3TSRE

X-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
457
structure length
457
Chain Sequence
MMSLDIQCEQLSDARWTELLPLIQQYEVVRLDDCGLTEVRCKDISSAVQANPALTELSLRTNELGDGGVGLVLQGLQNPTCKIQKLSLQNCGLTEAGCGILPGMLRSLSTLRELHLNDNPMGDAGLKLLCEGLQDPQCRLEKLQLEYCNLTATSCEPLASVLRVKADFKELVLSNNDLHEPGVRILCQGLKDSACQLESLKLENCGITAANCKDLCDVVASKASLQELDLSSNKLGNAGIAALCPGLLLPSCKLRTLWLWECDITAEGCKDLCRVLRAKQSLKELSLASNELKDEGARLLCESLLEPGCQLESLWIKTCSLTAASCPYFCSVLTKSRSLLELQMSSNPLGDEGVQELCKALSQPDTVLRELWLGDCDVTNSGCSSLANVLLANRSLRELDLSNNCMGGPGVLQLLESLKQPSCTLQQLVLYDIYWTNEVEEQLRALEEERPSLRIIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease pancreatic
publication title Functional evolution of ribonuclease inhibitor: insights from birds and reptiles.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 202
structure length 457
sequence length 457
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13516 LRR_6 Leucine Rich repeat
E PF18779 LRR_RI_capping Capping Ribonuclease inhibitor Leucine Rich Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3tsrE00
4AY9X 4CC4A 2P1QB 5GS0A 1U0ND 3W3KA 3G3AA 4M7EC 3UL8A 4U08A 4LSAA 3W3JA 4J4LA 5AWAA 2ID5A 5AWDA 4J0MA 1OGQA 1XECA 2ASTB 4GT6A 5FTTB 3OGMB 3G04C 4QBZA 2P1PB 4R5DA 1ZIWA 4KT1A 5GMGA 3RFEA 4R07A 3OGLB 4C2AB 3VQ1A 5B0NA 4MN8B 4H09A 2WQXA 2Z62A 1FS2A 2Z64A 3RFJA 4P91A 1PGVA 1M0ZA 1OOKG 3CVRA 4Z8GA 2FT3A 3ZYJA 3E6JA 4FS7A 2XWTC 4R08A 4R58A 4ECOA 3E3ZA 1DCEA 4LXSA 3ULVA 4LI2A 4B8CD 1O6VA 1XCDA 1K5DC 3G39A 2R9UA 2OMTA 1SQ0B 2V9SA 2IFGA 2WQUA 4RCWA 2Z7XA 5HDHA 4QC0A 3FXIA 3ULAA 3WPEA 4OQTA 4PQ8A 2Z63A 4Y61B 3UN9A 4BV4R 4WP6A 4V2EA 2WQVA 4YEBB 4BSRA 4LSXC 4G8AA 1P8TA 3RIZA 5A5CA 4Q3GA 3ZYNA 2BEXA 2ELLA 3W3GA 2RR6A 2O6RA 1O6SA 4Q62A 1OTOA 1K5GC 4WYKA 2OMZA 2Q4GW 4Z61C 5D3IA 3WPIA 3E4GA 3RFSA 3OJAA 3WN4A 1P8VA 2XOTA 2Y5QA 2JE1A 4CILA 3VQ2A 1M9LA 1OTNA 2V9TB 1Z7XW 1GWBA 4PSJA 4BSSA 4MQWX 2O6SA 5GS2B 4C2BB 1KOHA 5GMFA 4R6GA 1M10B 3RJ0A 4V2CA 3O6NA 3WPFA 4EZGA 1FQVA 4U09A 4R6FA 3UL7A 1WWLA 2JE0A 1A9NA 3G3BA 4CC4C 1DS9A 4ECNA 4TZHA 2RA8A 4PERA 5AWBA 5AZ5A 4R0AA 4IM6A 5CMPA 4Z94G 1D0BA 2WQWA 5IYXC 5GMHA 4LXRA 4ARRA 1M9SA 1JL5A 4QXEA 3A79B 2OMYA 5HZLB 1KOOA 5B4PA 1W8AA 2O6QA 4V2DA 3C6OB 3CIGA 1FO1A 4KXFB 4NKGA 2P1OB 4Q3IA 2JQDA 4RWTC 1XKUA 3JB9j 1LTXA 3C6PB 4RCAB 4AW4A 4CP6A 5IJDA 5IJCA 3PMHG 4FD0A 3OGKB 4PEQB 2Z66A 4P8SA 4Z64C 1FT8A 3UL9A 3RW6A 4HQ1A 4ARNA 4NKHA 2BNHA 1IO0A 3REZA 2CA6A 1YRGA 2Z82A 4R09A 2V70A 3M19A 1H6UA 5IJBA 4LSCA 3ZYOA 4L3AA 4XOSA 3BZ5A 2UZYA 4U7LA 3WPBA 2WFHA 3RW7A 2Z81A 2UZXA 1A4YA 3CIYA 4FHOA 4FMZA 1XWDC 3DZEA 3W3NA 4R6JA 5LFNA 2Z7XB 1QYYA 3SB4A 3P72A 3RGZA 4XSQA 1O6TA 4L3FA 4KNGA 4PKIG 4LI1A 3RGXA 4FDWA 5AWCA 3GOZA 3ZYIA 4R6AA 4UFRA 3KJ4A 4LSXA 1OZNA 4XGOA 4BSUA 4GLPA 1DFJI 1G9UA 1XEUA 4FCGA 5CMNA 4CNCA 2OMUA 3TSRE 2OMVA 3OJAB 3M18A 4Z79A 3WPCA 3G06A 5GQRK 1OTMA 2ASSB 4M7EA 2P1MB 2OMXA 5B0TA 3W3LA 3WPGA 3WPDA 3O53A 4CNMA 2A0ZA 2OMWA 3ULUA 3WPHA 4R5CA 3C6NB 2P1NB 4I6JB 1P9AG 2Z65A 4K17A 3E2JA 1H6TA 3W3MA 4U06A
chains in the Genus database with same CATH superfamily
4AY9X 4CC4A 2P1QB 5GS0A 1U0ND 3W3KA 3G3AA 4M7EC 3UL8A 4U08A 4LSAA 3W3JA 4J4LA 5AWAA 2ID5A 5AWDA 4J0MA 1OGQA 1XECA 2ASTB 4GT6A 5FTTB 3OGMB 3G04C 4QBZA 2P1PB 4R5DA 1ZIWA 4KT1A 5GMGA 3RFEA 4R07A 3OGLB 4C2AB 3VQ1A 5B0NA 4MN8B 4H09A 2WQXA 2Z62A 1FS2A 2Z64A 3RFJA 4P91A 1PGVA 4NZTM 1M0ZA 1OOKG 3CVRA 4Z8GA 2FT3A 3ZYJA 3E6JA 4FS7A 2XWTC 4R08A 4R58A 4ECOA 3E3ZA 1DCEA 4LXSA 3ULVA 4LI2A 4B8CD 1O6VA 1XCDA 1K5DC 3G39A 2R9UA 2OMTA 1SQ0B 2V9SA 2IFGA 2WQUA 4RCWA 2Z7XA 5HDHA 4QC0A 3FXIA 3ULAA 3WPEA 4OQTA 4PQ8A 2Z63A 4Y61B 3UN9A 4BV4R 4WP6A 4V2EA 2WQVA 4YEBB 4BSRA 4LSXC 4G8AA 1P8TA 3RIZA 5A5CA 4Q3GA 3ZYNA 2BEXA 2ELLA 3W3GA 2RR6A 2O6RA 1O6SA 4Q62A 1OTOA 1K5GC 4WYKA 2OMZA 2Q4GW 4Z61C 5D3IA 3WPIA 3E4GA 3RFSA 3OJAA 3WN4A 1P8VA 2XOTA 2Y5QA 2JE1A 4CILA 3VQ2A 1M9LA 1OTNA 2V9TB 1Z7XW 1GWBA 4PSJA 4BSSA 4MQWX 2O6SA 5GS2B 4C2BB 1KOHA 5GMFA 4R6GA 1M10B 3RJ0A 4V2CA 3O6NA 3WPFA 4EZGA 1FQVA 4U09A 4R6FA 3UL7A 1WWLA 2JE0A 1A9NA 3G3BA 4CC4C 1DS9A 4ECNA 4TZHA 2RA8A 4PERA 5AWBA 5AZ5A 4R0AA 4IM6A 5CMPA 4Z94G 1D0BA 2WQWA 5IYXC 5GMHA 4LXRA 4ARRA 1M9SA 1JL5A 4QXEA 3A79B 2OMYA 5HZLB 1KOOA 4NZRM 5B4PA 1W8AA 2O6QA 4V2DA 3C6OB 3CIGA 1FO1A 4KXFB 4NKGA 2P1OB 4Q3IA 2JQDA 4RWTC 1XKUA 3JB9j 1LTXA 3C6PB 4RCAB 4AW4A 4CP6A 5IJDA 5IJCA 3PMHG 4FD0A 3OGKB 4PEQB 2Z66A 4P8SA 4Z64C 1FT8A 3UL9A 3RW6A 4HQ1A 4ARNA 4NKHA 2BNHA 1IO0A 3REZA 2CA6A 1YRGA 2Z82A 4R09A 2V70A 3M19A 1H6UA 5IJBA 4LSCA 3ZYOA 4L3AA 4XOSA 3BZ5A 2UZYA 4U7LA 3WPBA 2WFHA 3RW7A 2Z81A 2UZXA 1A4YA 3CIYA 4FHOA 4FMZA 1XWDC 3DZEA 3W3NA 4R6JA 5LFNA 2Z7XB 1QYYA 3SB4A 3P72A 3RGZA 4XSQA 1O6TA 4L3FA 4KNGA 4PKIG 4LI1A 3RGXA 4FDWA 5AWCA 3GOZA 3ZYIA 4R6AA 4UFRA 3KJ4A 4LSXA 1OZNA 4XGOA 4BSUA 4GLPA 1DFJI 1G9UA 1XEUA 4FCGA 5CMNA 4CNCA 2OMUA 3TSRE 2OMVA 3OJAB 3M18A 4Z79A 3WPCA 3G06A 5GQRK 1OTMA 2ASSB 4M7EA 2P1MB 2OMXA 5B0TA 3W3LA 3WPGA 3WPDA 3O53A 4CNMA 2A0ZA 2OMWA 3ULUA 3WPHA 4R5CA 3C6NB 2P1NB 4I6JB 1P9AG 2Z65A 4K17A 3E2JA 1H6TA 3W3MA 4U06A
chains in the Genus database with same CATH topology
4AY9X 4CC4A 2P1QB 5GS0A 1U0ND 3W3KA 3G3AA 4M7EC 3UL8A 4U08A 4LSAA 3W3JA 4J4LA 5AWAA 2ID5A 5AWDA 4J0MA 1OGQA 1XECA 2ASTB 4GT6A 5FTTB 3OGMB 3G04C 4QBZA 2P1PB 4R5DA 1ZIWA 4KT1A 5GMGA 3RFEA 4R07A 3OGLB 4C2AB 3VQ1A 5B0NA 4MN8B 4H09A 2WQXA 2Z62A 1FS2A 2Z64A 3RFJA 4P91A 1PGVA 1M0ZA 1OOKG 3CVRA 4Z8GA 2FT3A 3ZYJA 3E6JA 4FS7A 2XWTC 4R08A 4R58A 4ECOA 3E3ZA 1DCEA 4LXSA 3ULVA 4LI2A 4B8CD 1O6VA 1XCDA 1K5DC 3G39A 2R9UA 2OMTA 1SQ0B 2V9SA 2IFGA 2WQUA 4RCWA 2Z7XA 5HDHA 4QC0A 3FXIA 3ULAA 3WPEA 4OQTA 4PQ8A 2Z63A 4Y61B 3UN9A 4BV4R 4WP6A 4V2EA 2WQVA 4YEBB 4BSRA 4LSXC 4G8AA 1P8TA 3RIZA 5A5CA 4Q3GA 3ZYNA 2BEXA 2ELLA 3W3GA 2RR6A 2O6RA 1O6SA 4Q62A 1OTOA 1K5GC 4WYKA 2OMZA 2Q4GW 4Z61C 5D3IA 3WPIA 3E4GA 3RFSA 3OJAA 3WN4A 1P8VA 2XOTA 2Y5QA 2JE1A 4CILA 3VQ2A 1M9LA 1OTNA 2V9TB 1Z7XW 1GWBA 4PSJA 4BSSA 4MQWX 2O6SA 5GS2B 4C2BB 1KOHA 5GMFA 4R6GA 1M10B 3RJ0A 4V2CA 3O6NA 3WPFA 4EZGA 1FQVA 4U09A 4R6FA 3UL7A 1WWLA 2JE0A 1A9NA 3G3BA 4CC4C 1DS9A 4ECNA 4TZHA 2RA8A 4PERA 5AWBA 5AZ5A 4R0AA 4IM6A 5CMPA 4Z94G 1D0BA 2WQWA 5IYXC 5GMHA 4LXRA 4ARRA 1M9SA 1JL5A 4QXEA 3A79B 2OMYA 5HZLB 1KOOA 5B4PA 1W8AA 2O6QA 4V2DA 3C6OB 3CIGA 1FO1A 4KXFB 4NKGA 2P1OB 4Q3IA 2JQDA 4RWTC 1XKUA 3JB9j 1LTXA 3C6PB 4RCAB 4AW4A 4CP6A 5IJDA 5IJCA 3PMHG 4FD0A 3OGKB 4PEQB 2Z66A 4P8SA 4Z64C 1FT8A 3UL9A 3RW6A 4HQ1A 4ARNA 4NKHA 2BNHA 1IO0A 3REZA 2CA6A 1YRGA 2Z82A 4R09A 2V70A 3M19A 1H6UA 5IJBA 4LSCA 3ZYOA 4L3AA 4XOSA 3BZ5A 2UZYA 4U7LA 3WPBA 2WFHA 3RW7A 2Z81A 2UZXA 1A4YA 3CIYA 4FHOA 4FMZA 1XWDC 3DZEA 3W3NA 4R6JA 5LFNA 2Z7XB 1QYYA 3SB4A 3P72A 3RGZA 4XSQA 1O6TA 4L3FA 4KNGA 4PKIG 4LI1A 3RGXA 4FDWA 5AWCA 3GOZA 3ZYIA 4R6AA 4UFRA 3KJ4A 4LSXA 1OZNA 4XGOA 4BSUA 4GLPA 1DFJI 1G9UA 1XEUA 4FCGA 5CMNA 4CNCA 2OMUA 3TSRE 2OMVA 3OJAB 3M18A 4Z79A 3WPCA 3G06A 5GQRK 1OTMA 2ASSB 4M7EA 2P1MB 2OMXA 5B0TA 3W3LA 3WPGA 3WPDA 3O53A 4CNMA 2A0ZA 2OMWA 3ULUA 3WPHA 4R5CA 3C6NB 2P1NB 4I6JB 1P9AG 2Z65A 4K17A 3E2JA 1H6TA 3W3MA 4U06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY9 X;  4CC4 A;  2P1Q B;  5GS0 A;  1U0N D;  3W3K A;  3G3A A;  4M7E C;  3UL8 A;  4U08 A;  4LSA A;  3W3J A;  4J4L A;  5AWA A;  2ID5 A;  5AWD A;  4J0M A;  1OGQ A;  1XEC A;  2AST B;  4GT6 A;  5FTT B;  3OGM B;  3G04 C;  4QBZ A;  2P1P B;  4R5D A;  1ZIW A;  4KT1 A;  5GMG A;  3RFE A;  4R07 A;  3OGL B;  4C2A B;  3VQ1 A;  5B0N A;  4MN8 B;  4H09 A;  2WQX A;  2Z62 A;  1FS2 A;  2Z64 A;  3RFJ A;  4P91 A;  1PGV A;  1M0Z A;  1OOK G;  3CVR A;  4Z8G A;  2FT3 A;  3ZYJ A;  3E6J A;  4FS7 A;  2XWT C;  4R08 A;  4R58 A;  4ECO A;  3E3Z A;  1DCE A;  4LXS A;  3ULV A;  4LI2 A;  4B8C D;  1O6V A;  1XCD A;  1K5D C;  3G39 A;  2R9U A;  2OMT A;  1SQ0 B;  2V9S A;  2IFG A;  2WQU A;  4RCW A;  2Z7X A;  5HDH A;  4QC0 A;  3FXI A;  3ULA A;  3WPE A;  4OQT A;  4PQ8 A;  2Z63 A;  4Y61 B;  3UN9 A;  4BV4 R;  4WP6 A;  4V2E A;  2WQV A;  4YEB B;  4BSR A;  4LSX C;  4G8A A;  1P8T A;  3RIZ A;  5A5C A;  4Q3G A;  3ZYN A;  2BEX A;  2ELL A;  3W3G A;  2RR6 A;  2O6R A;  1O6S A;  4Q62 A;  1OTO A;  1K5G C;  4WYK A;  2OMZ A;  2Q4G W;  4Z61 C;  5D3I A;  3WPI A;  3E4G A;  3RFS A;  3OJA A;  3WN4 A;  1P8V A;  2XOT A;  2Y5Q A;  2JE1 A;  4CIL A;  3VQ2 A;  1M9L A;  1OTN A;  2V9T B;  1Z7X W;  1GWB A;  4PSJ A;  4BSS A;  4MQW X;  2O6S A;  5GS2 B;  4C2B B;  1KOH A;  5GMF A;  4R6G A;  1M10 B;  3RJ0 A;  4V2C A;  3O6N A;  3WPF A;  4EZG A;  1FQV A;  4U09 A;  4R6F A;  3UL7 A;  1WWL A;  2JE0 A;  1A9N A;  3G3B A;  4CC4 C;  1DS9 A;  4ECN A;  4TZH A;  2RA8 A;  4PER A;  5AWB A;  5AZ5 A;  4R0A A;  4IM6 A;  5CMP A;  4Z94 G;  1D0B A;  2WQW A;  5IYX C;  5GMH A;  4LXR A;  4ARR A;  1M9S A;  1JL5 A;  4QXE A;  3A79 B;  2OMY A;  5HZL B;  1KOO A;  5B4P A;  1W8A A;  2O6Q A;  4V2D A;  3C6O B;  3CIG A;  1FO1 A;  4KXF B;  4NKG A;  2P1O B;  4Q3I A;  2JQD A;  4RWT C;  1XKU A;  3JB9 j;  1LTX A;  3C6P B;  4RCA B;  4AW4 A;  4CP6 A;  5IJD A;  5IJC A;  3PMH G;  4FD0 A;  3OGK B;  4PEQ B;  2Z66 A;  4P8S A;  4Z64 C;  1FT8 A;  3UL9 A;  3RW6 A;  4HQ1 A;  4ARN A;  4NKH A;  2BNH A;  1IO0 A;  3REZ A;  2CA6 A;  1YRG A;  2Z82 A;  4R09 A;  2V70 A;  3M19 A;  1H6U A;  5IJB A;  4LSC A;  3ZYO A;  4L3A A;  4XOS A;  3BZ5 A;  2UZY A;  4U7L A;  3WPB A;  2WFH A;  3RW7 A;  2Z81 A;  2UZX A;  1A4Y A;  3CIY A;  4FHO A;  4FMZ A;  1XWD C;  3DZE A;  3W3N A;  4R6J A;  5LFN A;  2Z7X B;  1QYY A;  3SB4 A;  3P72 A;  3RGZ A;  4XSQ A;  1O6T A;  4L3F A;  4KNG A;  4PKI G;  4LI1 A;  3RGX A;  4FDW A;  5AWC A;  3GOZ A;  3ZYI A;  4R6A A;  4UFR A;  3KJ4 A;  4LSX A;  1OZN A;  4XGO A;  4BSU A;  4GLP A;  1DFJ I;  1G9U A;  1XEU A;  4FCG A;  5CMN A;  4CNC A;  2OMU A;  3TSR E;  2OMV A;  3OJA B;  3M18 A;  4Z79 A;  3WPC A;  3G06 A;  5GQR K;  1OTM A;  2ASS B;  4M7E A;  2P1M B;  2OMX A;  5B0T A;  3W3L A;  3WPG A;  3WPD A;  3O53 A;  4CNM A;  2A0Z A;  2OMW A;  3ULU A;  3WPH A;  4R5C A;  3C6N B;  2P1N B;  4I6J B;  1P9A G;  2Z65 A;  4K17 A;  3E2J A;  1H6T A;  3W3M A;  4U06 A; 
#chains in the Genus database with same CATH topology
 4AY9 X;  4CC4 A;  2P1Q B;  5GS0 A;  1U0N D;  3W3K A;  3G3A A;  4M7E C;  3UL8 A;  4U08 A;  4LSA A;  3W3J A;  4J4L A;  5AWA A;  2ID5 A;  5AWD A;  4J0M A;  1OGQ A;  1XEC A;  2AST B;  4GT6 A;  5FTT B;  3OGM B;  3G04 C;  4QBZ A;  2P1P B;  4R5D A;  1ZIW A;  4KT1 A;  5GMG A;  3RFE A;  4R07 A;  3OGL B;  4C2A B;  3VQ1 A;  5B0N A;  4MN8 B;  4H09 A;  2WQX A;  2Z62 A;  1FS2 A;  2Z64 A;  3RFJ A;  4P91 A;  1PGV A;  4NZT M;  1M0Z A;  1OOK G;  3CVR A;  4Z8G A;  2FT3 A;  3ZYJ A;  3E6J A;  4FS7 A;  2XWT C;  4R08 A;  4R58 A;  4ECO A;  3E3Z A;  1DCE A;  4LXS A;  3ULV A;  4LI2 A;  4B8C D;  1O6V A;  1XCD A;  1K5D C;  3G39 A;  2R9U A;  2OMT A;  1SQ0 B;  2V9S A;  2IFG A;  2WQU A;  4RCW A;  2Z7X A;  5HDH A;  4QC0 A;  3FXI A;  3ULA A;  3WPE A;  4OQT A;  4PQ8 A;  2Z63 A;  4Y61 B;  3UN9 A;  4BV4 R;  4WP6 A;  4V2E A;  2WQV A;  4YEB B;  4BSR A;  4LSX C;  4G8A A;  1P8T A;  3RIZ A;  5A5C A;  4Q3G A;  3ZYN A;  2BEX A;  2ELL A;  3W3G A;  2RR6 A;  2O6R A;  1O6S A;  4Q62 A;  1OTO A;  1K5G C;  4WYK A;  2OMZ A;  2Q4G W;  4Z61 C;  5D3I A;  3WPI A;  3E4G A;  3RFS A;  3OJA A;  3WN4 A;  1P8V A;  2XOT A;  2Y5Q A;  2JE1 A;  4CIL A;  3VQ2 A;  1M9L A;  1OTN A;  2V9T B;  1Z7X W;  1GWB A;  4PSJ A;  4BSS A;  4MQW X;  2O6S A;  5GS2 B;  4C2B B;  1KOH A;  5GMF A;  4R6G A;  1M10 B;  3RJ0 A;  4V2C A;  3O6N A;  3WPF A;  4EZG A;  1FQV A;  4U09 A;  4R6F A;  3UL7 A;  1WWL A;  2JE0 A;  1A9N A;  3G3B A;  4CC4 C;  1DS9 A;  4ECN A;  4TZH A;  2RA8 A;  4PER A;  5AWB A;  5AZ5 A;  4R0A A;  4IM6 A;  5CMP A;  4Z94 G;  1D0B A;  2WQW A;  5IYX C;  5GMH A;  4LXR A;  4ARR A;  1M9S A;  1JL5 A;  4QXE A;  3A79 B;  2OMY A;  5HZL B;  1KOO A;  4NZR M;  5B4P A;  1W8A A;  2O6Q A;  4V2D A;  3C6O B;  3CIG A;  1FO1 A;  4KXF B;  4NKG A;  2P1O B;  4Q3I A;  2JQD A;  4RWT C;  1XKU A;  3JB9 j;  1LTX A;  3C6P B;  4RCA B;  4AW4 A;  4CP6 A;  5IJD A;  5IJC A;  3PMH G;  4FD0 A;  3OGK B;  4PEQ B;  2Z66 A;  4P8S A;  4Z64 C;  1FT8 A;  3UL9 A;  3RW6 A;  4HQ1 A;  4ARN A;  4NKH A;  2BNH A;  1IO0 A;  3REZ A;  2CA6 A;  1YRG A;  2Z82 A;  4R09 A;  2V70 A;  3M19 A;  1H6U A;  5IJB A;  4LSC A;  3ZYO A;  4L3A A;  4XOS A;  3BZ5 A;  2UZY A;  4U7L A;  3WPB A;  2WFH A;  3RW7 A;  2Z81 A;  2UZX A;  1A4Y A;  3CIY A;  4FHO A;  4FMZ A;  1XWD C;  3DZE A;  3W3N A;  4R6J A;  5LFN A;  2Z7X B;  1QYY A;  3SB4 A;  3P72 A;  3RGZ A;  4XSQ A;  1O6T A;  4L3F A;  4KNG A;  4PKI G;  4LI1 A;  3RGX A;  4FDW A;  5AWC A;  3GOZ A;  3ZYI A;  4R6A A;  4UFR A;  3KJ4 A;  4LSX A;  1OZN A;  4XGO A;  4BSU A;  4GLP A;  1DFJ I;  1G9U A;  1XEU A;  4FCG A;  5CMN A;  4CNC A;  2OMU A;  3TSR E;  2OMV A;  3OJA B;  3M18 A;  4Z79 A;  3WPC A;  3G06 A;  5GQR K;  1OTM A;  2ASS B;  4M7E A;  2P1M B;  2OMX A;  5B0T A;  3W3L A;  3WPG A;  3WPD A;  3O53 A;  4CNM A;  2A0Z A;  2OMW A;  3ULU A;  3WPH A;  4R5C A;  3C6N B;  2P1N B;  4I6J B;  1P9A G;  2Z65 A;  4K17 A;  3E2J A;  1H6T A;  3W3M A;  4U06 A; 
#chains in the Genus database with same CATH homology
 4AY9 X;  4CC4 A;  2P1Q B;  5GS0 A;  1U0N D;  3W3K A;  3G3A A;  4M7E C;  3UL8 A;  4U08 A;  4LSA A;  3W3J A;  4J4L A;  5AWA A;  2ID5 A;  5AWD A;  4J0M A;  1OGQ A;  1XEC A;  2AST B;  4GT6 A;  5FTT B;  3OGM B;  3G04 C;  4QBZ A;  2P1P B;  4R5D A;  1ZIW A;  4KT1 A;  5GMG A;  3RFE A;  4R07 A;  3OGL B;  4C2A B;  3VQ1 A;  5B0N A;  4MN8 B;  4H09 A;  2WQX A;  2Z62 A;  1FS2 A;  2Z64 A;  3RFJ A;  4P91 A;  1PGV A;  1M0Z A;  1OOK G;  3CVR A;  4Z8G A;  2FT3 A;  3ZYJ A;  3E6J A;  4FS7 A;  2XWT C;  4R08 A;  4R58 A;  4ECO A;  3E3Z A;  1DCE A;  4LXS A;  3ULV A;  4LI2 A;  4B8C D;  1O6V A;  1XCD A;  1K5D C;  3G39 A;  2R9U A;  2OMT A;  1SQ0 B;  2V9S A;  2IFG A;  2WQU A;  4RCW A;  2Z7X A;  5HDH A;  4QC0 A;  3FXI A;  3ULA A;  3WPE A;  4OQT A;  4PQ8 A;  2Z63 A;  4Y61 B;  3UN9 A;  4BV4 R;  4WP6 A;  4V2E A;  2WQV A;  4YEB B;  4BSR A;  4LSX C;  4G8A A;  1P8T A;  3RIZ A;  5A5C A;  4Q3G A;  3ZYN A;  2BEX A;  2ELL A;  3W3G A;  2RR6 A;  2O6R A;  1O6S A;  4Q62 A;  1OTO A;  1K5G C;  4WYK A;  2OMZ A;  2Q4G W;  4Z61 C;  5D3I A;  3WPI A;  3E4G A;  3RFS A;  3OJA A;  3WN4 A;  1P8V A;  2XOT A;  2Y5Q A;  2JE1 A;  4CIL A;  3VQ2 A;  1M9L A;  1OTN A;  2V9T B;  1Z7X W;  1GWB A;  4PSJ A;  4BSS A;  4MQW X;  2O6S A;  5GS2 B;  4C2B B;  1KOH A;  5GMF A;  4R6G A;  1M10 B;  3RJ0 A;  4V2C A;  3O6N A;  3WPF A;  4EZG A;  1FQV A;  4U09 A;  4R6F A;  3UL7 A;  1WWL A;  2JE0 A;  1A9N A;  3G3B A;  4CC4 C;  1DS9 A;  4ECN A;  4TZH A;  2RA8 A;  4PER A;  5AWB A;  5AZ5 A;  4R0A A;  4IM6 A;  5CMP A;  4Z94 G;  1D0B A;  2WQW A;  5IYX C;  5GMH A;  4LXR A;  4ARR A;  1M9S A;  1JL5 A;  4QXE A;  3A79 B;  2OMY A;  5HZL B;  1KOO A;  5B4P A;  1W8A A;  2O6Q A;  4V2D A;  3C6O B;  3CIG A;  1FO1 A;  4KXF B;  4NKG A;  2P1O B;  4Q3I A;  2JQD A;  4RWT C;  1XKU A;  3JB9 j;  1LTX A;  3C6P B;  4RCA B;  4AW4 A;  4CP6 A;  5IJD A;  5IJC A;  3PMH G;  4FD0 A;  3OGK B;  4PEQ B;  2Z66 A;  4P8S A;  4Z64 C;  1FT8 A;  3UL9 A;  3RW6 A;  4HQ1 A;  4ARN A;  4NKH A;  2BNH A;  1IO0 A;  3REZ A;  2CA6 A;  1YRG A;  2Z82 A;  4R09 A;  2V70 A;  3M19 A;  1H6U A;  5IJB A;  4LSC A;  3ZYO A;  4L3A A;  4XOS A;  3BZ5 A;  2UZY A;  4U7L A;  3WPB A;  2WFH A;  3RW7 A;  2Z81 A;  2UZX A;  1A4Y A;  3CIY A;  4FHO A;  4FMZ A;  1XWD C;  3DZE A;  3W3N A;  4R6J A;  5LFN A;  2Z7X B;  1QYY A;  3SB4 A;  3P72 A;  3RGZ A;  4XSQ A;  1O6T A;  4L3F A;  4KNG A;  4PKI G;  4LI1 A;  3RGX A;  4FDW A;  5AWC A;  3GOZ A;  3ZYI A;  4R6A A;  4UFR A;  3KJ4 A;  4LSX A;  1OZN A;  4XGO A;  4BSU A;  4GLP A;  1DFJ I;  1G9U A;  1XEU A;  4FCG A;  5CMN A;  4CNC A;  2OMU A;  3TSR E;  2OMV A;  3OJA B;  3M18 A;  4Z79 A;  3WPC A;  3G06 A;  5GQR K;  1OTM A;  2ASS B;  4M7E A;  2P1M B;  2OMX A;  5B0T A;  3W3L A;  3WPG A;  3WPD A;  3O53 A;  4CNM A;  2A0Z A;  2OMW A;  3ULU A;  3WPH A;  4R5C A;  3C6N B;  2P1N B;  4I6J B;  1P9A G;  2Z65 A;  4K17 A;  3E2J A;  1H6T A;  3W3M A;  4U06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...