3TSSA

Toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
NIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRIKKSQHTSEGTWIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFKIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 63
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tssA01
1RD9D 1LT6D 1LTRD 2R61A 1HTLD 1XXGA 1FNWA 5I4DA 1DYQA 3DWPA 1EWCA 1KLUD 1QILA 1EU3A 1FNVA 1SBBB 1M4VA 1I4HA 3DWQA 1TY2A 1SEBD 1LT4D 3OWEB 2AQ1B 4UDUC 5D3DA 1TS3A 1L0XB 1LT5D 3CHBD 3R2IA 1S5FD 1PRTC 1BCPF 2IPKD 2IJ0A 1CQVA 1LTAD 4DXFA 1PRTD 1BCPB 5FKAC 1BXTA 1L0YB 1SE3A 1PZKD 2SEBD 1TS5A 1YN5A 4ZYSA 4RGMA 1I4XA 2TSSA 4RH6A 1LTBD 2QILA 1LTSD 2WV6D 1SE4A 4RGTA 1UUPA 1D6EC 1ENFA 1CHPD 1JCKB 4Z9CB 1PTOB 3W2DA 1I4GA 4L63B 3GP7A 1KTKA 4C56C 1AW7A 1BCPC 1PRTF 1STEA 1T5XD 3KLSX 1FGBD 3BVMA 1I4QA 1V1OA 3TSSA 1SXTA 4RFBA 1YN4A 1FNUA 1HA5A 5ELBA 1LO5D 1ET6A 1B44D 1RF2D 2NTSA 3MC0B 3BVGA 1LLRD 3MFGA 1SJED 3BVZA 4RGNA 1JWSD 2XRSD 1EU4A 1B1ZA 5D3IB 1EEFD 1CT1D 1PZJD 4RCOA 1PTOC 4RHSA 2O2LD 1PTOD 3EFXD 4O1NA 2NTTA 1ESFA 1V1PA 1SE2A 1AN8A 3O13A 4RHRA 2XRQD 1TY0A 5ELFA 3URYA 1RDPD 1KLGD 1S5BD 1TS4A 1PYWD 2RDGA 2AQ2B 1JR0D 1ET9A 1CK1A 3SEBA 1EEID 2XN9C 1PRTB 1I4PA 4L6TB 1S5DD 2J4XA 4TSSA 1HXYD 1RCVD 3EA6A 1PTOF 2QEJC 1EFID 2RDHA 1JWMD 4DXGA 1D5XC 3BYYB 1MD2D 1G8ZD 2Z8LA 1DJRD 3DWAA 2AQ3B 1V1PB 5TSSA 4RGOS 1FD7D 4NZLB 3V05A 1GOZA 5ELCA 1LT3D 1LTGD 1PTOH 4K6LA 1BCPD 1D5ZC 2XNAC 3BYTB 4OHJA 4BWGB 3BZDB 1YN3A 1CHQD 1I4RA 3R2TA 1D5MC 1LTID 1S5ED 1JWUD 2ICIA 1PZID 1JQYD 1S5CD 1XTCD 2CHBD 1HQRD 5ELDA 3R8BA 5FK9C 1F77A 1LTTD 1SJHD 2G9HD 1TS2A 5ELEA 1UNSA
chains in the Genus database with same CATH superfamily
5JHBA 2IGGA 1J19A 1PVOA 1KNAA 5EKIA 2OTLA 1RAXA 4PYUA 3QR8A 2Z1CA 1ASYA 4KN7C 3HOYB 2KTRA 2XK5A 4A3DG 3I57A 2EYPA 4GOPB 4JI0L 2FHTA 1X6OA 5EGTA 4FDBA 4Y52H 3OWEB 3PUYA 3WIMA 4A3EG 2DYBA 4KKTA 1WE6A 4XXEA 2NVYH 2IJ0A 3HOUG 1GB1A 2K5DA 4B3TQ 2KFKB 1EY9A 2NPTA 4LUZA 4QY7A 2A68C 1E7ZA 2ID0A 4HIOA 3L0WB 4C7YA 2QDLA 3IRBA 3J81c 4X3KA 3J7AF 4LDTD 5KGUA 2M9VA 3P42A 3RUIB 2K75A 1JJGA 3SGIA 4A55A 1PFSA 2B8FA 3DEPA 3SR6A 5G5HA 3G71A 3FILA 4DGZA 4N6EB 1TQOA 1STEA 3HKZG 3OOCA 4IJLA 3SR1A 4XQQA 3HUIA 3ICEA 4DU9A 1YNJD 1N32L 2N55A 3EFUA 2B3AA 4XYOA 1ET6A 5K36G 3LX0A 4AJYB 3T1HQ 3A4SC 1F2RC 4POFA 4GN5A 2KT7A 1UEAB 1ZKHA 3W1SC 4KIKA 4KY5A 1GUTA 1K9MC 1DOLA 2A5UA 4DR1Q 4RA8A 2R3ZA 2FFKB 2K4KA 3AFPA 2F4IA 2D9UA 1F9RA 3GTGH 1VMCA 5FO7B 4A20A 1SROA 1G91A 4B9WA 2BYVE 1WM2A 4DAYB 3C0RB 2WU5B 1A63A 3GE8C 1Z9FA 4I6PA 1HR0Q 4MDKE 4M02A 5E4WC 2K1FA 5M5YH 3L2PA 5JXVA 1F52A 2UXCQ 1GUGA 5HY6A 1XYIA 4R4QA 3K5MA 2ONQA 4ULLA 2F52A 2F0DA 3K5OA 3J80i 3ML8A 4KV2A 4JV5Q 3KLRA 1ZOYB 1VQEA 3LYYA 1P7EA 4G7ZC 4DR7Q 4LJOB 2B2TA 1UH6A 4AYBE 4M01A 3VFKA 3D4RA 4CJ2C 4A3EH 3V3XA 1MD2D 4R3DA 3MEFA 2N9LA 1X3EA 3OWFA 3LJ3A 1KJTA 4CHTB 1QZGA 2B63B 2PQAB 1RM6C 2WDQB 1IGDA 1DOYA 1SNCA 2CQAA 2L05A 5IT9E 2IT1A 5E6NA 1EWHA 4OHJA 3H6NA 1G6PA 1UEBA 1WJ4A 1X1MA 2FIDA 1PH7A 2GA4B 1L1OC 3L3OC 5CGKA 1EOTA 2EJGC 3S1NB 1XNRQ 3RZDB 2KMMA 1VQBA 2IX3A 5AUKA 4CDDC 4MT5A 1U4LA 2ES2A 3H6MA 3S2DB 2B8GA 2K5WA 2R61A 2CH4W 3I4NG 4C2MB 2JEBI 1XXGA 5JEAJ 1Y1VG 4DK1A 2AWTA 4GDLB 4BBNF 2CHXA 1QOAA 2Y5CA 3JVZX 1IBXB 1KLUD 3J81L 1NYRA 3OAWA 4LW1A 4X65Q 5E4XA 3TZDA 2WB1G 1YX6B 4HCNB 4IOIE 3DBRI 1Q82C 1UGMA 2N9PC 1HNWQ 2FMMA 3E9HA 2KKCA 4X62L 2Q5WD 4RM8A 2NBUA 2ZM6Q 3AE8B 3AB9A 2V1YA 4KK7A 1I6HH 1GXDC 4EVOA 4IN3A 3O65B 2WB1B 3I4OA 5FO9B 5GAEC 3HOUH 1JORA 4NXNL 4HJ8A 2LUEA 1EY4A 4EE2A 4RGTA 5M3FB 5IAAC 1I5FA 4XYQA 5EPJA 1PH3A 5D7GA 4JC0A 1Y8RC 2V4IB 2JJQA 3VA7A 3NQIA 3KWLA 1DOXA 3VUWA 2DAJA 1WFYA 4BBSG 4LFCL 3BDCA 2N78A 3H0GB 4LFCQ 2WS3B 3HM6X 2IBIB 1P8LA 3FRPB 2HT1A 3STBC 2H1EA 4H0LC 1VRAB 3TCAA 1VQJA 2KQ3A 2LUMA 1O7YA 2BDNA 3U52E 3AECB 1FL0A 4K5VA 1WIAA 1T0QC 1D1IA 1TZ1A 3Q14C 1KRTA 3IFWB 4A3OA 1DOKA 5C4JH 1PZJD 1CQFA 1SLJA 3U4VA 1WMHB 1UZXB 2OJRA 2R6GA 2O2LD 1PTOD 2VY3A 1SMXA 4B3ML 2DJFC 1H9KA 3E5SA 3NY5A 3RYTA 2CKZB 2KVZA 1L4ZB 4BOSC 1IBKQ 2WXQA 5H92C 1JB3A 5FLXE 2DYOA 3AEEB 3AULA 2QIEB 1TWHH 1XF5L 3AE1B 4DA2A 2EY5A 5IWAQ 3K0YA 1FPYA 1NJIC 2P5ZX 3H3VC 2LGYA 3F8TA 2VUMH 1WCMH 1VQ5A 2YU9B 1WVLA 4OO1G 1IBML 4DR4Q 3ZXVA 1QUQB 4B3TL 3NBIA 4Y7NH 3ONAB 5DPTA 3RZFA 3RMHA 5I2XA 1JE4A 2C5CA 4DK6C 1WXSA 5I9OA 4PG3A 4ZDVA 1HQMC 3GD7A 3ITPA 1K52A 4NZLB 4ID6A 4IUQA 3SHLA 2WXKA 4BFRA 3PIO3 1VF7A 1EQTA 2KANA 2L1BA 1J8IA 3M9BA 1N5XA 3Q24A 1Z5SB 2BCOA 1FFVA 3NS8A 3CCVA 1CMXB 4AIMA 5C3XA 4HEA1 1Y1VB 4B3RQ 4HROA 4KKIA 4M0WA 2ICIA 5HGQA 1S5CD 1XMQQ 4A90A 4W9CA 3BJUA 1QOFA 1XMQL 1SJHD 2YV5A 2DZMA 3QC8B 4NKLA 1N5WA 2L9HA 4LDTB 3EQLC 4YWMA 4MH8A 4WQMA 2MJ8A 2A6EC 1TKEA 5A2QL 1IL2A 1YQ3B 4P16A 2BYEA 1A3TA 3CAMA 2NN6G 2D3BA 4ZUJA 4DR1L 4WWNA 3GTPH 3MC8A 3HZXA 1IYFA 3GTJH 3QA8A 5EPLA 3C1EA 3NK9A 1E8ZA 3HOVH 5M3MG 2AL6A 2BS2B 4LF7L 3GV6A 1K0SA 4GKJL 3TP8A 3QX1A 1TZOA 2E76C 3DVNV 1BKBA 3HVDA 4XE0A 1F9QA 1QLBB 1Y8OB 1V2YA 2I07B 5EE3A 3PUZA 2D3GA 2UUBL 4JI4L 1WCMG 2INPE 3TIXA 4KLKA 1C8CA 3WAOA 1HPCA 4NW2A 5FKAC 1SE3A 4EQ5A 2KWVB 3HRDD 3QHTA 4RG1A 1I4XA 3DHGC 3TUOA 2QILA 1JT8A 1XQQA 1YQBA 3UIPB 2LS01 3L54A 4IQZA 3T1YL 4OELB 1HCZA 5JH5C 3N1ZC 3ML9A 4ANXA 2WAQB 3NWSA 3S17H 1XO3A 1AARA 3GP7A 2ZVOA 1K83B 3NXWA 4BKGA 1BCPC 2VRRB 2D3AA 2LXAA 4A75A 2K8CA 4RFBA 3E0JA 2EXZA 1YN4A 3BK1A 2NZ1D 1SIJA 1HA5A 3N6RA 1ZW7A 1S40A 4ZK9B 3S2AA 3U50C 2KHSA 4WWOA 2E5LQ 3Q8DA 4IPHA 3UI2A 2GBMA 2DN8A 2L8JA 3KLSA 1I42A 4PMWA 2F0IA 5C3EG 2DX5B 4IM0A 3K7AH 1QWYA 2JN4A 4O0AA 5IYCG 2HCIA 2DENB 5IT9L 2R2OA 3PT2B 1N34L 2BB6A 3U8ZA 2VQEQ 5I6YA 3P4PB 2XRQD 4KD4A 3Q2AC 2CW0D 2G4SA 4EEWA 1TXYA 4W9DA 2AQ2B 4R4CA 3JAME 4MJSA 3D32A 1I6HB 3ZRFA 5BN5A 2QCPX 4LF8Q 2KYWA 1C76A 2EJMA 1VDVA 2GN5A 2C7MB 1CZGA 4K1RB 1NMFA 3Q23A 4F87A 4IFDI 4XGAB 2BTEA 3T3NA 2DY7A 4LCDE 2B2TC 5BN4A 2ICEC 1YIJA 4ACFA 1LABA 1VQFA 4ILWA 4YHHQ 1G6ZA 4HJGE 3A8IE 4BY1B 4JV5L 1F1HA 4PS8A 3MP9A 1IBLQ 3DM3A 3BZDB 4HMJA 4QF4A 1YI2A 2UYZB 4W9FA 4USAA 1SYCA 1D5MC 1IW7D 2IY1B 3RCZA 1L2NA 1N63A 3BDLA 4J15A 3JW0X 2PMZE 2NVXH 3ZDMC 1SFOB 2HUGA 1BBXC 3B9JA 3I63C 4C3HG 2RSNA 1RODA 1XPOA 3NUHB 3VH3B 3ZTCA 1N33L 1RD9D 3E6ZX 2J7ZA 4IPDA 4E6IA 4C3HB 4L5RC 1EUVB 1WYWB 2UXDL 1EUJA 1ACCA 2Y3AA 2RF4A 3L08A 1JE5A 1JMLA 1AFPA 4ZRJA 5LMNL 3D0FA 1VQIA 2N3SA 5LMNQ 1BDOA 3DWPA 3T51B 2D3CA 2JA6G 1U4PA 4APVA 1Q86C 1FYCA 1RTNA 1K8GA 1I4HA 4WFN3 2WACA 3ZNGC 4A3IH 5BO4B 5IGCA 1V97A 5EE0A 4HIMA 3SDZA 1WCMB 1S5FD 2KMAA 1STGA 4OVZA 1BCPB 4JI5Q 3HKZE 5ELNA 2HJ1A 3WA0A 5A35A 1ASZA 3ABVB 1A15A 2JA5G 4II2B 3HOXG 4O42A 4CHKA 5C0XI 1NENB 4Q5VA 2MA9B 4FYDA 3TEHB 4URKA 3CPFA 2JK8A 2M17A 1WYDA 1F9SA 1WD1A 2WV6D 1QZEA 4S17A 1DGJA 4TVAB 1XWEA 4DR4L 1BT0A 4LNNA 4S0RA 3OSOA 4WAFA 3W2DA 2F4VL 3RZOB 1HFNA 3DVGY 1CFMA 4H44C 4HXDA 2MJ3A 3STBD 3U4EG 1PRTF 1JMCA 1GJXA 2ZM6L 1WH3A 2LY7A 2RSOA 1YHBA 1VQNA 1NI2A 2JYEA 1ZXHA 1PDQA 2HTME 2WXLA 3NS1A 3TSSA 4DBGA 1YX5B 4HDOA 2LGSA 4KDIC 3EVQA 3OIQA 2J0MA 4KHPL 2KWCA 3I7FA 1II3A 1GUSA 3DHQA 4R8IA 2F0JA 2LKVA 3PO3G 1PDXA 3H8HA 4KGSA 1ICWA 4IUNA 3GZNI 4F1SA 3IAYA 3BVZA 3H91A 3JSVA 3PTFC 4FXCA 3OLMD 4C4VA 3GTOH 1A70A 4CO7A 2F0QA 3R7QA 1XMOQ 4M00A 2K32A 3T4AC 5D3IB 3V62A 4NXMQ 5BYQA 4ZCKA 4MJSB 2FUHB 1Y8NB 4M8MA 1L6VA 4DV5L 3E56A 1STHA 3EIVA 2R92B 4HKQA 1R9TB 2GBJA 2ZTDA 3G6JB 4QUCA 2I38A 1RDPD 2K8BA 3P2BA 1S5BD 3R66C 3M63B 3S1MH 2VQFL 4AQYQ 3RI7C 5E7NA 4UHVA 3K57A 4MN3A 2Z6BA 3MVVA 3T16A 2Z4HA 1OXSC 4FJZA 3ZIMA 5T1GA 4HJ9A 4K0KQ 2MJEA 2BS4B 4ZHOA 2E6XA 3W1BA 2K14A 3ONSA 2Z6KC 4DXGA 2XSCA 3J7AV 3CRLC 5JEAG 1DJRD 3R3MA 4TQ1A 2NN6I 3D6CA 1V1PB 4ARIA 2JPHA 1YNJC 1A5RA 3EHVA 3KBGA 1KOTA 4A3MG 2IW3A 4A9AA 3EROA 3CQZH 4MACA 4DPGA 4C3JH 4XQNA 3EECA 2MLBA 3DM1A 2WXFA 2XNAC 4KHZA 3FAHA 2JXMB 1I4RA 1V9PA 2MQHA 4A3FG 2F0VA 4L2YA 1Q10A 2WDTB 3PZ8A 3LWUA 3G7LA 5D65A 4R8NA 4FHJA 1F77A 1Q3LA 1KXLA 2WXMA 3K7AB 4XT3B 4LF4Q 1GUWA 1IP9A 1LTRD 1PLFA 4YY3L 1EZ6A 4BVUC 4DV6Q 1HTLD 1D1KA 2OTJA 2BS3B 4H2AA 4HPMB 1KFYB 1XLQA 1AE2A 3F2UA 4PZ6A 2M1MA 1DOMA 1YBYA 5BYSA 1DM0B 4OX9Q 2OWOA 1PH5A 4A3KH 4OX9L 3JSVB 4MIUA 1YEZA 2KHIA 1F0ZA 3PRPB 4JYAL 4X66Q 1S72A 5KNCA 2MO0A 4FP5D 2D10A 4ODGA 1PHJA 1TKYA 3FC4A 4IUPA 3B6YA 3VUYA 1Q90A 3PS6A 1BXTA 2Y0SG 1YOVB 3NVYA 2SEBD 1H9SA 2OJWA 3W5VB 2LEKA 2F0HA 1EQRA 2KO3A 4K2KA 4CGYB 1R4NI 3DBLB 2JP1A 3ND8A 2HDLA 1JCKB 1K28A 1Q46A 3CU7A 3I5JC 4C3IB 3S1QH 4WJNA 2YVCA 3L10B 4A76A 2UUBQ 1XD3B 1A62A 5IIFA 2EVBA 5IOCA 2TMPA 2GBRA 1QJOA 1Q7YC 4KN4C 4TRDA 4LNFA 1N32Q 4IFDH 4QGUA 1EYAA 2RVLA 5KIXA 4A3FB 2PE9A 2SAKA 3N1XC 4J8QA 3KUPA 1PH9A 1SR3A 2F0KA 3PUVA 2I5LX 3MFGA 4CDCC 5C4XG 3KW5B 1JWSD 2XRSD 1G6JA 1PQSA 1VQLA 2YLMA 4Q2JA 3ZDTA 4N8FA 1WTOA 3DPDA 4RCOA 2VNUD 3RZWC 4H02A 3I56A 4DXAB 4DAYA 3F2CA 1ZYRD 2NTTA 1ESFA 3HP3A 4TKOB 2LMCA 2YEPB 3B2GA 1EWIA 1Y69U 2LVOA 3URYA 3AE9B 4TQUS 2HHHQ 3G4SA 3GTKB 1V1QA 1ICFB 3M95A 2HHHL 1HRJA 4FXKC 1OXTA 2O5JC 1HZ6A 3Q3FA 1KH0A 1QVFA 1N61A 3M3JA 1NY4A 2N9KA 3PGEA 3HIZA 4BXXH 1NUCA 2MW5A 3JYUA 3B0AA 4GU2A 5LMNW 2MHJA 3EA6A 5EDSA 2EY1A 3ZXRA 1Q1OA 4WORA 4JI6Q 3IT6B 1HZBA 2CFMA 4JBJA 2K3UA 2DZIA 2KD0A 4LUOA 2SOBA 1RHPA 2KBNA 3RZOH 2KN5A 1C3TA 3EBEA 4DV7L 2F0UA 1P3QU 3ZNID 1KLVA 5CHVC 2BE5C 1J9OA 3W1YA 2O6VD 4I6NB 2OXPA 3VYSA 1VQ6A 2Y5BB 4HCPB 1J5EQ 1E0BA 2AUKA 4I7AA 3IL8A 4HIDA 1JB7A 1VQ9A 4LF6Q 2L12A 2O4XA 2IY5B 3FEWX 2PNHA 1N8RC 1AZPA 1ILPA 2ASQA 2V4DA 4OW0A 2K9XA 2B3GA 3AMZA 2F1MA 1LUZA 1ENAA 3VYTA 2UXBL 5CTRC 2CHBD 3M7NA 5KNDA 4FF3A 1V49A 3NWTA 1Q81C 3H09A 1VQMA 3E3XA 2QW7A 3PV0A 4A3MH 4A8XC 2G5DA 4IFDG 3PLVA 1LGRA 3PQIA 5JEAH 1L4DB 3CPWA 1HH2P 1X65A 2R92H 1FNWA 2I5HA 1ZKOA 5J39A 1KC8C 1IBLL 2C60A 2RGFA 1JICA 1VR9A 4IW0A 3VR8B 1JQ4A 1E2VA 3NHEB 2MJDA 1Q0WB 1O7LA 2RSUA 3QJYA 1V8CA 2Z0SA 2ZW0A 1E3PA 1ONLA 4DV2Q 4K8IA 1CUKA 3PO2G 2I1JA 2KJHB 3BDOA 3MJ5A 4UDUC 2MP2A 1QNKA 3CHBD 5LHY1 1FM0D 1BO0A 1N33Q 1PV4A 4MSMB 1NDDA 2CHZA 1PRTD 3SK6A 4P6VF 3ZGZA 2JE6I 1HR0L 2KC2A 2K01A 1EIHA 4NMZA 2LRUA 4FNFA 2K50A 4A3PA 1V6EA 1F2LA 5F2DA 2KA7A 3MWYW 1QB5D 4IFDJ 4LLGM 4QQBX 4KD3A 3PIPA 3PRMB 3CCRA 1KM7A 4JOIC 1K50A 4JBWA 4NPSA 2DLBA 2L7RA 2LWPA 4KKJA 4XDCA 1IZ6A 4IWPA 2BH8A 3S16B 1VCBA 3DWGC 3KLSX 3P7JA 4JI5L 4CKEA 1B7YB 4GDKB 3AI5A 1WYGA 2LVQA 2G9DA 1XNQQ 3AEAB 5G3LD 1WJ6A 1K73C 1M94A 5LL6S 4JVZA 2QF7A 2R93B 1YNND 1MJDA 1EY5A 2A6ED 1ZGUB 4NAWB 5HGTA 1K8RB 2KLCA 4DK3C 5D2MB 1D4BA 1MPEA 1MHWC 2K7VA 1TWCB 2E2HB 2EYOA 4ZLTF 1JWBD 3AN1A 3NE5B 1HFGA 4BY7G 4NPNA 1F9JA 2N0SB 2M8SA 1UWMA 3RZDH 3QOLA 2DZJA 4MGIE 3Q8EA 3GTJB 1XX8A 1FCLA 1C48A 1GO3E 2ENBA 3HOVB 3CCJA 1VQCA 4IPCA 2XBBC 4B3MQ 3HVZA 1L0VB 4AQ7A 4B0MA 3FMCA 3BZKA 2MBEA 4KHPQ 2LRWA 3FHWA 4HLEA 1P16A 3QG1A 5FOBB 5LL6X 3H94A 2R7FA 1FXAA 3NBHB 4NDXA 2OQKA 4GNXC 2HJ8A 1O7ZA 1W6KA 3DVGX 4GOPA 3RPFC 5EJWA 2XN9C 3GTMB 2WAQE 1TTNA 1I4PA 5FR6A 2PZTA 2JA6H 3A4RA 2QEJC 4XX5A 1EYGA 2MQJA 2VB2X 2EYHA 1JROA 3A55A 3I8ZA 1J6QA 3M4YA 3WDNA 5GAHC 2Z6KA 1FRDA 4A3IG 2Z59B 4JWSC 3MFYA 4FJVB 2ZXPA 4C3IH 1HNWL 3Q3OC 3HOUB 1K83H 3KDFB 2F0WA 3D4WA 1GKHA 4V0BA 4MGYE 3E9IA 1YJWA 1HNZL 1NI3A 4OVVA 2FNJB 3NUCA 1CKOA 3T8MA 1VDZA 1D5ZC 1VZ6A 1PH6A 4NXNQ 3SK4A 1TGZB 1UWXA 3S16H 3BINA 2GI9A 3LDZE 2JA9A 3L16A 3IXSA 4PT5A 5JVG3 1JWUD 1XPUA 2EQSA 2HTHA 1SE8A 3IKJA 1R4QB 1HQRD 1WTQA 5HG2A 2G9HD 2ZW1A 1D3ZA 2RPQA 1NAPA 1GVPA 2OHFA 3QOJA 3ULLA 4G7HC 4JI8L 3KWVA 5IT9c 1FRRA 3NSWA 1VQPA 1NCVA 4ZUIA 1E7VA 1V5OA 1O78A 5JJKA 3N1YC 1PFBA 1WGDA 1DYQA 2KDMA 3GTKH 1SSNA 3HHMA 4LFBL 4RF1A 2VB3X 1EWCA 3AE4B 2ZJPA 1TWGB 2VS1A 1YNXA 1KAAA 1NTGA 4KJOA 1F2MA 4IC7B 2D5DA 4PV1C 4LFAQ 3CF6E 1Y1WB 2R7DA 4QMGA 1U4RA 4G57A 4JI3Q 1CQVA 4BBRH 4L5QA 4PQXA 4AWJA 4A3EB 1A2TA 3A8JE 5JZEB 1W3SA 1EO6A 1X55A 2O6VB 2YTYA 3EFCA 1B50A 1GC6A 3P1MA 2YU9H 2Q2TA 4JLCA 1MHHE 4N58A 3U2SC 4XT1B 2B63H 3HOYG 2L76A 4A93H 1D6EC 1ENFA 2A5HA 2B2VA 3D31A 4Y7NB 2UU9L 1LQBA 3KYDD 1I4GA 1BQQT 3NVZA 1R4NB 2MP2B 3H15A 2DBYA 3UIOB 2JYTA 3N52A 1SMYD 4K3CA 4C3JB 1V1OA 1BUIC 1TIID 3KDFA 2BGFA 2OQ0A 4NAMA 2IWHA 1UAPA 1YJ9A 1VQHA 1V86A 1LO5D 3PSIA 4XTCS 2IO2B 2QJLA 2BKRB 1K0RA 2Q2IA 4RKLA 1FJGQ 2JA8B 4GZYC 3ERSX 1YJIA 3BVGA 2JZZA 4QB4A 3MJWA 3CCSA 1H9MA 2BWES 5KRUA 2DZKA 1CM9A 5LNK1 1EU4A 4BZAA 4DUZL 3G6EA 1EEFD 4IOCA 3Q3JA 5IO9A 3KK7A 1O7IA 2GVAA 4DDGD 1WRDB 5LMUQ 3AXCA 1SE2A 4A3IB 3W5UB 3D8GA 3TBLD 1N34Q 1SYDA 2LASA 4KGTA 5ELFA 3I70A 4ME5A 2IO3B 4IG7B 3TP5A 3Q0AA 2D2CC 2CW0C 5IN7A 1HZCA 1NR4A 4PNYA 4W9HA 1YIWA 2BDOA 3CC4A 1E22A 1P7FA 2INCC 1Z2MA 2KX3A 3S15B 3H7PA 4CJ0B 4DDID 1SE9A 4WJWA 4XC2A 2BA1A 4EGVA 1T0SC 2N4FA 3ZVVA 2X6GA 5C0XJ 5GXGB 2K25A 4CQNA 1J8CA 2NZHA 4GN1A 5EKLA 2REXA 4KGRA 4WH4A 4K5XA 3ZNZB 5CBEE 5C44B 1EIYB 3V05A 5IYDH 3CCUA 2KDIA 1YJJA 1HR0W 2L1AA 1FO4A 1C4QA 2LXJA 5CORA 1LT3D 1DZ1A 1GUAB 2MRPA 4IOAA 1ESRA 3S17B 4US9A 4GDLA 1IBXA 3DLLA 2ACZB 5FR3A 1YN3A 2V9HA 5J3BA 1HJPA 5GQOA 4BKTA 5MPOA 4JI6L 2WX0A 4HPPA 4BY7H 2KVRA 1PZID 5FJ8H 1PH2A 2BKFA 4WWPA 1RL2A 3R8BA 2I5MX 3P75A 2E2JH 4DHJB 1Z6HA 5ELEA 4BBSB 1YNTE 3TEXA 1PA6A 2ZPYA 2A74C 4IWOA 3ZKJC 3SFEB 1SNOA 4DR6L 1OQRA 1KIXA 4MM3A 2CJNA 2KJRA 2INNE 1ZDXA 4WIPA 2G1EA 4B6WA 3RLNA 5M5XB 2K5QA 3IBEA 2OOBB 3AE2B 1QILA 4EQOA 4CBVA 3VYRA 1SNDA 2VUMG 2FBWB 2QA4A 1WE7A 2V3PA 1IUEA 4NNJB 4HSPA 2Y0SE 3PIOA 2Q8IB 1SEBD 2MNAA 2EKEC 3GTMH 2O5IC 1QVGA 4EQPA 1LT5D 3CMMB 4JCVE 5JAVA 3MHBA 1PXUA 2PVOD 3TZUA 3W1SA 2GMIC 1H4RA 2ZNVB 1WTWA 2EZVA 4R4IA 2PVGC 2VQEL 3PO2B 5BR8Q 4GMVA 1YHQA 4JI1L 2TSSA 4JK1C 2RQXA 4US8A 4HJ7A 3AH7A 4TMAB 1SYBA 5C23A 4YWKA 1V5TA 3ZTDA 1SRUA 3L9AX 4GOCA 4MM3B 2KCNA 4AJWA 2JY6A 2K5VA 3ERQA 3C1FA 2RHSB 4IUUA 3KYCD 2C7HA 1TJEA 1HZ5A 2EELA 2EMSA 4GLXA 2JXTA 3A5ZB 3AE7B 2IY0B 5KYIA 1K3RA 3RLFA 2KTRB 1RF2D 1GNUA 2XK5B 4DV1L 4JI0Q 2YTVA 4D2KA 3J7A5 4WJPA 3NOBA 1S3OA 3ZJYC 3A8KE 4LF5Q 2KMCA 2QEXA 4JE3B 3EGRA 2PW9A 4BOZB 5DLQE 1XMOL 1NMGA 1CT1D 1SYGA 4A3MB 3V60A 1OXUA 4RHSA 4DR2Q 1V81A 2AWOA 3JAML 1TWGH 4HWIB 1X3PA 4O1NA 1ISNA 1A8VA 1UE1A 4HK2A 1ENCA 3RLOA 2PLPA 5E6JA 3A5UA 1Y1WH 1KD1C 1I94Q 1QUQA 4P73A 3UI3A 2BOSA 3SK8A 1WOCA 1Z7TA 4BBRB 2ZZPB 3TEYA 4OXPA 4KKUA 1L1OA 3CW2C 4K2LA 4LK1C 4RAUC 1ET9A 4AQYL 2JUOA 3PHWB 3U58A 4EFOA 3PZDA 2A1AA 1B9MA 4GOPC 5M3FG 5DPRA 2GRIA 4ARCA 1FVIA 2LJIA 2HDEA 3B2FA 2N9EB 3HKSA 1OEYA 2KQ4X 3IHPC 1CA5A 2C9WB 2WXIA 3S1RH 3BYYB 2Q2UA 3A7LA 3DWAA 1WJJA 3NPPA 4POGA 4JG2A 5IP4D 2EYJA 4KX6B 2BPSA 3Q3MC 3JAMc 4RKBA 5M3FH 2PPBC 3VUXA 4A3GH 3P1HA 5KEEA 3R7RA 2W55A 4XWWA 1HUMA 4OWXB 1E1TA 2ZVNA 4FJYA 1UE5A 4A3LH 2F3WA 4W9JA 4W9IA 1CHQD 3U7DA 3HOWG 1X32A 1NYQA 3X3MA 3IVFA 3WALA 2PMZB 1S5ED 4W9LA 5BYRA 4IPGA 3P4SB 4HJKA 4ZKCB 5J17A 1TS2A 3UDXA 3M4QA 3F1ZA 2VXWA 4DNRB 2INDC 5CV8A 2ATWA 2UU7A 2VZAA 4LF4L 3GTQB 3DXJC 5HI1A 2HD5B 3VH4B 5C4XH 2ZNVC 2M0XA 1PYSB 3TREA 2M19A 1RLFA 4ZKBB 1E6EB 3Q8BA 1STNA 3NTHA 5I4DA 4LUVA 4XDXA 2KLGA 4AOFA 3NBHA 4R4OA 1F2YA 4M1UB 1SNQA 4R1JA 3KYHC 1LT4D 3DEOA 3VTWA 2Y0SB 4KV6A 3V96A 3VTUA 1EOVA 1I3QH 3A0JA 3CRKC 1R9TH 2N9XA 3FDTA 1BCPF 1JRUA 3DVNU 1NR2A 1PFNA 3NJTA 2DY8A 3DOWA 4DV4Q 4DV5Q 4QCLA 4XWTA 4DQOC 1I6VC 2DJGC 4RGMA 3BU2A 1R7SA 2OF1A 5COYA 2VUMB 1T6BX 3C19A 3U30A 4QL5A 4FF4A 2PYKA 3OW2A 1HNZQ 1FXIA 4LJZC 1JOOA 4GKJQ 2BVCA 1SN8A 2IX0A 4L63B 1CTMA 3QB3A 4CKCA 1OQYA 1KTKA 4GLVB 4IDIA 3I9V1 1XCQL 3DDCB 4JI4Q 1MG4A 4B08A 4J1MA 4QAYA 3TL5A 5GAGC 1I4QA 4K6DA 2AX5A 4YTNB 3A9JA 3I4NH 4F7ZA 4HCEA 1TT2A 4JW0A 1QNUA 1QF6A 3NVVA 1NBWA 2EY6A 1V43A 2NTSA 5DM73 1BMLC 5DCNA 2Q8TA 2M4NA 3QWZB 3CMAA 4OEMB 3T1YQ 3AYHB 1GHJA 5IODA 1SNMA 1TR5A 4DV3Q 3EN2A 2UU9Q 3S2DH 4C2MH 2PMVA 3X0WA 5L83A 1W2BA 1WTRA 2SNSA 1EM7A 2WXPA 3A56A 4A3BH 2KCCA 3J81E 1NE3A 2BYFA 5EE1A 3NELA 1GUOA 1PFDA 3CKIB 2WXGA 1Q12A 2J42A 3W5OA 1U4AA 2NVTH 1MSHA 3H0GG 3S2HB 5KHOA 1AN8A 4C3JG 4BS9A 1GD7A 3DUZA 2QKIC 3HKZB 4JI3L 3M3YB 1C0AA 2C7NB 3GTPB 1KLGD 3V61A 4A3KB 2EOTA 3RN5A 4P2CB 1HEZE 1JR0D 3NHHA 4QJFA 2WXOA 3MC9A 3CMEA 3PO2H 3FP9A 5IYDG 1I3QB 5DM63 3TMPB 4L6TB 1CKNB 4ICUA 4UP7A 2CU3A 2KHJA 3T53B 2H5XA 3APCA 1EFID 2G45B 2NS5A 2RBMA 1TWFB 2A68D 2R92G 4JYAQ 2IO0B 3MXNB 1D5XC 4J3OD 2VZKB 1YJNA 3RT3B 1VZ7A 4EZKA 3ETRA 3GS2A 4EZJA 5BR8L 3QARA 4RGOS 3J80E 3HS0C 4A3DH 3EUB2 2FE8A 5J22A 2LGIA 1RTOA 2JZPA 2WP8J 4B9KA 5EPKA 3A9KB 2MSED 1WSPA 2R93H 1VD2A 3DMUA 4FHKA 2OT2A 2OCEA 4HR7B 3RNEC 5IYBH 2JWUA 4TQ0A 1TWCH 1MVKA 4JX1C 4P74A 1JWAD 1WI5A 3F2BA 2YYZA 1DONA 4A3JB 1AYFA 4RWSC 3SDLC 1IBKL 3FPUB 2WU2B 3NP8A 1YHAA 2K0PA 3AV8A 1QOHA 1HNXL 1AZQA 2D2QA 1HNXQ 2PIAA 3DBHI 4RNAA 4L8JA 2JT4B 3OIPA 1I7HA 2KN4A 2MWSB 4DK5A 2F0SA 2GOWA 2M0AA 4P7IA 4P1BC 4YL8A 4E74A 3GTGB 4BA2I 2K5HA 3S9WA 1PH4A 2MBBB 4C4VB 4ABNA 5A2QE 1JRPA 1WWTA 1T9HA 4KIKB 3AEBB 3APDA 4DR2L 1YJ1A 3NTKA 2LGDA 2RHQB 3AEFB 1F9PA 2NYZD 3PCOB 5I6WA 2VW9A 1FFUA 1XLOA 3RNUA 1CSPA 3VTVA 3IAS1 1BUVT 2H89B 1PYBA 1QG7A 4BA1I 2DAFA 2MHVA 2DWQA 2XEWA 3K9PB 1ZDVA 3FKIG 4A93G 1E8YA 3NG0A 3H3VH 2KHWB 2RD0A 3PZ7A 2MBOA 4EKUA 4MELA 1QT9A 4DR5L 1WF9A 1HZAA 5AJ3Q 2CJOA 3CQZB 5K5PA 1N62A 5AJ3L 2PJHA 4IUMB 1FCCC 1CHPD 4Z9CB 2QDFA 4KKSA 4HN7A 5IYCH 3N30A 3C2PA 4E3CA 2D5GA 3M4PA 4G11A 3PVLA 2JZ3B 4NJCA 1SNPA 3TRZA 3MTNB 2J0TD 4G4KA 2KEEA 2AL3A 2LD9A 4GSWA 2PKOA 1HZ9A 3WANA 1ILQA 1A2UA 2LGXA 2MO1A 1A0IA 4W9KA 1LYLA 4H7BA 4C1NK 3VXWA 5JPMC 4BY7B 4U673 2KVMA 4FVMA 4H13C 5C0XG 4ZQ3A 2A19A 2F4VQ 4A3JH 4LJPB 3RNBC 4MZ9A 2F0EA 4ZOHC 2KJXA 1B1ZA 4HKZE 3FKYA 5LLIA 2ZJRA 1JW9D 1PTOC 1VCIA 3J81j 1B3AA 1UELA 3PRZA 3DBRB 1NSNS 1E10A 2D0PA 4MGZE 5GADC 1XNRL 3GOEA 2A6HC 3QIJA 5IE8A 1TY0A 4B3SL 2GBNA 1OEYJ 2CS4A 5IP9H 4BAXA 2SDFA 4ITKA 1C7YA 2LXKA 3BIID 1SSOA 3UDGA 4LF5L 2KQ7A 1YITA 1CK1A 1PRTB 2QMTA 1K8AC 4YXDB 1MG8A 1XEEA 4V190 4DFAA 3CC2A 5CX3A 3MXNA 4GGQA 5G55A 1UE6A 2PQAA 3HRZC 3HOXB 3M4OH 3CIRB 1E2ZA 2NVQH 5GROA 3TDQA 2ZJQA 5M3MH 1AP0A 1EL0A 1L5PA 4ZYNA 4I7ZC 4AH6A 2W54A 3AM9A 2N1VA 2H88B 3OW7A 3TMEA 1GOZA 5C3EB 4DUYL 1A3UA 1R4MI 3ZW3A 2MP1A 2Z4IA 2NCNA 5C2TB 1G2SA 4GS3A 4K0KL 4BWGB 4YSYB 5EAYA 2LFIA 4I6LB 1OXVA 4JIOU 3ENEA 2JA8H 2X6LA 4OVUA 2CU1A 3DBSA 3KUZA 1BR9A 1OTRB 2GB1A 2L4NA 2KEDA 5M5WH 5C3WA 1ZPSA 2BBCA 3AQQA 3NENA 5E1FA 3KJPA 1C78A 4L23A 3KUDB 1IHZA 2K33A 2IO1B 2LI5A 2WYQA 2K52A 1MKHA 4GLAC 3GTLB 1WXAA 1T5EA 3IFTA 4KDLB 3CC7A 3S2HH 4DV3L 2NVTB 2CQOA 3PLUA 2G4DB 4LF8L 4O2DA 3BY4B 2F0LA 4OWWB 2N49A 5C4JB 1VQ7A 3V6CB 5FLXL 2NBFA 3J7ZC 4YTPB 2RDBC 4PZ7A 4QIWE 1TY2A 4MSQB 2FCQA 1AE3A 2WWZA 4KTAA 5D3DA 2D62A 3S15H 4K14A 3R2IA 1KL9A 2Y5PA 2V4LA 4ZRKA 3K58A 2F0FA 3PPAA 3KF6A 5C6AA 3N32A 1FMAD 3RN9C 4GN4B 5CC4A 2MEKA 4ZYSA 4DR3L 4RH6A 2O6VA 4OWTB 3T9LA 4EOYA 5AFWA 4OGQC 2MCNB 4PZ8A 1UUPA 4X66L 4X6AH 3BWUD 2FXQA 1WZ0A 3VR5A 2L5TA 4DAPA 3UF8A 1L2FA 1VMPA 2KC1A 3P4RB 1G2TA 1EY6A 4X64L 2KWUB 2NN6H 1U5KA 2LMCB 4IALA 1N36L 2KNBA 4LNIA 2IDYA 3J9CA 2J0JA 1FNUA 3IAM1 3MHSD 3PHXB 5ELBA 3MXPA 3I91A 3HOVG 1IXRA 1WGHA 3C3LA 2FAZA 3A7AB 2JRHA 2Q2HA 3H7PB 5T8IA 3ZUNA 3MC0B 1K53A 1FJGL 2L0CA 3PGZA 5HURA 1K3BC 1WGRA 5C1ZA 2KOLA 2EYLA 5L95C 3W3AA 2FCMA 3RNAC 2EY2A 4F7XA 2B2UA 5M5WB 3D6WA 1GM5A 3P20A 1E7UA 1KAWA 1GUNA 2B2YC 5IGDA 3TP7A 1PFMA 3RFZB 2K28A 2F0NA 4C7ZA 5LMUL 2JA5H 3AB5A 1O80A 3L0OA 4NP5A 4ASWC 1TBEA 3HOYH 1RYJA 2XWJB 2HCCA 3J80L 4MEMA 1U9RA 4MNOA 1TS4A 5CBAE 4JQWC 1YQ4B 3OTOQ 3H9DA 4RM9A 4CYEA 3RULA 4DV0L 3AEGB 1E8WA 1QOBA 3PIP3 4EX5A 4G0NB 3UE1A 1BBUA 2J4XA 2GLSA 4DHZB 4PS3A 2UUCQ 2MH7A 2NR2A 4DWFA 4GXBA 2FMCA 5LXHA 5JPNC 2A69C 2R7ZH 2JSOA 2KDEB 2QSDA 1X3QA 3TS0A 1P1AA 2BQQA 4TUUA 2CVRA 5TSSA 4OO1H 2K39A 1D7QA 1FD7D 2JU6X 5IGFA 4A3CH 3I3CA 3SE0A 2CH4A 3RD4A 2W3SA 3NTIA 2IHFA 5IY0A 3UDIA 4WJ3M 3AEVA 2EKIA 4UPAA 4MGKE 1KNEA 4B9XA 4OZCA 4AP4C 3ECIA 3R2TA 2LJ5A 2XWBB 2HD3A 4J6IA 4NXML 4X57B 2DNFA 2WNMA 4KVGB 5C0XH 1JQYD 3I4NB 5IKCM 4YIJA 5DPSA 2ZT9C 2JYOA 2BA0A 3KLWA 4DV7Q 4WJQA 3CSFA 3LXFA 5KHQA 4K7WA 1Q5WB 2VQFQ 2J52A 3QCAA 2ON8A 1J5EL 3PMFA 2LHDA 1J0GA 3VRBB 5M9OA 3VR3A 1WGGA 1PMRA 4A3BB 4G50A 2E5LL 4WJ4A 4FULA 1FXTB 5C4ZA 1M4VA 3DWQA 1TIFA 2K5NA 1WX7A 5NUCA 2AMCB 2HIVA 3VA5A 3BS1A 2CWAA 4DUZQ 1EYDA 3UQAA 1JJCB 3K80C 3VDYA 4JBKA 3K59A 3M3YH 3KF6B 3M62B 1LTAD 5AUIA 3M4OB 1VQGA 3F2DA 3S1RB 1ZXTA 1TS5A 2EDGA 1VQKA 4N59A 2N88A 1N60A 2E2IB 5D14A 1EF5A 4W9EA 2D0OA 3IG3A 3JC66 2NBWB 3GB1A 2WINB 4DV2L 1KF6B 2KZRA 2MBHA 2R7ZB 3A1QA 1WXVA 3UGBB 4ANUA 5I9PA 1W6JA 1WGYA 4HVBA 2KCMA 1NVID 1AW7A 1T5XD 3LGJA 3DQVA 1WFQA 1Y1VH 1IKMA 2Q8RE 1ZEQX 4DNIA 5E6OA 5EBDA 3L17A 4LTUA 3ZLZA 2XTIA 3W1GA 4GKKQ 3MEHA 1IGCA 3DBLI 3KOJA 3T3OA 2V0GA 1STAA 3AFQA 2I1KA 2DNCA 4UY8C 1S4ZA 2PCFB 4DN4M 4DV1Q 2L55A 2QHOA 5CV9A 1LLRD 1L6UA 5C4XB 3SVMA 2A6HD 4IJHA 5CMDA 3PO3B 3VDZA 1DOIA 2KWDA 3TEWA 2JQRB 2WXHA 2ZTEA 3CCQA 2JEAI 3ND9A 1IBMQ 3HGBA 3BG3A 4OIJA 2KTFA 3OPOA 1E90A 2IZVB 3A54A 1P98A 1HTQA 3SXHA 3AU5A 1VZ8A 3OG5A 5CHFA 1MGSA 1E7PB 2EPBA 3A1QB 1XPRA 1I94L 4C3IG 2UXDQ 2F0PA 2WX1A 1WX9A 4NY0A 4KY7A 3PREA 4JPSA 3Q6SA 4UAIA 5H1SE 4JI7L 1RCVD 1E5WA 4FLHA 2SNMA 2RDHA 3JAMi 5C4HA 1MFWA 1VLBA 4XDDA 1HHVA 2V3NA 1B9RA 5LXIB 3ZJVA 1WR1A 2VL6A 2FIFA 2B29A 4G3XB 1WI0A 2MBQA 2LFNA 4K7SA 2M00A 1UE7A 2WKDA 4K6LA 1BCPD 2O2VA 3KQ4A 1EY7A 1IW7C 3I4MG 3S14H 1JOKA 5CV7A 1E1OA 1R4PB 1TWAB 2JA8G 2HE7A 2VH1A 1MI2A 3GO5A 3IT4B 4B0EA 1N36Q 4P71A 3BZCA 3H0GH 3VR2A 1BF4A 1EZ8A 2L15A 1LM8B 2F03A 1T0YA 2HDMA 1LTTD 2N7JA 2YTXA 5JOBA 1X9NA 4PK1A 5DPWA 5BN3A 5K36H 4J6HA 1H9JA 4HPLB 5JHAA 1TKGA 2LSSA 1HTPA 4JOIA 1YZ6A 1VS0A 2UUAL 1WMHA 2NVUI 2UWQA 3ZQ4A 4B3SQ 3QQ8B 5CV4A 2N7DA 5M5YB 1QE6A 3PO3H 2RDFA 5JJZA 3K5LA 1GB4A 4FXDA 1WM3A 1AEXA 1YVCA 3CSTA 5EBCA 1IYJB 3P63A 2RCNA 4QUFA 3NRZA 3G48A 2RPVA 1K8MA 2X8XX 3DWMA 1KHIA 3PUWA 3HM3A 1L0XB 2IPKD 4YCWA 3TBIB 2ZPNA 1TWHB 1E2WA 4JI2Q 2KAJA 1FR3A 2KFKA 2NPTB 4XQJA 4ZAIA 4KSKC 4WAAA 4IM2A 4LNQA 5T1IA 4ICVA 2QCZA 1C1YB 2AYOB 3WOFA 3GZNB 1LTLA 2JVCA 3M85A 2K6DB 5HFYA 4LF6L 1LTBD 3I90A 3RN2A 2DYMA 2KDFB 1B53A 2JA6B 5JJLA 1GC7A 2RKSA 4A3DB 2F0GA 2QC8A 2WDVB 1S3SG 3LNNA 4YT0B 2PZUA 2E8GA 5I2YA 3HOXH 2ASBA 2ZJDA 2UXBQ 1WTHA 2DHZA 4II3B 1TKWB 2F0MA 2EE1A 4JBMA 1KRHA 3QK0A 3VYUA 5IGEA 4OO1I 5KNBA 1X3GA 1EF1A 2WXNA 2K5PA 2AEHA 2JF5A 2QGQA 3K6OA 2X38A 2EIFA 3SFDB 4N9TA 4R4TA 4AYBG 2JA7H 3NZ3A 2E2JB 4A6QA 4RMAA 2DUDA 2KXJA 1NEKB 1RRBA 5J1ZA 1G291 4HIKA 1C9FA 4BY1G 2WLBA 5C5MA 3PV1A 1VQDA 5AZGA 1SB3C 4AS1A 2B2WA 1PH1A 3K8AA 3UQBA 4K3BA 4X64Q 1E9MA 4C80A 2BF8B 4YWGG 2B2UC 3MXGA 4S3SA 1IL8A 1QVCA 2F0TA 3EFXD 3GTQH 4LK0M 3VVWB 2B2YA 1WX8A 1B2TA 3CCEA 2NWGA 3TP6A 1KRSA 3FILB 3HOWH 3Q69A 4ZRPA 3W9CB 2Z9HA 4A3LG 1SAPA 4YY3Q 1I50H 5J2RA 2H4OA 1B9NA 4XZ4A 1V9JA 4HSVA 3X23A 3RD2A 4N8X1 4OL7A 2BYTA 2FUG1 2L3ZA 4K5WA 2KCTA 4DR3Q 1SYEA 2NB0A 1E8XA 2KECA 4TSSA 2J7QB 3ZJUA 1HXYD 4A3KG 3AU7A 1M90C 2QDBA 3VQIA 4BXXG 2J0KA 4KZCA 1RWSA 4X3UA 1XNQL 1CKMA 4HCSA 5CR3A 1ML0D 2AQ3B 1N6ZA 5TR5A 3EJIA 5FO8B 4OZBA 1Y1WG 3SU8X 2AKWB 3M7GA 3QWNA 1KABA 5CV6A 5C5LA 4DV4L 2WXRA 5EKKA 1EIFA 3I55A 1WR6E 3K5NA 3PF4A 4LF9L 1MBYA 2W9NA 3S1QB 2ZXRA 3TQYA 3HK0A 3C46A 5IYBG 1B8AA 1XT9B 2I0QA 2IX1A 2BW2A 2HQLA 1GJZA 2FINB 3OMGA 2XIWA 1VQ4A 1XJVA 3QO2A 1EWYC 4QIWB 1HE8A 5EE9A 5AEKB 3GTOB 4A4IA 2M2LA 1UWVA 5FK9C 3SD5A 4KY6A 3KJOA 1CZPA 4GIVA 1EQQA 4GKKL 3WAMA 3IFDA 4A3FH 2ZCCA 5D94A 3ZO5B 4B95A 4XIGS 4LWCA 3GQBA 2JA7G 2JXXA 3AE5B 2ZXOA 4ZRQA 1AWDA 2K6AA 1A3VA 3HFZB 1ROEA 1ZE3D 3AU4A 4IWQA 2B76B 2RCFA 2PEAA 1OGWA 4X65L 3MZ5A 3S1MB 4DV0Q 4HTHA 4HEDA 2N7EA 1WTVA 5G3LF 1H9SB 1VQAA 5ELOA 1OFFA 3PUXA 2UUCL 1PRTC 2PO4A 1MI0A 4DXFA 1E24A 2BH2A 2B39A 3CP0A 2ALYB 4DAVA 3NVWA 3L7ZC 4IURA 2VH2A 1PZKD 3N3KB 2NVQB 3HOZB 5M3MB 3E9SA 2PPHA 2MUYA 4GNXB 3Q6BA 1B3QA 1LTSD 5FLMG 4DR5Q 4A3BG 1KDAA 1SDFA 2F3IA 1MJEA 1SGHA 2WDRB 4HRSA 2WIIB 3RNGC 1TWFH 1OQQA 1HTOA 4YTMB 1PTOB 4ZHPA 4X3TA 4FF2A 1QQRA 3AE6B 1TWAH 4G7OC 1OXXK 1EQVA 4IKGA 2BWFA 5L37A 1OTCA 5E6PA 4YCVA 1HA6A 4JI8Q 1IPGA 1F2ZA 2X69A 1C79A 2JSVX 2RMMA 5J18A 1D8LA 3OYYA 5ISRA 1XLNA 2Z0EB 3QJZA 3WAPA 3TS2A 4JPBW 4JI1Q 1PGBA 3OHXC 3AEDB 1B44D 1EYCA 1L1OB 3L13A 2WFWA 3U4ZA 5H8YE 4NJ7A 4RGNA 2PE6B 2VZKD 1SFOH 1IYVA 1HUNA 1J7BA 2KACA 2HQEA 1RFAA 4TV3A 5GMVA 3RNCC 2PI2E 4L5SA 4IUVA 3CXCA 3I4MH 2YEPF 1PGXA 4AYBB 4PMCA 1IYUA 1DD2A 1LFDA 5FJ8G 4ME3A 1WJNA 3C8YA 4DF7A 5DEHA 5D6JB 4X3SA 4EUTA 4K8JA 2EYFA 2RR9A 4UP8A 2LVPA 4GB9A 1K51A 2WAQG 2JQOA 4WJOA 4IZ8A 3GE3C 3ZJTA 1EEID 2AUJD 1Y56A 1T3QA 4UP9A 1GPXA 5JJIA 2K22A 1S5DD 1AH9A 2V1CC 1PUTA 2BT6A 2L83A 3K7UC 3DHHC 2W3RA 4HDQA 1FIQA 1WY8A 3VHTC 1MJCA 3B1LX 3WCQA 1ZP0B 1C4CA 1G8ZD 2PZWA 1RKNA 1R4MB 3HOZH 1CJEA 1YD8U 5BMHA 1BNZA 2E2IH 4R9WA 3UDFA 2JWZA 4OONA 2MFIA 1WGKA 2IGDA 4NJ6A 5HHDG 4DUYQ 1LTGD 1PTOH 4GNXA 3OJ3A 2WB1E 3CCLA 2KK8A 1EIGA 1PH8A 3KF8A 5JVH3 3FVQA 5CHWA 2I2YA 1Y14B 4IUTA 3K81C 3H3VI 3X3NA 4L5TA 2R2QA 1IKLA 2L0TA 3QAQA 1XTCD 2F0OA 3RNFC 5IA7A 1I35A 2K8HA 3ER0A 3NQTA 3J80c 1UNSA 2KUMA 4N9PA 1YMHE 3A9JB 4BBNC 3KBXA 3T1HL 3RMKC 1LT6D 1LACA 3MA2B 3QIAA 2KQSA 5FLXc 1KDCA 4FBJB 4CKBA 4HJ5A 2FJ2A 3NEMA 2C5LC 3DHIC 3RUZA 4M8NA 4A3CG 4ALPA 4YWLA 3T56B 4DHJD 2PTLA 3HOWB 5EQ0A 1UD7A 1EY0A 4HAEA 1U4MA 3I4MB 1FNVA 1SBBB 4MH0E 3HOZG 4BKSA 4PMBA 1UBQA 2NMQA 2AWNA 1TT5B 1LM0A 4FADA 2B63G 1Q8IA 5IP7G 4JGHB 2WKCA 3Q3NC 1STYA 1GG3A 3AE3B 3CD6A 2LHEA 4IM3A 4M0WB 4YHHL 3GDEA 1L0YB 3MHZA 3KF8B 2WQYB 4TKNA 3FPPA 1LV9A 3Q8CA 5G5GA 4OZAA 4YCUA 3U9SA 3UINB 1B70B 1SE4A 5IP7H 3OMCA 5C44H 3EC8A 4CDFC 2BE5D 1V8QA 1BOSA 1WXQA 4LNOA 1VQ8A 2ZEQA 3I73A 2N8NA 5C3JB 1GHKA 4NAWA 2O2VB 3OJ4B 4BBRG 3R3OA 2PQEA 4JI2L 3LWEA 1CI3M 3SK5A 1FGBD 1RFKA 5AZFA 1K8OA 5C3EH 2NVXB 1X54A 1SXTA 2EJFC 2IGHA 3J81i 1CZWA 1JC7A 3A74A 2MX2A 3S1NH 1P0RA 4LF9Q 1STBA 1DCZA 4YSZB 5HKHA 4IO9A 2UXCL 2AHOB 4FF1A 2FCSA 3J7YW 4C3HH 1XLPA 2UUAQ 1SJED 1Y8PB 2L52A 4WWMA 4CDEC 1X3FA 1FD6A 5IGBA 5M5XH 2G3QB 1X56A 1DGSA 2B2VC 1SYFA 1EY8A 1WTPA 1J7AA 1XCTL 4L1BA 2B2WC 3R93A 2M56B 5CV5A 3GTLH 3Q8FA 1QCBD 1TU2B 1ZUD2 4PS7A 3MTSA 1V1PA 1H95A 2KENA 4HMIA 2E3TA 4ZRZA 4LNKA 1E0ZA 4C00A 2MPMA 3O13A 4RMFA 1D2BA 2E2DC 3ZYYX 3B08A 5AZHA 4AUQC 2RDGA 2NZOA 4EQNA 1FGUA 4CJ1B 2R7ZG 3OTOL 2NBVB 2K05A 3DBHB 1BVSA 1GAQB 1OO9B 5BMGA 2JRIB 4U68A 1CSQA 4LFBQ 1ZYRC 4F8MA 3A9KA 4JL9A 2DGYA 3WWVA 2CR5A 1C9OA 1Q1BA 3I4LA 4DNTB 5G2NA 3VRAB 2Z8LA 3V6EB 2IL8A 4FA6A 3Q8AA 1WJUA 4RF0A 4FO2A 4NQKE 2E74C 4ANVA 2GVBA 3ULJA 3ZNHB 2RA4A 1DXMA 4Q0FA 5ELCA 3SHQA 2HIXA 3HEJA 2CWPA 3U9OA 3TJPA 3BYTB 2N1WA 1XTDA 2I46A 4M8AA 2A73B 3UE0A 1MIUA 1SMYC 4F88A 1UGJA 3BK2A 3AMUA 1LTID 4KZ0A 1VQOA 2E2HH 3MXUA 2PNRC 1L0WA 2K04A 1T0RC 2JA7B 4C1NI 5ELDA 1S1QB 4PYZA 4BKSD 1H9RA 2MGSA 3LB8C 2XVSA 1MHXA 4X62Q 1EFWA 4K7UA 1Z47A 1V80A 2WP9B 2K6QA 4ANWA 2L11A 3A33B 1EU3A 3D3RA 3VR9B 2A69D 4NB3A 3FKIB 2JA5B 4NQLB 1FEHA 2IYDB 2AQ1B 1VF5C 3L4PA 2J53A 1TS3A 1UBIA 3N9YC 4KHVA 1QZHA 1ZXIA 2WGSA 4FXGC 2WXJA 4DR7L 3K9OB 4RCNA 1I50B 2IHEA 1WTXA 3D4DA 2D07B 2Z0DB 2PW7A 3E0EA 1YN5A 2KX0A 4GLSC 5FLMH 3I2ZA 1WRIA 1KQSA 1F2RI 1QOGA 3KH0A 4F8CB 2E75C 1U0LA 5IOIA 4OIKA 4A3GB 2GBKA 2ZCBA 3VR6A 1RJTA 3Q22A 1J7CA 4REZA 4P1CC 2XGTA 3T13A 1SF0A 1UF0A 3S14B 1JJ2A 4C56C 1B4OA 4DHZE 2L32A 4KMUC 2CHWA 3CF5A 2C9OA 3U7ZA 3BVMA 4WURA 3H7SA 1TVXA 4A3JG 3KFUA 1NNXA 4LMQD 2L00B 1C4AA 1BBWA 4DV6L 1NBFC 1N9WA 4BY1H 2OEOA 1WXMA 1TYGB 3KUCB 4MTKA 3TN2A 3HG9A 4GN3B 4MTNA 1M8AA 1Q1EA 4B3RL 1PGAA 1CA6A 3PSEB 5IWAL 1QKZA 3V2TA 2BB5A 4BBSH 4EZLA 2K03A 2W82A 5E3FA 5C44G 3APFA 4WRDA 2CKHB 2EYMA 4W9GA 4E71A 2C35B 5DAUA 1JALA 3CWIA 5DNFA 2OEDA 4DK0A 4P72A 4GDKA 3RR5A 2A8VA 2WHIA 2EXDA 2DNEA 4KI0A 3GV3A 4RHRA 3ULPA 3NZSA 2D11A 4KSLC 5CYUA 2NVYB 1JOQA 3VAWA 2FCNA 4DAMA 1C77A 1PYWD 4DR6Q 1C4PA 4FN2A 4N9F4 2CCZA 4MHEA 3PF5A 3SEBA 3FKIH 4LF7Q 2LXCA 1A6XA 1KDBA 3NZUA 5KYLA 4A3GG 3TEZA 1M1KC 2EMTA 1Q8KA 1PTOF 4JI7Q 1LXDA 2JX5A 2KDBA 1P9DU 5BMIA 2V3SA 4A93B 1JWMD 1VJKA 3PO0A 1G51A 3I72A 4HJAA 3H1UA 3ZRCA 1L7YA 3S24A 1RIPA 4P75A 1CKNA 2K1BA 3MAQA 1SIFA 5IP9G 4YSXB 3CCMA 3I3TB 2LZ6A 4DKAC 3P4QB 2PW5A 2KJ6A 3KVFB 4XYCA 3K0XA 2NUCA 2ZTCA 2F3VA 2KOXA 4LAAA 3VR4A 2L0FA 2A4ZA 2KFJA 4JWUC 4ZRIA 1YNNC 1WZ3A 3ALBA 3DCGA 4KJNA 2R93G 2PI2A 4I65A 3WOEA 1WD0A 4K81A 1MSGA 3N20C 4WQOB 4LFAL 5IGGA 1H8CA
chains in the Genus database with same CATH topology
2IGGA 1KNAA 5EKIA 2Z1CA 4KN7C 3HOYB 3I57A 2EYPA 2FHTA 5EGTA 3OWEB 3PUYA 4KKTA 4XXEA 2IJ0A 1GB1A 2K5DA 1EY9A 2A68C 2ID0A 4X3KA 3J7AF 5KGUA 2M9VA 3P42A 4A55A 2B8FA 3DEPA 3SR6A 5G5HA 3FILA 4DGZA 4N6EB 1TQOA 1STEA 3OOCA 3SR1A 4XQQA 3HUIA 4DU9A 1YNJD 2N55A 4XYOA 1ET6A 5K36G 3LX0A 1F2RC 1UEAB 4KY5A 1GUTA 1DOLA 4RA8A 2R3ZA 2FFKB 2F4IA 2D9UA 1F9RA 1VMCA 5FO7B 1G91A 4B9WA 2WU5B 5E4WC 5JXVA 1GUGA 1XYIA 3K5MA 2ONQA 4ULLA 2F0DA 3K5OA 3KLRA 1ZOYB 3LYYA 1P7EA 4G7ZC 2B2TA 3D4RA 4CJ2C 3V3XA 1MD2D 4R3DA 2N9LA 3OWFA 4CHTB 2B63B 1RM6C 2WDQB 1DOYA 1IGDA 1SNCA 2CQAA 5IT9E 2IT1A 1EWHA 4OHJA 2GA4B 3L3OC 5CGKA 1EOTA 2EJGC 3S1NB 3RZDB 2KMMA 2IX3A 5AUKA 4MT5A 1U4LA 3H6MA 3S2DB 2B8GA 2K5WA 2R61A 4C2MB 2JEBI 1XXGA 5JEAJ 4DK1A 4GDLB 1IBXB 1QOAA 2Y5CA 1KLUD 3J81L 1NYRA 5E4XA 3TZDA 4IOIE 2FMMA 2Q5WD 3AE8B 3AB9A 4KK7A 1GXDC 4EVOA 4IN3A 2WB1B 5FO9B 1JORA 4EE2A 1EY4A 4RGTA 5M3FB 4XYQA 5EPJA 5D7GA 2V4IB 3VA7A 3NQIA 3KWLA 1DOXA 3BDCA 3H0GB 2WS3B 3FRPB 2H1EA 4H0LC 1VRAB 2KQ3A 2LUMA 1O7YA 2BDNA 3U52E 3AECB 4K5VA 1D1IA 1DOKA 1PZJD 1CQFA 2R6GA 2O2LD 1PTOD 1H9KA 3E5SA 1L4ZB 2WXQA 5H92C 1JB3A 5FLXE 2DYOA 3AEEB 2QIEB 1XF5L 3AE1B 4DA2A 2EY5A 3K0YA 3H3VC 2YU9B 1WVLA 4OO1G 3NBIA 3ONAB 3RMHA 5I2XA 1JE4A 2C5CA 5I9OA 1HQMC 3GD7A 3ITPA 1K52A 4NZLB 4ID6A 4IUQA 3SHLA 2WXKA 3PIO3 1VF7A 1EQTA 2L1BA 1J8IA 1N5XA 3Q24A 2BCOA 1FFVA 4HROA 5C3XA 4HEA1 1Y1VB 4KKIA 4M0WA 2ICIA 1S5CD 4A90A 1QOFA 1SJHD 4NKLA 1N5WA 2L9HA 3EQLC 4MH8A 4WQMA 2MJ8A 2A6EC 1TKEA 5A2QL 1YQ3B 4P16A 1A3TA 2NN6G 4ZUJA 3HZXA 5EPLA 3C1EA 3NK9A 2BS2B 3GV6A 3TP8A 1TZOA 2E76C 3HVDA 4XE0A 1F9QA 1QLBB 1Y8OB 2I07B 5EE3A 3PUZA 2INPE 1C8CA 1HPCA 4NW2A 5FKAC 1SE3A 3HRDD 1I4XA 3TUOA 2QILA 2LS01 4IQZA 1HCZA 2WAQB 3NWSA 1XO3A 3GP7A 1K83B 3NXWA 1BCPC 4RFBA 3E0JA 2EXZA 1YN4A 3BK1A 2NZ1D 1SIJA 1HA5A 3N6RA 4ZK9B 2KHSA 3UI2A 2DN8A 3KLSA 4PMWA 2F0IA 1QWYA 2HCIA 5IT9L 2BB6A 5I6YA 3P4PB 2XRQD 4KD4A 2CW0D 2AQ2B 3JAME 1I6HB 5BN5A 2QCPX 1C76A 2EJMA 1VDVA 1CZGA 3Q23A 4IFDI 4F87A 2BTEA 3T3NA 2DY7A 2B2TC 5BN4A 2ICEC 1LABA 4ILWA 1G6ZA 4HJGE 3A8IE 4BY1B 3MP9A 3BZDB 4HMJA 4QF4A 4USAA 1SYCA 1D5MC 1IW7D 1N63A 3BDLA 1SFOB 1BBXC 2HUGA 3B9JA 4C3HG 2RSNA 1RODA 3NUHB 1RD9D 3E6ZX 2J7ZA 4E6IA 4C3HB 1ACCA 2Y3AA 1JMLA 1AFPA 1BDOA 3DWPA 3T51B 1U4PA 1FYCA 1RTNA 1I4HA 4WFN3 2WACA 5IGCA 1V97A 5EE0A 3SDZA 1WCMB 1S5FD 1STGA 4OVZA 1BCPB 5A35A 3ABVB 1A15A 4C7YA 4O42A 5C0XI 1NENB 4Q5VA 4FYDA 1F9SA 1WD1A 2WV6D 1DGJA 1XWEA 3OSOA 4WAFA 3W2DA 1HFNA 3RZOB 1CFMA 4H44C 2MJ3A 3U4EG 1PRTF 1GJXA 2LY7A 2RSOA 2WXLA 3NS1A 2JYEA 1ZXHA 1PDQA 2HTME 3TSSA 3EVQA 3OIQA 1II3A 1GUSA 3DHQA 4R8IA 3H8HA 2F0JA 2LKVA 1PDXA 4KGSA 1ICWA 4IUNA 3IAYA 3BVZA 3H91A 4FXCA 1A70A 2F0QA 2K32A 3T4AC 5D3IB 5BYQA 1Y8NB 1L6VA 3E56A 1STHA 2R92B 4HKQA 1R9TB 3G6JB 4QUCA 2I38A 1RDPD 1S5BD 3K57A 4MN3A 3T16A 3MVVA 2Z4HA 1OXSC 5T1GA 2MJEA 2BS4B 4ZHOA 2E6XA 4DXGA 2XSCA 3J7AV 3CRLC 5JEAG 1DJRD 4TQ1A 2NN6I 3D6CA 1V1PB 4ARIA 1YNJC 3KBGA 2IW3A 4A9AA 3EROA 4MACA 4XQNA 3DM1A 2WXFA 2XNAC 4KHZA 3FAHA 2JXMB 1I4RA 2F0VA 4L2YA 1Q10A 3PZ8A 3LWUA 3G7LA 5D65A 4R8NA 1F77A 1Q3LA 2WXMA 3K7AB 4XT3B 1GUWA 1LTRD 1PLFA 1EZ6A 1HTLD 1D1KA 2BS3B 4H2AA 1KFYB 1XLQA 3F2UA 1DOMA 5BYSA 1DM0B 4MIUA 1F0ZA 5KNCA 4FP5D 4ODGA 1TKYA 3FC4A 4IUPA 1Q90A 1BXTA 3NVYA 2SEBD 1H9SA 3W5VB 2LEKA 2F0HA 4K2KA 4CGYB 2JP1A 3ND8A 2HDLA 1JCKB 3CU7A 4C3IB 5IIFA 2EVBA 5IOCA 2TMPA 1QJOA 4KN4C 4TRDA 4IFDH 1EYAA 2RVLA 5KIXA 4A3FB 2SAKA 4J8QA 3KUPA 2F0KA 3PUVA 3MFGA 1JWSD 2XRSD 4Q2JA 1WTOA 4RCOA 2VNUD 4DAYA 1ZYRD 2NTTA 1ESFA 3HP3A 4TKOB 2LMCA 2YEPB 3B2GA 1Y69U 3URYA 3AE9B 4TQUS 3GTKB 1HRJA 4FXKC 1OXTA 2O5JC 1HZ6A 1KH0A 1N61A 2N9KA 1NUCA 3EA6A 2EY1A 4WORA 3IT6B 2K3UA 2SOBA 1RHPA 2F0UA 2BE5C 1J9OA 2OXPA 3VYSA 1E0BA 2AUKA 3IL8A 2L12A 2O4XA 3FEWX 1AZPA 1ILPA 2V4DA 4OW0A 2K9XA 3AMZA 2F1MA 1ENAA 3VYTA 2CHBD 3M7NA 5KNDA 4FF3A 3NWTA 3H09A 3PV0A 4A8XC 4IFDG 5JEAH 1L4DB 1FNWA 5J39A 1ZKOA 1JQ4A 3VR8B 1JICA 1VR9A 1E2VA 2MJDA 1O7LA 3QJYA 1V8CA 2ZW0A 1ONLA 4K8IA 3MJ5A 3BDOA 4UDUC 1QNKA 3CHBD 5LHY1 1FM0D 1BO0A 1PRTD 3SK6A 4P6VF 3ZGZA 2JE6I 2K01A 1EIHA 4NMZA 4FNFA 1F2LA 5F2DA 2KA7A 3MWYW 1QB5D 4IFDJ 4LLGM 4KD3A 2DLBA 1K50A 4JBWA 4KKJA 4XDCA 3S16B 3DWGC 3KLSX 3P7JA 4CKEA 4GDKB 1WYGA 2G9DA 3AEAB 5G3LD 5LL6S 2R93B 2QF7A 4NAWB 1YNND 1EY5A 2A6ED 5HGTA 1D4BA 1MPEA 2K7VA 1TWCB 2E2HB 2EYOA 4ZLTF 1JWBD 3AN1A 3NE5B 1HFGA 2N0SB 1UWMA 3QOLA 3Q8EA 3GTJB 1XX8A 1FCLA 1C48A 2ENBA 3HOVB 3HVZA 1L0VB 4AQ7A 4B0MA 3FMCA 5FOBB 3QG1A 5LL6X 3H94A 1FXAA 4NDXA 1O7ZA 1W6KA 3RPFC 5EJWA 2XN9C 3GTMB 1I4PA 2PZTA 2QEJC 2VB2X 2EYHA 1JROA 3A55A 3I8ZA 3M4YA 3WDNA 1FRDA 4JWSC 3MFYA 2ZXPA 3HOUB 2F0WA 3D4WA 4V0BA 1NI3A 3NUCA 1VDZA 1D5ZC 1VZ6A 3SK4A 1UWXA 2GI9A 3IXSA 4PT5A 5JVG3 1JWUD 3IKJA 1R4QB 1HQRD 1WTQA 5HG2A 2G9HD 2ZW1A 1NAPA 2OHFA 3QOJA 4G7HC 3KWVA 1FRRA 3NSWA 1NCVA 4ZUIA 1O78A 1PFBA 1DYQA 2KDMA 4RF1A 1SSNA 2VB3X 1EWCA 3AE4B 1TWGB 1KAAA 4KJOA 1F2MA 2D5DA 4PV1C 1Y1WB 4QMGA 1U4RA 4G57A 1CQVA 4PQXA 4A3EB 1A2TA 3A8JE 1B50A 3P1MA 4N58A 1MHHE 3U2SC 4XT1B 1D6EC 1ENFA 2A5HA 2B2VA 3D31A 4Y7NB 1I4GA 1BQQT 3NVZA 2DBYA 2JYTA 3N52A 1SMYD 4C3JB 1V1OA 1BUIC 1TIID 4NAMA 2IWHA 1UAPA 2QJLA 1LO5D 4XTCS 4RKLA 2JA8B 4GZYC 1YJIA 3BVGA 4QB4A 1H9MA 5KRUA 1CM9A 5LNK1 1EU4A 1EEFD 3KK7A 1SE2A 4A3IB 3W5UB 3D8GA 1SYDA 4KGTA 5ELFA 3I70A 4ME5A 3TP5A 3Q0AA 2D2CC 2CW0C 1NR4A 4PNYA 2BDOA 1P7FA 3S15B 4CJ0B 4WJWA 2BA1A 4EGVA 2X6GA 5C0XJ 5GXGB 4CQNA 4KGRA 5EKLA 4WH4A 4K5XA 5CBEE 5C44B 3V05A 1YJJA 2L1AA 1FO4A 1C4QA 5CORA 1LT3D 1DZ1A 1ESRA 3S17B 4US9A 1IBXA 2ACZB 5FR3A 1YN3A 5MPOA 1PZID 3R8BA 3P75A 1Z6HA 5ELEA 4BBSB 1YNTE 3TEXA 2A74C 3SFEB 1SNOA 1OQRA 2CJNA 2INNE 1ZDXA 4WIPA 2G1EA 5M5XB 2K5QA 3AE2B 1QILA 4EQOA 4CBVA 3VYRA 1SNDA 2FBWB 2V3PA 1IUEA 4HSPA 2Q8IB 1SEBD 2O5IC 4EQPA 1LT5D 5JAVA 3MHBA 1PXUA 2PVOD 3TZUA 3W1SA 1WTWA 2EZVA 2PVGC 3PO2B 2TSSA 4JK1C 2RQXA 4US8A 3AH7A 4TMAB 1SYBA 3L9AX 4MM3B 2KCNA 3ERQA 3C1FA 4IUUA 1TJEA 1HZ5A 2EELA 2JXTA 3AE7B 5KYIA 3RLFA 1RF2D 4D2KA 3A8KE 4JE3B 3EGRA 2PW9A 1CT1D 1SYGA 4A3MB 1OXUA 4RHSA 2AWOA 3JAML 1X3PA 4O1NA 1ENCA 2PLPA 5E6JA 3UI3A 3TEYA 2BOSA 3SK8A 1Z7TA 4BBRB 4KKUA 4K2LA 4LK1C 4RAUC 1ET9A 1B9MA 2GRIA 4ARCA 2LJIA 2HDEA 3B2FA 2KQ4X 1CA5A 2WXIA 3BYYB 3A7LA 3DWAA 3NPPA 2EYJA 4KX6B 4RKBA 2PPBC 3P1HA 5KEEA 2W55A 4XWWA 1HUMA 2F3WA 1CHQD 1X32A 1NYQA 3X3MA 2PMZB 1S5ED 5BYRA 3P4SB 4ZKCB 1TS2A 4DNRB 2VXWA 5CV8A 3GTQB 3DXJC 5HI1A 2M19A 4ZKBB 1E6EB 3Q8BA 1STNA 3NTHA 5I4DA 4XDXA 3NBHA 1F2YA 4M1UB 1SNQA 1LT4D 3DEOA 2Y0SB 4KV6A 3V96A 3CRKC 3FDTA 1BCPF 1NR2A 1PFNA 2DY8A 4QCLA 4XWTA 4DQOC 1I6VC 4RGMA 1R7SA 2OF1A 5COYA 2VUMB 1T6BX 4FF4A 2PYKA 1FXIA 4LJZC 1JOOA 2IX0A 4L63B 1CTMA 3QB3A 4CKCA 1KTKA 4IDIA 3I9V1 1XCQL 4B08A 4J1MA 1I4QA 4K6DA 2AX5A 4YTNB 4HCEA 1TT2A 1QNUA 1QF6A 3NVVA 2EY6A 1V43A 2NTSA 5DM73 1BMLC 2Q8TA 5IODA 1GHJA 1SNMA 1TR5A 2PMVA 1WTRA 2SNSA 1EM7A 2WXPA 3A56A 2KCCA 3J81E 5EE1A 1GUOA 1PFDA 3CKIB 2WXGA 1Q12A 2J42A 3S2HB 1MSHA 1AN8A 4C3JG 4BS9A 3DUZA 2QKIC 3HKZB 3M3YB 3GTPB 1KLGD 4A3KB 2EOTA 2WXOA 4P2CB 1HEZE 1JR0D 3NHHA 1I3QB 5DM63 4L6TB 2CU3A 3T53B 1EFID 2RBMA 1TWFB 2A68D 1D5XC 4J3OD 2VZKB 1VZ7A 3ETRA 3GS2A 4RGOS 3J80E 3HS0C 3EUB2 2FE8A 5J22A 2LGIA 1RTOA 2JZPA 2WP8J 5EPKA 1WSPA 3DMUA 2OT2A 4HR7B 2JWUA 4TQ0A 1MVKA 4JX1C 1JWAD 2YYZA 1DONA 4A3JB 1AYFA 4RWSC 3FPUB 2WU2B 3NP8A 2K0PA 3AV8A 1QOHA 1AZQA 2PIAA 4RNAA 4L8JA 3OIPA 1I7HA 2KN4A 2F0SA 2M0AA 3GTGB 4BA2I 3S9WA 4ABNA 5A2QE 1JRPA 1WWTA 3AEBB 3NTKA 3AEFB 1F9PA 2NYZD 5I6WA 1FFUA 1XLOA 3IAS1 1BUVT 2H89B 4BA1I 1QG7A 2MHVA 2DWQA 1ZDVA 3PZ7A 1QT9A 2CJOA 3CQZB 5K5PA 1N62A 1FCCC 1CHPD 4Z9CB 4KKSA 4HN7A 3C2PA 2D5GA 4NJCA 1SNPA 2J0TD 4G4KA 2KEEA 2PKOA 1ILQA 1A2UA 4H7BA 4C1NK 5JPMC 4BY7B 4U673 2KVMA 4FVMA 4H13C 5C0XG 4ZQ3A 2F0EA 4ZOHC 2KJXA 1B1ZA 4HKZE 1JW9D 1PTOC 1VCIA 1B3AA 1NSNS 1E10A 2A6HC 1TY0A 2SDFA 4ITKA 3BIID 1SSOA 1CK1A 1PRTB 2QMTA 1XEEA 4V190 4DFAA 3MXNA 3HRZC 3CIRB 3HOXB 1E2ZA 3TDQA 1AP0A 1EL0A 1L5PA 4I7ZC 2W54A 3AM9A 2H88B 3OW7A 3TMEA 1GOZA 5C3EB 1A3UA 2MP1A 2Z4IA 5C2TB 1G2SA 4BWGB 4YSYB 2LFIA 1OXVA 2X6LA 1BR9A 2GB1A 2L4NA 2KEDA 1ZPSA 5C3WA 2BBCA 5E1FA 4L23A 1C78A 1IHZA 2K33A 3GTLB 1T5EA 3IFTA 2NVTB 2F0LA 5C4JB 5FLXL 2NBFA 4YTPB 1TY2A 4KTAA 5D3DA 2D62A 4K14A 3R2IA 2Y5PA 3K58A 2F0FA 5C6AA 1FMAD 5CC4A 2MEKA 4ZYSA 4RH6A 5AFWA 4OGQC 1UUPA 3BWUD 3VR5A 2L5TA 4DAPA 1VMPA 3P4RB 1G2TA 1EY6A 2NN6H 2LMCB 4IALA 2IDYA 3J9CA 1FNUA 3IAM1 5ELBA 3MXPA 3I91A 3C3LA 3A7AB 5T8IA 3MC0B 1K53A 2L0CA 5HURA 2KOLA 2EYLA 3W3AA 2EY2A 4F7XA 5M5WB 2B2UA 3D6WA 3P20A 3RFZB 1GUNA 2B2YC 5IGDA 3TP7A 1PFMA 2K28A 2F0NA 4C7ZA 3AB5A 1O80A 4NP5A 1RYJA 2XWJB 2HCCA 3J80L 1U9RA 1TS4A 5CBAE 1YQ4B 3AEGB 1QOBA 3PIP3 2J4XA 2MH7A 2FMCA 5JPNC 2A69C 2JSOA 2QSDA 1X3QA 2CVRA 5TSSA 4OO1H 1FD7D 2JU6X 5IGFA 3I3CA 3SE0A 3RD4A 2W3SA 3NTIA 2EKIA 1KNEA 4B9XA 4OZCA 3R2TA 2XWBB 2WNMA 5C0XH 1JQYD 3I4NB 4YIJA 2ZT9C 2JYOA 2BA0A 3LXFA 2J52A 2ON8A 3PMFA 2LHDA 3VRBB 5M9OA 3VR3A 1PMRA 4A3BB 5C4ZA 1M4VA 3DWQA 5NUCA 3VA5A 3BS1A 1EYDA 3K59A 1LTAD 5AUIA 3M4OB 3S1RB 1ZXTA 1TS5A 2EDGA 4N59A 2N88A 1N60A 2E2IB 5D14A 3GB1A 2WINB 1KF6B 2R7ZB 5I9PA 1W6JA 1NVID 1AW7A 1T5XD 1IKMA 2Q8RE 1ZEQX 5EBDA 4LTUA 3MEHA 1IGCA 3T3OA 2V0GA 1STAA 2DNCA 1S4ZA 2PCFB 4DN4M 2L55A 5CV9A 1LLRD 1L6UA 5C4XB 3SVMA 2A6HD 5CMDA 3PO3B 1DOIA 2KWDA 3TEWA 2JQRB 2WXHA 2JEAI 3ND9A 3HGBA 3BG3A 4OIJA 3OPOA 3A54A 3SXHA 1VZ8A 1MGSA 1E7PB 2EPBA 4C3IG 2F0PA 4KY7A 4JPSA 3Q6SA 4UAIA 1RCVD 2SNMA 2RDHA 5C4HA 1VLBA 4XDDA 1HHVA 2V3NA 1B9RA 3ZJVA 2LFNA 2M00A 2WKDA 3KQ4A 4K6LA 1BCPD 4YXDB 1EY7A 1IW7C 1JOKA 5CV7A 1R4PB 1TWAB 1MI2A 3GO5A 3IT4B 4B0EA 1BF4A 3VR2A 1EZ8A 2F03A 2HDMA 1LTTD 2N7JA 5JOBA 5BN3A 5K36H 4J6HA 1H9JA 1TKGA 1HTPA 3ZQ4A 5CV4A 5M5YB 1QE6A 2RDFA 5JJZA 3K5LA 1GB4A 4FXDA 1AEXA 5EBCA 3P63A 4QUFA 3NRZA 2RPVA 1K8MA 3DWMA 3PUWA 1L0XB 2IPKD 3TBIB 1TWHB 1E2WA 2KAJA 1FR3A 4XQJA 4ZAIA 5T1IA 3WOFA 5HFYA 3M85A 1LTBD 3I90A 2DYMA 1B53A 2JA6B 2WDVB 2RKSA 4A3DB 2F0GA 4YT0B 3LNNA 2PZUA 5I2YA 1TKWB 2F0MA 2EE1A 1KRHA 3VYUA 5IGEA 4OO1I 5KNBA 2WXNA 2K5PA 3K6OA 2X38A 3SFDB 4N9TA 3NZ3A 2E2JB 4A6QA 1NEKB 5J1ZA 1G291 1C9FA 2WLBA 5C5MA 1SB3C 4AS1A 2B2WA 1E9MA 4C80A 4YWGG 2B2UC 3MXGA 4S3SA 1IL8A 3EFXD 2F0TA 4LK0M 2B2YA 1B2TA 2NWGA 3TP6A 3FILB 3Q69A 4ZRPA 3W9CB 1SAPA 2H4OA 1B9NA 4HSVA 4OL7A 2BYTA 2FUG1 4K5WA 1SYEA 2NB0A 2KECA 4TSSA 3ZJUA 1HXYD 3AU7A 3VQIA 2QDBA 1RWSA 4X3UA 4HCSA 5CR3A 1ML0D 2AQ3B 3EJIA 5FO8B 4OZBA 3M7GA 3QWNA 1KABA 5CV6A 5C5LA 2WXRA 5EKKA 3K5NA 1MBYA 3S1QB 2ZXRA 3C46A 2BW2A 2IX1A 2FINB 3OMGA 2XIWA 1EWYC 3QO2A 4QIWB 5EE9A 3GTOB 2M2LA 5FK9C 4KY6A 1CZPA 3IFDA 4XIGS 3GQBA 3AE5B 2ZXOA 4ZRQA 1AWDA 2K6AA 1A3VA 1ROEA 1ZE3D 2B76B 3MZ5A 3S1MB 4HTHA 4HEDA 1WTVA 5G3LF 1H9SB 1OFFA 3PUXA 1PRTC 2PO4A 1MI0A 4DXFA 2B39A 4DAVA 3NVWA 3L7ZC 4IURA 1PZKD 2NVQB 3HOZB 5M3MB 3E9SA 2MUYA 1LTSD 1KDAA 1SDFA 2WDRB 4HRSA 2WIIB 1OQQA 4YTMB 1PTOB 4ZHPA 4X3TA 4FF2A 1QQRA 3AE6B 4IKGA 4G7OC 1OXXK 1EQVA 1HA6A 1F2ZA 2X69A 1C79A 2JSVX 2RMMA 5ISRA 1XLNA 1PGBA 3OHXC 3AEDB 1B44D 1EYCA 5H8YE 4RGNA 2VZKD 1IYVA 1HUNA 1J7BA 2KACA 2HQEA 4IUVA 2YEPF 1PGXA 4AYBB 4PMCA 1IYUA 1DD2A 3C8YA 4DF7A 5DEHA 4X3SA 4K8JA 2EYFA 1K51A 4IZ8A 3ZJTA 1EEID 2AUJD 1Y56A 1T3QA 1GPXA 2K22A 1S5DD 2BT6A 1PUTA 2L83A 2W3RA 1FIQA 3WCQA 1ZP0B 1C4CA 1G8ZD 2PZWA 1RKNA 5BMHA 1CJEA 1BNZA 4R9WA 1WGKA 2IGDA 5HHDG 1LTGD 1PTOH 1EIGA 3KF8A 5JVH3 3FVQA 2I2YA 4IUTA 3X3NA 1IKLA 1XTCD 2F0OA 3NQTA 1UNSA 2KUMA 4N9PA 1YMHE 3KBXA 1LT6D 1LACA 3MA2B 3QIAA 1KDCA 4CKBA 2FJ2A 3RUZA 3T56B 2PTLA 3HOWB 5EQ0A 1EY0A 4HAEA 1U4MA 3I4MB 1FNVA 1SBBB 4PMBA 2NMQA 2AWNA 1Q8IA 2WKCA 1STYA 3AE3B 2LHEA 1L0YB 3MHZA 2WQYB 3FPPA 1LV9A 3Q8CA 5G5GA 4OZAA 3U9SA 1SE4A 3OMCA 2BE5D 1V8QA 1BOSA 1WXQA 3I73A 5C3JB 1GHKA 3R3OA 2PQEA 3LWEA 1CI3M 3SK5A 1FGBD 1RFKA 1K8OA 2NVXB 1SXTA 2EJFC 2IGHA 1CZWA 1JC7A 1STBA 1DCZA 4YSZB 4FF1A 3J7YW 1XLPA 1SJED 1Y8PB 2L52A 4WWMA 1FD6A 5IGBA 2B2VC 1WTPA 1SYFA 1EY8A 1J7AA 1XCTL 4L1BA 2B2WC 3R93A 2M56B 5CV5A 3Q8FA 1QCBD 1TU2B 1ZUD2 3MTSA 1V1PA 2E3TA 4HMIA 1E0ZA 4ZRZA 2MPMA 3O13A 1D2BA 2E2DC 3ZYYX 2RDGA 4EQNA 4CJ1B 2K05A 1GAQB 1OO9B 5BMGA 4U68A 1ZYRC 4F8MA 4DNTB 1Q1BA 3I4LA 3VRAB 2Z8LA 2IL8A 3Q8AA 4RF0A 4FO2A 2E74C 2RA4A 1DXMA 4Q0FA 5ELCA 3HEJA 3U9OA 3BYTB 2I46A 4M8AA 2A73B 1SMYC 4F88A 1UGJA 3BK2A 3AMUA 1LTID 3MXUA 2PNRC 2K04A 2JA7B 4C1NI 5ELDA 1H9RA 2MGSA 3LB8C 2XVSA 1MHXA 1Z47A 2WP9B 2L11A 1EU3A 3D3RA 3VR9B 2A69D 3FKIB 2JA5B 1FEHA 3L4PA 2AQ1B 1VF5C 2J53A 1TS3A 3N9YC 4KHVA 1ZXIA 2WXJA 4FXGC 4RCNA 1I50B 1WTXA 3D4DA 2PW7A 1YN5A 4GLSC 1WRIA 1F2RI 1QOGA 2E75C 4OIKA 4A3GB 3VR6A 1RJTA 3Q22A 1J7CA 4REZA 3T13A 1SF0A 3S14B 4C56C 1B4OA 2L32A 4KMUC 2C9OA 3U7ZA 3BVMA 4WURA 1TVXA 4LMQD