 O;  3CME N;  3PLA A;  1TKU A;  2LN3 A;  1DGK N;  3CJA A;  3GDQ A;  1NGI A;  1WOQ A;  4FPB A;  4M63 C;  2IVN A;  4BRF A;  1S72 N;  2NRR A;  1ESV A;  1QQM A;  1YUW A;  3MMV A;  5KQ8 A;  1JCU A;  3FZF A;  2P9N B;  1U2V B;  3O5B A;  2IVO A;  1H1V A;  3CQY A;  4FWS A;  4A59 A;  4O5F A;  3JXU A;  1M90 O;  4YOV A;  1PVW A;  4CJ7 A;  2EQA A;  4CBW A;  1G99 A;  3MX2 A;  4FBQ A;  2AA4 A;  2YI1 A;  3O9T A;  4OPA A;  4DCH A;  5F0X A;  3FZL A;  3MIO A;  4CZJ A;  3QB0 A;  3IDH A;  5JLF A;  1S22 A;  2VCP A;  3N4Q A;  2GX9 A;  3H1V X;  3AGK A;  1GLB G;  2HST A;  4IXC A;  1Q81 O;  4FO0 A;  3VPZ A;  3CF5 L;  3LDP A;  3UKU A;  4CZK A;  4J8F A;  1W2B M;  4FVU A;  4BR7 A;  4UY8 O;  4BC4 A;  3Q7C A;  5BPN A;  3UKU B;  4PKG A;  3W0L A;  2QWN A;  3VEX A;  3A8Y A;  1V4T A;  3TTC A;  3EO3 A;  4ISF A;  4IJN A;  4CZH A;  3O1W A;  3NVK A;  4BRO A;  3LM2 A;  4KH4 A;  1QZ5 A;  2P9L B;  5BRD A;  3A5O C;  3D2E A;  2FSJ A;  2QWP A;  3O08 A;  1MDU B;  1NMD A;  4K41 A;  3MWP A;  2A41 A;  2HMP A;  4JNE A;  4BRM A;  2QWR A;  2D0P A;  2ZGY A;  3AAR A;  3AGR A;  3HSC A;  4H5V A;  1IEZ A;  2I7N A;  3AAQ A;  3HM8 A;  2HF3 A;  4QS8 A;  5BN8 A;  1ZBS A;  3CC4 N;  3C7N A;  3EN9 A;  3ZX0 A;  4GVE A;  2QM1 A;  3HI0 A;  2P9S B;  4CBU A;  1U6Z A;  1PVY A;  2NRT A;  3OBW A;  1P8Z A;  4BQL A;  1KC8 O;  2P9S A;  1QVG M;  3ID6 A;  3WXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...