3TSRE

X-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
457
structure length
457
Chain Sequence
b'MMSLDIQCEQLSDARWTELLPLIQQYEVVRLDDCGLTEVRCKDISSAVQANPALTELSLRTNELGDGGVGLVLQGLQNPTCKIQKLSLQNCGLTEAGCGILPGMLRSLSTLRELHLNDNPMGDAGLKLLCEGLQDPQCRLEKLQLEYCNLTATSCEPLASVLRVKADFKELVLSNNDLHEPGVRILCQGLKDSACQLESLKLENCGITAANCKDLCDVVASKASLQELDLSSNKLGNAGIAALCPGLLLPSCKLRTLWLWECDITAEGCKDLCRVLRAKQSLKELSLASNELKDEGARLLCESLLEPGCQLESLWIKTCSLTAASCPYFCSVLTKSRSLLELQMSSNPLGDEGVQELCKALSQPDTVLRELWLGDCDVTNSGCSSLANVLLANRSLRELDLSNNCMGGPGVLQLLESLKQPSCTLQQLVLYDIYWTNEVEEQLRALEEERPSLRIIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease pancreatic
publication title Functional evolution of ribonuclease inhibitor: insights from birds and reptiles.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 202
structure length 457
sequence length 457
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13516 LRR_6 Leucine Rich repeat
E PF18779 LRR_RI_capping Capping Ribonuclease inhibitor Leucine Rich Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3tsrE00
2O6SA 1OTOA 4P8SA 3WN4A 3OJAB 4L3FA 1KOOA 4KT1A 2XWTC 4LXSA 2Y5QA 3O6NA 2P1QB 3SB4A 3JB9j 4H09A 3A79B 3WPBA 3C6NB 2WQXA 4U7LA 4R6GA 3ZYJA 3ULAA 1OTNA 2OMWA 4LSCA 2WQVA 4TZHA 3G04C 1XEUA 4FMZA 4FCGA 3RIZA 5LFNA 5AWBA 1FT8A 5AWAA 4ARRA 3KJ4A 2BEXA 2IFGA 4LXRA 2OMTA 1XCDA 4K17A 5IYXC 1OZNA 5GMGA 1P8TA 1SQ0B 3WPCA 4FD0A 1A4YA 1ZIWA 4GT6A 2RA8A 3E2JA 2WQWA 4BSUA 4KXFB 1H6TA 1H6UA 4CNCA 2V9SA 4PEQB 2UZYA 3RFSA 4R08A 5B0TA 5GS0A 1A9NA 4G8AA 5GMFA 2Z82A 4M7EC 4M7EA 1KOHA 3RGXA 2Q4GW 2OMYA 3ZYIA 3REZA 3WPIA 4R0AA 3W3GA 5CMPA 1O6SA 4J4LA 3UL7A 3UL8A 5B0NA 1WWLA 1FO1A 2ID5A 4UFRA 1M9SA 4B8CD 4R5DA 4CNMA 2Z7XB 4U09A 2O6QA 2BNHA 2FT3A 4I6JB 2Z62A 2V70A 3C6OB 4Q3IA 1M0ZA 2XOTA 1FQVA 1QYYA 4MQWX 2P1MB 4PQ8A 1GWBA 3UL9A 3G3BA 3P72A 1LTXA 4BV4R 2RR6A 4Z94G 2CA6A 5GS2B 3W3MA 2JE1A 3RJ0A 4QBZA 1XKUA 4LI2A 3WPEA 4KNGA 3VQ1A 4BSSA 2R9UA 1DS9A 1JL5A 4Z61C 3CIGA 3FXIA 5AWDA 2OMVA 3E3ZA 4WP6A 4IM6A 4RWTC 1G9UA 4Z79A 1O6TA 1OGQA 4P91A 3E6JA 5GMHA 4AW4A 2P1NB 4Q3GA 2OMXA 3GOZA 3W3NA 4R09A 3OJAA 4R07A 4RCAB 4PERA 4C2BB 2OMUA 1PGVA 3TSRE 3ULUA 3VQ2A 4CC4C 4CC4A 2Z66A 3UN9A 3ZYOA 4BSRA 3RFEA 5HDHA 4L3AA 3WPGA 4V2CA 4LSAA 3BZ5A 1U0ND 4V2DA 1XECA 4R58A 4Z64C 4OQTA 2ASTB 1W8AA 4PKIG 2Z64A 3G39A 2OMZA 4QC0A 5AZ5A 1DFJI 1IO0A 3PMHG 4U08A 4XOSA 4RCWA 4Z8GA 3M18A 3W3KA 3W3LA 4NKGA 3ZYNA 3RFJA 2WFHA 2O6RA 4EZGA 4CILA 2UZXA 1K5DC 4WYKA 4ECOA 4AY9X 1OOKG 4V2EA 4QXEA 1K5GC 3CVRA 5IJCA 1D0BA 5HZLB 4Y61B 1Z7XW 4R6JA 3RW6A 4FHOA 5IJDA 1XWDC 2JE0A 2A0ZA 4MN8B 2V9TB 2Z65A 3G3AA 5IJBA 3WPFA 3ULVA 1M9LA 4CP6A 2Z7XA 2Z63A 3OGMB 2WQUA 3CIYA 4R6FA 5D3IA 2P1OB 2Z81A 3O53A 3W3JA 3RW7A 5A5CA 5B4PA 4R6AA 4XGOA 2JQDA 1FS2A 1OTMA 3G06A 4Q62A 3RGZA 3DZEA 4LSXC 4LSXA 5AWCA 2P1PB 5FTTB 3M19A 4PSJA 2ASSB 1DCEA 4U06A 4FS7A 5GQRK 3WPDA 4XSQA 1P8VA 4HQ1A 4FDWA 3WPHA 4C2AB 1P9AG 3OGKB 4NKHA 1YRGA 2ELLA 3E4GA 3C6PB 4ARNA 4J0MA 5CMNA 4YEBB 4GLPA 4LI1A 1M10B 3OGLB 1O6VA 4R5CA 4ECNA
chains in the Genus database with same CATH superfamily
2O6SA 1OTOA 4P8SA 3WN4A 3OJAB 4L3FA 1KOOA 4KT1A 2XWTC 4LXSA 2Y5QA 3O6NA 2P1QB 3SB4A 3JB9j 4H09A 3A79B 3WPBA 3C6NB 2WQXA 4U7LA 4R6GA 3ZYJA 3ULAA 1OTNA 2OMWA 4LSCA 2WQVA 4TZHA 3G04C 1XEUA 4FMZA 4FCGA 3RIZA 5LFNA 5AWBA 1FT8A 5AWAA 4ARRA 3KJ4A 2BEXA 2IFGA 4NZRM 4LXRA 2OMTA 1XCDA 4K17A 5IYXC 1OZNA 5GMGA 1P8TA 1SQ0B 3WPCA 4FD0A 1A4YA 1ZIWA 4GT6A 2RA8A 3E2JA 2WQWA 4BSUA 4KXFB 1H6TA 1H6UA 4CNCA 2V9SA 4PEQB 2UZYA 3RFSA 4R08A 5B0TA 5GS0A 1A9NA 4G8AA 5GMFA 2Z82A 4M7EC 4M7EA 1KOHA 3RGXA 2Q4GW 2OMYA 3ZYIA 3REZA 3WPIA 4R0AA 3W3GA 5CMPA 1O6SA 4J4LA 3UL7A 3UL8A 5B0NA 1WWLA 1FO1A 2ID5A 4UFRA 1M9SA 4B8CD 4R5DA 4CNMA 2Z7XB 4U09A 2O6QA 2BNHA 2FT3A 4I6JB 2Z62A 2V70A 3C6OB 4Q3IA 1M0ZA 2XOTA 1FQVA 1QYYA 4MQWX 2P1MB 4PQ8A 1GWBA 3UL9A 3G3BA 3P72A 1LTXA 4BV4R 2RR6A 4Z94G 2CA6A 5GS2B 3W3MA 2JE1A 3RJ0A 4QBZA 1XKUA 4LI2A 3WPEA 4KNGA 3VQ1A 4BSSA 2R9UA 1DS9A 1JL5A 4Z61C 3CIGA 3FXIA 5AWDA 2OMVA 3E3ZA 4WP6A 4IM6A 4RWTC 1G9UA 4Z79A 1O6TA 1OGQA 4P91A 3E6JA 5GMHA 4AW4A 2P1NB 4Q3GA 2OMXA 3GOZA 3W3NA 4R09A 3OJAA 4R07A 4RCAB 4PERA 4C2BB 2OMUA 1PGVA 3TSRE 3ULUA 3VQ2A 4CC4C 4CC4A 2Z66A 3UN9A 3ZYOA 4BSRA 3RFEA 5HDHA 4L3AA 3WPGA 4V2CA 4LSAA 3BZ5A 1U0ND 4V2DA 1XECA 4R58A 4Z64C 4OQTA 2ASTB 1W8AA 4PKIG 2Z64A 3G39A 2OMZA 4QC0A 5AZ5A 1DFJI 1IO0A 3PMHG 4U08A 4XOSA 4RCWA 4Z8GA 3M18A 3W3KA 3W3LA 4NKGA 3ZYNA 3RFJA 2WFHA 2O6RA 4EZGA 4CILA 2UZXA 1K5DC 4WYKA 4ECOA 4AY9X 1OOKG 4V2EA 4QXEA 1K5GC 3CVRA 5IJCA 1D0BA 5HZLB 4Y61B 1Z7XW 4R6JA 3RW6A 4FHOA 5IJDA 1XWDC 2JE0A 2A0ZA 4MN8B 2V9TB 2Z65A 3G3AA 5IJBA 3WPFA 3ULVA 1M9LA 4CP6A 2Z7XA 2Z63A 3OGMB 2WQUA 3CIYA 4R6FA 5D3IA 2P1OB 2Z81A 3O53A 3W3JA 3RW7A 5A5CA 5B4PA 4R6AA 4XGOA 2JQDA 1FS2A 1OTMA 3G06A 4Q62A 3RGZA 3DZEA 4LSXC 4LSXA 5AWCA 2P1PB 5FTTB 3M19A 4PSJA 2ASSB 1DCEA 4U06A 4FS7A 5GQRK 3WPDA 4XSQA 1P8VA 4HQ1A 4FDWA 3WPHA 4C2AB 4NZTM 1P9AG 3OGKB 4NKHA 1YRGA 2ELLA 3E4GA 3C6PB 4ARNA 4J0MA 5CMNA 4YEBB 4GLPA 4LI1A 1M10B 3OGLB 1O6VA 4R5CA 4ECNA
chains in the Genus database with same CATH topology
2O6SA 1OTOA 4P8SA 3WN4A 3OJAB 4L3FA 1KOOA 4KT1A 2XWTC 4LXSA 2Y5QA 3O6NA 2P1QB 3SB4A 3JB9j 4H09A 3A79B 3WPBA 3C6NB 2WQXA 4U7LA 4R6GA 3ZYJA 3ULAA 1OTNA 2OMWA 4LSCA 2WQVA 4TZHA 3G04C 1XEUA 4FMZA 4FCGA 3RIZA 5LFNA 5AWBA 1FT8A 5AWAA 4ARRA 3KJ4A 2BEXA 2IFGA 4LXRA 2OMTA 1XCDA 4K17A 5IYXC 1OZNA 5GMGA 1P8TA 1SQ0B 3WPCA 4FD0A 1A4YA 1ZIWA 4GT6A 2RA8A 3E2JA 2WQWA 4BSUA 4KXFB 1H6TA 1H6UA 4CNCA 2V9SA 4PEQB 2UZYA 3RFSA 4R08A 5B0TA 5GS0A 1A9NA 4G8AA 5GMFA 2Z82A 4M7EC 4M7EA 1KOHA 3RGXA 2Q4GW 2OMYA 3ZYIA 3REZA 3WPIA 4R0AA 3W3GA 5CMPA 1O6SA 4J4LA 3UL7A 3UL8A 5B0NA 1WWLA 1FO1A 2ID5A 4UFRA 1M9SA 4B8CD 4R5DA 4CNMA 2Z7XB 4U09A 2O6QA 2BNHA 2FT3A 4I6JB 2Z62A 2V70A 3C6OB 4Q3IA 1M0ZA 2XOTA 1FQVA 1QYYA 4MQWX 2P1MB 4PQ8A 1GWBA 3UL9A 3G3BA 3P72A 1LTXA 4BV4R 2RR6A 4Z94G 2CA6A 5GS2B 3W3MA 2JE1A 3RJ0A 4QBZA 1XKUA 4LI2A 3WPEA 4KNGA 3VQ1A 4BSSA 2R9UA 1DS9A 1JL5A 4Z61C 3CIGA 3FXIA 5AWDA 2OMVA 3E3ZA 4WP6A 4IM6A 4RWTC 1G9UA 4Z79A 1O6TA 1OGQA 4P91A 3E6JA 5GMHA 4AW4A 2P1NB 4Q3GA 2OMXA 3GOZA 3W3NA 4R09A 3OJAA 4R07A 4RCAB 4PERA 4C2BB 2OMUA 1PGVA 3TSRE 3ULUA 3VQ2A 4CC4C 4CC4A 2Z66A 3UN9A 3ZYOA 4BSRA 3RFEA 5HDHA 4L3AA 3WPGA 4V2CA 4LSAA 3BZ5A 1U0ND 4V2DA 1XECA 4R58A 4Z64C 4OQTA 2ASTB 1W8AA 4PKIG 2Z64A 3G39A 2OMZA 4QC0A 5AZ5A 1DFJI 1IO0A 3PMHG 4U08A 4XOSA 4RCWA 4Z8GA 3M18A 3W3KA 3W3LA 4NKGA 3ZYNA 3RFJA 2WFHA 2O6RA 4EZGA 4CILA 2UZXA 1K5DC 4WYKA 4ECOA 4AY9X 1OOKG 4V2EA 4QXEA 1K5GC 3CVRA 5IJCA 1D0BA 5HZLB 4Y61B 1Z7XW 4R6JA 3RW6A 4FHOA 5IJDA 1XWDC 2JE0A 2A0ZA 4MN8B 2V9TB 2Z65A 3G3AA 5IJBA 3WPFA 3ULVA 1M9LA 4CP6A 2Z7XA 2Z63A 3OGMB 2WQUA 3CIYA 4R6FA 5D3IA 2P1OB 2Z81A 3O53A 3W3JA 3RW7A 5A5CA 5B4PA 4R6AA 4XGOA 2JQDA 1FS2A 1OTMA 3G06A 4Q62A 3RGZA 3DZEA 4LSXC 4LSXA 5AWCA 2P1PB 5FTTB 3M19A 4PSJA 2ASSB 1DCEA 4U06A 4FS7A 5GQRK 3WPDA 4XSQA 1P8VA 4HQ1A 4FDWA 3WPHA 4C2AB 1P9AG 3OGKB 4NKHA 1YRGA 2ELLA 3E4GA 3C6PB 4ARNA 4J0MA 5CMNA 4YEBB 4GLPA 4LI1A 1M10B 3OGLB 1O6VA 4R5CA 4ECNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6S A;  1OTO A;  4P8S A;  3WN4 A;  3OJA B;  4L3F A;  1KOO A;  4KT1 A;  2XWT C;  4LXS A;  2Y5Q A;  3O6N A;  2P1Q B;  3SB4 A;  3JB9 j;  4H09 A;  3A79 B;  3WPB A;  3C6N B;  2WQX A;  4U7L A;  4R6G A;  3ZYJ A;  3ULA A;  1OTN A;  2OMW A;  4LSC A;  2WQV A;  4TZH A;  3G04 C;  1XEU A;  4FMZ A;  4FCG A;  3RIZ A;  5LFN A;  5AWB A;  1FT8 A;  5AWA A;  4ARR A;  3KJ4 A;  2BEX A;  2IFG A;  4LXR A;  2OMT A;  1XCD A;  4K17 A;  5IYX C;  1OZN A;  5GMG A;  1P8T A;  1SQ0 B;  3WPC A;  4FD0 A;  1A4Y A;  1ZIW A;  4GT6 A;  2RA8 A;  3E2J A;  2WQW A;  4BSU A;  4KXF B;  1H6T A;  1H6U A;  4CNC A;  2V9S A;  4PEQ B;  2UZY A;  3RFS A;  4R08 A;  5B0T A;  5GS0 A;  1A9N A;  4G8A A;  5GMF A;  2Z82 A;  4M7E C;  4M7E A;  1KOH A;  3RGX A;  2Q4G W;  2OMY A;  3ZYI A;  3REZ A;  3WPI A;  4R0A A;  3W3G A;  5CMP A;  1O6S A;  4J4L A;  3UL7 A;  3UL8 A;  5B0N A;  1WWL A;  1FO1 A;  2ID5 A;  4UFR A;  1M9S A;  4B8C D;  4R5D A;  4CNM A;  2Z7X B;  4U09 A;  2O6Q A;  2BNH A;  2FT3 A;  4I6J B;  2Z62 A;  2V70 A;  3C6O B;  4Q3I A;  1M0Z A;  2XOT A;  1FQV A;  1QYY A;  4MQW X;  2P1M B;  4PQ8 A;  1GWB A;  3UL9 A;  3G3B A;  3P72 A;  1LTX A;  4BV4 R;  2RR6 A;  4Z94 G;  2CA6 A;  5GS2 B;  3W3M A;  2JE1 A;  3RJ0 A;  4QBZ A;  1XKU A;  4LI2 A;  3WPE A;  4KNG A;  3VQ1 A;  4BSS A;  2R9U A;  1DS9 A;  1JL5 A;  4Z61 C;  3CIG A;  3FXI A;  5AWD A;  2OMV A;  3E3Z A;  4WP6 A;  4IM6 A;  4RWT C;  1G9U A;  4Z79 A;  1O6T A;  1OGQ A;  4P91 A;  3E6J A;  5GMH A;  4AW4 A;  2P1N B;  4Q3G A;  2OMX A;  3GOZ A;  3W3N A;  4R09 A;  3OJA A;  4R07 A;  4RCA B;  4PER A;  4C2B B;  2OMU A;  1PGV A;  3TSR E;  3ULU A;  3VQ2 A;  4CC4 C;  4CC4 A;  2Z66 A;  3UN9 A;  3ZYO A;  4BSR A;  3RFE A;  5HDH A;  4L3A A;  3WPG A;  4V2C A;  4LSA A;  3BZ5 A;  1U0N D;  4V2D A;  1XEC A;  4R58 A;  4Z64 C;  4OQT A;  2AST B;  1W8A A;  4PKI G;  2Z64 A;  3G39 A;  2OMZ A;  4QC0 A;  5AZ5 A;  1DFJ I;  1IO0 A;  3PMH G;  4U08 A;  4XOS A;  4RCW A;  4Z8G A;  3M18 A;  3W3K A;  3W3L A;  4NKG A;  3ZYN A;  3RFJ A;  2WFH A;  2O6R A;  4EZG A;  4CIL A;  2UZX A;  1K5D C;  4WYK A;  4ECO A;  4AY9 X;  1OOK G;  4V2E A;  4QXE A;  1K5G C;  3CVR A;  5IJC A;  1D0B A;  5HZL B;  4Y61 B;  1Z7X W;  4R6J A;  3RW6 A;  4FHO A;  5IJD A;  1XWD C;  2JE0 A;  2A0Z A;  4MN8 B;  2V9T B;  2Z65 A;  3G3A A;  5IJB A;  3WPF A;  3ULV A;  1M9L A;  4CP6 A;  2Z7X A;  2Z63 A;  3OGM B;  2WQU A;  3CIY A;  4R6F A;  5D3I A;  2P1O B;  2Z81 A;  3O53 A;  3W3J A;  3RW7 A;  5A5C A;  5B4P A;  4R6A A;  4XGO A;  2JQD A;  1FS2 A;  1OTM A;  3G06 A;  4Q62 A;  3RGZ A;  3DZE A;  4LSX C;  4LSX A;  5AWC A;  2P1P B;  5FTT B;  3M19 A;  4PSJ A;  2ASS B;  1DCE A;  4U06 A;  4FS7 A;  5GQR K;  3WPD A;  4XSQ A;  1P8V A;  4HQ1 A;  4FDW A;  3WPH A;  4C2A B;  1P9A G;  3OGK B;  4NKH A;  1YRG A;  2ELL A;  3E4G A;  3C6P B;  4ARN A;  4J0M A;  5CMN A;  4YEB B;  4GLP A;  4LI1 A;  1M10 B;  3OGL B;  1O6V A;  4R5C A;  4ECN A; 
#chains in the Genus database with same CATH topology
 2O6S A;  1OTO A;  4P8S A;  3WN4 A;  3OJA B;  4L3F A;  1KOO A;  4KT1 A;  2XWT C;  4LXS A;  2Y5Q A;  3O6N A;  2P1Q B;  3SB4 A;  3JB9 j;  4H09 A;  3A79 B;  3WPB A;  3C6N B;  2WQX A;  4U7L A;  4R6G A;  3ZYJ A;  3ULA A;  1OTN A;  2OMW A;  4LSC A;  2WQV A;  4TZH A;  3G04 C;  1XEU A;  4FMZ A;  4FCG A;  3RIZ A;  5LFN A;  5AWB A;  1FT8 A;  5AWA A;  4ARR A;  3KJ4 A;  2BEX A;  2IFG A;  4NZR M;  4LXR A;  2OMT A;  1XCD A;  4K17 A;  5IYX C;  1OZN A;  5GMG A;  1P8T A;  1SQ0 B;  3WPC A;  4FD0 A;  1A4Y A;  1ZIW A;  4GT6 A;  2RA8 A;  3E2J A;  2WQW A;  4BSU A;  4KXF B;  1H6T A;  1H6U A;  4CNC A;  2V9S A;  4PEQ B;  2UZY A;  3RFS A;  4R08 A;  5B0T A;  5GS0 A;  1A9N A;  4G8A A;  5GMF A;  2Z82 A;  4M7E C;  4M7E A;  1KOH A;  3RGX A;  2Q4G W;  2OMY A;  3ZYI A;  3REZ A;  3WPI A;  4R0A A;  3W3G A;  5CMP A;  1O6S A;  4J4L A;  3UL7 A;  3UL8 A;  5B0N A;  1WWL A;  1FO1 A;  2ID5 A;  4UFR A;  1M9S A;  4B8C D;  4R5D A;  4CNM A;  2Z7X B;  4U09 A;  2O6Q A;  2BNH A;  2FT3 A;  4I6J B;  2Z62 A;  2V70 A;  3C6O B;  4Q3I A;  1M0Z A;  2XOT A;  1FQV A;  1QYY A;  4MQW X;  2P1M B;  4PQ8 A;  1GWB A;  3UL9 A;  3G3B A;  3P72 A;  1LTX A;  4BV4 R;  2RR6 A;  4Z94 G;  2CA6 A;  5GS2 B;  3W3M A;  2JE1 A;  3RJ0 A;  4QBZ A;  1XKU A;  4LI2 A;  3WPE A;  4KNG A;  3VQ1 A;  4BSS A;  2R9U A;  1DS9 A;  1JL5 A;  4Z61 C;  3CIG A;  3FXI A;  5AWD A;  2OMV A;  3E3Z A;  4WP6 A;  4IM6 A;  4RWT C;  1G9U A;  4Z79 A;  1O6T A;  1OGQ A;  4P91 A;  3E6J A;  5GMH A;  4AW4 A;  2P1N B;  4Q3G A;  2OMX A;  3GOZ A;  3W3N A;  4R09 A;  3OJA A;  4R07 A;  4RCA B;  4PER A;  4C2B B;  2OMU A;  1PGV A;  3TSR E;  3ULU A;  3VQ2 A;  4CC4 C;  4CC4 A;  2Z66 A;  3UN9 A;  3ZYO A;  4BSR A;  3RFE A;  5HDH A;  4L3A A;  3WPG A;  4V2C A;  4LSA A;  3BZ5 A;  1U0N D;  4V2D A;  1XEC A;  4R58 A;  4Z64 C;  4OQT A;  2AST B;  1W8A A;  4PKI G;  2Z64 A;  3G39 A;  2OMZ A;  4QC0 A;  5AZ5 A;  1DFJ I;  1IO0 A;  3PMH G;  4U08 A;  4XOS A;  4RCW A;  4Z8G A;  3M18 A;  3W3K A;  3W3L A;  4NKG A;  3ZYN A;  3RFJ A;  2WFH A;  2O6R A;  4EZG A;  4CIL A;  2UZX A;  1K5D C;  4WYK A;  4ECO A;  4AY9 X;  1OOK G;  4V2E A;  4QXE A;  1K5G C;  3CVR A;  5IJC A;  1D0B A;  5HZL B;  4Y61 B;  1Z7X W;  4R6J A;  3RW6 A;  4FHO A;  5IJD A;  1XWD C;  2JE0 A;  2A0Z A;  4MN8 B;  2V9T B;  2Z65 A;  3G3A A;  5IJB A;  3WPF A;  3ULV A;  1M9L A;  4CP6 A;  2Z7X A;  2Z63 A;  3OGM B;  2WQU A;  3CIY A;  4R6F A;  5D3I A;  2P1O B;  2Z81 A;  3O53 A;  3W3J A;  3RW7 A;  5A5C A;  5B4P A;  4R6A A;  4XGO A;  2JQD A;  1FS2 A;  1OTM A;  3G06 A;  4Q62 A;  3RGZ A;  3DZE A;  4LSX C;  4LSX A;  5AWC A;  2P1P B;  5FTT B;  3M19 A;  4PSJ A;  2ASS B;  1DCE A;  4U06 A;  4FS7 A;  5GQR K;  3WPD A;  4XSQ A;  1P8V A;  4HQ1 A;  4FDW A;  3WPH A;  4C2A B;  4NZT M;  1P9A G;  3OGK B;  4NKH A;  1YRG A;  2ELL A;  3E4G A;  3C6P B;  4ARN A;  4J0M A;  5CMN A;  4YEB B;  4GLP A;  4LI1 A;  1M10 B;  3OGL B;  1O6V A;  4R5C A;  4ECN A; 
#chains in the Genus database with same CATH homology
 2O6S A;  1OTO A;  4P8S A;  3WN4 A;  3OJA B;  4L3F A;  1KOO A;  4KT1 A;  2XWT C;  4LXS A;  2Y5Q A;  3O6N A;  2P1Q B;  3SB4 A;  3JB9 j;  4H09 A;  3A79 B;  3WPB A;  3C6N B;  2WQX A;  4U7L A;  4R6G A;  3ZYJ A;  3ULA A;  1OTN A;  2OMW A;  4LSC A;  2WQV A;  4TZH A;  3G04 C;  1XEU A;  4FMZ A;  4FCG A;  3RIZ A;  5LFN A;  5AWB A;  1FT8 A;  5AWA A;  4ARR A;  3KJ4 A;  2BEX A;  2IFG A;  4LXR A;  2OMT A;  1XCD A;  4K17 A;  5IYX C;  1OZN A;  5GMG A;  1P8T A;  1SQ0 B;  3WPC A;  4FD0 A;  1A4Y A;  1ZIW A;  4GT6 A;  2RA8 A;  3E2J A;  2WQW A;  4BSU A;  4KXF B;  1H6T A;  1H6U A;  4CNC A;  2V9S A;  4PEQ B;  2UZY A;  3RFS A;  4R08 A;  5B0T A;  5GS0 A;  1A9N A;  4G8A A;  5GMF A;  2Z82 A;  4M7E C;  4M7E A;  1KOH A;  3RGX A;  2Q4G W;  2OMY A;  3ZYI A;  3REZ A;  3WPI A;  4R0A A;  3W3G A;  5CMP A;  1O6S A;  4J4L A;  3UL7 A;  3UL8 A;  5B0N A;  1WWL A;  1FO1 A;  2ID5 A;  4UFR A;  1M9S A;  4B8C D;  4R5D A;  4CNM A;  2Z7X B;  4U09 A;  2O6Q A;  2BNH A;  2FT3 A;  4I6J B;  2Z62 A;  2V70 A;  3C6O B;  4Q3I A;  1M0Z A;  2XOT A;  1FQV A;  1QYY A;  4MQW X;  2P1M B;  4PQ8 A;  1GWB A;  3UL9 A;  3G3B A;  3P72 A;  1LTX A;  4BV4 R;  2RR6 A;  4Z94 G;  2CA6 A;  5GS2 B;  3W3M A;  2JE1 A;  3RJ0 A;  4QBZ A;  1XKU A;  4LI2 A;  3WPE A;  4KNG A;  3VQ1 A;  4BSS A;  2R9U A;  1DS9 A;  1JL5 A;  4Z61 C;  3CIG A;  3FXI A;  5AWD A;  2OMV A;  3E3Z A;  4WP6 A;  4IM6 A;  4RWT C;  1G9U A;  4Z79 A;  1O6T A;  1OGQ A;  4P91 A;  3E6J A;  5GMH A;  4AW4 A;  2P1N B;  4Q3G A;  2OMX A;  3GOZ A;  3W3N A;  4R09 A;  3OJA A;  4R07 A;  4RCA B;  4PER A;  4C2B B;  2OMU A;  1PGV A;  3TSR E;  3ULU A;  3VQ2 A;  4CC4 C;  4CC4 A;  2Z66 A;  3UN9 A;  3ZYO A;  4BSR A;  3RFE A;  5HDH A;  4L3A A;  3WPG A;  4V2C A;  4LSA A;  3BZ5 A;  1U0N D;  4V2D A;  1XEC A;  4R58 A;  4Z64 C;  4OQT A;  2AST B;  1W8A A;  4PKI G;  2Z64 A;  3G39 A;  2OMZ A;  4QC0 A;  5AZ5 A;  1DFJ I;  1IO0 A;  3PMH G;  4U08 A;  4XOS A;  4RCW A;  4Z8G A;  3M18 A;  3W3K A;  3W3L A;  4NKG A;  3ZYN A;  3RFJ A;  2WFH A;  2O6R A;  4EZG A;  4CIL A;  2UZX A;  1K5D C;  4WYK A;  4ECO A;  4AY9 X;  1OOK G;  4V2E A;  4QXE A;  1K5G C;  3CVR A;  5IJC A;  1D0B A;  5HZL B;  4Y61 B;  1Z7X W;  4R6J A;  3RW6 A;  4FHO A;  5IJD A;  1XWD C;  2JE0 A;  2A0Z A;  4MN8 B;  2V9T B;  2Z65 A;  3G3A A;  5IJB A;  3WPF A;  3ULV A;  1M9L A;  4CP6 A;  2Z7X A;  2Z63 A;  3OGM B;  2WQU A;  3CIY A;  4R6F A;  5D3I A;  2P1O B;  2Z81 A;  3O53 A;  3W3J A;  3RW7 A;  5A5C A;  5B4P A;  4R6A A;  4XGO A;  2JQD A;  1FS2 A;  1OTM A;  3G06 A;  4Q62 A;  3RGZ A;  3DZE A;  4LSX C;  4LSX A;  5AWC A;  2P1P B;  5FTT B;  3M19 A;  4PSJ A;  2ASS B;  1DCE A;  4U06 A;  4FS7 A;  5GQR K;  3WPD A;  4XSQ A;  1P8V A;  4HQ1 A;  4FDW A;  3WPH A;  4C2A B;  1P9A G;  3OGK B;  4NKH A;  1YRG A;  2ELL A;  3E4G A;  3C6P B;  4ARN A;  4J0M A;  5CMN A;  4YEB B;  4GLP A;  4LI1 A;  1M10 B;  3OGL B;  1O6V A;  4R5C A;  4ECN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...