3TSPA

Crystal structure of e. coli hypf
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
646
structure length
646
Chain Sequence
b'QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 212
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tspA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tspA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tspA01
3VEZA 3VETA 3VTHA 3VF2A 3TTCA 3TTFA 3VESA 3VEXA 3VTIA 3VENA 3TSUA 3TSPA 3VERA 3VEWA 3VF4A 3TTDA 3TSQA 3VEOA
chains in the Genus database with same CATH superfamily
1WOQA 2P1JA 2YX6A 3G0ZA 4DF4A 3CG7A 3D2FB 4CJSA 4ELUA 4KO0A 5M1PA 4AHUA 1XUPO 4MLEA 3VQCA 3KK3A 5AQIA 3NBPA 2B6AA 2WFBA 4DV6K 3ZEUB 3GG4A 3O3GA 4KHWA 5C15A 2P9IA 4KHNA 3NVKA 2P9BA 4E1MA 1ITGA 2W40A 4DU1A 4BGBA 4BE2A 2DTUA 4FW1A 3VGKA 2Q3VA 4DQRA 4Z94A 3J7ZO 3T3FA 4FPAA 1ZYQA 3FZFA 2CGJA 4HWIA 5AQYA 4FBWA 4IEEA 1S1XA 5AZIA 5AQQA 2A41A 3VOVA 1VQPN 3MXMA 2G8FA 5AQVA 3E66A 3DXMA 3K5OA 4CE9A 4IG3A 2KQ2A 2DY4A 3IRXA 5JLFA 3EKUA 4IJNA 3BDPA 1C1CA 1FXXA 4G9ZA 4BVOA 5JVHL 1IKXA 4QS7A 4KHUA 3QETA 1J5OA 4HVZA 2E2QA 2B5JA 3QEXA 4CEFA 3QEWA 4B8CA 1K73O 5LY3A 4TWAA 3PY8A 3MXIA 2QI2A 3UIQA 3LZIA 1HMVA 2ETJA 2NRWA 3SV4A 3T69A 5CYMA 2PYLA 4A59A 3LZJA 5FRMA 1T3VA 1VRTA 1OH6A 3DWLA 4BRNA 4DTRA 4JRQA 3VF6A 4CEQA 3H1VX 3OBYA 3ATUA 4FWSA 4HTLA 5EX5A 2A1RA 2F9WA 1S6QA 3IG1A 3C65A 1KXPA 4DSJA 4CJ5A 1FKOA 4JKAA 4MLHA 2NRRA 2YV0X 3VPZA 3M8SA 3NF7A 3VQEA 3SNNA 1KVAA 4BWMA 4LFCK 2IS3A 1SAZA 3SI6A 4FK4A 2D5RA 3V81A 5BN8A 4DSFA 3LP0A 1YJ9N 4CHOA 1FK9A 1T6DA 4E7JA 4KH6A 2HVIA 1JO0A 4FM2A 4K87A 1QSSA 4J8FA 2O8FA 4IDKA 2OPQA 1JLAA 1TKTA 1CXQA 5AQTA 1GLDG 3IKMA 3IABA 3TAMA 4O4GA 4FOEA 2FBTA 1K7JA 4KPYA 3JS6A 2E2PA 1KFDA 1LCUA 3TTFA 3O3HA 4FLYA 3L4IA 4YOTA 1SUQA 4YDQA 4FM0A 1XEZA 4BRDA 1IBKK 5H1SQ 3ASMA 4NXMK 3MN9A 5GAGP 2HHHK 2V52B 2O8CA 2KFNA 4DR2K 1BG3A 3LS6A 3AVNA 1NMDA 3SBTA 3OYGA 3RTVA 2L8YA 2HHTA 3C6TA 4FBQA 3I0RA 4WFAL 3WEEB 4YOVA 2ITMA 3HYFA 4DSKA 1IG9A 4CJQA 1RTJA 1H4SA 4B1YB 1RTHA 3LAMA 5EXWA 4ELVA 3CC2N 3DXKB 4DS5A 1RTIA 4LF6K 3KHYA 4LFBK 5AQZA 4FWNA 4E7HA 3BF1A 5J2MA 4DTNA 2NRTA 4JKCA 3V9ZA 4CBUA 3QESA 4Z4HA 5EY4A 4BE1A 3KD1E 3H3OB 3ZSXA 4BGAA 1M1KO 1EKEA 5KRTA 4PKGA 3PV8A 1DEJA 1KAZA 4CZLA 2QW9A 4FWPA 3CJ7A 1SZ2A 1EO1A 1VQLN 4AM7A 1IG8A 1YVUA 4K88A 3IS9A 3ZETA 3T1IA 2PAVA 4IOXA 4BR7A 2UXDK 4FCXA 4Z9EA 3AVMA 2FF3B 3IMXA 2A40A 4HCCA 4BRKA 4JKDA 1A5XA 3TABA 3C6HA 3P1GA 4IOCL 4CZFA 3U6YA 2E4LA 3T1AA 4P6PA 3DM2A 2O8EB 4AHVA 1TVRA 4FWRA 5TKWA 2V51B 3P39A 2PY5A 2X6SA 3K59A 3KWGA 1K8AO 4FZZA 2FBYA 2XY6A 1U04A 2ZJPL 2EH1A 1UA0A 2QM1A 3CCUN 4CI6A 1BU6O 3QMLA 5JS2A 3U6FA 3SUNA 2Z1JA 2FBVA 4B3SK 1BWFO 1P90A 3D2EB 4ID5A 2GUPA 2G8UA 3UB5A 1J53A 4Y0WA 3R3LA 1BDGA 4WQ5A 5C2FA 1BISA 1XHXA 4KHSA 3L2RA 4KB0A 4Y1CA 2Y1IA 3TARA 2B4JA 3EZWA 3NGZA 1HR0K 4FVUA 4WYBA 2A1SA 4CZHA 3THVA 4BRCA 4B9TA 3M3ZA 4CF8A 4DV3K 4CD1A 3CQ8A 4F2RA 3OW2M 1NOYA 4KHQA 4DR4K 3IALA 4DWIA 3D2FA 1WSHA 3KLIA 3VQ7A 4E7IA 3ZIIA 2D1KA 4CHPA 3TPQA 2FXUA 3VQ4A 3EZ5A 1ZBFA 3D45A 4WQ4A 3ZEUA 1VK0A 2GTCA 3L4QA 3KKSA 4LF8K 1VQ9N 4BRQA 1J9AA 4IFYA 1NJXA 3NDKA 1KVBA 2GBZA 3A5OC 4YOXA 4KH4A 3ZX3A 3CCMN 2XY8A 1HNVA 2BE2A 1ZBIA 1NGJA 4C1NI 2E6LA 4BROA 5ADXH 1QVGM 2RPIA 3RRGA 2HHXA 4KHYA 3SAHA 1O13A 4BR0A 5LMNK 4H0TB 4K8XA 4XH4A 1H0XA 1LN4A 1YAGA 4BQLA 2ZJQL 3CHWA 4OPAA 5ELZA 3M8RA 3QB0A 4FOIA 4O55A 4QS8A 4GW6A 5M1QA 2YHBA 5BPLA 3HVTA 4BRLA 4NZTM 4J2BA 1I39A 4B3RK 1NFJA 4B3TK 4HTUA 1VR4A 5AQPA 4C8KA 4KHPK 3MWTA 4CIFA 1NJ5A 3ISNC 3PX6A 1HX1A 3OYCA 3A2FA 3SCXA 1UDVA 2KFZA 3LQUA 4I9LA 3VF4A 3P04A 1X1PA 1OVYA 1RDAA 3I33A 4CF1A 4DV1K 3TAEA 2GEMA 3NMUA 1WSIA 3CIPA 1CLQA 3G71N 1DT9A 2JWKA 4A61A 2O4GA 2HVHA 3G10A 5CY4A 2CH5A 3PO4A 4M45A 1TKSA 3KLGA 1TAUA 1IKVA 3E1YA 3OYFA 4AQYK 3CCVN 1A5VA 4N41A 3UE5A 4UY8O 3LVKB 4CHNA 4AHCA 1TKZA 4EIAA 4MO4A 2P9SB 2HHUA 4ILJA 1QQOA 3O9UA 2WONA 3T7ZA 2E1ZA 4BDZA 2P9NB 1KAYA 2KLAA 4OLBA 1QHTA 1H0YA 3BEXA 2UUCK 4CFBA 4O0JA 4FWQA 1L3VA 3OYDA 5GIOA 3CJ9A 4ICLA 1WBBA 2I7PA 3DJCA 1OH8A 4DV0K 4KAZA 2J4RA 4C8MA 3E9OA 4YDUC 1BQMA 4K86A 3J81O 1C0FA 3HOTA 3AVJA 4IKFA 4B9QA 2UXBK 3SQ0A 2DPNA 3JYTA 4FM1A 3RWUA 1HYZA 1HRUA 3VQAA 2D0PA 3I56N 3C95A 3CXCM 2D0AA 5J2PA 4C8OA 4DS4A 4YORA 3VQ6A 4JI1K 2G8KA 4B9LA 1NK6A 4DFJA 3V9WA 3T19A 2ASPA 1V4TA 3BZCA 1IV0A 1C6VA 1E4FT 4Z0UA 4HHTA 5BRFA 4M3RA 4B9VA 3CPEA 1X9MA 4FJLA 1KLMA 3WEEA 3ZSZA 2OYQA 1K9MO 5DK5A 4DV4K 4RWTA 4FWLA 4Z4IA 2A3ZA 5D3GA 1K4LA 5K14A 1NH9A 3ID8A 5HL7L 3DXKA 4QS9A 3NH2A 4DFMA 2E5LK 4BR4A 1TKDA 3ZT3A 3VN5A 2I7NA 4EO0A 4E1JA 3LAKA 1GOAA 1KC8O 3KIOA 5BPNA 1RBTA 2HMIA 2Z1GA 4X65K 3LDLA 2KHOA 4JLHA 4FK0A 4DR5K 1QQNA 1E4GT 3N4PA 4B1VA 4BDYA 4OLFA 2FSKA 3LM9A 3ZCMA 3J80O 1QSYA 1C0TA 3THWB 4JYAK 4BACA 4KBOA 3CERA 1GLFO 5FPEA 4O5BA 4IDHA 3WXJA 1NG9A 3ZT0A 3QNNA 3WNFA 2HNYA 2VYPA 2P9UB 2O8EA 1BQNA 4BR5A 4CZKA 1RBRA 5I9EB 1BIZA 4DTXA 5AQXA 4FJ5A 3MDQA 1Q8IA 1TKXA 2FBXA 4DTUA 1TK0A 4GV3A 4BC2A 4BRFA 3P31A 3KLEA 5HROA 1Z6RA 2NNWA 3HL8A 4K43A 3BZKA 4K8ZA 3MWPA 3TR8A 4BG9A 3L7VA 2W42A 4JKGB 1CZBA 3EY1A 2EX3A 2YNGA 3AO4A 5I3UA 4DTSA 3CD6N 4DTMA 5AQSA 4YY3K 3KLHA 3D2EA 4A2BA 3DMJA 4IOAL 3LPUA 3O1BA 1NGHA 1RT1A 2YCHA 1FW6A 5TKYA 3EYZA 1N32K 1K49A 5HLFA 3PX4A 3WXIA 1GLCG 1DKGD 1NK8A 3T1HK 4A57A 1UA1A 2Q36A 2X78A 5FPNA 4CZJA 4DSLA 4M3TA 5LJWA 4JK7A 3AGRA 1YJNN 1U2VB 3OJSA 2YNHA 2WOMA 3MX5A 1NKBA 3OYMA 3S9HA 4I7FA 3DRPA 4BWJA 4AILC 3FR0A 2FSNA 4CZGA 3K2PA 4Z4GA 3VEVA 3VQBA 4OJRA 1R59O 4DQSA 1DTQA 1D9FA 3S3OA 1RT3A 1JJ2M 3RSEB 5AQJA 1Y64A 4DCHA 1NGBA 5J2NA 3AO5A 1J5EK 4IZ9A 1VQ5N 4B3OA 4LH4A 4CK3A 4OO1J 4LD0A 3D7EO 1BA1A 3TOEA 1VAZA 3IDHA 3HP6A 3ZT4A 4H4OA 4FYDA 3AVGA 1B9FA 3HO1A 1HLUA 4BR9A 4EHTA 3OS2A 5JMVA 3L2UA 3TSQA 3V1OA 2EK0A 4J2DA 4M7XA 1JXBA 3U9DA 4QCLA 3O4WA 1C1BA 2KZMA 3NCIA 4RG8A 3QEVA 2FF6A 5BR9A 2VQFK 1S3XA 1VSMA 1ZBLA 3EE8A 4JNEA 3SJHA 3ATVA 4H4MA 3KZBA 4GKKK 5SZTA 1EQYA 1REVA 1VQ8N 3H46O 3WUHA 4P6CA 2RN2A 2YKMA 2CH6A 4CIGA 1T44A 1T6CA 3KWIA 4MFBA 5C24A 2BGGA 4OLAA 4K42A 1JLBA 3K58A 1MA9B 2VG7A 1ATRA 5AQMA 5HOOA 5JLHA 1W7AA 5A2QO 3ZX2A 3HRGA 1TGOA 3QEIA 2YHXA 3C0BA 3G25A 2A42A 3VQ8A 3UKRB 3WT0A 3CJ1A 2GTDA 5AQOA 1TK5A 3M6GA 3TANA 3LM2A 4O5FA 2Z1IA 4DV7K 1Q7YO 3NGIA 4J2EA 3SQ2A 2HOEA 2P9SA 1UOCA 4BRMA 4FJHA 2YNFA 2P9NA 1CXUA 4ISFA 4KRFA 1NGDA 1KCFA 4CERA 3O9QA 3U4LA 4AM6A 3MN7A 4XH1A 4B3MK 4FJJA 1BL3A 4BC4A 4FZYA 3H07A 4ID1A 1VQ7N 2NRZA 1RFQA 4CJLA 5GINA 2VGNA 2YI1A 1YIJN 1VSLA 3LP2A 2Q3SA 4L8RB 4BG8A 4DB3A 4FO0A 4F2SA 3VEYA 3AVLA 4EZ9A 4BE0A 1HPZA 3KK2A 2HHSA 1NGFA 2F96A 5AQRA 3WXLA 5M1NA 3M8QA 4CJ4A 3L2VA 1XMQK 3DLEA 4JKEA 4FJ7A 3J7YP 2Y1JA 4XH5A 4DF8A 3RR8A 3DLLL 1LAWA 4HVJA 1Q9XA 5BR8K 1RCHA 3LP3A 4BVPA 4CJFA 1ATSA 3EKSA 4CGDA 3VETA 4H8KA 1LV5A 1L5UA 3O5BA 5HRRA 4CEDA 4DUYK 1J54A 2ZWHA 1PAVA 4B1ZA 2UUBK 4NLCA 4DFPA 1RT7A 4FL9A 4CZEA 2A5XA 2F8SA 5JICA 3LWMA 1ZBUA 4YFUA 5GADP 5HP1A 1I3AA 4E1NA 3LRJA 1CZ9A 4DTPA 3SBGA 3H08A 2A6AA 4X66K 2GWKA 2HNDA 3AO3A 5B8HA 2ATQA 4H5TA 4OGCA 3MK5A 4DQPA 4JKHA 1V4SA 2IIRA 4JAXA 3AY9A 4B9MA 3U3GA 3C7NB 3FZLA 3DSCA 5HRPA 2OA8A 1JCGA 3IUCA 4Q0BA 3AA3A 1YF5L 3HSCA 2LXRA 4CCHA 1LWFA 4FJXA 4FJ8A 4B1XB 3THWA 2IDOA 1XNQK 3QEPA 3F9MA 1VQMN 3DLKA 4JHDB 4BDPA 3HOSA 2O8DB 1XNRK 3RMBA 2ITGA 1TUYA 3U3YA 3W3DA 2UU9K 1ASUA 3ALYA 4O0IA 2P9UA 1LWCA 4DR3K 4DTJA 1E3MA 2VWKA 2FC0A 4BRIA 1BHLA 2YNIA 3A8YA 3O9SA 4ISEA 4YOUA 3SK3A 4Q15A 4KREA 4P8EA 4CW7B 5GAEP 1Q82O 3UKUB 4IXCA 2OCEA 1JCFA 1ASVA 1HYVA 2HF4A 1KD1O 3LALA 3AVIA 3OHRA 1FJGK 4JKGA 1LW0A 3ID6A 3ZSRA 2AP1A 3AVFA 1IH7A 1HNZK 4EHUA 4PL7A 1XI1A 1HNWK 2P5OA 3HM9A 1YHQN 1ZC6A 3I8BA 1S72N 1NJ6A 3CMAN 3OYLA 2W6LA 5FPMA 4JD2B 4CFAA 4IO9L 3K9KA 3SPYA 3NH0A 1Z05A 4RW7A 5M1FA 3DRRA 5HBMA 1NOZA 3OYHA 1JCUA 4Y1DA 2V7YA 4B1UB 3QNOA 1U2VA 4B08A 4IFVA 4FBKA 3WNEA 5DM6L 1YVNA 3LDSA 4EZ6A 1EWQA 4OKKA 3U8XA 5IWAK 5HRSA 3MK6A 1GLAG 2CRQA 1RDUA 2EHGA 1JKHA 1CZAN 1HPMA 3ULEB 4I2PA 5J2QA 1SL2A 2QKKA 1BCOA 3CM5A 5AFUH 3ZIGA 3DLBA 1S1WA 2EWSA 3BUZB 3M5RA 3KKRA 3RSEA 2QXFA 1BI4B 3WXKA 2G8WA 4DTOA 1T7PA 4CECA 4XEIA 4M7YA 1MWMA 4HUFA 3PUFA 1WSEA 4QAGA 3THXB 4ILGB 4DSEA 1IBMK 2DFHA 5LMUK 4RW4A 3H6EA 1W9HA 3VQ9A 1OVQA 4RW9A 4ELTA 3L3UA 1NJ8A 1VSFA 4GV9A 4W5RA 4OVLA 4PKIA 2H3GX 2JWLA 2OZMA 3M8PA 1R0AA 1ESVA 1T03A 1TV6A 5CHIA 2OPPA 4EAHD 4FLXA 1N8RO 4EP5A 4ZTFA 5T7BA 2QA4N 2JGUA 2ZQBA 2NRXA 3MCAB 4KH5A 1KTQA 2HBMA 3IFRA 4YDUA 4FSVA 3P83D 1QTMA 4GKJK 4CFCA 4FLZA 2YKNA 3WNHA 3SMSA 3MEDA 3VMFB 5JS1A 1ZXOA 4PQUA 1X3MA 2BKYX 1JL1A 3AVAA 4I6MB 4JK8A 4DG1A 1DCJA 3BGRA 2QWPA 4CZMA 1NK9A 4Z4FA 3NAEA 3V9XA 2WTUA 1KAXA 4BC5A 3UKRA 1KFSA 1EXQA 3ZIEA 5LJVA 2GWJA 3H45C 4CHZA 3SUPA 4CEOA 3MIOA 3CFPA 3RMDA 4EFHA 4Q5VA 3TI0A 3AVHA 1N6QA 1RGIA 1BO5O 1QHAA 2Q0UA 1DGKN 1VSDA 4JN4A 3HVRA 1TL3A 5CR4A 4KKOA 4IBNA 4BRGA 4H5WA 2PZSA 2R7YA 4WQ4C 4GMJB 1H1VA 3Q7CA 1WUAA 4HCBA 2X74A 1G58A 1NJIO 2RHKA 2YHYA 4F4KA 3CCQN 4AF1A 3EL2A 3K5NA 1Z25A 5KPTA 1SKRA 4FCYA 2IVPA 4OPKA 4CK2A 3CYMA 3HTVA 3OY9A 1XMOK 1NKCA 3ZSYA 2WBNA 4OGEA 4E1BA 4WI1A 1N36K 4JS5A 3HXMA 3OYEA 4YNQA 2GELA 3AA5X 1K4IA 3O6WA 3FE1A 5C2DA 1GLJO 4JRPA 1KSPA 3OBWA 4DR1K 2ZJRL 4LH5A 3PSIA 2HHWA 5EU7A 1KK9A 4FJGA 1MWKA 3CCJN 3OYAA 3TTDA 3VF2A 1D8YA 3O8MA 3N4QA 4LSNA 4CIEA 4JI3K 1GLEG 3AVBA 3OA9A 2E6MA 1D9DA 1JCEA 4NLBA 1S1VA 3V4IA 1NJ1A 3CQXA 3VENA 4N56A 1RBVA 2P9LB 4H5NA 3PSFA 1Y97A 4CEBA 4DU3A 3CFOA 3TWHA 4FJNA 2NUBA 5BRDA 2ZD1A 1HUXA 3R1XA 2QEXN 4OKEA 4M3YA 4Z4CA 2QWMA 3EEQA 4HUEA 1Y2IA 3F73A 2VWJA 4M3UA 4CBWA 3QBXA 2Q1NA 3E01A 2W41A 2ZE2A 1TL1A 3TTCA 3C7NA 3CM6A 3ITHA 3FFIA 4IWVA 1MDUB 3EE9A 1G99A 2VG5A 1VSHA 4GVEA 4DQQA 2F9TA 2D4WA 3MEEA 5C0YA 3HPOA 2GX9A 3WQUA 2QWQA 5DMRA 4JHDA 4ZTJA 2O8DA 2QWLA 4LF4K 4NYFA 2RE2A 3CC7N 1C1AA 3SAGA 2NRVA 1RT4A 2X6NA 5CZ1A 2E8AA 5AQHA 2UYTA 3TAFA 1QSLA 1JL2A 1QS4A 2E2NA 4KTWA 4TSXA 3FGUA 1C0GA 3UKUA 3OS1A 4H03B 3S3NA 3HBTA 1VSIA 3CQYA 4DFKA 2KTQA 4F3OA 1HKBA 4DLEA 1JDQA 4OPJA 1U4BA 4KFBA 4JV5K 3ENOA 2YHWA 4FJKA 4H0OA 3S41A 2Q2RA 1JLGA 4B1WB 4E7KA 2KKZA 2KW4A 3FLCO 4LY7A 3CETA 1NGCA 4FLWA 3L6QA 1YTUA 3SAFA 4FJ9A 1YTAA 3FZHA 4JD2A 3P4IA 3JSMA 4NCBA 1BUPA 1IBLK 2DFEA 1RDBA 3HZ7A 3TSUA 3NHGA 2IVOA 5KTQA 1H4TA 5C12A 1II7A 4Z4EA 3AVCA 3RMAA 4YKEA 3FZMA 3MX2A 3I55N 3QLHA 3D6RA 1VQON 5FDLA 4NXNK 5BRHA 4GV6A 2NZTA 3CCSN 4XIUA 3VQ5A 4CHQA 2UXCK 4BREA 3ULEA 3CFRA 4GVMA 4WFBL 4O8KA 4J2AA 1JLQA 4P77A 1O1WA 2EQAA 5E26A 3ZSWA 1NMNA 4CF0A 1BI4A 4CJRA 5KRSA 3WNGA 1LWEA 3ULDA 3THXA 3NE6A 1S8EA 4K0KK 4AH9A 1IKWA 3ZIHA 3SZ2A 3AVKA 3O3FA 3PLAA 3V6DA 1NLVA 2HSTA 2ASOA 2OTLN 4FLVA 5C25A 3QDKA 4FVMA 1NFHA 4A62A 1X9JA 3HPHA 1XC3A 4JI0K 4H0XB 4ZHRA 1P8ZA 1L3TA 1NGIA 4DQIA 1IEZA 4B9UA 4IG0A 2VGMA 1U45A 2WUSA 5FPDA 4DR7K 4M41A 2YJFA 3ZT1A 4LF5K 4ISGA 3A0IX 3WQTA 3DLHA 3ZSQA 1RDDA 4B8AB 1S1TA 4FK2A 3AA4A 1VQKN 1RBSA 3E9LA 3C6UA 2O8BB 4CVNE 2LN3A 4R79A 4PHTX 1BIUA 1T05A 3MN5A 4M3XA 1SV5A 1HQUA 2IC3A 3CC4N 4MDBA 3S3MA 4I6MA 5IT9O 1YUWA 5KPZA 1KRPA 1U6ZA 4OX9K 4LF7K 3EO3A 3K5MA 3VA3A 2VCPA 5EOYA 1K4OA 2WC9A 5I42A 4DLGA 4JS4A 2O4IA 1HQEA 4NCXA 5KQ8A 1ZBHA 1NK5A 1SS6A 4H5VA 4BY9C 2HHVA 3BF3A 5AFUA 1B92A 1KLNA 4C8NA 2CGKA 1ILYA 1HC7A 2F4VK 4JEPA 2QTDA 1NGGA 1JXEA 4E19A 1LAVA 3FZKA 2NLXA 4H0YB 1NWKA 4JI8K 2Z7CA 2QWOA 3DLRA 3HSTB 2UUAK 3VEOA 4FJIA 1NBWA 1WLJA 1DTTA 2QXLA 4GNIA 4NB4A 3GE1A 3CJCA 3HT3A 2HBJA 5KGWA 4NCGA 5GIPA 3SV3A 2OTJN 1VSJA 4LFAK 4X62K 4A5AA 3R8EA 1SQKA 3R6MA 2IVNA 2OZSA 3IAYA 5ADXA 1WAJA 3TSPA 5FROA 4DSIA 4MDAA 2E88A 3WBMA 1YXQA 1JLCA 2XRIA 4CZIA 1HKCA 3OS0A 3HPGA 4RW8A 4OPHA 3ZLJA 3CCLN 4CJ3A 1QVFM 3JXUA 1Y9XA 4I2QA 4PY5A 1S5JA 4UQGA 3O4QA 3ENHA 3RVCA 4P6DA 1X9SA 4KI4A 4A2AA 3HM8A 5KPRA 4JI7K 4E89A 3TAGA 2GV9A 5LL6Z 3L8BA 5KGXA 4IO8A 3QIOA 3THYB 1QZ5A 1HYSA 1WB9A 1WNSA 1S6PA 1UWBA 2P9LA 4CGFA 2ZM6K 3CF5L 3LPTA 1FKPA 3C6AA 4FWKA 1NNEA 3G6EN 4MQ3A 2E20A 2OPSA 2V7ZA 2DFFA 1VRUA 4DV2K 5C10A 1D4XA 4CJUA 3GBTA 2BDPA 3AV9A 1TAQA 3V9UA 3NVMA 3H3NO 2BUPA 5AQNA 1F21A 4I9QA 2Q97A 1K8KB 3A5LC 4CGGA 1W0HA 1RTDA 3BP8A 4CESA 5GAHP 1HKGA 4C23A 1LOTB 4CGHA 2HNZA 2VQEK 4H0PA 3DSDA 4FWMA 4IFEA 3FFKB 3LVJC 3AGKA 1W97L 2P9KB 3AARA 1TYQB 4CJWA 2BANA 4G1QA 3H1QA 3TU5A 3QFUA 1XC9A 4CEZA 2PFUA 3NF9A 4MO5A 3NF6A 3F9KA 3C94A 3PIOL 2QWRA 2IGIA 3P5JA 4E7LA 3KK7A 2H9UA 3PIPL 4EP4A 2A2YA 3NGYA 2ZGZA 1OKJA 1Q86O 2IOCA 3PX0A 4DV5K 1Q9YA 3NF8A 1G15A 3HP9A 2QK9A 3OTOK 1LW2A 1BGXT 1BA0A 4W5QA 3VTIA 1RQ8A 3VQQA 3K0SA 4NYNA 2AA4A 4N5SA 1QQCA 2G8HA 4CJEA 3T1YK 3AJEA 1WAFA 4HD0A 4CEAA 3DAWA 5AQKA 1NK7A 1SNNA 2RKIA 4BRHA 3DRSA 1NU0A 1L3SA 3K5LA 2D0CA 4DUZK 2D0OA 1X9WA 4B9SA 3KVGA 4O8UA 3TAQA 3SMPA 4CJPA 5DM7L 1NK0A 2BTFA 4FWOA 1GOBA 2YJEA 3O9RA 4IEIA 5AQWA 4KTQA 4FZXC 2OPRA 1VQ6N 1WSJA 1QZ6A 1DLOA 3B6OA 3VEXA 3SPZA 1W2BM 2D0BA 1K4PA 2FSJA 1SL1A 3J7AP 2IFEA 3PO5A 5E84A 4LSLA 1M90O 1HJRA 4K41A 2YHAA 2M71A 3P38A 5M1OA 4N47A 4N76A 4CGIA 3HJFA 5CZ2A 3L2WA 2QKBA 5MLCQ 4L3QA 3QBWA 3RR7A 4FXDA 3AO1A 3J8AA 3QINA 3Q7BA 3SLCA 1XWLA 1XHZA 4CEEA 2G8IA 4CJKA 3SQ1A 1WSFA 2P9PB 1GLLO 4FLTA 2OANA 4AHRA 3OYBA 4DHYA 3VTHA 3MN6A 2I5JA 3CJBA 1SL0A 5AZJB 4CF9A 3B6PA 5F0XA 4U67L 1U48A 2CGLA 1RT5A 1HRHA 1A5WA 3DYAA 3NH1A 3LANA 4JKFA 1NKEA 3LDNA 3ZSOA 4LF9K 4JK9A 4CFDA 1C0MA 4M42A 2F8TA 4M3WA 4WCEL 1ASWA 4DU4A 3HI0A 2F7TA 1RNHA 2O8BA 1IJJA 1RDCA 1NM1A 4PA1A 1YITN 3VESA 1N5YA 2KZZA 3A5NC 3GL1A 2P9IB 5AQGA 1VQNN 3LDOA 4P8JA 1S22A 3MAQA 4YOWA 3OVNA 3VEWA 1N34K 3L3VA 2Z1HA 3NFAA 3EN9A 2Q0RA 1RT2A 1K6YA 3QIPA 1ATNA 1NJWA 4O44A 5AZIB 4BC3A 1RT6A 4FLUA 3LWLA 5AQLA 1GLBG 1U49A 1RBUA 4WF9L 4WQ5C 3DXMB 4NCAA 4CJTA 1UAXA 4WFNL 1QE1A 2ZGYA 4H5RA 3AAQA 4FFJA 4CHYA 2PBDA 4E3SA 4LC9B 4F9OA 1KQSM 3I0SA 1TIGA 2Y1BA 1OH7A 3KK1A 3QERA 3U9ZA 4BRPA 2XHBA 3G4SN 3VGMA 2HMPA 3AAPA 1G57A 3V1QA 3KLFA 4FPBA 3OYIA 1WN7A 4WE1A 1N33K 1SKWA 1EP4A 2W6KA 4JKBA 2XO7A 3M1FA 1VSEA 5KQDA 3OJUA 4CD3A 4DQ8A 5CE3A 1GOCA 4B9NA 2E1YA 3MMVA 4AHTA 4JI5K 1D5AA 2HBKA 2VG6A 3LDQA 5E41A 4C8LA 1NJ2A 3O1WA 3O9TA 1EWRA 3QO9A 4PUOA 1Q81O 1BOTO 5AJ3K 5JVGL 1MU2A 2AJQA 3F5TA 1TUUA 3O80A 2G8VA 2HW3A 4CBXA 2Q31A 4W5NA 1NK4A 5FLXO 2RF2A 3D0PA 4RTFD 1VQ4N 3ZT2A 3MXJA 3ZYYX 3THYA 3I8DA 1L3UA 3MGZA 3RRHA 3GDQA 3CI5A 5BN9A 3LL3A 3ZSVA 4IJAA 3OYKA 3VA0A 1NGEA 2O8FB 3V1RA 4X64K 5BREA 3CCEN 4DMNA 3IABB 1SKSA 5HRNA 1IO2A 2BH1A 3SYZA 3L2QA 3SUQA 3E9PA 1S9EA 3JAMO 4KB1A 1JE3A 1S9GA 1K8KA 1QQMA 1C0UA 4RW6A 3CMEN 3HK2A 1J6ZA 3BY5A 3KD5E 2HB5A 3DOLA 2E2OA 2P9KA 5EVZA 1TYQA 4DKWA 2NRHA 4A5BA 1WBDA 2O8CB 1JLEA 3MCPA 3VQPA 3A5MC 2P51A 5C42A 1YJWN 4BRAA 3DLGA 3VGLA 2VWBA 5BPMA 4PKHA 4K25A 1VM0A 4HVCA 1I94K 4F3TA 3L0QA 1YI2N 3AA2A 1TK8A 2ASMA 4FW2A 3CPWM 4KI6A 1KVCA 1RILA 3QFPA 4KTZA 1VSKA 5KI6A 2HF3A 4AHSA 3DI6A 3DOKA 4OKJA 4BR2A 2HHQA 4CF2A 3QKBA 3HZ6A 4U7BA 3V9SA 1OH5A 4R5PA 1TKUA 3CJAA 1Q18A 1Z26A 2HBLA 2JLEA 2PYJA 1B9DA 4F8RA 4W5OA 1S1UA 1T8EA 5AR0A 3LDPA 1EETA 5F2RA 3AO2A 4JI4K 2RIUA 3GOIA 1BCMA 4M63C 5J1EA 4JI6K 3QICA 3ZETB 5F1XA 3ENBA 1RDWX 1XQSC 1HNIA 3OYNA 5CYQA 3VERA 1IKYA 4I14A 1U47A 1H4QA 4PWDA 4KV8A 1VHXA 1JLFA 1WSGA 3MEGA 3LP1A 3K9JA 2P5GA 4QOZB 3CCRN 3KTQA 2LSNA 5AQFA 4YOYA 2MX1A 3SUOA 1PVWA 4FJMA 3OYJA 4PL8A 4CK1A 4HUGA 2QWNA 3B8AX 4W5TA 1NJYA 4H0VB 4ILHA 3SQ4A 4C1NK 2XY7A 1EX4A 4YHHK 3K57A 1HJOA 4CJVA 3WXMB 5M1KA 2ZF5O 4V19S 1ZBSA 1HNXK 3TAPA 2RISA 4E0DA 2GUIA 3R9PA 3SJJA 1YT3A 3O4NA 3ZX0A 3RMCA 1NJZA 2FLOA 3KJVA 3W0LA 3VQDA 4CGJA 2P9PA 4DR6K 4RCHA 1NGAA 3VEZA 4GY2B 3F2KA 3MECA 4CJ7A 5FRNA 4BQZA 2IAJA 5AZJA 4JI2K 5AQUA 4NO7A 4NZRM 5SWMA 3O08A 1X3NA 4M3ZA 1PVYA 2XY5A
chains in the Genus database with same CATH topology
1WOQA 2YX6A 2ASPA 1V4TA 3C6AA 4FWKA 1G57A 3D2FB 3G6EN 1E4FT 3H6EA 2E20A 2V7ZA 5M1PA 5BRFA 5C10A 1D4XA 1XUPO 4MLEA 3GBTA 5AQIA 3CPEA 3NVMA 3WEEA 3H3NO 2BUPA 5AQNA 2WFBA 1K9MO 4GV9A 2Q97A 1K8KB 3A5LC 4RWTA 3ZEUB 3GG4A 4PKIA 2H3GX 4FWLA 2JWLA 3BP8A 5GAHP 1HKGA 2A3ZA 1LOTB 4C23A 5C15A 2P9IA 1K4LA 3NVKA 2P9BA 1ESVA 3ID8A 5HL7L 2W40A 3DXKA 4H0PA 4QS9A 4BR4A 5CHIA 4EAHD 1N8RO 4BGBA 4FWMA 4IFEA 2I7NA 4EO0A 3FFKB 3VGKA 4Z94A 3J7ZO 3AGKA 1W97L 2P9KB 3FZFA 4FPAA 2CGJA 1TYQB 3AARA 4E1JA 2QA4N 4HWIA 2NRXA 3MCAB 3H1QA 4FBWA 5AQYA 4IEEA 4KH5A 3TU5A 1KC8O 5AZIA 3QFUA 2HBMA 3IFRA 4YDUA 4FSVA 5BPNA 5AQQA 2A41A 2PFUA 3VOVA 1VQPN 4MO5A 5AQVA 3E66A 3DXMA 3PIOL 2QWRA 3SMSA 3LDLA 3KK7A 3VMFB 2KHOA 3PIPL 1PVYA 5JLFA 1ZXOA 2ZGZA 3EKUA 1OKJA 1X3MA 4IJNA 1QQNA 1Q86O 1E4GT 3N4PA 4G9ZA 4B1VA 4BVOA 5JVHL 2FSKA 3LM9A 4I6MB 4QS7A 4JK8A 4HVZA 2E2QA 2QWPA 4CZMA 1BA0A 1KAXA 4BC5A 3VTIA 3UKRA 4KBOA 3CERA 1GLFO 1K73O 5FPEA 3ZIEA 5LJVA 4IDHA 3WXJA 5LY3A 2AA4A 2GWJA 2QI2A 3H45C 2VYPA 3AJEA 3MIOA 2P9UB 2NRWA 4BR5A 4CZKA 5I9EB 3T69A 3DAWA 5AQKA 4EFHA 1SNNA 5AQXA 4A59A 4BRHA 1RGIA 1BO5O 1QHAA 1T3VA 3MDQA 3DWLA 4BRNA 4GV3A 2Q0UA 1DGKN 4JN4A 3VF6A 4BC2A 5CR4A 4BRFA 3P31A 2D0OA 3H1VX 1Z6RA 2NNWA 4K43A 3OBYA 3ATUA 3MWPA 4BRGA 4FWSA 4HTLA 3KVGA 4O8UA 4H5WA 5EX5A 4BG9A 3L7VA 4JKGB 2F9WA 3SMPA 5DM7L 4WQ4C 2BTFA 4FWOA 2YJEA 3O9RA 3CD6N 4IEIA 3C65A 5AQSA 5AQWA 1H1VA 1KXPA 1WUAA 3D2EA 3Q7CA 4A2BA 1G58A 1NJIO 2RHKA 4JKAA 4MLHA 2YHYA 1VQ6N 2NRRA 3CCQN 4IOAL 1QZ6A 3O1BA 3VPZA 3VEXA 1NGHA 2YCHA 3EL2A 4AF1A 1W2BM 5KPTA 5TKYA 2IVPA 2FSJA 1K49A 1K4PA 5E84A 1SAZA 3HTVA 1M90O 3WXIA 4K41A 1GLCG 2WBNA 1DKGD 5BN8A 4E1BA 3P38A 5M1OA 1YJ9N 4A57A 1T6DA 2GELA 2Q36A 5FPNA 4KH6A 4CZJA 1K4IA 3O6WA 3FE1A 5C2DA 5LJWA 1GLJO 4J8FA 3OBWA 4JK7A 3AGRA 5MLCQ 1YJNN 1U2VB 2ZJRL 4L3QA 3QBWA 5AQTA 1KK9A 3MX5A 1GLDG 3IKMA 1MWKA 3J8AA 3CCJN 4FOEA 3TTDA 3Q7BA 3VF2A 3O8MA 3SLCA 3N4QA 1K7JA 1GLEG 3FR0A 3OA9A 2FSNA 1JCEA 2P9PB 4NLBA 4CZGA 1GLLO 2OANA 3JS6A 3VEVA 4DHYA 3VTHA 2E2PA 1R59O 1LCUA 3MN6A 3TTFA 3CJBA 5AZJB 3CQXA 3L4IA 5F0XA 4YOTA 3VENA 1JJ2M 3RSEB 5AQJA 2P9LB 4U67L 1XEZA 1Y64A 4H5NA 1NGBA 4BRDA 4DCHA 2CGLA 1VQ5N 4IZ9A 5H1SQ 5GAGP 3MN9A 5BRDA 4OO1J 2V52B 4JKFA 1HUXA 3R1XA 3D7EO 2QEXN 1BA1A 3LDNA 1BG3A 1VAZA 2QWMA 3IDHA 4JK9A 3LS6A 4WCEL 1NMDA 3SBTA 1HLUA 4BR9A 4CBWA 3QBXA 4FBQA 4EHTA 4WFAL 2Q1NA 3HI0A 3WEEB 3TSQA 5JMVA 4YOVA 2ITMA 2F7TA 1IJJA 2W41A 1NM1A 3C7NA 3TTCA 3VESA 1YITN 4IWVA 3A5NC 4B1YB 3GL1A 1MDUB 4M7XA 2P9IB 3EE9A 5AQGA 5EXWA 1G99A 3LDOA 1VQNN 3CC2N 3U9DA 3DXKB 1S22A 4P8JA 3O4WA 4YOWA 4GVEA 3VEWA 2F9TA 3KHYA 5AQZA 2D4WA 4FWNA 3EN9A 3BF1A 5C0YA 2Q0RA 2GX9A 3WQUA 2NRTA 4JKCA 2FF6A 2QWQA 4CBUA 4JHDA 2QWLA 5BR9A 1S3XA 1ATNA 5EY4A 5AZIB 3EE8A 4BC3A 2RE2A 3H3OB 4JNEA 5AQLA 1GLBG 3ATVA 3SJHA 3KZBA 4BGAA 1M1KO 3CC7N 4PKGA 1EQYA 2NRVA 3SAGA 4WF9L 4WQ5C 1VQ8N 3DXMB 3H46O 2E8AA 1DEJA 5AQHA 2UYTA 3WUHA 4P6CA 4WFNL 4FFJA 2ZGYA 4H5RA 3AAQA 2CH6A 1T44A 1KAZA 1T6CA 4CZLA 2PBDA 3KWIA 2QW9A 4FWPA 3CJ7A 2E2NA 4K42A 4LC9B 1SZ2A 1EO1A 1MA9B 5AQMA 1ATRA 3FGUA 4F9OA 1C0GA 1KQSM 3UKUA 5HOOA 1VQLN 5JLHA 4H03B 4AM7A 1IG8A 3HBTA 3ZETA 3T1IA 3ZX2A 3CQYA 2PAVA 3HRGA 4IOXA 4BR7A 2YHXA 1HKBA 4FCXA 3C0BA 3U9ZA 4BRPA 3G4SN 3VGMA 2HMPA 2A42A 3AAPA 3ENOA 3G25A 2YHWA 3UKRB 4H0OA 3WT0A 2FF3B 3IMXA 4FPBA 3CJ1A 2A40A 3S41A 2Q2RA 2GTDA 5AQOA 4BRKA 3M6GA 4JKDA 4B1WB 3LM2A 3C6HA 4IOCL 2KKZA 3FLCO 4JKBA 4CZFA 3CETA 4O5FA 3M1FA 1Q7YO 4P6PA 5KQDA 1NGCA 4CD3A 4DQ8A 5CE3A 2HOEA 3L6QA 2P9SA 4FWRA 5TKWA 3SAFA 2E1YA 3FZHA 4JD2A 2V51B 3P39A 3P4IA 3MMVA 4BRMA 1BUPA 3KWGA 2P9NA 1K8AO 4ISFA 2HBKA 3TSUA 2IVOA 2ZJPL 1NGDA 2QM1A 3LDQA 3CCUN 5C12A 3O9QA 3U4LA 4AM6A 3O1WA 3O9TA 4CI6A 1BU6O 3MN7A 4XH1A 1Q81O 1BOTO 3QMLA 4BC4A 4YKEA 3FZMA 3MX2A 3I55N 5JVGL 3H07A 3D6RA 1VQON 1VQ7N 2NRZA 1RFQA 5GINA 1BWFO 1P90A 3D2EB 2VGNA 5BRHA 4GV6A 2NZTA 2YI1A 3F5TA 3CCSN 1TUUA 1YIJN 3O80A 2GUPA 3UB5A 4Y0WA 3R3LA 1BDGA 4BREA 2Q31A 4WQ5A 3ULEA 4BG8A 4CBXA 4DB3A 4FO0A 5C2FA 4WFBL 4O8KA 3VEYA 4RTFD 4P77A 1VQ4N 3ZYYX 2EQAA 3EZWA 5E26A 4FVUA 1NGFA 4WYBA 5AQRA 4CZHA 3WXLA 4BRCA 5M1NA 3M3ZA 3MGZA 3GDQA 3CI5A 5BN9A 3LL3A 4IJAA 4CD1A 3OW2M 1NGEA 4JKEA 3D2FA 3ZIHA 5BREA 3CCEN 4XH5A 3PLAA 3ZIIA 2D1KA 1NLVA 2HSTA 3TPQA 3DLLL 2ASOA 2BH1A 2OTLN 2FXUA 3E9PA 3QDKA 4BVPA 1K8KA 4A62A 1QQMA 4WQ4A 3ZEUA 1ATSA 1X9JA 3EKSA 3CMEN 1XC3A 3L4QA 3VETA 4H0XB 3O5BA 1J6ZA 1P8ZA 2ZWHA 1VQ9N 1NGIA 4B1ZA 4BRQA 4NLCA 4FL9A 4CZEA 1IEZA 2A5XA 2VGMA 2E2OA 5JICA 2P9KA 5EVZA 1TYQA 2WUSA 3A5OC 4DKWA 2NRHA 4A5BA 2YJFA 5FPDA 5GADP 4YOXA 4KH4A 3MCPA 4ISGA 3ZX3A 3CCMN 3LRJA 3A5MC 3A0IX 3SBGA 1NGJA 1YJWN 2A6AA 4BRAA 2GWKA 3WQTA 4C1NI 5B8HA 3VGLA 2VWBA 4H5TA 4BROA 5ADXH 5BPMA 1QVGM 3MK5A 4PKHA 4JKHA 1V4SA 2IIRA 4JAXA 3AY9A 1VQKN 4K25A 3SAHA 3E9LA 1O13A 4BR0A 3C7NB 2LN3A 4R79A 3FZLA 4PHTX 4H0TB 1JCGA 3IUCA 4XH4A 3L0QA 3MN5A 1YAGA 4BQLA 1YI2N 1YF5L 3HSCA 2ZJQL 2ASMA 3CPWM 3CC4N 3CHWA 4MDBA 4OPAA 3QFPA 4I6MA 5ELZA 1YUWA 3QB0A 5KPZA 1U6ZA 4FOIA 4QS8A 5M1QA 3EO3A 4B1XB 5BPLA 2HF3A 4BRLA 4NZTM 3F9MA 2VCPA 5EOYA 4BR2A 4XEIA 1VQMN 5AQPA 2WC9A 1K4OA 4JHDB 3HOSA 3MWTA 3HZ6A 5KQ8A 1SS6A 4U7BA 1HX1A 1TUYA 4H5VA 4BY9C 3W3DA 1TKUA 3LQUA 3CJAA 3BF3A 3VF4A 5AFUA 1Q18A 2HBLA 2P9UA 3P04A 1OVYA 2CGKA 3I33A 1ILYA 2GEMA 3NMUA 4JEPA 2QTDA 1NGGA 3CIPA 4BRIA 3G71N 4ISEA 3A8YA 3O9SA 3SK3A 4YOUA 1DT9A 3FZKA 2NLXA 2JWKA 1NWKA 4H0YB 4A61A 5GAEP 4P8EA 5AR0A 3LDPA 1Q82O 3UKUB 5F2RA 1TKSA 2CH5A 2QWOA 3GOIA 2RIUA 4IXCA 3VEOA 4M63C 1JCFA 1KD1O 2HF4A 3QICA 3ZETB 5F1XA 3ENBA 1RDWX 3OHRA 1XQSC 1NBWA 4JKGA 3ID6A 2AP1A 3E1YA 3VERA 4GNIA 2QXLA 4NB4A 3GE1A 4EHUA 4I14A 3CCVN 3CJCA 4PL7A 2HBJA 3UE5A 5GIPA 1YHQN 1ZC6A 3I8BA 4UY8O 2OTJN 1S72N 3K9JA 3CMAN 4A5AA 3R8EA 3CCRN 1SQKA 4YOYA 5AQFA 2MX1A 3R6MA 4EIAA 4MO4A 2IVNA 5FPMA 2P9SB 1PVWA 4JD2B 4PL8A 5ADXA 4ILJA 1QQOA 4IO9L 3K9KA 3TSPA 2QWNA 3B8AX 3O9UA 3T7ZA 4H0VB 2E1ZA 4MDAA 4ILHA 2P9NB 1KAYA 2E88A 2KLAA 1Z05A 1YXQA 5M1FA 4CZIA 1HKCA 4C1NK 3BEXA 4FWQA 4OPHA 1JCUA 1HJOA 3CCLN 3WXMB 1QVFM 5GIOA 2V7YA 3CJ9A 3JXUA 4B1UB 2I7PA 2ZF5O 3DJCA 5M1KA 1U2VA 1ZBSA 2RISA 2J4RA 4FBKA 3E9OA 4YDUC 1YVNA 3R9PA 5DM6L 3ZX0A 1C0FA 3HOTA 3U8XA 2FLOA 4B9QA 3MK6A 1GLAG 3ENHA 1RDUA 3RVCA 3W0LA 4P6DA 1CZAN 1HPMA 2DPNA 3ULEB 4A2AA 3HM8A 5KPRA 2P9PA 4RCHA 1NGAA 3VEZA 5AFUH 4GY2B 3F2KA 4CJ7A 1HRUA 3ZIGA 4IO8A 4BQZA 5AZJA 1QZ5A 2D0PA 3I56N 3CXCM 2EWSA 3M5RA 3BUZB 4NO7A 5AQUA 3RSEA 4NZRM 2P9LA 3O08A 4YORA 1X3NA 3WXKA 4M7YA 1MWMA 3CF5L 4ILGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEZ A;  3VET A;  3VTH A;  3VF2 A;  3TTC A;  3TTF A;  3VES A;  3VEX A;  3VTI A;  3VEN A;  3TSU A;  3TSP A;  3VER A;  3VEW A;  3VF4 A;  3TTD A;  3TSQ A;  3VEO A; 
#chains in the Genus database with same CATH topology
 1WOQ A;  2P1J A;  2YX6 A;  3G0Z A;  4DF4 A;  3CG7 A;  3D2F B;  4CJS A;  4ELU A;  4KO0 A;  5M1P A;  4AHU A;  1XUP O;  4MLE A;  3VQC A;  3KK3 A;  5AQI A;  3NBP A;  2B6A A;  2WFB A;  4DV6 K;  3ZEU B;  3GG4 A;  3O3G A;  4KHW A;  5C15 A;  2P9I A;  4KHN A;  3NVK A;  2P9B A;  4E1M A;  1ITG A;  2W40 A;  4DU1 A;  4BGB A;  4BE2 A;  2DTU A;  4FW1 A;  3VGK A;  2Q3V A;  4DQR A;  4Z94 A;  3J7Z O;  3T3F A;  4FPA A;  1ZYQ A;  3FZF A;  2CGJ A;  4HWI A;  5AQY A;  4FBW A;  4IEE A;  1S1X A;  5AZI A;  5AQQ A;  2A41 A;  3VOV A;  1VQP N;  3MXM A;  2G8F A;  5AQV A;  3E66 A;  3DXM A;  3K5O A;  4CE9 A;  4IG3 A;  2KQ2 A;  2DY4 A;  3IRX A;  5JLF A;  3EKU A;  4IJN A;  3BDP A;  1C1C A;  1FXX A;  4G9Z A;  4BVO A;  5JVH L;  1IKX A;  4QS7 A;  4KHU A;  3QET A;  1J5O A;  4HVZ A;  2E2Q A;  2B5J A;  3QEX A;  4CEF A;  3QEW A;  4B8C A;  1K73 O;  5LY3 A;  4TWA A;  3PY8 A;  3MXI A;  2QI2 A;  3UIQ A;  3LZI A;  1HMV A;  2ETJ A;  2NRW A;  3SV4 A;  3T69 A;  5CYM A;  2PYL A;  4A59 A;  3LZJ A;  5FRM A;  1T3V A;  1VRT A;  1OH6 A;  3DWL A;  4BRN A;  4DTR A;  4JRQ A;  3VF6 A;  4CEQ A;  3H1V X;  3OBY A;  3ATU A;  4FWS A;  4HTL A;  5EX5 A;  2A1R A;  2F9W A;  1S6Q A;  3IG1 A;  3C65 A;  1KXP A;  4DSJ A;  4CJ5 A;  1FKO A;  4JKA A;  4MLH A;  2NRR A;  2YV0 X;  3VPZ A;  3M8S A;  3NF7 A;  3VQE A;  3SNN A;  1KVA A;  4BWM A;  4LFC K;  2IS3 A;  1SAZ A;  3SI6 A;  4FK4 A;  2D5R A;  3V81 A;  5BN8 A;  4DSF A;  3LP0 A;  1YJ9 N;  4CHO A;  1FK9 A;  1T6D A;  4E7J A;  4KH6 A;  2HVI A;  1JO0 A;  4FM2 A;  4K87 A;  1QSS A;  4J8F A;  2O8F A;  4IDK A;  2OPQ A;  1JLA A;  1TKT A;  1CXQ A;  5AQT A;  1GLD G;  3IKM A;  3IAB A;  3TAM A;  4O4G A;  4FOE A;  2FBT A;  1K7J A;  4KPY A;  3JS6 A;  2E2P A;  1KFD A;  1LCU A;  3TTF A;  3O3H A;  4FLY A;  3L4I A;  4YOT A;  1SUQ A;  4YDQ A;  4FM0 A;  1XEZ A;  4BRD A;  1IBK K;  5H1S Q;  3ASM A;  4NXM K;  3MN9 A;  5GAG P;  2HHH K;  2V52 B;  2O8C A;  2KFN A;  4DR2 K;  1BG3 A;  3LS6 A;  3AVN A;  1NMD A;  3SBT A;  3OYG A;  3RTV A;  2L8Y A;  2HHT A;  3C6T A;  4FBQ A;  3I0R A;  4WFA L;  3WEE B;  4YOV A;  2ITM A;  3HYF A;  4DSK A;  1IG9 A;  4CJQ A;  1RTJ A;  1H4S A;  4B1Y B;  1RTH A;  3LAM A;  5EXW A;  4ELV A;  3CC2 N;  3DXK B;  4DS5 A;  1RTI A;  4LF6 K;  3KHY A;  4LFB K;  5AQZ A;  4FWN A;  4E7H A;  3BF1 A;  5J2M A;  4DTN A;  2NRT A;  4JKC A;  3V9Z A;  4CBU A;  3QES A;  4Z4H A;  5EY4 A;  4BE1 A;  3KD1 E;  3H3O B;  3ZSX A;  4BGA A;  1M1K O;  1EKE A;  5KRT A;  4PKG A;  3PV8 A;  1DEJ A;  1KAZ A;  4CZL A;  2QW9 A;  4FWP A;  3CJ7 A;  1SZ2 A;  1EO1 A;  1VQL N;  4AM7 A;  1IG8 A;  1YVU A;  4K88 A;  3IS9 A;  3ZET A;  3T1I A;  2PAV A;  4IOX A;  4BR7 A;  2UXD K;  4FCX A;  4Z9E A;  3AVM A;  2FF3 B;  3IMX A;  2A40 A;  4HCC A;  4BRK A;  4JKD A;  1A5X A;  3TAB A;  3C6H A;  3P1G A;  4IOC L;  4CZF A;  3U6Y A;  2E4L A;  3T1A A;  4P6P A;  3DM2 A;  2O8E B;  4AHV A;  1TVR A;  4FWR A;  5TKW A;  2V51 B;  3P39 A;  2PY5 A;  2X6S A;  3K59 A;  3KWG A;  1K8A O;  4FZZ A;  2FBY A;  2XY6 A;  1U04 A;  2ZJP L;  2EH1 A;  1UA0 A;  2QM1 A;  3CCU N;  4CI6 A;  1BU6 O;  3QML A;  5JS2 A;  3U6F A;  3SUN A;  2Z1J A;  2FBV A;  4B3S K;  1BWF O;  1P90 A;  3D2E B;  4ID5 A;  2GUP A;  2G8U A;  3UB5 A;  1J53 A;  4Y0W A;  3R3L A;  1BDG A;  4WQ5 A;  5C2F A;  1BIS A;  1XHX A;  4KHS A;  3L2R A;  4KB0 A;  4Y1C A;  2Y1I A;  3TAR A;  2B4J A;  3EZW A;  3NGZ A;  1HR0 K;  4FVU A;  4WYB A;  2A1S A;  4CZH A;  3THV A;  4BRC A;  4B9T A;  3M3Z A;  4CF8 A;  4DV3 K;  4CD1 A;  3CQ8 A;  4F2R A;  3OW2 M;  1NOY A;  4KHQ A;  4DR4 K;  3IAL A;  4DWI A;  3D2F A;  1WSH A;  3KLI A;  3VQ7 A;  4E7I A;  3ZII A;  2D1K A;  4CHP A;  3TPQ A;  2FXU A;  3VQ4 A;  3EZ5 A;  1ZBF A;  3D45 A;  4WQ4 A;  3ZEU A;  1VK0 A;  2GTC A;  3L4Q A;  3KKS A;  4LF8 K;  1VQ9 N;  4BRQ A;  1J9A A;  4IFY A;  1NJX A;  3NDK A;  1KVB A;  2GBZ A;  3A5O C;  4YOX A;  4KH4 A;  3ZX3 A;  3CCM N;  2XY8 A;  1HNV A;  2BE2 A;  1ZBI A;  1NGJ A;  4C1N I;  2E6L A;  4BRO A;  5ADX H;  1QVG M;  2RPI A;  3RRG A;  2HHX A;  4KHY A;  3SAH A;  1O13 A;  4BR0 A;  5LMN K;  4H0T B;  4K8X A;  4XH4 A;  1H0X A;  1LN4 A;  1YAG A;  4BQL A;  2ZJQ L;  3CHW A;  4OPA A;  5ELZ A;  3M8R A;  3QB0 A;  4FOI A;  4O55 A;  4QS8 A;  4GW6 A;  5M1Q A;  2YHB A;  5BPL A;  3HVT A;  4BRL A;  4NZT M;  4J2B A;  1I39 A;  4B3R K;  1NFJ A;  4B3T K;  4HTU A;  1VR4 A;  5AQP A;  4C8K A;  4KHP K;  3MWT A;  4CIF A;  1NJ5 A;  3ISN C;  3PX6 A;  1HX1 A;  3OYC A;  3A2F A;  3SCX A;  1UDV A;  2KFZ A;  3LQU A;  4I9L A;  3VF4 A;  3P04 A;  1X1P A;  1OVY A;  1RDA A;  3I33 A;  4CF1 A;  4DV1 K;  3TAE A;  2GEM A;  3NMU A;  1WSI A;  3CIP A;  1CLQ A;  3G71 N;  1DT9 A;  2JWK A;  4A61 A;  2O4G A;  2HVH A;  3G10 A;  5CY4 A;  2CH5 A;  3PO4 A;  4M45 A;  1TKS A;  3KLG A;  1TAU A;  1IKV A;  3E1Y A;  3OYF A;  4AQY K;  3CCV N;  1A5V A;  4N41 A;  3UE5 A;  4UY8 O;  3LVK B;  4CHN A;  4AHC A;  1TKZ A;  4EIA A;  4MO4 A;  2P9S B;  2HHU A;  4ILJ A;  1QQO A;  3O9U A;  2WON A;  3T7Z A;  2E1Z A;  4BDZ A;  2P9N B;  1KAY A;  2KLA A;  4OLB A;  1QHT A;  1H0Y A;  3BEX A;  2UUC K;  4CFB A;  4O0J A;  4FWQ A;  1L3V A;  3OYD A;  5GIO A;  3CJ9 A;  4ICL A;  1WBB A;  2I7P A;  3DJC A;  1OH8 A;  4DV0 K;  4KAZ A;  2J4R A;  4C8M A;  3E9O A;  4YDU C;  1BQM A;  4K86 A;  3J81 O;  1C0F A;  3HOT A;  3AVJ A;  4IKF A;  4B9Q A;  2UXB K;  3SQ0 A;  2DPN A;  3JYT A;  4FM1 A;  3RWU A;  1HYZ A;  1HRU A;  3VQA A;  2D0P A;  3I56 N;  3C95 A;  3CXC M;  2D0A A;  5J2P A;  4C8O A;  4DS4 A;  4YOR A;  3VQ6 A;  4JI1 K;  2G8K A;  4B9L A;  1NK6 A;  4DFJ A;  3V9W A;  3T19 A;  2ASP A;  1V4T A;  3BZC A;  1IV0 A;  1C6V A;  1E4F T;  4Z0U A;  4HHT A;  5BRF A;  4M3R A;  4B9V A;  3CPE A;  1X9M A;  4FJL A;  1KLM A;  3WEE A;  3ZSZ A;  2OYQ A;  1K9M O;  5DK5 A;  4DV4 K;  4RWT A;  4FWL A;  4Z4I A;  2A3Z A;  5D3G A;  1K4L A;  5K14 A;  1NH9 A;  3ID8 A;  5HL7 L;  3DXK A;  4QS9 A;  3NH2 A;  4DFM A;  2E5L K;  4BR4 A;  1TKD A;  3ZT3 A;  3VN5 A;  2I7N A;  4EO0 A;  4E1J A;  3LAK A;  1GOA A;  1KC8 O;  3KIO A;  5BPN A;  1RBT A;  2HMI A;  2Z1G A;  4X65 K;  3LDL A;  2KHO A;  4JLH A;  4FK0 A;  4DR5 K;  1QQN A;  1E4G T;  3N4P A;  4B1V A;  4BDY A;  4OLF A;  2FSK A;  3LM9 A;  3ZCM A;  3J80 O;  1QSY A;  1C0T A;  3THW B;  4JYA K;  4BAC A;  4KBO A;  3CER A;  1GLF O;  5FPE A;  4O5B A;  4IDH A;  3WXJ A;  1NG9 A;  3ZT0 A;  3QNN A;  3WNF A;  2HNY A;  2VYP A;  2P9U B;  2O8E A;  1BQN A;  4BR5 A;  4CZK A;  1RBR A;  5I9E B;  1BIZ A;  4DTX A;  5AQX A;  4FJ5 A;  3MDQ A;  1Q8I A;  1TKX A;  2FBX A;  4DTU A;  1TK0 A;  4GV3 A;  4BC2 A;  4BRF A;  3P31 A;  3KLE A;  5HRO A;  1Z6R A;  2NNW A;  3HL8 A;  4K43 A;  3BZK A;  4K8Z A;  3MWP A;  3TR8 A;  4BG9 A;  3L7V A;  2W42 A;  4JKG B;  1CZB A;  3EY1 A;  2EX3 A;  2YNG A;  3AO4 A;  5I3U A;  4DTS A;  3CD6 N;  4DTM A;  5AQS A;  4YY3 K;  3KLH A;  3D2E A;  4A2B A;  3DMJ A;  4IOA L;  3LPU A;  3O1B A;  1NGH A;  1RT1 A;  2YCH A;  1FW6 A;  5TKY A;  3EYZ A;  1N32 K;  1K49 A;  5HLF A;  3PX4 A;  3WXI A;  1GLC G;  1DKG D;  1NK8 A;  3T1H K;  4A57 A;  1UA1 A;  2Q36 A;  2X78 A;  5FPN A;  4CZJ A;  4DSL A;  4M3T A;  5LJW A;  4JK7 A;  3AGR A;  1YJN N;  1U2V B;  3OJS A;  2YNH A;  2WOM A;  3MX5 A;  1NKB A;  3OYM A;  3S9H A;  4I7F A;  3DRP A;  4BWJ A;  4AIL C;  3FR0 A;  2FSN A;  4CZG A;  3K2P A;  4Z4G A;  3VEV A;  3VQB A;  4OJR A;  1R59 O;  4DQS A;  1DTQ A;  1D9F A;  3S3O A;  1RT3 A;  1JJ2 M;  3RSE B;  5AQJ A;  1Y64 A;  4DCH A;  1NGB A;  5J2N A;  3AO5 A;  1J5E K;  4IZ9 A;  1VQ5 N;  4B3O A;  4LH4 A;  4CK3 A;  4OO1 J;  4LD0 A;  3D7E O;  1BA1 A;  3TOE A;  1VAZ A;  3IDH A;  3HP6 A;  3ZT4 A;  4H4O A;  4FYD A;  3AVG A;  1B9F A;  3HO1 A;  1HLU A;  4BR9 A;  4EHT A;  3OS2 A;  5JMV A;  3L2U A;  3TSQ A;  3V1O A;  2EK0 A;  4J2D A;  4M7X A;  1JXB A;  3U9D A;  4QCL A;  3O4W A;  1C1B A;  2KZM A;  3NCI A;  4RG8 A;  3QEV A;  2FF6 A;  5BR9 A;  2VQF K;  1S3X A;  1VSM A;  1ZBL A;  3EE8 A;  4JNE A;  3SJH A;  3ATV A;  4H4M A;  3KZB A;  4GKK K;  5SZT A;  1EQY A;  1REV A;  1VQ8 N;  3H46 O;  3WUH A;  4P6C A;  2RN2 A;  2YKM A;  2CH6 A;  4CIG A;  1T44 A;  1T6C A;  3KWI A;  4MFB A;  5C24 A;  2BGG A;  4OLA A;  4K42 A;  1JLB A;  3K58 A;  1MA9 B;  2VG7 A;  1ATR A;  5AQM A;  5HOO A;  5JLH A;  1W7A A;  5A2Q O;  3ZX2 A;  3HRG A;  1TGO A;  3QEI A;  2YHX A;  3C0B A;  3G25 A;  2A42 A;  3VQ8 A;  3UKR B;  3WT0 A;  3CJ1 A;  2GTD A;  5AQO A;  1TK5 A;  3M6G A;  3TAN A;  3LM2 A;  4O5F A;  2Z1I A;  4DV7 K;  1Q7Y O;  3NGI A;  4J2E A;  3SQ2 A;  2HOE A;  2P9S A;  1UOC A;  4BRM A;  4FJH A;  2YNF A;  2P9N A;  1CXU A;  4ISF A;  4KRF A;  1NGD A;  1KCF A;  4CER A;  3O9Q A;  3U4L A;  4AM6 A;  3MN7 A;  4XH1 A;  4B3M K;  4FJJ A;  1BL3 A;  4BC4 A;  4FZY A;  3H07 A;  4ID1 A;  1VQ7 N;  2NRZ A;  1RFQ A;  4CJL A;  5GIN A;  2VGN A;  2YI1 A;  1YIJ N;  1VSL A;  3LP2 A;  2Q3S A;  4L8R B;  4BG8 A;  4DB3 A;  4FO0 A;  4F2S A;  3VEY A;  3AVL A;  4EZ9 A;  4BE0 A;  1HPZ A;  3KK2 A;  2HHS A;  1NGF A;  2F96 A;  5AQR A;  3WXL A;  5M1N A;  3M8Q A;  4CJ4 A;  3L2V A;  1XMQ K;  3DLE A;  4JKE A;  4FJ7 A;  3J7Y P;  2Y1J A;  4XH5 A;  4DF8 A;  3RR8 A;  3DLL L;  1LAW A;  4HVJ A;  1Q9X A;  5BR8 K;  1RCH A;  3LP3 A;  4BVP A;  4CJF A;  1ATS A;  3EKS A;  4CGD A;  3VET A;  4H8K A;  1LV5 A;  1L5U A;  3O5B A;  5HRR A;  4CED A;  4DUY K;  1J54 A;  2ZWH A;  1PAV A;  4B1Z A;  2UUB K;  4NLC A;  4DFP A;  1RT7 A;  4FL9 A;  4CZE A;  2A5X A;  2F8S A;  5JIC A;  3LWM A;  1ZBU A;  4YFU A;  5GAD P;  5HP1 A;  1I3A A;  4E1N A;  3LRJ A;  1CZ9 A;  4DTP A;  3SBG A;  3H08 A;  2A6A A;  4X66 K;  2GWK A;  2HND A;  3AO3 A;  5B8H A;  2ATQ A;  4H5T A;  4OGC A;  3MK5 A;  4DQP A;  4JKH A;  1V4S A;  2IIR A;  4JAX A;  3AY9 A;  4B9M A;  3U3G A;  3C7N B;  3FZL A;  3DSC A;  5HRP A;  2OA8 A;  1JCG A;  3IUC A;  4Q0B A;  3AA3 A;  1YF5 L;  3HSC A;  2LXR A;  4CCH A;  1LWF A;  4FJX A;  4FJ8 A;  4B1X B;  3THW A;  2IDO A;  1XNQ K;  3QEP A;  3F9M A;  1VQM N;  3DLK A;  4JHD B;  4BDP A;  3HOS A;  2O8D B;  1XNR K;  3RMB A;  2ITG A;  1TUY A;  3U3Y A;  3W3D A;  2UU9 K;  1ASU A;  3ALY A;  4O0I A;  2P9U A;  1LWC A;  4DR3 K;  4DTJ A;  1E3M A;  2VWK A;  2FC0 A;  4BRI A;  1BHL A;  2YNI A;  3A8Y A;  3O9S A;  4ISE A;  4YOU A;  3SK3 A;  4Q15 A;  4KRE A;  4P8E A;  4CW7 B;  5GAE P;  1Q82 O;  3UKU B;  4IXC A;  2OCE A;  1JCF A;  1ASV A;  1HYV A;  2HF4 A;  1KD1 O;  3LAL A;  3AVI A;  3OHR A;  1FJG K;  4JKG A;  1LW0 A;  3ID6 A;  3ZSR A;  2AP1 A;  3AVF A;  1IH7 A;  1HNZ K;  4EHU A;  4PL7 A;  1XI1 A;  1HNW K;  2P5O A;  3HM9 A;  1YHQ N;  1ZC6 A;  3I8B A;  1S72 N;  1NJ6 A;  3CMA N;  3OYL A;  2W6L A;  5FPM A;  4JD2 B;  4CFA A;  4IO9 L;  3K9K A;  3SPY A;  3NH0 A;  1Z05 A;  4RW7 A;  5M1F A;  3DRR A;  5HBM A;  1NOZ A;  3OYH A;  1JCU A;  4Y1D A;  2V7Y A;  4B1U B;  3QNO A;  1U2V A;  4B08 A;  4IFV A;  4FBK A;  3WNE A;  5DM6 L;  1YVN A;  3LDS A;  4EZ6 A;  1EWQ A;  4OKK A;  3U8X A;  5IWA K;  5HRS A;  3MK6 A;  1GLA G;  2CRQ A;  1RDU A;  2EHG A;  1JKH A;  1CZA N;  1HPM A;  3ULE B;  4I2P A;  5J2Q A;  1SL2 A;  2QKK A;  1BCO A;  3CM5 A;  5AFU H;  3ZIG A;  3DLB A;  1S1W A;  2EWS A;  3BUZ B;  3M5R A;  3KKR A;  3RSE A;  2QXF A;  1BI4 B;  3WXK A;  2G8W A;  4DTO A;  1T7P A;  4CEC A;  4XEI A;  4M7Y A;  1MWM A;  4HUF A;  3PUF A;  1WSE A;  4QAG A;  3THX B;  4ILG B;  4DSE A;  1IBM K;  2DFH A;  5LMU K;  4RW4 A;  3H6E A;  1W9H A;  3VQ9 A;  1OVQ A;  4RW9 A;  4ELT A;  3L3U A;  1NJ8 A;  1VSF A;  4GV9 A;  4W5R A;  4OVL A;  4PKI A;  2H3G X;  2JWL A;  2OZM A;  3M8P A;  1R0A A;  1ESV A;  1T03 A;  1TV6 A;  5CHI A;  2OPP A;  4EAH D;  4FLX A;  1N8R O;  4EP5 A;  4ZTF A;  5T7B A;  2QA4 N;  2JGU A;  2ZQB A;  2NRX A;  3MCA B;  4KH5 A;  1KTQ A;  2HBM A;  3IFR A;  4YDU A;  4FSV A;  3P83 D;  1QTM A;  4GKJ K;  4CFC A;  4FLZ A;  2YKN A;  3WNH A;  3SMS A;  3MED A;  3VMF B;  5JS1 A;  1ZXO A;  4PQU A;  1X3M A;  2BKY X;  1JL1 A;  3AVA A;  4I6M B;  4JK8 A;  4DG1 A;  1DCJ A;  3BGR A;  2QWP A;  4CZM A;  1NK9 A;  4Z4F A;  3NAE A;  3V9X A;  2WTU A;  1KAX A;  4BC5 A;  3UKR A;  1KFS A;  1EXQ A;  3ZIE A;  5LJV A;  2GWJ A;  3H45 C;  4CHZ A;  3SUP A;  4CEO A;  3MIO A;  3CFP A;  3RMD A;  4EFH A;  4Q5V A;  3TI0 A;  3AVH A;  1N6Q A;  1RGI A;  1BO5 O;  1QHA A;  2Q0U A;  1DGK N;  1VSD A;  4JN4 A;  3HVR A;  1TL3 A;  5CR4 A;  4KKO A;  4IBN A;  4BRG A;  4H5W A;  2PZS A;  2R7Y A;  4WQ4 C;  4GMJ B;  1H1V A;  3Q7C A;  1WUA A;  4HCB A;  2X74 A;  1G58 A;  1NJI O;  2RHK A;  2YHY A;  4F4K A;  3CCQ N;  4AF1 A;  3EL2 A;  3K5N A;  1Z25 A;  5KPT A;  1SKR A;  4FCY A;  2IVP A;  4OPK A;  4CK2 A;  3CYM A;  3HTV A;  3OY9 A;  1XMO K;  1NKC A;  3ZSY A;  2WBN A;  4OGE A;  4E1B A;  4WI1 A;  1N36 K;  4JS5 A;  3HXM A;  3OYE A;  4YNQ A;  2GEL A;  3AA5 X;  1K4I A;  3O6W A;  3FE1 A;  5C2D A;  1GLJ O;  4JRP A;  1KSP A;  3OBW A;  4DR1 K;  2ZJR L;  4LH5 A;  3PSI A;  2HHW A;  5EU7 A;  1KK9 A;  4FJG A;  1MWK A;  3CCJ N;  3OYA A;  3TTD A;  3VF2 A;  1D8Y A;  3O8M A;  3N4Q A;  4LSN A;  4CIE A;  4JI3 K;  1GLE G;  3AVB A;  3OA9 A;  2E6M A;  1D9D A;  1JCE A;  4NLB A;  1S1V A;  3V4I A;  1NJ1 A;  3CQX A;  3VEN A;  4N56 A;  1RBV A;  2P9L B;  4H5N A;  3PSF A;  1Y97 A;  4CEB A;  4DU3 A;  3CFO A;  3TWH A;  4FJN A;  2NUB A;  5BRD A;  2ZD1 A;  1HUX A;  3R1X A;  2QEX N;  4OKE A;  4M3Y A;  4Z4C A;  2QWM A;  3EEQ A;  4HUE A;  1Y2I A;  3F73 A;  2VWJ A;  4M3U A;  4CBW A;  3QBX A;  2Q1N A;  3E01 A;  2W41 A;  2ZE2 A;  1TL1 A;  3TTC A;  3C7N A;  3CM6 A;  3ITH A;  3FFI A;  4IWV A;  1MDU B;  3EE9 A;  1G99 A;  2VG5 A;  1VSH A;  4GVE A;  4DQQ A;  2F9T A;  2D4W A;  3MEE A;  5C0Y A;  3HPO A;  2GX9 A;  3WQU A;  2QWQ A;  5DMR A;  4JHD A;  4ZTJ A;  2O8D A;  2QWL A;  4LF4 K;  4NYF A;  2RE2 A;  3CC7 N;  1C1A A;  3SAG A;  2NRV A;  1RT4 A;  2X6N A;  5CZ1 A;  2E8A A;  5AQH A;  2UYT A;  3TAF A;  1QSL A;  1JL2 A;  1QS4 A;  2E2N A;  4KTW A;  4TSX A;  3FGU A;  1C0G A;  3UKU A;  3OS1 A;  4H03 B;  3S3N A;  3HBT A;  1VSI A;  3CQY A;  4DFK A;  2KTQ A;  4F3O A;  1HKB A;  4DLE A;  1JDQ A;  4OPJ A;  1U4B A;  4KFB A;  4JV5 K;  3ENO A;  2YHW A;  4FJK A;  4H0O A;  3S41 A;  2Q2R A;  1JLG A;  4B1W B;  4E7K A;  2KKZ A;  2KW4 A;  3FLC O;  4LY7 A;  3CET A;  1NGC A;  4FLW A;  3L6Q A;  1YTU A;  3SAF A;  4FJ9 A;  1YTA A;  3FZH A;  4JD2 A;  3P4I A;  3JSM A;  4NCB A;  1BUP A;  1IBL K;  2DFE A;  1RDB A;  3HZ7 A;  3TSU A;  3NHG A;  2IVO A;  5KTQ A;  1H4T A;  5C12 A;  1II7 A;  4Z4E A;  3AVC A;  3RMA A;  4YKE A;  3FZM A;  3MX2 A;  3I55 N;  3QLH A;  3D6R A;  1VQO N;  5FDL A;  4NXN K;  5BRH A;  4GV6 A;  2NZT A;  3CCS N;  4XIU A;  3VQ5 A;  4CHQ A;  2UXC K;  4BRE A;  3ULE A;  3CFR A;  4GVM A;  4WFB L;  4O8K A;  4J2A A;  1JLQ A;  4P77 A;  1O1W A;  2EQA A;  5E26 A;  3ZSW A;  1NMN A;  4CF0 A;  1BI4 A;  4CJR A;  5KRS A;  3WNG A;  1LWE A;  3ULD A;  3THX A;  3NE6 A;  1S8E A;  4K0K K;  4AH9 A;  1IKW A;  3ZIH A;  3SZ2 A;  3AVK A;  3O3F A;  3PLA A;  3V6D A;  1NLV A;  2HST A;  2ASO A;  2OTL N;  4FLV A;  5C25 A;  3QDK A;  4FVM A;  1NFH A;  4A62 A;  1X9J A;  3HPH A;  1XC3 A;  4JI0 K;  4H0X B;  4ZHR A;  1P8Z A;  1L3T A;  1NGI A;  4DQI A;  1IEZ A;  4B9U A;  4IG0 A;  2VGM A;  1U45 A;  2WUS A;  5FPD A;  4DR7 K;  4M41 A;  2YJF A;  3ZT1 A;  4LF5 K;  4ISG A;  3A0I X;  3WQT A;  3DLH A;  3ZSQ A;  1RDD A;  4B8A B;  1S1T A;  4FK2 A;  3AA4 A;  1VQK N;  1RBS A;  3E9L A;  3C6U A;  2O8B B;  4CVN E;  2LN3 A;  4R79 A;  4PHT X;  1BIU A;  1T05 A;  3MN5 A;  4M3X A;  1SV5 A;  1HQU A;  2IC3 A;  3CC4 N;  4MDB A;  3S3M A;  4I6M A;  5IT9 O;  1YUW A;  5KPZ A;  1KRP A;  1U6Z A;  4OX9 K;  4LF7 K;  3EO3 A;  3K5M A;  3VA3 A;  2VCP A;  5EOY A;  1K4O A;  2WC9 A;  5I42 A;  4DLG A;  4JS4 A;  2O4I A;  1HQE A;  4NCX A;  5KQ8 A;  1ZBH A;  1NK5 A;  1SS6 A;  4H5V A;  4BY9 C;  2HHV A;  3BF3 A;  5AFU A;  1B92 A;  1KLN A;  4C8N A;  2CGK A;  1ILY A;  1HC7 A;  2F4V K;  4JEP A;  2QTD A;  1NGG A;  1JXE A;  4E19 A;  1LAV A;  3FZK A;  2NLX A;  4H0Y B;  1NWK A;  4JI8 K;  2Z7C A;  2QWO A;  3DLR A;  3HST B;  2UUA K;  3VEO A;  4FJI A;  1NBW A;  1WLJ A;  1DTT A;  2QXL A;  4GNI A;  4NB4 A;  3GE1 A;  3CJC A;  3HT3 A;  2HBJ A;  5KGW A;  4NCG A;  5GIP A;  3SV3 A;  2OTJ N;  1VSJ A;  4LFA K;  4X62 K;  4A5A A;  3R8E A;  1SQK A;  3R6M A;  2IVN A;  2OZS A;  3IAY A;  5ADX A;  1WAJ A;  3TSP A;  5FRO A;  4DSI A;  4MDA A;  2E88 A;  3WBM A;  1YXQ A;  1JLC A;  2XRI A;  4CZI A;  1HKC A;  3OS0 A;  3HPG A;  4RW8 A;  4OPH A;  3ZLJ A;  3CCL N;  4CJ3 A;  1QVF M;  3JXU A;  1Y9X A;  4I2Q A;  4PY5 A;  1S5J A;  4UQG A;  3O4Q A;  3ENH A;  3RVC A;  4P6D A;  1X9S A;  4KI4 A;  4A2A A;  3HM8 A;  5KPR A;  4JI7 K;  4E89 A;  3TAG A;  2GV9 A;  5LL6 Z;  3L8B A;  5KGX A;  4IO8 A;  3QIO A;  3THY B;  1QZ5 A;  1HYS A;  1WB9 A;  1WNS A;  1S6P A;  1UWB A;  2P9L A;  4CGF A;  2ZM6 K;  3CF5 L;  3LPT A;  1FKP A;  3C6A A;  4FWK A;  1NNE A;  3G6E N;  4MQ3 A;  2E20 A;  2OPS A;  2V7Z A;  2DFF A;  1VRU A;  4DV2 K;  5C10 A;  1D4X A;  4CJU A;  3GBT A;  2BDP A;  3AV9 A;  1TAQ A;  3V9U A;  3NVM A;  3H3N O;  2BUP A;  5AQN A;  1F21 A;  4I9Q A;  2Q97 A;  1K8K B;  3A5L C;  4CGG A;  1W0H A;  1RTD A;  3BP8 A;  4CES A;  5GAH P;  1HKG A;  4C23 A;  1LOT B;  4CGH A;  2HNZ A;  2VQE K;  4H0P A;  3DSD A;  4FWM A;  4IFE A;  3FFK B;  3LVJ C;  3AGK A;  1W97 L;  2P9K B;  3AAR A;  1TYQ B;  4CJW A;  2BAN A;  4G1Q A;  3H1Q A;  3TU5 A;  3QFU A;  1XC9 A;  4CEZ A;  2PFU A;  3NF9 A;  4MO5 A;  3NF6 A;  3F9K A;  3C94 A;  3PIO L;  2QWR A;  2IGI A;  3P5J A;  4E7L A;  3KK7 A;  2H9U A;  3PIP L;  4EP4 A;  2A2Y A;  3NGY A;  2ZGZ A;  1OKJ A;  1Q86 O;  2IOC A;  3PX0 A;  4DV5 K;  1Q9Y A;  3NF8 A;  1G15 A;  3HP9 A;  2QK9 A;  3OTO K;  1LW2 A;  1BGX T;  1BA0 A;  4W5Q A;  3VTI A;  1RQ8 A;  3VQQ A;  3K0S A;  4NYN A;  2AA4 A;  4N5S A;  1QQC A;  2G8H A;  4CJE A;  3T1Y K;  3AJE A;  1WAF A;  4HD0 A;  4CEA A;  3DAW A;  5AQK A;  1NK7 A;  1SNN A;  2RKI A;  4BRH A;  3DRS A;  1NU0 A;  1L3S A;  3K5L A;  2D0C A;  4DUZ K;  2D0O A;  1X9W A;  4B9S A;  3KVG A;  4O8U A;  3TAQ A;  3SMP A;  4CJP A;  5DM7 L;  1NK0 A;  2BTF A;  4FWO A;  1GOB A;  2YJE A;  3O9R A;  4IEI A;  5AQW A;  4KTQ A;  4FZX C;  2OPR A;  1VQ6 N;  1WSJ A;  1QZ6 A;  1DLO A;  3B6O A;  3VEX A;  3SPZ A;  1W2B M;  2D0B A;  1K4P A;  2FSJ A;  1SL1 A;  3J7A P;  2IFE A;  3PO5 A;  5E84 A;  4LSL A;  1M90 O;  1HJR A;  4K41 A;  2YHA A;  2M71 A;  3P38 A;  5M1O A;  4N47 A;  4N76 A;  4CGI A;  3HJF A;  5CZ2 A;  3L2W A;  2QKB A;  5MLC Q;  4L3Q A;  3QBW A;  3RR7 A;  4FXD A;  3AO1 A;  3J8A A;  3QIN A;  3Q7B A;  3SLC A;  1XWL A;  1XHZ A;  4CEE A;  2G8I A;  4CJK A;  3SQ1 A;  1WSF A;  2P9P B;  1GLL O;  4FLT A;  2OAN A;  4AHR A;  3OYB A;  4DHY A;  3VTH A;  3MN6 A;  2I5J A;  3CJB A;  1SL0 A;  5AZJ B;  4CF9 A;  3B6P A;  5F0X A;  4U67 L;  1U48 A;  2CGL A;  1RT5 A;  1HRH A;  1A5W A;  3DYA A;  3NH1 A;  3LAN A;  4JKF A;  1NKE A;  3LDN A;  3ZSO A;  4LF9 K;  4JK9 A;  4CFD A;  1C0M A;  4M42 A;  2F8T A;  4M3W A;  4WCE L;  1ASW A;  4DU4 A;  3HI0 A;  2F7T A;  1RNH A;  2O8B A;  1IJJ A;  1RDC A;  1NM1 A;  4PA1 A;  1YIT N;  3VES A;  1N5Y A;  2KZZ A;  3A5N C;  3GL1 A;  2P9I B;  5AQG A;  1VQN N;  3LDO A;  4P8J A;  1S22 A;  3MAQ A;  4YOW A;  3OVN A;  3VEW A;  1N34 K;  3L3V A;  2Z1H A;  3NFA A;  3EN9 A;  2Q0R A;  1RT2 A;  1K6Y A;  3QIP A;  1ATN A;  1NJW A;  4O44 A;  5AZI B;  4BC3 A;  1RT6 A;  4FLU A;  3LWL A;  5AQL A;  1GLB G;  1U49 A;  1RBU A;  4WF9 L;  4WQ5 C;  3DXM B;  4NCA A;  4CJT A;  1UAX A;  4WFN L;  1QE1 A;  2ZGY A;  4H5R A;  3AAQ A;  4FFJ A;  4CHY A;  2PBD A;  4E3S A;  4LC9 B;  4F9O A;  1KQS M;  3I0S A;  1TIG A;  2Y1B A;  1OH7 A;  3KK1 A;  3QER A;  3U9Z A;  4BRP A;  2XHB A;  3G4S N;  3VGM A;  2HMP A;  3AAP A;  1G57 A;  3V1Q A;  3KLF A;  4FPB A;  3OYI A;  1WN7 A;  4WE1 A;  1N33 K;  1SKW A;  1EP4 A;  2W6K A;  4JKB A;  2XO7 A;  3M1F A;  1VSE A;  5KQD A;  3OJU A;  4CD3 A;  4DQ8 A;  5CE3 A;  1GOC A;  4B9N A;  2E1Y A;  3MMV A;  4AHT A;  4JI5 K;  1D5A A;  2HBK A;  2VG6 A;  3LDQ A;  5E41 A;  4C8L A;  1NJ2 A;  3O1W A;  3O9T A;  1EWR A;  3QO9 A;  4PUO A;  1Q81 O;  1BOT O;  5AJ3 K;  5JVG L;  1MU2 A;  2AJQ A;  3F5T A;  1TUU A;  3O80 A;  2G8V A;  2HW3 A;  4CBX A;  2Q31 A;  4W5N A;  1NK4 A;  5FLX O;  2RF2 A;  3D0P A;  4RTF D;  1VQ4 N;  3ZT2 A;  3MXJ A;  3ZYY X;  3THY A;  3I8D A;  1L3U A;  3MGZ A;  3RRH A;  3GDQ A;  3CI5 A;  5BN9 A;  3LL3 A;  3ZSV A;  4IJA A;  3OYK A;  3VA0 A;  1NGE A;  2O8F B;  3V1R A;  4X64 K;  5BRE A;  3CCE N;  4DMN A;  3IAB B;  1SKS A;  5HRN A;  1IO2 A;  2BH1 A;  3SYZ A;  3L2Q A;  3SUQ A;  3E9P A;  1S9E A;  3JAM O;  4KB1 A;  1JE3 A;  1S9G A;  1K8K A;  1QQM A;  1C0U A;  4RW6 A;  3CME N;  3HK2 A;  1J6Z A;  3BY5 A;  3KD5 E;  2HB5 A;  3DOL A;  2E2O A;  2P9K A;  5EVZ A;  1TYQ A;  4DKW A;  2NRH A;  4A5B A;  1WBD A;  2O8C B;  1JLE A;  3MCP A;  3VQP A;  3A5M C;  2P51 A;  5C42 A;  1YJW N;  4BRA A;  3DLG A;  3VGL A;  2VWB A;  5BPM A;  4PKH A;  4K25 A;  1VM0 A;  4HVC A;  1I94 K;  4F3T A;  3L0Q A;  1YI2 N;  3AA2 A;  1TK8 A;  2ASM A;  4FW2 A;  3CPW M;  4KI6 A;  1KVC A;  1RIL A;  3QFP A;  4KTZ A;  1VSK A;  5KI6 A;  2HF3 A;  4AHS A;  3DI6 A;  3DOK A;  4OKJ A;  4BR2 A;  2HHQ A;  4CF2 A;  3QKB A;  3HZ6 A;  4U7B A;  3V9S A;  1OH5 A;  4R5P A;  1TKU A;  3CJA A;  1Q18 A;  1Z26 A;  2HBL A;  2JLE A;  2PYJ A;  1B9D A;  4F8R A;  4W5O A;  1S1U A;  1T8E A;  5AR0 A;  3LDP A;  1EET A;  5F2R A;  3AO2 A;  4JI4 K;  2RIU A;  3GOI A;  1BCM A;  4M63 C;  5J1E A;  4JI6 K;  3QIC A;  3ZET B;  5F1X A;  3ENB A;  1RDW X;  1XQS C;  1HNI A;  3OYN A;  5CYQ A;  3VER A;  1IKY A;  4I14 A;  1U47 A;  1H4Q A;  4PWD A;  4KV8 A;  1VHX A;  1JLF A;  1WSG A;  3MEG A;  3LP1 A;  3K9J A;  2P5G A;  4QOZ B;  3CCR N;  3KTQ A;  2LSN A;  5AQF A;  4YOY A;  2MX1 A;  3SUO A;  1PVW A;  4FJM A;  3OYJ A;  4PL8 A;  4CK1 A;  4HUG A;  2QWN A;  3B8A X;  4W5T A;  1NJY A;  4H0V B;  4ILH A;  3SQ4 A;  4C1N K;  2XY7 A;  1EX4 A;  4YHH K;  3K57 A;  1HJO A;  4CJV A;  3WXM B;  5M1K A;  2ZF5 O;  4V19 S;  1ZBS A;  1HNX K;  3TAP A;  2RIS A;  4E0D A;  2GUI A;  3R9P A;  3SJJ A;  1YT3 A;  3O4N A;  3ZX0 A;  3RMC A;  1NJZ A;  2FLO A;  3KJV A;  3W0L A;  3VQD A;  4CGJ A;  2P9P A;  4DR6 K;  4RCH A;  1NGA A;  3VEZ A;  4GY2 B;  3F2K A;  3MEC A;  4CJ7 A;  5FRN A;  4BQZ A;  2IAJ A;  5AZJ A;  4JI2 K;  5AQU A;  4NO7 A;  4NZR M;  5SWM A;  3O08 A;  1X3N A;  4M3Z A;  1PVY A;  2XY5 A; 
#chains in the Genus database with same CATH homology
 1WOQ A;  2YX6 A;  2ASP A;  1V4T A;  3C6A A;  4FWK A;  1G57 A;  3D2F B;  3G6E N;  1E4F T;  3H6E A;  2E20 A;  2V7Z A;  5M1P A;  5BRF A;  5C10 A;  1D4X A;  1XUP O;  4MLE A;  3GBT A;  5AQI A;  3CPE A;  3NVM A;  3WEE A;  3H3N O;  2BUP A;  5AQN A;  2WFB A;  1K9M O;  4GV9 A;  2Q97 A;  1K8K B;  3A5L C;  4RWT A;  3ZEU B;  3GG4 A;  4PKI A;  2H3G X;  4FWL A;  2JWL A;  3BP8 A;  5GAH P;  1HKG A;  2A3Z A;  1LOT B;  4C23 A;  5C15 A;  2P9I A;  1K4L A;  3NVK A;  2P9B A;  1ESV A;  3ID8 A;  5HL7 L;  2W40 A;  3DXK A;  4H0P A;  4QS9 A;  4BR4 A;  5CHI A;  4EAH D;  1N8R O;  4BGB A;  4FWM A;  4IFE A;  2I7N A;  4EO0 A;  3FFK B;  3VGK A;  4Z94 A;  3J7Z O;  3AGK A;  1W97 L;  2P9K B;  3FZF A;  4FPA A;  2CGJ A;  1TYQ B;  3AAR A;  4E1J A;  2QA4 N;  4HWI A;  2NRX A;  3MCA B;  3H1Q A;  4FBW A;  5AQY A;  4IEE A;  4KH5 A;  3TU5 A;  1KC8 O;  5AZI A;  3QFU A;  2HBM A;  3IFR A;  4YDU A;  4FSV A;  5BPN A;  5AQQ A;  2A41 A;  2PFU A;  3VOV A;  1VQP N;  4MO5 A;  5AQV A;  3E66 A;  3DXM A;  3PIO L;  2QWR A;  3SMS A;  3LDL A;  3KK7 A;  3VMF B;  2KHO A;  3PIP L;  1PVY A;  5JLF A;  1ZXO A;  2ZGZ A;  3EKU A;  1OKJ A;  1X3M A;  4IJN A;  1QQN A;  1Q86 O;  1E4G T;  3N4P A;  4G9Z A;  4B1V A;  4BVO A;  5JVH L;  2FSK A;  3LM9 A;  4I6M B;  4QS7 A;  4JK8 A;  4HVZ A;  2E2Q A;  2QWP A;  4CZM A;  1BA0 A;  1KAX A;  4BC5 A;  3VTI A;  3UKR A;  4KBO A;  3CER A;  1GLF O;  1K73 O;  5FPE A;  3ZIE A;  5LJV A;  4IDH A;  3WXJ A;  5LY3 A;  2AA4 A;  2GWJ A;  2QI2 A;  3H45 C;  2VYP A;  3AJE A;  3MIO A;  2P9U B;  2NRW A;  4BR5 A;  4CZK A;  5I9E B;  3T69 A;  3DAW A;  5AQK A;  4EFH A;  1SNN A;  5AQX A;  4A59 A;  4BRH A;  1RGI A;  1BO5 O;  1QHA A;  1T3V A;  3MDQ A;  3DWL A;  4BRN A;  4GV3 A;  2Q0U A;  1DGK N;  4JN4 A;  3VF6 A;  4BC2 A;  5CR4 A;  4BRF A;  3P31 A;  2D0O A;  3H1V X;  1Z6R A;  2NNW A;  4K43 A;  3OBY A;  3ATU A;  3MWP A;  4BRG A;  4FWS A;  4HTL A;  3KVG A;  4O8U A;  4H5W A;  5EX5 A;  4BG9 A;  3L7V A;  4JKG B;  2F9W A;  3SMP A;  5DM7 L;  4WQ4 C;  2BTF A;  4FWO A;  2YJE A;  3O9R A;  3CD6 N;  4IEI A;  3C65 A;  5AQS A;  5AQW A;  1H1V A;  1KXP A;  1WUA A;  3D2E A;  3Q7C A;  4A2B A;  1G58 A;  1NJI O;  2RHK A;  4JKA A;  4MLH A;  2YHY A;  1VQ6 N;  2NRR A;  3CCQ N;  4IOA L;  1QZ6 A;  3O1B A;  3VPZ A;  3VEX A;  1NGH A;  2YCH A;  3EL2 A;  4AF1 A;  1W2B M;  5KPT A;  5TKY A;  2IVP A;  2FSJ A;  1K49 A;  1K4P A;  5E84 A;  1SAZ A;  3HTV A;  1M90 O;  3WXI A;  4K41 A;  1GLC G;  2WBN A;  1DKG D;  5BN8 A;  4E1B A;  3P38 A;  5M1O A;  1YJ9 N;  4A57 A;  1T6D A;  2GEL A;  2Q36 A;  5FPN A;  4KH6 A;  4CZJ A;  1K4I A;  3O6W A;  3FE1 A;  5C2D A;  5LJW A;  1GLJ O;  4J8F A;  3OBW A;  4JK7 A;  3AGR A;  5MLC Q;  1YJN N;  1U2V B;  2ZJR L;  4L3Q A;  3QBW A;  5AQT A;  1KK9 A;  3MX5 A;  1GLD G;  3IKM A;  1MWK A;  3J8A A;  3CCJ N;  4FOE A;  3TTD A;  3Q7B A;  3VF2 A;  3O8M A;  3SLC A;  3N4Q A;  1K7J A;  1GLE G;  3FR0 A;  3OA9 A;  2FSN A;  1JCE A;  2P9P B;  4NLB A;  4CZG A;  1GLL O;  2OAN A;  3JS6 A;  3VEV A;  4DHY A;  3VTH A;  2E2P A;  1R59 O;  1LCU A;  3MN6 A;  3TTF A;  3CJB A;  5AZJ B;  3CQX A;  3L4I A;  5F0X A;  4YOT A;  3VEN A;  1JJ2 M;  3RSE B;  5AQJ A;  2P9L B;  4U67 L;  1XEZ A;  1Y64 A;  4H5N A;  1NGB A;  4BRD A;  4DCH A;  2CGL A;  1VQ5 N;  4IZ9 A;  5H1S Q;  5GAG P;  3MN9 A;  5BRD A;  4OO1 J;  2V52 B;  4JKF A;  1HUX A;  3R1X A;  3D7E O;  2QEX N;  1BA1 A;  3LDN A;  1BG3 A;  1VAZ A;  2QWM A;  3IDH A;  4JK9 A;  3LS6 A;  4WCE L;  1NMD A;  3SBT A;  1HLU A;  4BR9 A;  4CBW A;  3QBX A;  4FBQ A;  4EHT A;  4WFA L;  2Q1N A;  3HI0 A;  3WEE B;  3TSQ A;  5JMV A;  4YOV A;  2ITM A;  2F7T A;  1IJJ A;  2W41 A;  1NM1 A;  3C7N A;  3TTC A;  3VES A;  1YIT N;  4IWV A;  3A5N C;  4B1Y B;  3GL1 A;  1MDU B;  4M7X A;  2P9I B;  3EE9 A;  5AQG A;  5EXW A;  1G99 A;  3LDO A;  1VQN N;  3CC2 N;  3U9D A;  3DXK B;  1S22 A;  4P8J A;  3O4W A;  4YOW A;  4GVE A;  3VEW A;  2F9T A;  3KHY A;  5AQZ A;  2D4W A;  4FWN A;  3EN9 A;  3BF1 A;  5C0Y A;  2Q0R A;  2GX9 A;  3WQU A;  2NRT A;  4JKC A;  2FF6 A;  2QWQ A;  4CBU A;  4JHD A;  2QWL A;  5BR9 A;  1S3X A;  1ATN A;  5EY4 A;  5AZI B;  3EE8 A;  4BC3 A;  2RE2 A;  3H3O B;  4JNE A;  5AQL A;  1GLB G;  3ATV A;  3SJH A;  3KZB A;  4BGA A;  1M1K O;  3CC7 N;  4PKG A;  1EQY A;  2NRV A;  3SAG A;  4WF9 L;  4WQ5 C;  1VQ8 N;  3DXM B;  3H46 O;  2E8A A;  1DEJ A;  5AQH A;  2UYT A;  3WUH A;  4P6C A;  4WFN L;  4FFJ A;  2ZGY A;  4H5R A;  3AAQ A;  2CH6 A;  1T44 A;  1KAZ A;  1T6C A;  4CZL A;  2PBD A;  3KWI A;  2QW9 A;  4FWP A;  3CJ7 A;  2E2N A;  4K42 A;  4LC9 B;  1SZ2 A;  1EO1 A;  1MA9 B;  5AQM A;  1ATR A;  3FGU A;  4F9O A;  1C0G A;  1KQS M;  3UKU A;  5HOO A;  1VQL N;  5JLH A;  4H03 B;  4AM7 A;  1IG8 A;  3HBT A;  3ZET A;  3T1I A;  3ZX2 A;  3CQY A;  2PAV A;  3HRG A;  4IOX A;  4BR7 A;  2YHX A;  1HKB A;  4FCX A;  3C0B A;  3U9Z A;  4BRP A;  3G4S N;  3VGM A;  2HMP A;  2A42 A;  3AAP A;  3ENO A;  3G25 A;  2YHW A;  3UKR B;  4H0O A;  3WT0 A;  2FF3 B;  3IMX A;  4FPB A;  3CJ1 A;  2A40 A;  3S41 A;  2Q2R A;  2GTD A;  5AQO A;  4BRK A;  3M6G A;  4JKD A;  4B1W B;  3LM2 A;  3C6H A;  4IOC L;  2KKZ A;  3FLC O;  4JKB A;  4CZF A;  3CET A;  4O5F A;  3M1F A;  1Q7Y O;  4P6P A;  5KQD A;  1NGC A;  4CD3 A;  4DQ8 A;  5CE3 A;  2HOE A;  3L6Q A;  2P9S A;  4FWR A;  5TKW A;  3SAF A;  2E1Y A;  3FZH A;  4JD2 A;  2V51 B;  3P39 A;  3P4I A;  3MMV A;  4BRM A;  1BUP A;  3KWG A;  2P9N A;  1K8A O;  4ISF A;  2HBK A;  3TSU A;  2IVO A;  2ZJP L;  1NGD A;  2QM1 A;  3LDQ A;  3CCU N;  5C12 A;  3O9Q A;  3U4L A;  4AM6 A;  3O1W A;  3O9T A;  4CI6 A;  1BU6 O;  3MN7 A;  4XH1 A;  1Q81 O;  1BOT O;  3QML A;  4BC4 A;  4YKE A;  3FZM A;  3MX2 A;  3I55 N;  5JVG L;  3H07 A;  3D6R A;  1VQO N;  1VQ7 N;  2NRZ A;  1RFQ A;  5GIN A;  1BWF O;  1P90 A;  3D2E B;  2VGN A;  5BRH A;  4GV6 A;  2NZT A;  2YI1 A;  3F5T A;  3CCS N;  1TUU A;  1YIJ N;  3O80 A;  2GUP A;  3UB5 A;  4Y0W A;  3R3L A;  1BDG A;  4BRE A;  2Q31 A;  4WQ5 A;  3ULE A;  4BG8 A;  4CBX A;  4DB3 A;  4FO0 A;  5C2F A;  4WFB L;  4O8K A;  3VEY A;  4RTF D;  4P77 A;  1VQ4 N;  3ZYY X;  2EQA A;  3EZW A;  5E26 A;  4FVU A;  1NGF A;  4WYB A;  5AQR A;  4CZH A;  3WXL A;  4BRC A;  5M1N A;  3M3Z A;  3MGZ A;  3GDQ A;  3CI5 A;  5BN9 A;  3LL3 A;  4IJA A;  4CD1 A;  3OW2 M;  1NGE A;  4JKE A;  3D2F A;  3ZIH A;  5BRE A;  3CCE N;  4XH5 A;  3PLA A;  3ZII A;  2D1K A;  1NLV A;  2HST A;  3TPQ A;  3DLL L;  2ASO A;  2BH1 A;  2OTL N;  2FXU A;  3E9P A;  3QDK A;  4BVP A;  1K8K A;  4A62 A;  1QQM A;  4WQ4 A;  3ZEU A;  1ATS A;  1X9J A;  3EKS A;  3CME N;  1XC3 A;  3L4Q A;  3VET A;  4H0X B;  3O5B A;  1J6Z A;  1P8Z A;  2ZWH A;  1VQ9 N;  1NGI A;  4B1Z A;  4BRQ A;  4NLC A;  4FL9 A;  4CZE A;  1IEZ A;  2A5X A;  2VGM A;  2E2O A;  5JIC A;  2P9K A;  5EVZ A;  1TYQ A;  2WUS A;  3A5O C;  4DKW A;  2NRH A;  4A5B A;  2YJF A;  5FPD A;  5GAD P;  4YOX A;  4KH4 A;  3MCP A;  4ISG A;  3ZX3 A;  3CCM N;  3LRJ A;  3A5M C;  3A0I X;  3SBG A;  1NGJ A;  1YJW N;  2A6A A;  4BRA A;  2GWK A;  3WQT A;  4C1N I;  5B8H A;  3VGL A;  2VWB A;  4H5T A;  4BRO A;  5ADX H;  5BPM A;  1QVG M;  3MK5 A;  4PKH A;  4JKH A;  1V4S A;  2IIR A;  4JAX A;  3AY9 A;  1VQK N;  4K25 A;  3SAH A;  3E9L A;  1O13 A;  4BR0 A;  3C7N B;  2LN3 A;  4R79 A;  3FZL A;  4PHT X;  4H0T B;  1JCG A;  3IUC A;  4XH4 A;  3L0Q A;  3MN5 A;  1YAG A;  4BQL A;  1YI2 N;  1YF5 L;  3HSC A;  2ZJQ L;  2ASM A;  3CPW M;  3CC4 N;  3CHW A;  4MDB A;  4OPA A;  3QFP A;  4I6M A;  5ELZ A;  1YUW A;  3QB0 A;  5KPZ A;  1U6Z A;  4FOI A;  4QS8 A;  5M1Q A;  3EO3 A;  4B1X B;  5BPL A;  2HF3 A;  4BRL A;  4NZT M;  3F9M A;  2VCP A;  5EOY A;  4BR2 A;  4XEI A;  1VQM N;  5AQP A;  2WC9 A;  1K4O A;  4JHD B;  3HOS A;  3MWT A;  3HZ6 A;  5KQ8 A;  1SS6 A;  4U7B A;  1HX1 A;  1TUY A;  4H5V A;  4BY9 C;  3W3D A;  1TKU A;  3LQU A;  3CJA A;  3BF3 A;  3VF4 A;  5AFU A;  1Q18 A;  2HBL A;  2P9U A;  3P04 A;  1OVY A;  2CGK A;  3I33 A;  1ILY A;  2GEM A;  3NMU A;  4JEP A;  2QTD A;  1NGG A;  3CIP A;  4BRI A;  3G71 N;  4ISE A;  3A8Y A;  3O9S A;  3SK3 A;  4YOU A;  1DT9 A;  3FZK A;  2NLX A;  2JWK A;  1NWK A;  4H0Y B;  4A61 A;  5GAE P;  4P8E A;  5AR0 A;  3LDP A;  1Q82 O;  3UKU B;  5F2R A;  1TKS A;  2CH5 A;  2QWO A;  3GOI A;  2RIU A;  4IXC A;  3VEO A;  4M63 C;  1JCF A;  1KD1 O;  2HF4 A;  3QIC A;  3ZET B;  5F1X A;  3ENB A;  1RDW X;  3OHR A;  1XQS C;  1NBW A;  4JKG A;  3ID6 A;  2AP1 A;  3E1Y A;  3VER A;  4GNI A;  2QXL A;  4NB4 A;  3GE1 A;  4EHU A;  4I14 A;  3CCV N;  3CJC A;  4PL7 A;  2HBJ A;  3UE5 A;  5GIP A;  1YHQ N;  1ZC6 A;  3I8B A;  4UY8 O;  2OTJ N;  1S72 N;  3K9J A;  3CMA N;  4A5A A;  3R8E A;  3CCR N;  1SQK A;  4YOY A;  5AQF A;  2MX1 A;  3R6M A;  4EIA A;  4MO4 A;  2IVN A;  5FPM A;  2P9S B;  1PVW A;  4JD2 B;  4PL8 A;  5ADX A;  4ILJ A;  1QQO A;  4IO9 L;  3K9K A;  3TSP A;  2QWN A;  3B8A X;  3O9U A;  3T7Z A;  4H0V B;  2E1Z A;  4MDA A;  4ILH A;  2P9N B;  1KAY A;  2E88 A;  2KLA A;  1Z05 A;  1YXQ A;  5M1F A;  4CZI A;  1HKC A;  4C1N K;  3BEX A;  4FWQ A;  4OPH A;  1JCU A;  1HJO A;  3CCL N;  3WXM B;  1QVF M;  5GIO A;  2V7Y A;  3CJ9 A;  3JXU A;  4B1U B;  2I7P A;  2ZF5 O;  3DJC A;  5M1K A;  1U2V A;  1ZBS A;  2RIS A;  2J4R A;  4FBK A;  3E9O A;  4YDU C;  1YVN A;  3R9P A;  5DM6 L;  3ZX0 A;  1C0F A;  3HOT A;  3U8X A;  2FLO A;  4B9Q A;  3MK6 A;  1GLA G;  3ENH A;  1RDU A;  3RVC A;  3W0L A;  4P6D A;  1CZA N;  1HPM A;  2DPN A;  3ULE B;  4A2A A;  3HM8 A;  5KPR A;  2P9P A;  4RCH A;  1NGA A;  3VEZ A;  5AFU H;  4GY2 B;  3F2K A;  4CJ7 A;  1HRU A;  3ZIG A;  4IO8 A;  4BQZ A;  5AZJ A;  1QZ5 A;  2D0P A;  3I56 N;  3CXC M;  2EWS A;  3M5R A;  3BUZ B;  4NO7 A;  5AQU A;  3RSE A;  4NZR M;  2P9L A;  3O08 A;  4YOR A;  1X3N A;  3WXK A;  4M7Y A;  1MWM A;  3CF5 L;  4ILG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...