3TSSA

Toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
NIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRIKKSQHTSEGTWIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFKIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 63
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tssA01
1FNVA 3BZDB 1FGBD 3BVMA 1B1ZA 2AQ2B 1FNUA 4TSSA 2XRSD 2CHBD 1PRTD 1SJHD 2RDGA 4BWGB 3DWQA 1YN3A 1DJRD 1HQRD 1LTTD 2XRQD 1EU4A 1QILA 1D5MC 1TS5A 1LTID 2R61A 1ESFA 1PZKD 3W2DA 1SEBD 2IJ0A 1SE2A 2NTTA 4RGMA 1CQVA 1EEFD 1STEA 1PTOD 1LTBD 2G9HD 1SJED 1HA5A 1BCPB 1I4GA 1PZJD 1S5FD 2SEBD 1EFID 1HTLD 5ELFA 1RDPD 1SBBB 2O2LD 1I4RA 1S5ED 1TS4A 5ELEA 1LO5D 1LTRD 1D5ZC 3DWPA 3MFGA 1LTAD 1SXTA 1I4HA 1KLUD 5D3IB 4RHRA 3BYYB 1XTCD 1LT5D 1LTSD 1PRTB 1L0YB 1CT1D 1XXGA 4K6LA 3BYTB 1EEID 1JWSD 1CHQD 2RDHA 4RFBA 1V1PA 1CHPD 1KTKA 1ET9A 1V1OA 5I4DA 1BXTA 1JQYD 3TSSA 1AN8A 1RF2D 1EWCA 4RH6A 4L63B 3CHBD 1UNSA 1PRTC 4RCOA 1GOZA 1ET6A 1PYWD 5ELDA 1PRTF 1JWUD 1FD7D 4ZYSA 1LTGD 3DWAA 1I4XA 1B44D 4O1NA 1L0XB 2XN9C 1M4VA 5ELBA 2TSSA 1LT3D 2QEJC 1S5CD 5D3DA 3BVZA 1JR0D 4RHSA 4Z9CB 2IPKD 1LLRD 1PZID 1V1PB 1FNWA 3KLSX 1EU3A 3MC0B 1PTOC 3SEBA 4DXGA 1ENFA 1I4PA 1BCPF 2AQ1B 4DXFA 1BCPD 5FKAC 4UDUC 3URYA 1YN5A 1PTOB 3BVGA 1SE4A 1TS2A 1UUPA 1BCPC 1T5XD 2WV6D 1I4QA 1LT4D 1D6EC 4OHJA 1DYQA 3EFXD 1AW7A 3OWEB 3R2IA 5FK9C 3GP7A 3R8BA 3V05A 1SE3A 1TY0A 2ICIA 1PTOF 1HXYD 2Z8LA 1MD2D 1TS3A 2QILA 4L6TB 4C56C 1KLGD 3EA6A 2AQ3B 1JCKB 3R2TA 1PTOH 4RGNA 1YN4A 1CK1A 4NZLB 2J4XA 3O13A 5ELCA 1RD9D 1S5DD 1G8ZD 1JWMD 2NTSA 1LT6D 1RCVD 2XNAC 1TY2A 4RGOS 4RGTA 5TSSA 1S5BD 1F77A 1D5XC
chains in the Genus database with same CATH superfamily
2ZT9C 4ID6A 2K52A 2KWUB 4A3PA 5T1GA 4HJGE 1VQIA 3C46A 3S24A 2NZHA 3Q6BA 4QGUA 1LTTD 3NS8A 2GBKA 3UIOB 3F1ZA 1SF0A 4LJPB 3ML9A 1Q1BA 4TMAB 4DXAB 4E74A 4WAAA 2PE6B 1II3A 2F3WA 1V49A 1L2NA 4DR4Q 2B63G 1OQYA 3ZRFA 3OIPA 2IO2B 4YWLA 5JH5C 1Y1VH 1EYAA 4Q5VA 1DOMA 4CKBA 3JSVB 1EIFA 2JP1A 1UF0A 2KCNA 2CCZA 2I1JA 3VTWA 4WQOB 4B0EA 2XTIA 3Q6SA 4KDLB 2ICEC 1ENAA 1HA5A 1RTNA 4IN3A 1S5FD 1JRPA 2OT2A 2YTYA 2N88A 1HTPA 2O2LD 1TS4A 5E1FA 3Q23A 1Q86C 1KD1C 1JALA 2Z9HA 1IBXA 2GBMA 2G4DB 1UWMA 3DWPA 2SAKA 4TQ0A 1E3PA 2F0OA 3GTKB 2A6ED 4K3BA 1MBYA 4PV1C 1XXGA 4IPHA 1K53A 3AEEB 1JWSD 3PT2B 1M8AA 5CV6A 1QG7A 4D2KA 1KTKA 2MPMA 1JWBD 2ONQA 2WQYB 4UPAA 4X64Q 3F2UA 4IUUA 4M0WA 4IM2A 3H0GH 4E3CA 3HOVH 1YJNA 2IL8A 3BG3A 1SDFA 2M2LA 2PQAA 3K0YA 1LXDA 5H92C 1CZWA 3ERSX 3OTOQ 4HKZE 1PH1A 2DHZA 2RBMA 2NYZD 3Q2AC 3AQQA 4LDTD 1Y8OB 1M4VA 1IL8A 1WD1A 3A8JE 4BY1H 2IO1B 4R4TA 2AYOB 5GXGB 1EU3A 4A3GB 1OXTA 1ZE3D 2F0WA 2LMCB 3RZWC 2KMCA 4KDIC 4XC2A 4WJ3M 1DCZA 1KAWA 1XMQL 4HCSA 2B2YA 4KD4A 2HIXA 2K3UA 2KQ7A 1V9PA 2Q2IA 4KY5A 2BWES 2VUMB 4REZA 5KEEA 3EFXD 3V05A 1QT9A 4L2YA 3J7AF 1PH6A 3KK7A 1H9RA 2WDQB 3IAS1 2IW3A 3NWTA 1MD2D 4JBJA 1Q1EA 4AQYQ 3ERQA 2CHZA 1YN4A 2YEPF 3U2SC 3K5MA 1ILQA 2K05A 2LXKA 3QJYA 1QVCA 4IZ8A 1QZGA 1Y1VB 4H44C 1NSNS 3K59A 3RPFC 2A6HD 4GLVB 4AH6A 2B2WA 3M3JA 1DOXA 1A3TA 1EQTA 1TY2A 4WJNA 2JRHA 1L1OA 1IYJB 1SIFA 1WR1A 1QZHA 1OXXK 1RAXA 4X65L 2Z4HA 3WWVA 3Q3OC 4JX1C 3HOZH 2H89B 1WTHA 3RZOB 5CV4A 2HQLA 2AL3A 3BVMA 1Z47A 2F0KA 2AQ2B 4GDKA 5JJIA 3LNNA 2OCEA 1A2UA 5IT9E 2JVCA 4YSZB 1P1AA 3QX1A 1B70B 4OZAA 2AWTA 3AU7A 4LF8Q 4EQ5A 1PH2A 3VHTC 1H9SA 3KOJA 5E6OA 4NPSA 4ARCA 1TWHH 2H88B 4MELA 5J1ZA 2WXKA 4WAFA 4ZRPA 4DUYQ 2JXXA 5BMGA 4IWPA 5IYCG 5C4ZA 3SFEB 3A8IE 2ZJQA 2V1YA 2NTTA 4BKGA 2FUG1 1O78A 2C7NB 3KUDB 3VVWB 3A7AB 4R4CA 1B2TA 2Q5WD 3GTPH 1SBBB 4NNJB 4S17A 1I4RA 4FVMA 5IP7G 2G45B 1Q5WB 2KEDA 5C4JH 3DVGX 1R4NB 3D31A 2YV5A 3AH7A 2HQEA 1RWSA 4P74A 1C0AA 1LTLA 4DR5Q 1CQFA 4LF7Q 1UD7A 4JI6L 1YX6B 4M0WB 4YSYB 1VF5C 5NUCA 1DD2A 4QY7A 2DZIA 3H91A 3H6NA 1PGAA 5FLMH 3JAML 2QGQA 5GAHC 1V2YA 2WU5B 4WRDA 4ZRIA 3Q69A 4B6WA 1V1PA 1V1OA 1YNJC 2FXQA 1YHBA 1N33Q 2RR9A 5IT9L 1ZPSA 4H2AA 1V8QA 4W9DA 2AHOB 1SFOB 3J80c 1VZ6A 4ZHOA 4KY6A 3DVNV 1EYGA 2VZAA 5BMIA 5D65A 2VUMH 5T1IA 2Y0SE 3TP5A 2UXDQ 2BBCA 2AL6A 2L12A 4TRDA 3VR9B 4A3DH 1ZGUB 1ZXIA 5JJKA 1XMQQ 1BMLC 4NMZA 4K7SA 1P9DU 2A5UA 1FXIA 2Q8RE 3IVFA 2OEOA 1YQ3B 1MIUA 3K57A 2FIDA 1D4BA 2NS5A 3RMKC 4A3GG 2CHXA 2R92G 3H3VC 2B2UA 1OXUA 1GHKA 1SNMA 5JEAJ 4WWOA 4HCEA 1G6JA 3RUZA 2ACZB 1EYCA 1JWAD 3PO2B 1E1TA 4GDLB 1L4DB 2JZZA 3RLNA 2NR2A 1YHAA 4JI7L 4LUOA 5C5LA 4US8A 1PDQA 1CTMA 4HJ8A 4N9F4 2X38A 3PREA 5FOBB 5AZHA 4DBGA 2VZKB 3D6WA 2MUYA 1V43A 2N7DA 1SMXA 1NE3A 2UU9Q 2DAJA 4KY7A 4A55A 1KHIA 1JB7A 1CK1A 4DK6C 1Y1VG 3VFKA 1FCCC 5IGCA 3KLSA 3LB8C 3QARA 4R8IA 2ZNVB 2M1MA 3SR1A 4A3EH 4EE2A 4Q0FA 2KQSA 4QJFA 3DEPA 1SR3A 1EY5A 1NMFA 2MQJA 2WNMA 3RNAC 2ZXPA 5JHBA 2HJ1A 5KHOA 2B39A 2I1KA 2UUBQ 2P5ZX 3CCUA 4RA8A 4TUUA 5T8IA 1WGHA 2EE1A 3TP7A 1B1ZA 1VDZA 3S1NH 3A4RA 1IGCA 5M3FG 3V6CB 2KC2A 1STAA 1FCLA 1DJRD 4HSPA 2WXPA 2LGIA 1WIAA 3NHEB 1OGWA 3DLLA 5K36G 4QQBX 4CDEC 1MI0A 2L15A 2VZKD 4LNNA 3BDOA 3HP3A 3DWGC 3LXFA 4JG2A 1MHWC 1GUOA 2R61A 4DWFA 5FLMG 1B4OA 2PYKA 3I3CA 4MNOA 2XGTA 4H02A 5IYDG 1ACCA 1GUNA 1T0QC 3TCAA 2QCPX 2EMTA 4C4VB 1N34Q 2KK8A 4FF1A 1WI0A 2D2QA 2N9LA 4DHZB 1LTBD 3S2HB 3D3RA 2Z59B 4IJLA 4C1NK 3J80E 3HVZA 3AFQA 2FAZA 4DV6L 1TQOA 2ENBA 1TXYA 3PUWA 2BS2B 2GI9A 3WA0A 2SNSA 1K73C 3SHQA 1HEZE 3SK6A 1Q0WB 4NQLB 1C4CA 2UXDL 4OZCA 3JAMc 2DWQA 2MBOA 4A3IG 3W1SC 1UEBA 3STBD 5JVH3 2WP9B 1GUAB 3QWZB 2H5XA 5KYLA 4HPPA 4KV6A 4HMJA 1CKMA 4LW1A 2ES2A 2ZPYA 3ECIA 3NY5A 3T1HQ 5LL6S 2QW7A 4MGYE 2WKDA 1RIPA 3BS1A 3ZKJC 1XYIA 1XX8A 4QCLA 3HOYH 2RDFA 1UH6A 5M3FH 1EWHA 3G6EA 3L17A 1PRTC 4P75A 2BCOA 3HOUB 5EKKA 2BB6A 1VMCA 1PYWD 2K6AA 2JQRB 4JW0A 1A3VA 1UZXB 1WRDB 3AU5A 4AQ7A 1WMHB 4PK1A 5CV5A 4B9KA 1LTGD 2KLGA 2J0TD 1O7LA 4KGRA 2BVCA 3E56A 2XN9C 3S15H 2CKHB 1WTVA 3TN2A 1TYGB 1JR0D 3GTGB 3H09A 3K5LA 4OX9Q 1YJ9A 3CKIB 2R92B 1IBML 2J52A 4EQNA 3EIVA 2I07B 4H7BA 3AEGB 2IHEA 2CW0D 2NPTA 4GZYC 2NN6I 1TWAH 3NBIA 1XQQA 3I90A 2JSOA 3VYSA 2QEXA 4JYAL 1B50A 1TS2A 4GNXC 4K81A 4ZRJA 4ODGA 2R93H 3PRMB 1GPXA 4HDQA 2N4FA 1PFNA 1XO3A 5DPTA 2EMSA 5J39A 1KM7A 1V97A 2EQSA 1AW7A 1S3OA 3OSOA 4IM3A 3T9LA 3CQZH 4QB4A 1ENCA 1U9RA 2JYOA 3WIMA 2KTRB 3X3MA 3NVVA 2QILA 5EPKA 1EY9A 1WGDA 3AE6B 1IYFA 4K0KL 3ENEA 1KNAA 1XNQQ 3DDCB 2K9XA 3LGJA 2KO3A 4OVUA 2OEDA 5G2NA 5KNDA 5HI1A 5COYA 3TP6A 4WJOA 3CCQA 3IT4B 1JJGA 4NY0A 2FNJB 3RN5A 1LT6D 1YIWA 3ZIMA 4MGZE 1IKLA 3DMUA 3PHXB 4JI4Q 4A3MB 3RNFC 1OQQA 3Q8FA 2L11A 3EQLC 3KJPA 2IX1A 2M4NA 4NP5A 4KKJA 1E0BA 4OELB 2EDGA 2E75C 1Z5SB 2BOSA 5IP9G 1VQ8A 5EPLA 1SNCA 4N8FA 2VH2A 3U4ZA 2CQAA 2AX5A 2DNEA 2CHBD 1PRTD 1PH8A 3EECA 2F0IA 5CBAE 1N34L 3L10B 5C44B 4GU2A 3QK0A 2JA5B 3T13A 4HVBA 2MJ3A 4P16A 1R9TB 1G6ZA 1TKYA 3DXJC 2A5HA 5C3JB 1PQSA 2JYTA 4HPMB 2F0LA 3DQVA 5AUKA 3AE9B 2PVOD 3HIZA 4LJZC 2WLBA 1OFFA 3VUXA 1WM3A 2VW9A 3CCSA 3VUYA 4MTKA 1WWTA 5IOCA 4OO1H 5E6JA 4A90A 4DR2L 3E0JA 3RZDB 3HOYG 1BCPB 2EJMA 2K75A 2UUBL 2F0FA 4GOPC 1HNXQ 2F0VA 1HTLD 5LMNL 3I4NB 1VQOA 2K8CA 2F0UA 2WXLA 1DOYA 1S5ED 1XJVA 2ZJPA 2HHHQ 3GTJB 2G3QB 1O7YA 1CI3M 3S2AA 2PQAB 5FR3A 2NPTB 4ZUJA 1VD2A 1RYJA 1EY0A 1DOLA 3RNBC 4A3EB 2FUHB 3V3XA 4NKLA 2WAQE 3SK5A 2L76A 5E7NA 2MEKA 3MHZA 5DPSA 1A15A 1FXAA 5EKLA 3A5ZB 1ROEA 2WXHA 1K83B 3CSFA 4A3FB 4M01A 2WB1B 1X32A 3K5NA 4P1CC 3V61A 3ZYYX 1NCVA 1YVCA 1BXTA 4A3JG 2J0JA 3V60A 2A6HC 2PIAA 4FO2A 3DBHB 2HDLA 1EWCA 5LMNQ 4HCNB 5EAYA 3CF5A 2Q2UA 2PW9A 2RD0A 4H0LC 4I6LB 3TEXA 2GA4B 3NK9A 1PFMA 2QDBA 1F52A 1F0ZA 1BQQT 4A4IA 3V96A 1WOCA 1C4AA 4XQQA 4XQNA 2PVGC 4W9IA 4EFOA 2NBUA 2B2YC 4JYAQ 2J53A 4NQKE 3IG3A 1WGRA 1EQQA 1TKGA 4R4QA 5JAVA 3S2DH 2RSUA 5D3DA 3B2FA 4GN3B 1JICA 2HTME 4A3CG 1A8VA 3NVZA 4XQJA 2OTLA 3P4QB 2WU2B 4X64L 5I6WA 2O6VA 3TIXA 3G7LA 5IGBA 2HE7A 1ZYRD 2KFJA 4NW2A 1UE1A 2I38A 1HQMC 2MBBB 4QUFA 5FLXL 4C7YA 4W9HA 3PLVA 3PO2H 3PO3G 1GAQB 4M8AA 3KLRA 4EZLA 1EO6A 5IWAL 3VR6A 1PFSA 1HUNA 3DVNU 2NZOA 2R2QA 3N1XC 5EJWA 3NZSA 3EA6A 2HCCA 1JCKB 4GNXB 4ICVA 3CSTA 4EZJA 1QF6A 1IGDA 2G1EA 3G71A 1YBYA 3CP0A 3RN9C 2HIVA 4A3BB 4IOIE 4NPNA 4KLKA 3T56B 5HGQA 3LX0A 4MJSB 4RGTA 4X62L 3B0AA 1AFPA 3A9JA 4JIOU 1PH4A 4Y7NB 1HNXL 1K50A 4HIKA 1P98A 4NXNQ 2R92H 2H1EA 1WTOA 3BU2A 1K0RA 3VDYA 5DPWA 3H0GG 5D14A 3WCQA 1VCBA 2IY0B 3MXPA 3J81L 1HJPA 3VYRA 4CBVA 1XLOA 2F0GA 2N3SA 2CJNA 2M00A 5C2TB 2EYOA 2MP2B 1C78A 2RSNA 2B63B 4II2B 2INNE 4OZBA 4HIMA 1UGJA 3NP8A 3UI3A 2C5LC 2WX1A 4LF6Q 4IFDI 1ILPA 3W2DA 1YITA 1W3SA 4DNTB 1C3TA 1NVID 2WKCA 3E9IA 1HCZA 1SE9A 3W1YA 1MJCA 3TREA 1SNOA 1TWFH 3CCJA 1EEFD 2DGYA 2L3ZA 2G9HD 5BYRA 2WGSA 4DV7L 3NWSA 1PZJD 1TT2A 2WX0A 3PIO3 4GN1A 3QOJA 2DLBA 1KAAA 1XLPA 1RDPD 3U50C 1V6EA 1I7HA 1OTCA 3DHIC 4HWIB 3AMZA 4B3TL 4M8NA 1LV9A 1RFKA 2VQEQ 2WXQA 2D5DA 1YQBA 3K7AB 4ILWA 2Q8TA 2DY7A 3IL8A 2E5LL 2PZTA 3HM6X 1V8CA 2JA8H 2KN5A 2WXFA 2WB1E 5M3MB 5L37A 4G3XB 3W9CB 1KOTA 3DOWA 1Y8NB 4C3IB 2L5TA 3S1MH 4ZQ3A 4K6LA 4BBRH 4YCUA 2EY6A 1WJUA 5G5GA 1EY6A 5F2DA 2WXGA 2ZJRA 4DV0Q 2L83A 2K22A 2EXZA 1U4RA 1LM0A 2RKSA 4DKAC 5BR8L 4UHVA 2NBFA 5JHAA 4DV1Q 4RH6A 3ZRCA 4DR4L 4A3LH 4GNXA 1U4AA 3AE7B 5ELNA 4YY3Q 2PZUA 1TWGB 1G2SA 2MCNB 4AYBG 2Z0EB 5ELDA 3TZDA 1HH2P 3AE4B 1PRTF 1J6QA 3RNUA 2F0MA 1WI5A 4LDTB 2V1CC 2E2DC 3A1QA 1H95A 1W6KA 5JPNC 3KFUA 1GUSA 2ZTDA 4U68A 3A9JB 2OHFA 1ZUD2 2ZW1A 2Q2HA 2N7JA 1LLRD 1FNWA 4IOAA 3NUCA 3WAOA 4DNRB 4HJKA 1I4PA 1YMHE 4A8XC 5LNK1 4ZKBB 3N52A 4K1RB 2HCIA 3A54A 1C48A 2KJRA 1FRRA 1WE6A 4BXXG 4ANWA 2FMMA 3VQIA 3KF6A 1WGGA 4B9XA 2CH4W 3F2DA 2JK8A 1N8RC 5FK9C 4MJSA 1PA6A 1IL2A 2ICIA 2KWVB 3X0WA 4C3IH 3GZNI 4I7ZC 3DM3A 1BDOA 3AEDB 3R7QA 3R2TA 2FJ2A 4WQMA 4RGNA 1OXSC 4K5VA 2CKZB 3C8YA 4KD3A 2ZTEA 4S0RA 2WXMA 1B7YB 2K8BA 4A3KH 4DUYL 1QOGA 2OJRA 1L4ZB 1XWEA 4RGOS 5C1ZA 1GUGA 3BINA 3I9V1 5CX3A 4WIPA 2O5JC 4JWUC 4LCDE 4G11A 4A3MH 1T5EA 1XPRA 1FNVA 4DV6Q 2XWBB 2JA7B 1TKEA 4IM0A 3AN1A 5ELOA 3FAHA 4GLXA 1N6ZA 1EIHA 1FNUA 4DN4M 5KYIA 1TBEA 1E8XA 2LEKA 5M5YB 4FN2A 5E6PA 3OG5A 3NQIA 3PZ8A 4EOYA 2JA6B 5G3LF 4DR3L 2MQHA 1EU4A 5C0XI 2WXRA 5IIFA 1RRBA 3APFA 2A74C 4GS3A 3H9DA 3ZUNA 4DR7L 2DZKA 4WH4A 2OXPA 4HROA 2LUMA 1A63A 3MA2B 1BBUA 2IJ0A 1Q7YC 3CMMB 2V3NA 3RLFA 2E5LQ 1WXMA 3L13A 1UBIA 3UDXA 5FJ8H 4DV5L 5HG2A 2CU3A 1E7ZA 4DV1L 3L4PA 4XYCA 5M5XB 1I4GA 1KIXA 4JLCA 4ZAIA 2BYTA 3RUIB 1K3RA 4XTCS 3HRZC 5ELEA 4BBNC 4R9WA 1M1KC 3GTGH 4I6NB 2K03A 2CVRA 2DYOA 4EX5A 1WMHA 2X6GA 3HGBA 1GM5A 5AUIA 1HFGA 3KLWA 3AULA 4UP9A 1KQSA 3Q0AA 3A33B 2Z4IA 1XTCD 1WR6E 4JBKA 4IC7B 1C1YB 2K5PA 4XE0A 2FMCA 2R93G 2IGHA 4BY1B 1SYFA 5LMUQ 2C60A 3SDLC 2DJGC 1CHPD 2LXAA 4C80A 5GQOA 1B9RA 1IBMQ 5C4XH 2ZJDA 2SDFA 1E22A 1PH9A 4WJPA 4PQXA 1J7CA 3I8ZA 2I5MX 5DLQE 1VJKA 4UP7A 4RCOA 3U4EG 1C4QA 3HOWB 4BXXH 1A6XA 2D3BA 2IYDB 5EBDA 2REXA 4CKCA 4CHTB 3BZKA 1Q82C 3MTNB 4ZYSA 4L5QA 3BWUD 4DAYA 4J6HA 1PYSB 4GLSC 3S2DB 5C4XB 2JEAI 1ICWA 2RCNA 5C3EG 1CM9A 2A1AA 4W9KA 4HMIA 2K32A 1D8LA 4EGVA 4X3UA 5FO7B 1JROA 3JW0X 4J3OD 1X3QA 5CGKA 3S1RH 1ASYA 2BYFA 3H7PA 3ULJA 4DV2Q 3GV3A 2I0QA 4GMVA 3IFTA 1GVPA 5FKAC 1MKHA 2Y3AA 3IBEA 3DBLI 3FKIB 3S16B 4IUPA 2LSSA 2F0DA 3AE3B 3N1ZC 1T5XD 3AYHB 4X66L 2KDFB 3C3LA 3HOZB 4KHPL 2IGDA 1P7FA 4C2MH 2MBQA 2BDNA 3HKZG 3R2IA 1QWYA 4I7AA 2HT1A 1EIGA 2LHEA 3VA7A 2WS3B 1SE3A 4OL7A 2CWAA 5M5WB 1BNZA 1N33L 1JT8A 1GC6A 2CJOA 2KDMA 4KTAA 2A6EC 1F2ZA 1TS3A 2Z8LA 1O80A 3A56A 4X3KA 3GV6A 2C7HA 2FE8A 2KHSA 4RM8A 3GTJH 4ZRQA 4C00A 1E2ZA 1SYGA 1BVSA 1KLVA 2X8XX 1LFDA 4Q2JA 1XNQL 2B2TC 3RZFA 2IO0B 4F8MA 2R7FA 3U9OA 1VQ4A 4FYDA 3EUB2 5KHQA 2F4IA 1E2WA 2KKCA 2KLCA 3KDFB 4N6EB 1JE5A 3EFUA 2JF5A 1LYLA 2GOWA 4IO9A 3MEHA 4CQNA 1SYDA 1VQDA 4WWMA 3FHWA 4JC0A 2KEEA 1F77A 2AUKA 2JY6A 2QSDA 2AUJD 4MSQB 5CYUA 2BKFA 4LFBQ 3NZ3A 2MH7A 3W5UB 1L7YA 4C3JH 2MA9B 3GB1A 2LASA 2Z0DB 3MC9A 3FP9A 2Y5CA 1Z7TA 1SSOA 2ZM6Q 1WYGA 2LGDA 1Z9FA 4JI0L 1WJ4A 4R3DA 3TJPA 1K8MA 2E2JH 3QA8A 1QILA 1EF5A 3AMUA 3H1UA 4N58A 3DBLB 3IFWB 3FMCA 1GB4A 4B95A 1B3AA 1WYWB 5C3EH 1H8CA 2JEBI 1R4QB 3W1BA 3UE0A 2CS4A 2BE5D 3NUHB 3I4LA 4IUQA 4AQYL 2JXTA 2KHIA 2PEAA 1QOHA 2UU9L 2K01A 4LNKA 1JJCB 4IPGA 4K7UA 4GDKB 3NVWA 3ER0A 1W2BA 4BY7H 3CF6E 4PT5A 4CDDC 4XDCA 1YJWA 1YNND 3PRPB 2WWZA 1LACA 4L1BA 1WZ3A 3W5VB 4IQZA 4CJ0B 1TKWB 4A3FH 1BBXC 2O2VA 5J17A 3RMHA 2EYJA 1TT5B 4YWGG 1S3SG 3S2HH 2K5VA 1L0YB 3X3NA 3W5OA 3AU4A 2MP1A 3MXNA 1Q90A 4LWCA 2K50A 3BYTB 4JV5L 4OW0A 2LXCA 4DQOC 1WRIA 1HZAA 4EQOA 2Y5BB 2UWQA 2DUDA 3TEWA 1XTDA 3E9HA 4DV5Q 3CPWA 1I6VC 2EY1A 1YX5B 2WXNA 1AE3A 3RZDH 2ZCCA 3T16A 4IJHA 3S16H 4XYQA 2Y0SG 2N9EB 3R3MA 3AEFB 2WXIA 2Z0SA 3DUZA 3PGEA 4YSXB 4W9EA 4US9A 4TQ1A 4XT3B 1BKBA 2L9HA 4EVOA 1I94Q 2XBBC 4MH8A 2YLMA 4OWTB 1A2TA 2ALYB 4DK3C 2UUAQ 2J0KA 4KIKB 4FF4A 3LWUA 5C3EB 1Q12A 2N8NA 1KDAA 5ELBA 4YXDB 1J5EL 2KWDA 4UP8A 4S3SA 3U30A 2PMVA 1F9JA 2LVQA 1V1PB 3MC0B 1SGHA 2EELA 5A35A 3N1YC 5GROA 3URYA 3KYHC 5CMDA 3HEJA 4IFDH 3BVGA 2FHTA 5C4JB 1VQPA 1WGKA 3ALBA 3HG9A 2E74C 5C4HA 1FMAD 3J80L 2AKWB 2K6DB 4NXNL 1SB3C 4DK1A 2EYLA 3OWEB 4PS3A 2PCFB 4KV2A 4DGZA 2VXWA 4M8MA 4ULLA 1QQRA 2QA4A 2EKIA 2AQ3B 1NTGA 1CMXB 1PTOH 4DAMA 3PMFA 3PIP3 1D3ZA 4LUZA 3ULPA 2A19A 1D1IA 2L0TA 3I4MB 3VUWA 2JA9A 4A3DB 2INPE 2N49A 1JOKA 5KGUA 3DBRB 3SXHA 5GAGC 2PW7A 4NDXA 3I63C 2LFIA 2K39A 4ZKCB 1IP9A 3VR4A 2NUCA 4GOPA 5EBCA 3DBRI 1KABA 4EUTA 2HTHA 1F9QA 3MEFA 4BBRG 2JA6H 1Y1WG 1X9NA 2KT7A 4KZ0A 4CJ1B 1IUEA 1GNUA 2K6QA 3FILB 3CW2C 1F1HA 4E6IA 1NI3A 3S1NB 1TWCB 5I2YA 1D5MC 2L1AA 1E9MA 1LTID 1PH7A 3ZJUA 2GVBA 4K14A 1G6PA 2EKEC 3ML8A 3I91A 2A8VA 3ETRA 4IDIA 1KRSA 2K7VA 4A93G 2MLBA 2ZPNA 2JXMB 1F9PA 4P71A 4BZAA 2ZXOA 4F7XA 4X62Q 4KKUA 2QMTA 2ZZPB 2IWHA 4BBNF 2BQQA 2KFKB 3C2PA 1HRJA 3I5JC 4BBSH 3RNCC 3M7GA 3PIOA 4JV5Q 3EGRA 2N9PC 3CD6A 1SE8A 2HHHL 1LTRD 5HKHA 3PO3H 1VQHA 2H4OA 4PYUA 4KKTA 3ZTCA 1J9OA 4R4IA 3KQ4A 3A1QB 3ZDMC 1DGJA 2OWOA 1LT5D 3Q3JA 1PRTB 1CKNB 4C3JB 5ISRA 1FEHA 1N63A 3NBHB 1AZQA 5D7GA 1I50B 4IALA 1N32Q 4RF1A 4ZLTF 2JU6X 4KZCA 3NTKA 4HK2A 5C0XH 4JI1Q 1HR0Q 3E9SA 1AN8A 1TWFB 3SHLA 4UAIA 5DM63 4IFDG 4XX5A 1WCMB 3G4SA 3U8ZA 1GOZA 2PJHA 1SSNA 4RG1A 1BUIC 3KF6B 3QB3A 1Y69U 4GKKQ 4DA2A 2F03A 3N20C 4FXKC 1GJZA 2QJLA 3RZOH 1AH9A 1CJEA 2XVSA 2EJGC 3M4PA 4OXPA 4RF0A 2TMPA 4DV7Q 2D3CA 1CUKA 2UUCL 1R7SA 5HHDG 3AB9A 2Q2TA 5DCNA 1N62A 3I4MH 1M90C 1NR4A 3S14H 3M4OH 4POFA 2FCMA 3UINB 3H6MA 3S15B 5CHWA 4DXFA 4K0KQ 4LFAL 3UGBB 1YOVB 1SE4A 3GTLB 1R4PB 5GMVA 2WV6D 2K1BA 4MN3A 1SMYC 2KVRA 4OHJA 5E4XA 3F2CA 1NNXA 4IOCA 3H3VI 3AM9A 4DR6Q 5C0XJ 1PXUA 1QUQA 3EC8A 1RLFA 3Q14C 2BB5A 5JEAH 2PI2E 2NZ1D 4N8X1 2VNUD 2MW5A 4JCVE 3PO0A 3OW2A 1KLGD 1FPYA 4JI8L 3BZCA 3ZNID 4LF5L 2VUMG 1PMRA 4GSWA 1XCQL 3UDIA 4JGHB 5IGDA 4B3SL 1A5RA 2D0PA 4A3GH 4A3IB 3UE1A 4TKOB 2VQFL 2DZMA 1JWMD 1QLBB 3KWLA 2DYMA 2YVCA 2UXCQ 5C0XG 1KRTA 2QCZA 2MRPA 5IOIA 2MJ8A 4DHJD 4OIJA 4XZ4A 3NBHA 1U4PA 3WAPA 3JAME 1D2BA 1HPCA 1BF4A 2KJHB 3S17B 1IYVA 4K8IA 1A3UA 5KRUA 1L1OB 2BH8A 1ZOYB 1ZXHA 2E76C 1AEXA 1NBWA 2V9HA 4IWOA 1XPUA 2B2TA 1YJIA 3CQZB 3U58A 2LWPA 1K83H 3A7LA 2K25A 3ZXVA 2LKVA 2XIWA 4ZRZA 3BY4B 3BJUA 1G51A 1FR3A 1JB3A 1L0WA 2KZRA 3QHTA 4KKIA 3K81C 2LGXA 5H8YE 3NVYA 1SMYD 2D3AA 1L2FA 4QMGA 2INCC 3OMGA 1IYUA 2KCMA 3PUZA 3I4NH 1PGXA 4WURA 1HTQA 3FVQA 1I4HA 1LGRA 4J6IA 4DR5L 4LF7L 3L08A 4C3IG 1LABA 4XWTA 4C3JG 3UIPB 5AJ3L 2SOBA 1EUVB 2DAFA 4ACFA 2KYWA 3ZLZA 5G5HA 2EIFA 3VH4B 1X65A 5E6NA 4HJ5A 4BA2I 3H7PB 4CYEA 2C35B 3PLUA 2ZCBA 4X3SA 3E0EA 2KX3A 2W9NA 4A3KB 2JUOA 1E7UA 3M62B 3VRAB 4LF5Q 2AWOA 3K0XA 4DU9A 2J0MA 4RKBA 4B3TQ 1P7EA 4KHPQ 3DHHC 1PH3A 3PS6A 4USAA 5IO9A 2BKRB 1DONA 1HZ5A 3W1SA 5EQ0A 2NVQH 2B2UC 5BN3A 1YNXA 1ZDVA 4AUQC 4HIOA 4BBSB 1MG8A 1FM0D 3B9JA 5LXIB 2KHJA 1VF7A 4R8NA 4YTPB 5TR5A 1HNWQ 1N9WA 5JJZA 1ONLA 4YHHQ 2E6XA 2QDFA 2I5HA 2KOXA 3D0FA 3MTSA 4JI1L 3VTUA 1YNNC 2J7ZA 4JK1C 3VYTA 1EYDA 2WDRB 4PYZA 2K5NA 2PKOA 1WTWA 1F2MA 1MSHA 2SNMA 1WX9A 3WANA 3P1MA 3WDNA 3L2PA 1PFDA 1AE2A 2OJWA 4EEWA 4GXBA 1WF9A 1HUMA 1S4ZA 1N61A 4ARIA 3K9OB 2ZVNA 1HHVA 2GB1A 3T3NA 4FA6A 1TY0A 4DV0L 1SNDA 2L7RA 2D07B 2R7ZB 4HJAA 2MFIA 3CRLC 3VYUA 1HNWL 1FXTB 2LS01 2PZWA 4LF9Q 4WWPA 1C77A 3MVVA 1JW9D 3APCA 3HOVG 3ND9A 4DV2L 4DHJB 3NENA 4ZHPA 4LJOB 3SK4A 4LNFA 2MBEA 1NYRA 1UWVA 1C76A 2N1VA 3PPAA 3VRBB 2Y0SB 5D6JB 3QR8A 3HOXB 4YT0B 1FFUA 3KH0A 3N30A 5JXVA 2NWGA 1C4PA 4ZRKA 1KJTA 2B8GA 3OYYA 1R9TH 3DWQA 1HQRD 1VQBA 1IBLL 1EOTA 3A9KB 3AB5A 5BO4B 5EE1A 4R1JA 2JN4A 2JA8B 3HOUH 2FCNA 1B53A 1Q81C 1ISNA 3T3OA 4A6QA 3M4YA 1WJ6A 4WJ4A 4XDXA 2I46A 4RCNA 4JI2L 3HOYB 1RFAA 3Q8CA 3J7ZC 2ON8A 3U7DA 2JPHA 3RI7C 4GN5A 1EIYB 2F0SA 3I7FA 2CFMA 4EKUA 2LVOA 4WORA 2KACA 1PFBA 1BUVT 4BKSD 2R6GA 3PCOB 1PYBA 4JI6Q 3HM3A 1PTOD 3OLMD 1GB1A 3U7ZA 5IYBG 3D32A 1OXVA 1QNUA 1VZ8A 1EFID 1NMGA 5FO8B 2EPBA 3TP8A 3H15A 4E71A 3VA5A 3VXWA 4LNQA 4M00A 4NAMA 3M4QA 4C3HG 2WB1G 5JVG3 3NEMA 2J7QB 3HVDA 3UDGA 5K5PA 1V9JA 2IT1A 3K9PB 3TBIB 5JOBA 1YZ6A 2B3GA 2R3ZA 4DFAA 5CHVC 2BF8B 1ZP0B 4AJWA 1U4MA 1XEEA 2R93B 4K3CA 4MGIE 4RMAA 3I4MG 3GTKH 4Y7NH 1FFVA 2C5CA 1ET9A 2EYMA 2LFNA 3IKJA 1WM2A 1JQYD 1WCMH 3JAMi 2G5DA 1SN8A 1MI2A 4BA1I 3FDTA 1WXVA 3Q22A 1UEAB 5KNBA 3PSIA 1AYFA 2E2HH 4BS9A 4LF6L 4MTNA 3GD7A 2ZEQA 1ET6A 4OO1I 2KJXA 4H13C 1EOVA 2PO4A 2ZW0A 4C4VA 1Y1WB 4BY7B 1JWUD 1EWIA 2EXDA 2XSCA 1H4RA 4ME3A 1JOQA 3FKIH 2L0CA 3H8HA 4BBSG 4LK0M 4HIDA 3KUZA 1SIJA 2L1BA 2TSSA 1LT3D 1J7BA 1TZOA 1S5CD 2IHFA 4DNIA 1R4MI 2BS4B 5LMUL 2N0SB 1JMLA 3PGZA 5FO9B 1PZID 3HHMA 1WFQA 4BFRA 2NBVB 4P1BC 3KDFA 2LY7A 4A76A 3OIQA 1BCPD 4DF7A 5C44H 4IKGA 2IY1B 3HRDD 2G4SA 2GBRA 4GIVA 3PZ7A 4JPSA 4ZCKA 1I3QB 3SU8X 1HZBA 1CKOA 3H94A 2NVXB 1YEZA 2OQKA 3MC8A 3HKZB 4BOSC 1NENB 4CDFC 1I94L 3CCLA 1GC7A 2RA4A 2KVZA 3GTQB 1HXYD 1GG3A 3LYYA 4W9JA 4C56C 1U0LA 2D9UA 2DZJA 1VLBA 5A2QL 4IW0A 4POGA 3A55A 1K28A 3O65B 1X54A 5J2RA 1NYQA 1Z2MA 1TWHB 3HOVB 1T6BX 2YYZA 4WJWA 3CMEA 2YU9B 3Q3NC 4L5SA 1S5DD 4A3LG 4GKJL 3MFYA 3NXWA 4JBWA 5LL6X 5GAEC 1EF1A 3A9KA 3BK2A 3RCZA 1IZ6A 2MJEA 3ZGZA 1X3GA 1FYCA 4ANVA 2D2CC 2L00B 1DGSA 2W3SA 2MNAA 2X69A 4XT1B 3HOXG 3EHVA 4B9WA 3ND8A 3BDCA 1F2LA 1F9SA 2DY8A 3K5OA 4A3JH 4NXML 3ZXRA 1X56A 4ZDVA 4GN4B 2RHQB 1Z6HA 1SYBA 3V6EB 1G291 1V86A 3BDLA 1QVGA 3D4WA 1R4NI 3NG0A 2XRQD 4L8JA 5IGEA 1STYA 1E24A 3PUYA 4LF8L 4K2KA 2PMZE 5DEHA 4B08A 1TS5A 4LF9L 1C9OA 1ZXTA 3TS2A 3MJ5A 3MXNB 1PV4A 1DZ1A 1VZ7A 2LRWA 2MO1A 3K6OA 4HSVA 4KKSA 5AFWA 2FCSA 2M8SA 3VR5A 2WYQA 2FBWB 1ZDXA 4A3CH 1W6JA 3NS1A 1Y14B 3HOWH 1RODA 2EY5A 2V0GA 1JORA 1WD0A 2QDLA 2DX5B 3N32A 3J81E 1WVLA 4DR1L 5EDSA 4A75A 1ZKHA 3SK8A 2B2VA 5IGGA 3KVFB 2DENB 2GVAA 2K28A 2JA5H 3T53B 4BAXA 3GE8C 3GS2A 1VQ7A 1MJDA 1NEKB 2N1WA 3GE3C 2BWFA 3B6YA 3S1RB 2LGYA 2WAQB 4AIMA 3W1GA 2PMZB 2VY3A 1E6EB 2A68D 4DV3L 1STBA 1KRHA 1T9HA 1WYDA 4APVA 4LFCL 1K52A 3OW7A 3TUOA 3EN2A 1CSQA 2PLPA 1RF2D 3PZDA 3ONAB 4HEDA 4HR7B 2A73B 3AFPA 1EUJA 4KGTA 3RNGC 2KMMA 2I2YA 2E2IB 3AECB 4OWXB 2BE5C 2Y5PA 3L0WB 1SLJA 2A69C 1QUQB 1Y8PB 4AWJA 3GTQH 4AP4C 2MGSA 3C1FA 5D2MB 2KWCA 2NN6H 3MAQA 4IG7B 2BTEA 2K8HA 2W82A 4FADA 3BVZA 4Z9CB 5IY0A 4ANUA 2CH4A 2QC8A 3GZNB 1HZ9A 4W9FA 1U5KA 3TZUA 2KTFA 5AZFA 1BCPF 2MWSB 4UDUC 1YN5A 1YJJA 3HKSA 4LAAA 1K8AC 1STNA 3P4PB 2BT6A 1FO4A 4TVAB 1H9KA 1BCPC 2KDIA 3HKZE 2G9DA 4RM9A 1DOKA 4NXMQ 4FF3A 2C7MB 2B76B 4ANXA 2YTXA 4HDOA 5IWAQ 3Q8DA 2N9XA 4A3FG 2EZVA 1UE5A 1I5FA 1PTOF 4JOIA 5I9OA 4DDGD 4J1MA 3P42A 3J81c 2O6VB 3TBLD 5IYCH 4XIGS 3NQTA 1P16A 3QIAA 1PH5A 4X3TA 3ICEA 1XT9B 5HFYA 3O13A 1WY8A 3MJWA 4HJ9A 2N9KA 4IUMB 5M3MH 4KX6B 2NTSA 1RCVD 2K14A 5M3FB 2UUAL 1MPEA 1ZW7A 4LLGM 1TIID 4P72A 1N36L 3E5SA 2BH2A 1E1OA 1KXLA 2K0PA 2B2VC 2XK5A 5IKCM 1YQ4B 3S17H 3L54A 3ZTDA 4P7IA 4L6TB 4FLHA 4BVUC 2NBWB 2MHVA 1V5TA 4FDBA 1CZPA 4G7OC 4BWGB 1WXSA 2ZVOA 4YCWA 1VQFA 3QG1A 3UDFA 4IPCA 3GTMH 1GO3E 4EQPA 1K8OA 3MZ5A 5KIXA 3NOBA 3OAWA 3Q8AA 4XGAB 3TEZA 2K4KA 2RF4A 2HD5B 2NVTH 3H3VH 1IKMA 1P8LA 3JC66 1X3FA 4HN7A 3JYUA 1V5OA 1WGYA 1D1KA 1KFYB 4PZ8A 1MGSA 4RKLA 4ABNA 3MXUA 4KN7C 1F2RI 2L32A 4FXCA 1VQCA 2IZVB 2NVXH 4JBMA 2ATWA 5C4XG 2MSED 1EY7A 2QHOA 1Q46A 5G3LD 4WWNA 2VB2X 3P4SB 4WFN3 1IHZA 4ALPA 2MBHA 4CKEA 3I4OA 1WTXA 1WSPA 1EQVA 2Z6KC 3HFZB 4QIWE 1SRUA 3KBGA 1PHJA 4B3SQ 1OEYJ 2LI5A 4KN4C 4BY1G 3I72A 4G4KA 1WXAA 1IBKQ 1E8WA 1EM7A 2EVBA 4JI4L 2R7ZG 1YHQA 3CCMA 1K0SA 3DCGA 1QCBD 1KLUD 4HJ7A 4FJVB 3TL5A 4RHRA 3BYYB 1ICFB 2LZ6A 4MACA 1GJXA 1EQRA 4L5TA 3ZJYC 5IN7A 2BYVE 1HNZQ 1PVOA 3GQBA 4YWKA 1JOOA 5DM73 1Q8IA 3CC7A 1CHQD 1G91A 1VDVA 2JX5A 3IHPC 4G0NB 5AEKB 1WTPA 4N9PA 1ML0D 5FLXc 2ID0A 1WFYA 1XPOA 1FL0A 1BBWA 3L0OA 2FINB 5GADC 1Q3LA 4L63B 3TEHB 2W55A 3LWEA 1UNSA 4OWWB 2CR5A 2F4VQ 5C6AA 1BO0A 2NVUI 3RNEC 1TVXA 3S1QH 1AARA 4JI3Q 2W3RA 1IW7D 4A3MG 3OWFA 3I56A 1HTOA 1SYCA 1UE7A 5J18A 4KHVA 2INDC 4HCPB 4DDID 2F1MA 2O5IC 1ZKOA 1C9FA 2B63H 1VQ5A 1FJGL 3N9YC 3KLSX 2LVPA 3J81i 2KQ4X 2UXBQ 1ENFA 2PNHA 2RDBC 2CU1A 3AI5A 2LRUA 3OTOL 5L95C 2Z6BA 2MJDA 2B29A 2IX0A 3G48A 2FCQA 3OMCA 3GTOH 4X66Q 3SVMA 5AJ3Q 1I3QH 3ZDTA 3WOEA 1N32L 1B3QA 1VMPA 2UYZB 3I3TB 1KDBA 1C7YA 4QUCA 3ULLA 2KUMA 4TQUS 5M5XH 2M9VA 4P2CB 2XK5B 4DR2Q 1BOSA 2LJ5A 2D11A 3I4NG 1N5WA 2BYEA 3PIPA 5FJ8G 1VQGA 2UUCQ 1H9SB 2RHSB 3FRPB 1K8RB 1Y56A 3H7SA 1KL9A 4HTHA 3L3OC 5EPJA 3QWNA 3DBHI 3ONSA 3M95A 2JA7H 2L05A 4MDKE 4TKNA 1RHPA 3AV8A 1Q10A 1RKNA 1VQAA 1VQEA 5A2QE 5C44G 2KAJA 4I65A 1GUWA 2L8JA 2LHDA 1QNKA 5M5YH 4C1NI 1NDDA 2K1FA 3VAWA 1E8YA 4KGSA 4URKA 1GHJA 4BKTA 4BY7G 1SJHD 3J7A5 4A3JB 3AXCA 3PV0A 4JI0Q 2JWZA 3RLOA 1O7IA 3KUPA 2E2HB 2ZM6L 4PS7A 1Q8KA 3SR6A 4DR3Q 2NVQB 2VB3X 4DK0A 5CTRC 2D0OA 2O4XA 4JQWC 4CHKA 3APDA 4CGYB 1QE6A 2JZPA 2FFKB 1QOFA 3T1YQ 4KSLC 1HR0W 2UXCL 4IUVA 4KK7A 4IPDA 2W54A 4KMUC 1E90A 1LQBA 4HPLB 3ZQ4A 2F3VA 1KF6B 4II3B 1SJED 2CQOA 3K8AA 1A70A 2DYBA 3HUIA 5C5MA 1FVIA 3I57A 4XDDA 3QC8B 2PPBC 2KVMA 1WZ0A 5I9PA 1RJTA 4V190 2V3SA 3Q8BA 3CIRB 4PG3A 3L9AX 4FNFA 3OJ3A 3MFGA 2K5HA 3BIID 1I6HH 3KUCB 3NRZA 4KSKC 3MWYW 4MM3A 5BN4A 3UI2A 4MSMB 5JEAG 5LMNW 1LTSD 3PO3B 4W9LA 1X1MA 4HLEA 2QIEB 5CHFA 2JA7G 2OF1A 4K6DA 2NCNA 4AJYB 2E8GA 3ZJVA 1YJ1A 5I4DA 1UBQA 2LXJA 4TV3A 1SYEA 4MHEA 5CV8A 2PNRC 5J22A 3CCRA 1MHXA 2JA6G 4F1SA 2JE6I 5JJLA 1X55A 1UELA 4K8JA 1K3BC 5CV7A 1WJJA 3DM1A 4BBRB 4QAYA 4WJQA 4HEA1 2MHJA 1SAPA 2I5LX 3T1YL 3QQ8B 4F7ZA 1LUZA 4LK1C 1B44D 4O1NA 3EBEA 3I55A 5BR8Q 3UQBA 1NY4A 3F2BA 3HOUG 1T0YA 3J9CA 2R7DA 5J3BA 1OEYA 1CKNA 3F8TA 1GD7A 5DAUA 2KC1A 4O2DA 2QEJC 2DNFA 2XEWA 1E10A 2WIIB 1B9MA 1HZCA 3STBC 5IP9H 3DHGC 3KWVA 5AZGA 4DXGA 3B08A 2F0NA 3IAYA 2AQ1B 1V1QA 4DAPA 2IDYA 2RVLA 2KCTA 2M0XA 4FXGC 3PRZA 2ZTCA 3TDQA 5EE9A 1HZ6A 2MP2A 1UUPA 1LT4D 3U9SA 1D6EC 3EJIA 3T8MA 3L16A 2A68C 3N3KB 4JI3L 1UE6A 4A93B 3R3OA 3GP7A 3HS0C 4DR6L 1DXMA 4RAUC 4NJ7A 1TGZB 4IURA 3A4SC 4DV3Q 4IFDJ 5EE0A 4A3DG 3GTOB 4N59A 3SE0A 3CXCA 4NJ6A 3ZO5B 4JL9A 4CO7A 3PTFC 3PVLA 3M7NA 4NZLB 4B3RL 4G7ZC 1FGUA 4O42A 2WDVB 3HOWG 3Q8EA 3VDZA 3ZNHB 4ZYNA 3VTVA 3CAMA 1HFNA 3LJ3A 3H0GB 4P73A 4G50A 4MM3B 1MSGA 3S1QB 1S5BD 1AZPA 2N78A 1YIJA 2R7ZH 1D5XC 1I42A 1CFMA 5DNFA 4YHHL 4ME5A 2C9WB 3TMPB 2JT4B 3J81j 1T0SC 3KBXA 4TSSA 2PTLA 2Z6KA 3IAM1 3K58A 3RD2A 5FLXE 1JRUA 5I6YA 3V62A 1EWYC 4LFAQ 3Q3MC 4JOIC 3RT3B 2EYHA 2K5DA 4NAWB 2A69D 4AYBE 2RMMA 3J7AV 1AWDA 4LUVA 4X65Q 4YTNB 1A0IA 1ESFA 2V3PA 3K7UC 2B2WC 3EROA 5I2XA 4HRSA 2BW2A 4P6VF 3SGIA 5H1SE 1J8IA 1YD8U 1SE2A 2EY2A 1WTRA 3NSWA 2QF7A 1EY8A 2CW0C 1YI2A 1K9MC 4X6AH 2SEBD 4DPGA 4YWMA 2EYPA 2OTJA 2DJFC 3C1EA 2KDEB 3GO5A 2NN6G 4JPBW 2WFWA 2F0EA 1DOIA 2D5GA 1S1QB 2M56B 3NPPA 1X6OA 4CDCC 1G2TA 1K8GA 1HE8A 2LJIA 4OONA 5L83A 2D62A 5MPOA 4YL8A 2AEHA 5IAAC 3U52E 1V80A 3GDEA 1CT1D 4B3MQ 1NUCA 3JSVA 1EEID 1DM0B 3MHBA 4GLAC 1AP0A 2PW5A 1L6UA 1WXQA 2GRIA 3RYTA 2RDHA 4RFBA 4AYBB 1E7PB 1J8CA 3P20A 3J80i 2V4IB 4OO1G 2BA1A 3NELA 3CPFA 2L52A 4A3EG 1D7QA 1K51A 1XCTL 3MP9A 4B0MA 3V2TA 3NTHA 2K5QA 4KJNA 4JI2Q 1CA5A 4MGKE 2OQ0A 2VL6A 4NB3A 3LDZE 5CV9A 3OHXC 1STHA 4A93H 1OTRB 1SNPA 3WOFA 4NJCA 1VCIA 1Y8RC 4IWQA 1IBXB 5FR6A 1FD7D 3TMEA 5HGTA 4U673 4KJOA 3WALA 3Q3FA 2JA5G 4K5XA 5IE8A 2O6VD 3JVZX 3PSEB 1NJIC 2KTRA 1TJEA 3ZW3A 1H9MA 3DHQA 3HZXA 1J0GA 3A5UA 2RGFA 1L0XB 3A74A 1KC8C 1KNEA 4JWSC 3S14B 3R93A 1QVFA 5IGFA 3M4OB 4LNOA 4RHSA 3I2ZA 1L0VB 2IPKD 3RULA 1EL0A 3K7AH 2DN8A 5C3XA 3VR8B 1S72A 4JI5L 4RMFA 1EY4A 2F0QA 5IYBH 4DV4Q 1VQMA 4OVVA 2O2VB 1CZGA 2ASBA 1PUTA 1STGA 3E6ZX 4M1UB 3W3AA 3RN2A 4KIKA 3NJTA 4YIJA 2V4DA 3M85A 1I4QA 2KHWB 3M3YH 3ZNZB 3ZJTA 2E2IH 4F8CB 4XWWA 1TR5A 4GKJQ 1DYQA 1JE4A 1JJ2A 1UWXA 3R8BA 2ASQA 1V81A 1S40A 1RM6C 1M94A 2JJQA 4W9CA 4AOFA 2JYEA 1MVKA 2WHIA 1EZ6A 4C3HH 4KI0A 4QF4A 3PF4A 4IUNA 1P0RA 2AWNA 1NBFC 4OVZA 3D4RA 2JWUA 3FKYA 3M3YB 5ELCA 2EYFA 3CRKC 2F0TA 4JI7Q 4DK5A 4FP5D 2XNAC 4DV4L 1LM8B 1VQ9A 1WX8A 1P3QU 2KQ3A 2GMIC 4K7WA 3NE5B 3BK1A 4X57B 1SNQA 2Q8IB 2NB0A 3BZDB 1VQKA 1VR9A 2PI2A 3M9BA 3ZVVA 3GTPB 2XRSD 1SROA 1MG4A 2RDGA 3KYCD 4DR1Q 3U4VA 2YEPB 1YN3A 4UY8C 5IT9c 2NMQA 4KHZA 2E3TA 2PPHA 3KF8B 4PMCA 3DPDA 4MEMA 3X23A 3RD4A 4FHKA 2K33A 4RWSC 1IW7C 5C23A 3CC4A 5JPMC 2BA0A 2RSOA 1L1OC 2PE9A 4EZKA 1UGMA 1NAPA 4K5WA 1SEBD 1TIFA 2JZ3B 3J7YW 2NVYB 3QCAA 3OOCA 3B1LX 4PMBA 1GXDC 5CR3A 1CA6A 4LTUA 5D94A 3PV1A 1STEA 4PNYA 4R4OA 5HY6A 4DUZQ 4FF2A 1VQ6A 5CORA 1TWAB 2V4LA 4JI8Q 3K80C 4HKQA 5ELFA 5IP4D 4G57A 2VQEL 4PMWA 2IY5B 1QKZA 2B8FA 1MJEA 3AEAB 1XF5L 1LO5D 4A9AA 1F2RC 1N60A 4LFCQ 1TTNA 3PQIA 1I35A 2RPVA 3FKIG 1R4MB 1H9JA 2AMCB 2A4ZA 2ZNVC 1SXTA 5KNCA 1WX7A 2KBNA 2CWPA 2IO3B 4A3KG 2WP8J 3FPPA 2KFKA 2OOBB 3OJ4B 3EVQA 2WINB 4GOPB 1N5XA 1XNRL 2ZXRA 5CBEE 4FXDA 2FIFA 1GUTA 3KJOA 5G55A 2WAQG 5DPRA 5EE3A 4OX9L 3D8GA 3HOXH 3P1HA 2KA7A 4A3BG 3B2GA 1QB5D 4DAYB 2JRIB 3AEBB 4ZOHC 3E3XA 5IA7A 3TSSA 2UXBL 4ZUIA 2L4NA 5M3MG 1XMOQ 2RCFA 3D4DA 1X3EA 1L5PA 2N7EA 3AEVA 4CJ2C 1MFWA 3Q24A 3A0JA 1QZEA 4J8QA 3QIJA 2F0HA 2KDBA 3KYDD 2IGGA 3WAMA 5K36H 4GKKL 3NZUA 2E2JB 1SFOH 5LXHA 3DWAA 1ZYRC 5E4WC 4ASWC 4J15A 2LD9A 5HURA 3S9WA 1CSPA 3G6JB 4MZ9A 3GTMB 1J5EQ 1XNRQ 2YTVA 3CMAA 1YNTE 3UQAA 3T1HL 4C7ZA 3HOZG 1I50H 1A62A 1E8ZA 3P4RB 4BOZB 2YU9H 1FJGQ 1PTOC 3SEBA 2JA8G 5IYDH 4XXEA 4GGQA 1ASZA 3KF8A 1JC7A 4XYOA 4KVGB 2GBJA 1PTOB 5BN5A 2F3IA 1E7VA 2JSVX 3P63A 2LGSA 3AE1B 3T4AC 2K5WA 4B3ML 4F87A 4G7HC 4MH0E 4QL5A 1VRAB 3UF8A 2RQXA 4DHZE 3TEYA 3DWMA 2CHWA 3MXGA 2MX2A 2F0PA 2K04A 2L55A 4A3IH 3ITPA 2KN4A 4YTMB 3IFDA 3R66C 4ICUA 4L23A 4PZ6A 4JVZA 1WCMG 5BMHA 1YNJD 2J4XA 1QOAA 2IX3A 3D6CA 2GN5A 3DBSA 3RR5A 4C3HB 4JI5Q 1VS0A 4FJZA 1G8ZD 4GOCA 3P7JA 3KW5B 4K2LA 3VR2A 1C79A 3VH3B 3SFDB 1IXRA 3CCVA 2HUGA 5E3FA 2M17A 3HK0A 4GDLA 4YCVA 4ITKA 2LUEA 1FGBD 1PGBA 4A3OA 1T0RC 1J7AA 3IXSA 1IBLQ 3PUXA 1E2VA 4O0AA 3SDZA 4ZK9B 1EFWA 2KD0A 2WXJA 3DVGY 3OPOA 1WH3A 3AE2B 3QAQA 2QKIC 2J42A 2C9OA 5JZEB 2RPQA 2Z1CA 1NR2A 4GB9A 3L7ZC 1FIQA 4YY3L 3I70A 1UAPA 1PZKD 3IRBA 1TZ1A 2F52A 1JMCA 4DR7Q 2N55A 3CU7A 1T3QA 1TWGH 1JQ4A 1IPGA 1PLFA 3NTIA 2KJ6A 1F2YA 2DBYA 1N36Q 2IBIB 4L5RC 1MHHE 4RGMA 1CQVA 2GBNA 1XLQA 2PQEA 3EFCA 4MT5A 2NVYH 3PO2G 4QIWB 3CWIA 3P75A 1I6HB 4DAVA 1O7ZA 3N6RA 5C3WA 2X6LA 2F4VL 4HAEA 1U4LA 3QO2A 3FEWX 3C19A 2R2OA 3I73A 1HR0L 1BR9A 1QJOA 2BPSA 1D5ZC 1FD6A 2XWJB 5EGTA 3CC2A 4BKSA 1LTAD 5M9OA 4FBJB 5D3IB 4IUTA 3T51B 4FULA 3TS0A 2WXOA 2HDMA 3C0RB 3NHHA 2KXJA 3PF5A 4M02A 4PS8A 4JE3B 1B9NA 4MIUA 1VQLA 1HNZL 5BYQA 4LF4L 1FRDA 2HDEA 2M19A 3VR3A 2KNBA 2D3GA 4F88A 5EKIA 4DUZL 1WJNA 1J19A 4OIKA 3M63B 4FHJA 1F9RA 2HJ8A 3CHBD 4OGQC 3ZNGC 3PHWB 1XD3B 1C8CA 4V0BA 4Y52H 1VQNA 3AE8B 3DEOA 5IP7H 3FPUB 3TRZA 2UU7A 1TWCH 2KX0A 1I4XA 3GTLH 1Y1WH 2DNCA 5IODA 2WDTB 1OO9B 5LHY1 4LFBL 4AS1A 1HA6A 4LF4Q 2D10A 1X3PA 3IT6B 1OQRA 4FJYA 2VS1A 4I6PA 5CC4A 1WE7A 1PDXA 1KDCA 1IBKL 1E0ZA 2KECA 1BT0A 5LLIA 3P2BA 3FILA 3FC4A 1B8AA 3MHSD 2M0AA 1E5WA 1RL2A 3AE5B 2VH1A 1L6VA 3GOEA 1GKHA 2KENA 3CCEA 2MO0A 4A3BH 3QJZA 3R7RA 5M5WH 2VQFQ 4PZ7A 2EJFC 4N9TA 1EZ8A 1Q1OA 4C2MB 2KMAA 2LMCA 2VRRB 2B3AA 2L0FA 1ESRA 3SD5A 1XMOL 1RTOA 2BS3B 2GLSA 3A8KE 2NVTB 4NAWA 4RNAA 5BYSA 3RFZB 2BDOA 1QOBA 2HD3A 3ABVB 4W9GA 1ZEQX 3TQYA 2KCCA 4B3RQ 2EOTA 1RD9D 2WACA 3PUVA 1WTQA 3S1MB 2KANA 2KOLA 4LNIA 1KH0A 4LMQD 2F0JA 4OEMB 1TU2B 3QOLA 4HXDA 4A20A 1XLNA 2BGFA 5TSSA 2JQOA 1NI2A 1VQJA
chains in the Genus database with same CATH topology
2ZT9C 4ID6A 5T1GA 4HJGE 3C46A 1LTTD 1SF0A 1Q1BA 4TMAB 1II3A 2F3WA 3OIPA 4Q5VA 1EYAA 1DOMA 4CKBA 2JP1A 2KCNA 4B0EA 3Q6SA 2ICEC 1ENAA 1HA5A 1RTNA 4IN3A 1S5FD 1JRPA 2OT2A 2N88A 1HTPA 2O2LD 1TS4A 5E1FA 3Q23A 1JALA 1IBXA 1UWMA 3DWPA 2SAKA 4TQ0A 2F0OA 3GTKB 2A6ED 1MBYA 4PV1C 1XXGA 1K53A 3AEEB 1JWSD 1M8AA 5CV6A 1QG7A 4D2KA 1KTKA 2MPMA 1JWBD 2ONQA 2WQYB 3F2UA 4IUUA 4M0WA 2IL8A 3BG3A 1SDFA 2M2LA 3K0YA 5H92C 1CZWA 4HKZE 2RBMA 2NYZD 1Y8OB 1M4VA 1IL8A 1WD1A 3A8JE 5GXGB 1EU3A 4A3GB 1OXTA 1ZE3D 2F0WA 2LMCB 1DCZA 4HCSA 2B2YA 4KD4A 2K3UA 4KY5A 2VUMB 4REZA 5KEEA 3EFXD 3V05A 1QT9A 4L2YA 3J7AF 3KK7A 1H9RA 2WDQB 3IAS1 2IW3A 3NWTA 1MD2D 1Q1EA 3ERQA 1YN4A 2YEPF 3U2SC 3K5MA 1ILQA 2K05A 3QJYA 4IZ8A 1Y1VB 4H44C 1NSNS 3K59A 3RPFC 2A6HD 2B2WA 1DOXA 1A3TA 1EQTA 1TY2A 1OXXK 2Z4HA 4JX1C 2H89B 3RZOB 5CV4A 3BVMA 1Z47A 2F0KA 2AQ2B 3LNNA 1A2UA 5IT9E 4YSZB 4OZAA 3AU7A 1H9SA 4ARCA 2H88B 5J1ZA 2WXKA 4WAFA 4ZRPA 5BMGA 5C4ZA 3SFEB 3A8IE 2NTTA 2FUG1 1O78A 3A7AB 1B2TA 2Q5WD 1SBBB 1I4RA 4FVMA 2KEDA 3D31A 3AH7A 2HQEA 1RWSA 1CQFA 4YSYB 1VF5C 5NUCA 1DD2A 3H91A 1PGAA 3JAML 2WU5B 4WRDA 3Q69A 1V1PA 1V1OA 1YNJC 5IT9L 1ZPSA 4H2AA 1V8QA 1SFOB 4ZHOA 1VZ6A 4KY6A 5BMIA 5D65A 5T1IA 3TP5A 2BBCA 2L12A 4TRDA 3VR9B 1ZXIA 1BMLC 4NMZA 1FXIA 2Q8RE 2OEOA 1YQ3B 3K57A 1D4BA 3H3VC 2B2UA 1OXUA 1GHKA 1SNMA 5JEAJ 4HCEA 3RUZA 2ACZB 1EYCA 1JWAD 3PO2B 4GDLB 1L4DB 5C5LA 4US8A 1PDQA 1CTMA 2X38A 5FOBB 2VZKB 3D6WA 2MUYA 1V43A 4A55A 4KY7A 1CK1A 1FCCC 5IGCA 3KLSA 3LB8C 4R8IA 3SR1A 4EE2A 4Q0FA 3DEPA 1EY5A 2WNMA 2ZXPA 2B39A 5T8IA 4RA8A 2EE1A 3TP7A 1B1ZA 1VDZA 1IGCA 1STAA 1FCLA 1DJRD 4HSPA 2WXPA 2LGIA 5K36G 1MI0A 2VZKD 3BDOA 3HP3A 3DWGC 3LXFA 2R61A 1GUOA 1B4OA 2PYKA 3I3CA 1ACCA 1GUNA 2QCPX 4FF1A 2N9LA 1LTBD 3S2HB 3D3RA 4C1NK 3J80E 3HVZA 1TQOA 2ENBA 3PUWA 2BS2B 2GI9A 2SNSA 1HEZE 3SK6A 1C4CA 4OZCA 2DWQA 5JVH3 2WP9B 5KYLA 4KV6A 4HMJA 5LL6S 2WKDA 3BS1A 1XYIA 1XX8A 4QCLA 2RDFA 1EWHA 1PRTC 3HOUB 2BCOA 5EKKA 2BB6A 1VMCA 1PYWD 2K6AA 2JQRB 1A3VA 4AQ7A 5CV5A 1LTGD 2J0TD 1O7LA 4KGRA 3E56A 2XN9C 1WTVA 3TN2A 1TYGB 1JR0D 3GTGB 3H09A 3K5LA 3CKIB 2R92B 2J52A 4EQNA 2I07B 4H7BA 3AEGB 2CW0D 4GZYC 2NN6I 3NBIA 3I90A 2JSOA 3VYSA 1B50A 1TS2A 4ODGA 1GPXA 1PFNA 1XO3A 5J39A 1V97A 1AW7A 3OSOA 4QB4A 1ENCA 1U9RA 2JYOA 3NVVA 3X3MA 2QILA 5EPKA 1EY9A 3AE6B 1KNAA 2K9XA 2OEDA 5KNDA 5HI1A 5COYA 3TP6A 3IT4B 1LT6D 1IKLA 3DMUA 4A3MB 1OQQA 3Q8FA 2L11A 3EQLC 2IX1A 4NP5A 4KKJA 1E0BA 2EDGA 2E75C 2BOSA 5EPLA 1SNCA 2CQAA 2AX5A 2DNEA 2CHBD 1PRTD 2F0IA 5CBAE 5C44B 2JA5B 3T13A 2MJ3A 4P16A 1R9TB 1G6ZA 1TKYA 3DXJC 2A5HA 5C3JB 2JYTA 2F0LA 5AUKA 3AE9B 2PVOD 4LJZC 2WLBA 1OFFA 1WWTA 5IOCA 4OO1H 5E6JA 4A90A 3E0JA 3RZDB 1BCPB 2EJMA 2F0FA 2F0VA 1HTLD 3I4NB 2WXLA 2F0UA 1DOYA 1S5ED 3GTJB 1O7YA 1CI3M 5FR3A 4ZUJA 1RYJA 1EY0A 1DOLA 4A3EB 3V3XA 4NKLA 3SK5A 2MEKA 3MHZA 1A15A 1FXAA 5EKLA 2WXHA 1ROEA 1K83B 4A3FB 2WB1B 1X32A 3K5NA 3ZYYX 1NCVA 1BXTA 2A6HC 2PIAA 4FO2A 2HDLA 1EWCA 2PW9A 3TEXA 4H0LC 2GA4B 3NK9A 1PFMA 2QDBA 1F0ZA 1BQQT 3V96A 1C4AA 4XQQA 4XQNA 2PVGC 2B2YC 2J53A 1TKGA 5JAVA 5D3DA 3B2FA 1JICA 2HTME 3NVZA 4XQJA 3P4QB 2WU2B 5I6WA 3G7LA 5IGBA 1ZYRD 4NW2A 2I38A 1HQMC 4QUFA 5FLXL 4C7YA 1GAQB 4M8AA 3KLRA 3VR6A 1HUNA 5EJWA 3EA6A 2HCCA 1JCKB 1QF6A 1IGDA 2G1EA 4A3BB 4IOIE 3T56B 3LX0A 4RGTA 1AFPA 4Y7NB 1K50A 2H1EA 1WTOA 5D14A 3WCQA 3MXPA 3J81L 3VYRA 4CBVA 1XLOA 2F0GA 2CJNA 2M00A 5C2TB 2EYOA 1C78A 2RSNA 2B63B 2INNE 4OZBA 1UGJA 3UI3A 3NP8A 4IFDI 1ILPA 3W2DA 4DNTB 1NVID 2WKCA 1HCZA 1SNOA 1EEFD 2G9HD 5BYRA 3NWSA 1PZJD 1TT2A 3PIO3 3QOJA 2DLBA 1KAAA 1XLPA 1RDPD 1I7HA 3AMZA 1LV9A 1RFKA 2WXQA 2D5DA 3K7AB 4ILWA 2Q8TA 2DY7A 3IL8A 2PZTA 1V8CA 2WXFA 5M3MB 3W9CB 1Y8NB 4C3IB 2L5TA 4ZQ3A 4K6LA 2EY6A 5G5GA 1EY6A 5F2DA 2WXGA 2L83A 2K22A 2EXZA 1U4RA 2RKSA 2NBFA 4RH6A 3AE7B 2PZUA 1TWGB 1G2SA 5ELDA 3TZDA 3AE4B 1PRTF 2F0MA 2E2DC 1W6KA 5JPNC 1GUSA 4U68A 2OHFA 1ZUD2 2ZW1A 2N7JA 1LLRD 1FNWA 3NUCA 4DNRB 1I4PA 1YMHE 4A8XC 5LNK1 4ZKBB 3N52A 2HCIA 3A54A 1C48A 1FRRA 2FMMA 3VQIA 4B9XA 5FK9C 2ICIA 4I7ZC 1BDOA 3AEDB 3R2TA 2FJ2A 4WQMA 4RGNA 1OXSC 4K5VA 3C8YA 4KD3A 2WXMA 1QOGA 1L4ZB 1XWEA 4RGOS 1GUGA 3I9V1 4WIPA 2O5JC 4JWUC 1T5EA 2JA7B 1FNVA 1TKEA 2XWBB 3AN1A 3FAHA 1EIHA 1FNUA 4DN4M 5KYIA 2LEKA 5M5YB 3NQIA 3PZ8A 2JA6B 5G3LF 1EU4A 5C0XI 2WXRA 5IIFA 2A74C 4WH4A 2OXPA 4HROA 2LUMA 3MA2B 2IJ0A 2V3NA 3RLFA 5HG2A 2CU3A 3L4PA 5M5XB 1I4GA 4ZAIA 2BYTA 4XTCS 3HRZC 5ELEA 4R9WA 2K03A 2CVRA 2DYOA 2X6GA 3HGBA 5AUIA 1HFGA 3Q0AA 2Z4IA 1XTCD 2K5PA 4XE0A 2FMCA 2IGHA 4BY1B 1SYFA 4C80A 1CHPD 1B9RA 2SDFA 4PQXA 1J7CA 3I8ZA 1VJKA 4RCOA 3U4EG 1C4QA 3HOWB 1A6XA 5EBDA 4CKCA 4CHTB 4ZYSA 3BWUD 4DAYA 4J6HA 4GLSC 3S2DB 5C4XB 2JEAI 1ICWA 1CM9A 4HMIA 2K32A 4EGVA 1JROA 4X3UA 5FO7B 4J3OD 1X3QA 5CGKA 3GV3A 3IFTA 5FKAC 2Y3AA 3FKIB 3S16B 4IUPA 3AE3B 2F0DA 1T5XD 3C3LA 3HOZB 2IGDA 1P7FA 2BDNA 3R2IA 1QWYA 2LHEA 1EIGA 3VA7A 2WS3B 1SE3A 4OL7A 5M5WB 2KDMA 1BNZA 2CJOA 4KTAA 2A6EC 1F2ZA 1TS3A 2Z8LA 1O80A 3A56A 4X3KA 3GV6A 2FE8A 4ZRQA 2KHSA 1E2ZA 1SYGA 4Q2JA 2B2TC 4F8MA 3U9OA 4FYDA 3EUB2 2F4IA 1E2WA 4N6EB 4CQNA 3MEHA 1SYDA 4WWMA 2KEEA 1F77A 2AUKA 2QSDA 2AUJD 5CYUA 3NZ3A 2MH7A 3W5UB 3GB1A 2Y5CA 1Z7TA 1SSOA 1WYGA 4R3DA 1K8MA 4N58A 1QILA 3AMUA 3FMCA 1GB4A 1B3AA 2JEBI 1R4QB 2BE5D 3NUHB 3I4LA 4IUQA 2JXTA 1QOHA 2K01A 4GDKB 3NVWA 4PT5A 4XDCA 1YNND 4L1BA 1LACA 3W5VB 4IQZA 4CJ0B 1TKWB 1BBXC 3RMHA 2EYJA 4YWGG 1L0YB 3X3NA 2MP1A 3MXNA 1Q90A 3BYTB 4DQOC 4OW0A 1WRIA 4EQOA 3TEWA 1I6VC 2EY1A 2WXNA 3T16A 4XYQA 3AEFB 2WXIA 4YSXB 3DUZA 4US9A 4TQ1A 4XT3B 2L9HA 4EVOA 4MH8A 1A2TA 4FF4A 3LWUA 5C3EB 1Q12A 1KDAA 5ELBA 4YXDB 2KWDA 4S3SA 2PMVA 1V1PB 3MC0B 2EELA 5A35A 3URYA 5CMDA 3HEJA 4IFDH 3BVGA 2FHTA 5C4JB 1WGKA 3HG9A 2E74C 5C4HA 1FMAD 3J80L 1SB3C 4DK1A 2EYLA 3OWEB 2PCFB 4DGZA 2VXWA 4ULLA 1QQRA 2EKIA 2AQ3B 1PTOH 3PMFA 3PIP3 1D1IA 3I4MB 4A3DB 2INPE 1JOKA 5KGUA 3SXHA 2PW7A 4NDXA 2LFIA 4ZKCB 3VR4A 2NUCA 5EBCA 1KABA 1F9QA 4CJ1B 1IUEA 3FILB 4E6IA 1NI3A 3S1NB 1TWCB 5I2YA 1D5MC 2L1AA 1E9MA 1LTID 3ZJUA 4K14A 3I91A 3ETRA 4IDIA 2K7VA 2JXMB 1F9PA 2ZXOA 4F7XA 2QMTA 4KKUA 2IWHA 3C2PA 1HRJA 3M7GA 3EGRA 1LTRD 2H4OA 4KKTA 1J9OA 3KQ4A 1DGJA 1LT5D 1PRTB 4C3JB 5ISRA 1FEHA 1N63A 1AZQA 5D7GA 1I50B 4IALA 4RF1A 4ZLTF 2JU6X 3NTKA 5C0XH 3E9SA 1AN8A 1TWFB 3SHLA 4UAIA 5DM63 4IFDG 1WCMB 1GOZA 1SSNA 1BUIC 3QB3A 1Y69U 4DA2A 2F03A 4FXKC 2QJLA 1CJEA 2XVSA 2EJGC 4RF0A 2TMPA 1R7SA 5HHDG 3AB9A 1N62A 1NR4A 3H6MA 3S15B 4DXFA 1SE4A 3GTLB 1R4PB 2WV6D 2K1BA 4MN3A 1SMYC 4OHJA 5E4XA 3AM9A 5C0XJ 1PXUA 2BB5A 5JEAH 2VNUD 2NZ1D 5BYQA 3PO0A 1KLGD 1PMRA 1XCQL 5IGDA 4A3IB 4TKOB 1JWMD 1QLBB 3KWLA 2DYMA 5C0XG 2MJ8A 4OIJA 3NBHA 1U4PA 3JAME 1D2BA 1HPCA 1BF4A 3S17B 1IYVA 4K8IA 1A3UA 5KRUA 1ZOYB 1ZXHA 2E76C 1AEXA 2B2TA 1YJIA 3CQZB 3A7LA 2LKVA 2XIWA 4ZRZA 1FR3A 1JB3A 4KKIA 5H8YE 3NVYA 1SMYD 4QMGA 3OMGA 1IYUA 3PUZA 4WURA 1PGXA 3FVQA 1I4HA 4C3IG 1LABA 4XWTA 4C3JG 2SOBA 5G5HA 4BA2I 4X3SA 4A3KB 3VRAB 2AWOA 4DU9A 4RKBA 1P7EA 4USAA 1DONA 1HZ5A 3W1SA 5EQ0A 2B2UC 5BN3A 1ZDVA 4BBSB 1FM0D 3B9JA 1VF7A 4R8NA 4YTPB 5JJZA 1ONLA 2E6XA 3MTSA 1YNNC 2J7ZA 4JK1C 3VYTA 1EYDA 2WDRB 2PKOA 1WTWA 1F2MA 1MSHA 2SNMA 3P1MA 3WDNA 1PFDA 4ARIA 1HUMA 1S4ZA 1N61A 1HHVA 2GB1A 3T3NA 1TY0A 1SNDA 2R7ZB 3CRLC 3VYUA 2LS01 2PZWA 1C77A 3MVVA 1JW9D 3ND9A 4ZHPA 3SK4A 1NYRA 1C76A 3VRBB 2Y0SB 3HOXB 4YT0B 1FFUA 5JXVA 2NWGA 1C4PA 2B8GA 3DWQA 1HQRD 1EOTA 3AB5A 5EE1A 2JA8B 1B53A 3T3OA 4A6QA 3M4YA 4XDXA 2I46A 4RCNA 3HOYB 3Q8CA 2ON8A 2F0SA 4WORA 2KACA 1PFBA 1BUVT 2R6GA 1PTOD 1GB1A 3U7ZA 1OXVA 1QNUA 1VZ8A 1EFID 5FO8B 2EPBA 3TP8A 3VA5A 4NAMA 4C3HG 5JVG3 3HVDA 5K5PA 2IT1A 3TBIB 5JOBA 2R3ZA 4DFAA 1ZP0B 1U4MA 1XEEA 2R93B 1FFVA 2C5CA 1ET9A 2EYMA 2LFNA 3IKJA 1JQYD 1MI2A 4BA1I 3FDTA 3Q22A 1UEAB 5KNBA 1AYFA 4BS9A 3GD7A 1ET6A 4OO1I 2KJXA 4H13C 2PO4A 2ZW0A 1Y1WB 4BY7B 1JWUD 2XSCA 1JOQA 2L0CA 3H8HA 4LK0M 1SIJA 2L1BA 2TSSA 1LT3D 1J7BA 1TZOA 1S5CD 2BS4B 2N0SB 1JMLA 5FO9B 1PZID 2LY7A 3OIQA 1BCPD 4DF7A 4IKGA 3HRDD 3PZ7A 4JPSA 1I3QB 3H94A 2NVXB 3HKZB 1NENB 2RA4A 3GTQB 1HXYD 3LYYA 4C56C 2D9UA 1VLBA 5A2QL 3A55A 1NYQA 1TWHB 3HOVB 1T6BX 2YYZA 2YU9B 4WJWA 1S5DD 3MFYA 3NXWA 4JBWA 5LL6X 3BK2A 2MJEA 3ZGZA 1FYCA 2D2CC 2W3SA 2X69A 4XT1B 4B9WA 3ND8A 3BDCA 1F2LA 1F9SA 2DY8A 3K5OA 1Z6HA 1SYBA 1G291 3BDLA 3D4WA 2XRQD 4L8JA 5IGEA 1STYA 3PUYA 4K2KA 5DEHA 4B08A 1TS5A 1ZXTA 3MJ5A 1DZ1A 1VZ7A 3K6OA 4HSVA 4KKSA 5AFWA 3VR5A 2FBWB 1ZDXA 1W6JA 3NS1A 1RODA 2EY5A 2V0GA 1JORA 1WD0A 3J81E 1WVLA 3SK8A 2B2VA 5IGGA 2K28A 3T53B 3GS2A 1NEKB 3S1RB 2WAQB 1KRHA 2PMZB 1E6EB 2A68D 1STBA 1K52A 3OW7A 3TUOA 2PLPA 1RF2D 3ONAB 4HEDA 4HR7B 2A73B 4KGTA 2KMMA 2I2YA 2E2IB 3AECB 2BE5C 2Y5PA 2A69C 1Y8PB 2MGSA 3C1FA 2NN6H 3MAQA 2BTEA 2W82A 3BVZA 4Z9CB 3TZUA 1BCPF 4UDUC 1YN5A 1YJJA 4LAAA 3P4PB 1STNA 1FO4A 2BT6A 1H9KA 1BCPC 2G9DA 1DOKA 4FF3A 2B76B 2EZVA 5I9OA 1PTOF 4J1MA 3P42A 4XIGS 3NQTA 3QIAA 4X3TA 5HFYA 3O13A 2N9KA 4KX6B 2NTSA 5M3FB 1RCVD 1MPEA 4LLGM 1TIID 3E5SA 2K0PA 2B2VC 1YQ4B 4L6TB 2MHVA 1CZPA 4G7OC 4BWGB 3QG1A 4EQPA 1K8OA 3MZ5A 5KIXA 3Q8AA 3TEZA 1IKMA 4HN7A 1D1KA 1KFYB 1MGSA 4RKLA 4ABNA 3MXUA 4KN7C 1F2RI 2L32A 4FXCA 1EY7A 5G3LD 2VB2X 3P4SB 4WFN3 1IHZA 4CKEA 1WTXA 1WSPA 1EQVA 3KBGA 4KN4C 3I72A 4G4KA 1EM7A 2EVBA 1QCBD 1KLUD 4RHRA 3BYYB 4MACA 1GJXA 3GQBA 1JOOA 5DM73 1Q8IA 1G91A 1CHQD 1VDVA 2JX5A 1WTPA 4N9PA 1ML0D 2ID0A 2FINB 1Q3LA 4L63B 2W55A 3LWEA 1UNSA 5C6AA 1BO0A 1TVXA 2W3RA 1IW7D 3OWFA 1SYCA 4KHVA 2F1MA 2O5IC 1ZKOA 1C9FA 3N9YC 3KLSX 2KQ4X 1ENFA 2MJDA 2IX0A 3OMCA 3SVMA 3WOEA 1VMPA 1KDBA 4QUCA 2KUMA 4TQUS 2M9VA 4P2CB 1BOSA 1N5WA 1H9SB 3FRPB 1Y56A 4HTHA 3L3OC 5EPJA 3QWNA 1RHPA 3AV8A 1Q10A 1RKNA 5A2QE 2KAJA 4I65A 1GUWA 2LHDA 1QNKA 4C1NI 4KGSA 1GHJA 1SJHD 4A3JB 3PV0A 3KUPA 2E2HB 3SR6A 2NVQB 2VB3X 4DK0A 2O4XA 4CGYB 1QE6A 2JZPA 2FFKB 1QOFA 4IUVA 4KK7A 2W54A 4KMUC 3ZQ4A 2F3VA 1KF6B 1SJED 1A70A 3HUIA 5C5MA 3I57A 4XDDA 2PPBC 2KVMA 5I9PA 1RJTA 4V190 3Q8BA 3CIRB 3L9AX 4FNFA 3MFGA 3BIID 3NRZA 3MWYW 5BN4A 3UI2A 5JEAG 1LTSD 3PO3B 2QIEB 2OF1A 4K6DA 3ZJVA 5I4DA 1SYEA 4MHEA 5CV8A 2PNRC 5J22A 1MHXA 2JE6I 4K8JA 5CV7A 3DM1A 4BBRB 4HEA1 1SAPA 4LK1C 1B44D 4O1NA 3J9CA 5DAUA 2QEJC 1E10A 2WIIB 1B9MA 3KWVA 4DXGA 2F0NA 3IAYA 2AQ1B 4DAPA 2IDYA 2RVLA 4FXGC 3TDQA 5EE9A 1HZ6A 1UUPA 1LT4D 3U9SA 1D6EC 3EJIA 2A68C 4A93B 3R3OA 3GP7A 3HS0C 1DXMA 4RAUC 4IURA 4IFDJ 5EE0A 3GTOB 4N59A 3SE0A 3M7NA 4NZLB 4G7ZC 4O42A 2WDVB 3Q8EA 1HFNA 3H0GB 4MM3B 1MSGA 3S1QB 1S5BD 1AZPA 1D5XC 1CFMA 5DNFA 4ME5A 3KBXA 4TSSA 2PTLA 3IAM1 3K58A 5FLXE 5I6YA 1EWYC 2EYHA 2K5DA 4NAWB 2A69D 2RMMA 3J7AV 1AWDA 4YTNB 1ESFA 2V3PA 2B2WC 3EROA 5I2XA 4HRSA 2BW2A 4P6VF 1J8IA 1SE2A 2EY2A 1WTRA 3NSWA 2QF7A 1EY8A 2CW0C 2SEBD 2EYPA 3C1EA 3GO5A 2NN6G 2F0EA 1DOIA 2D5GA 2M56B 3NPPA 1G2TA 2LJIA 2D62A 5MPOA 3U52E 1CT1D 1NUCA 1EEID 1DM0B 3MHBA 1L6UA 1AP0A 2PW5A 1WXQA 2GRIA 2RDHA 4RFBA 4AYBB 1E7PB 3P20A 2V4IB 4OO1G 2BA1A 2L52A 3MP9A 1K51A 1XCTL 4B0MA 3V2TA 3NTHA 2K5QA 4KJNA 1CA5A 5CV9A 3OHXC 1STHA 1SNPA 3WOFA 4NJCA 1VCIA 1IBXB 1FD7D 3TMEA 5HGTA 4U673 4KJOA 4K5XA 1TJEA 1H9MA 3DHQA 3HZXA 1L0XB 1KNEA 4JWSC 3S14B 3R93A 3M4OB 5IGFA 4RHSA 1L0VB 2IPKD 1EL0A 2DN8A 5C3XA 3VR8B 1EY4A 2F0QA 1CZGA 1PUTA 1STGA 3E6ZX 4M1UB 3W3AA 4YIJA 2V4DA 3M85A 1I4QA 3ZJTA 4XWWA 1TR5A 1DYQA 1JE4A 1UWXA 3R8BA 1RM6C 2JYEA 1MVKA 1EZ6A 4KI0A 4QF4A 4IUNA 2AWNA 4OVZA 3D4RA 2JWUA 3M3YB 5ELCA 2EYFA 3CRKC 2F0TA 4FP5D 2XNAC 2KQ3A 3NE5B 3BK1A 1SNQA 2Q8IB 2NB0A 3BZDB 1VR9A 3GTPB 2XRSD 2RDGA 2YEPB 1YN3A 2E3TA 2NMQA 4KHZA 4PMCA 3RD4A 2K33A 4RWSC 1IW7C 5JPMC 2BA0A 2RSOA 1NAPA 4K5WA 1SEBD 3J7YW 2NVYB 3OOCA 4PMBA 1GXDC 5CR3A 1CA6A 4LTUA 1STEA 4PNYA 4FF2A 5CORA 1TWAB 4HKQA 5ELFA 4G57A 4PMWA 1QKZA 2B8FA 3AEAB 1XF5L 1LO5D 4A9AA 1F2RC 1N60A 2RPVA 1H9JA 1SXTA 5KNCA 2WP8J 3FPPA 3EVQA 2WINB 1N5XA 4FXDA 2ZXRA 5CBEE 1GUTA 5EE3A 3D8GA 2KA7A 3P1HA 3B2GA 1QB5D 3AEBB 4ZOHC 3TSSA 4ZUIA 2L4NA 3D4DA 1L5PA 4CJ2C 3Q24A 4J8QA 2F0HA 2IGGA 5K36H 2E2JB 3DWAA 1ZYRC 5E4WC 5HURA 3S9WA 3G6JB 3GTMB 1YNTE 4C7ZA 3P4RB 1PTOC 3SEBA 4XXEA 3KF8A 1JC7A 4XYOA 1PTOB 5BN5A 2JSVX 3P63A 3AE1B 3T4AC 2K5WA 4F87A 4G7HC 1VRAB 2RQXA 3TEYA 3DWMA 3MXGA 2F0PA 2K04A 2L55A 3ITPA 2KN4A 4YTMB 3IFDA 4L23A 5BMHA 1YNJD 2J4XA 1QOAA 2IX3A 3D6CA 4C3HB 1G8ZD 3P7JA 4K2LA 3VR2A 1C79A 3SFDB 2HUGA 5E3FA 4ITKA 1FGBD 1PGBA 1J7AA 3IXSA 3PUXA 1E2VA 3SDZA 4ZK9B 2WXJA 3OPOA 3AE2B 2QKIC 2J42A 2C9OA 2Z1CA 1NR2A 3L7ZC 1FIQA 3I70A 1UAPA 1PZKD 1T3QA 2N55A 3CU7A 1JQ4A 1PLFA 3NTIA 1F2YA 2DBYA 1MHHE 4RGMA 1CQVA 1XLQA 2PQEA 4MT5A 4QIWB 3CWIA 3P75A 1I6HB 4DAVA 1O7ZA 3N6RA 5C3WA 2X6LA 4HAEA 1U4LA 3QO2A 3FEWX 3I73A 1BR9A 1QJOA 1FD6A 1D5ZC 2XWJB 5EGTA 1LTAD 5M9OA 5D3IB 4IUTA 3T51B 2WXOA 2HDMA 3NHHA 4JE3B 1B9NA 4MIUA 1FRDA 2HDEA 2M19A