3TSSA

Toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
b'NIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRIKKSQHTSEGTWIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFKIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
molecule tags Toxin
source organism Staphylococcus aureus
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
total genus 63
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tssA01
1FGBD 5D3IB 1V1OA 1KLUD 1PZKD 1JWMD 1F77A 1S5ED 1PRTF 1UUPA 1LTTD 4NZLB 1LT6D 2NTSA 1EEID 3MFGA 1CHPD 1PZID 1GOZA 5ELEA 2WV6D 1I4HA 3BZDB 1JCKB 1L0XB 2Z8LA 3DWQA 5ELBA 1PTOC 2IJ0A 1SE2A 2O2LD 1JWSD 2G9HD 1S5DD 3R2TA 1PRTC 1SE4A 1SEBD 1PYWD 5D3DA 4RGMA 2XRSD 3DWPA 1TS2A 4ZYSA 3BYTB 1EFID 1LTID 1FNUA 1PRTD 1SJHD 4UDUC 2AQ2B 4RFBA 1PZJD 4RGNA 1CQVA 3OWEB 2IPKD 1KTKA 1CHQD 4RCOA 1TS5A 1TY2A 1CT1D 2XRQD 1ENFA 2XNAC 5ELFA 1EWCA 1JR0D 1HA5A 1FNWA 4TSSA 3URYA 1BCPF 3BYYB 5ELDA 1MD2D 3R8BA 5FKAC 1DJRD 4C56C 1PRTB 3EFXD 1RF2D 1LLRD 1HQRD 1YN3A 1ET9A 1SJED 4OHJA 4RGTA 4K6LA 3DWAA 1YN5A 1BXTA 1D5XC 1BCPD 1I4RA 2SEBD 1DYQA 1I4GA 3MC0B 3O13A 2ICIA 5TSSA 1LT3D 1PTOD 3SEBA 3GP7A 1FD7D 4RHSA 5I4DA 1AW7A 2XN9C 3BVGA 2TSSA 3KLSX 5ELCA 2AQ1B 1QILA 1LTBD 3CHBD 1V1PB 5FK9C 1D6EC 1LT4D 1B1ZA 1SXTA 2CHBD 3BVMA 1XTCD 4RHRA 1LTRD 4L63B 4DXGA 1EU3A 1TS4A 3W2DA 4RGOS 2AQ3B 1D5ZC 1BCPC 1I4XA 1RDPD 1JWUD 1HXYD 1FNVA 1L0YB 1XXGA 2RDGA 1CK1A 4L6TB 1S5BD 3BVZA 1RCVD 1EEFD 4O1NA 4DXFA 1KLGD 1TY0A 1EU4A 3TSSA 1M4VA 1BCPB 1I4QA 1ET6A 1SBBB 3R2IA 2NTTA 1HTLD 1PTOF 1SE3A 1PTOH 3V05A 1B44D 1JQYD 1LT5D 1LTSD 1UNSA 1PTOB 1D5MC 2QEJC 1G8ZD 4Z9CB 1TS3A 4BWGB 1AN8A 1I4PA 1LTAD 1T5XD 1LTGD 2R61A 1S5FD 2J4XA 1LO5D 2QILA 1YN4A 1STEA 1RD9D 3EA6A 4RH6A 1S5CD 1V1PA 1ESFA 2RDHA
chains in the Genus database with same CATH superfamily
1LTLA 5IOCA 4JLCA 3GTLB 5CX3A 3ECIA 1AEXA 1N60A 4NXNQ 4JPBW 3LWEA 1MVKA 4HN7A 4A3KG 4JCVE 2MHJA 1C1YB 5EGTA 5JJIA 3TP8A 2K25A 3H94A 1VQ9A 5JEAJ 2FAZA 3RNEC 5ELBA 4A9AA 2NZHA 5JEAG 4B3TL 2KACA 3SK6A 1PRTC 2F0SA 3WWVA 1R4QB 1WXVA 2ONQA 2MJDA 2BS4B 1HNZQ 3S17B 2WXLA 4LJOB 4GLXA 4W9JA 1D8LA 3I72A 4V190 1KOTA 3D0FA 3FKIG 1SDFA 2GN5A 4UDUC 4RFBA 4GOPC 1E5WA 3MHSD 3PZ8A 3NVVA 4BY1B 1V9PA 2G9DA 1GPXA 1QB5D 3V3XA 4LK0M 4RM9A 1HR0Q 2QDLA 4BBSH 2GB1A 2PTLA 3H91A 1E9MA 3AN1A 3H7PA 1WE7A 4DV5Q 4MGZE 3DVGY 1YI2A 2DGYA 2H4OA 2RSNA 1GKHA 3NENA 3R8BA 3GTQH 3B1LX 4I7AA 2GBRA 2Z6KA 1SNPA 5COYA 1Q0WB 2NZ1D 1KHIA 5J17A 1Q8KA 2KQSA 2EXDA 4X6AH 4Y7NH 3HFZB 4RM8A 3DWAA 2DY8A 4P74A 4A3CG 4K5XA 2J7QB 1HNWQ 2MJEA 2PKOA 4L2YA 2KK8A 3CP0A 3GQBA 2MP1A 3KBGA 1WGHA 4G3XB 4OZBA 2LGIA 3Q22A 3GV3A 1EIGA 1N8RC 3MC9A 3OJ4B 4HVBA 5HY6A 1Q8IA 1R4NI 4E74A 4OONA 2MNAA 4R9WA 4RHSA 5T1GA 4N58A 2INDC 2IGGA 2PE9A 1HTPA 2RCNA 2EVBA 5IO9A 1JB7A 2C5CA 1XTCD 4DUYL 1SNMA 5FJ8G 3H6MA 4ME5A 3KF8B 1SSNA 3A5ZB 3BU2A 1DOKA 2NWGA 4C2MH 1XNRQ 2KN5A 1VZ8A 2Y5PA 1Z9FA 2ENBA 5C3JB 3I8ZA 4U673 1RDPD 1C79A 3M3YB 4IN3A 4JI8Q 5A2QE 2L32A 4YCVA 5M3MB 2W9NA 1X56A 2LVQA 2O6VB 3ZJVA 4IOCA 2SNMA 1A3VA 3TP5A 2V3NA 1ZDVA 1Y14B 4QB4A 3JAML 2IO2B 4WWOA 4GKKQ 3V05A 3QHTA 2OJRA 2WB1E 2BOSA 2MGSA 1O78A 2JA6B 2ALYB 2XSCA 2WU5B 4Z9CB 3ICEA 2IY5B 4LCDE 5DPRA 2N9LA 2L00B 1NJIC 1UWXA 4HJKA 1VQGA 5C4XG 2X69A 3MTSA 3LYYA 2V1CC 3P63A 2E74C 4KKTA 3ZYYX 1YN4A 2KFKA 5IY0A 5IGDA 3CC2A 2JSVX 3X23A 4GOPB 2VY3A 2FUG1 2DN8A 2ID0A 1MBYA 2WDVB 4GIVA 3NUHB 3CCMA 4C3JG 2KHSA 3JW0X 2EJMA 3ML9A 2E2IH 2JEAI 3BJUA 4F8MA 2DYBA 2JA8H 4JL9A 2Q8RE 1BUIC 3J7AF 5FLMH 1K8GA 5IYDH 1F2LA 2Q8IB 2F0TA 3FMCA 1PGBA 2HCIA 3HUIA 3BZDB 1VMCA 4J1MA 2KT7A 3PRMB 3AI5A 4ZOHC 1NY4A 4C80A 4JI6L 4IZ8A 1GVPA 4XQNA 2LJ5A 5J2RA 3U4EG 1QOAA 1VDVA 1S5DD 4AJWA 4FDBA 4QQBX 2UU7A 4IO9A 2Y3AA 2ZXPA 5D2MB 5CHFA 2OTJA 4GDLB 4R1JA 2DX5B 1SFOH 4HCNB 2WDTB 4KIKB 4BBNF 1WJNA 2IWHA 1B70B 2DAJA 3B2FA 4J8QA 1L6VA 3KBXA 2B2VC 4M1UB 2AL6A 1CHQD 3FDTA 1TR5A 1M94A 4I6NB 4ZHPA 2ZCCA 1RHPA 2G3QB 2XRQD 1EUJA 1F2RC 1QCBD 2F0FA 2OJWA 3DEOA 1TJEA 5KEEA 5H1SE 4DR5Q 2D3GA 2PNHA 1VQ7A 2X38A 4MGIE 4EQPA 4NAWA 3MXGA 2W55A 3J7AV 3FEWX 5ELDA 3PS6A 1O7IA 1F9PA 1MD2D 3ERSX 4MDKE 4ZDVA 4HXDA 4ACFA 4Y7NB 3QWNA 1C77A 1LLRD 3CCJA 3RI7C 1YNJD 3VR2A 1OQYA 1NYRA 2PW5A 4K0KL 3QA8A 4H0LC 2A68C 2NN6I 2WAQE 1E7PB 1HPCA 4A3LG 4L5SA 2LXCA 2C9WB 3KVFB 4A3IH 1BMLC 3A9KB 1HZ6A 2JVCA 2KMCA 3M3JA 4GDKA 3V6EB 4HKQA 1YBYA 2BKFA 2E5LQ 1L6UA 2KWUB 4ANUA 4RA8A 1B1ZA 1Y1VH 1K8OA 1GJXA 2CHXA 1IW7C 4A3GG 2E3TA 4KGTA 3EIVA 4A3MH 2UUCQ 3SDLC 2KUMA 3PO3B 4MGYE 1SNOA 5AZGA 3T16A 3SHQA 3Q23A 4C3IH 1WCMG 5T1IA 1E0BA 2R92B 1OQQA 2ZVOA 1BCPC 1YQ3B 4F87A 1MJCA 3UE0A 3PIP3 3ZNHB 1PFNA 2A6HC 3S2HH 1EUVB 1S5BD 3KOJA 4O2DA 2Z9HA 4BBRG 2K50A 4EQ5A 3DHQA 3ND8A 1SBBB 2L9HA 3A55A 2FCMA 1SLJA 4B08A 2JXMB 1SNQA 2MQJA 4EX5A 1B9NA 1HTLD 2BA1A 4KD4A 5CYUA 1R4MI 5EPKA 2LMCB 2RKSA 3CCQA 1RKNA 4IM0A 1BOSA 1E1OA 2EJGC 3IFDA 3D32A 2SDFA 4HTHA 4DUYQ 2JPHA 2MPMA 3CU7A 2R3ZA 4IURA 3A9JA 3I73A 5I2YA 1TKEA 4DV1Q 1I94L 4K8JA 3EBEA 5EPLA 1IBKQ 1I5FA 1XT9B 3ZVVA 1VRAB 3S1QH 1MGSA 5IA7A 2OQKA 4R4TA 1QZEA 2NBWB 3BS1A 3SHLA 4MZ9A 5LL6X 4DUZQ 2LWPA 2NBVB 1C4PA 4JI2L 3CIRB 1MI0A 4ARCA 1B53A 3ABVB 4ZK9B 4DR4Q 1IPGA 3P7JA 4QAYA 3H8HA 3I7FA 1I4HA 1J0GA 3A4RA 2KX3A 3QR8A 4IUVA 2P5ZX 1SF0A 1HUMA 2IJ0A 2MO0A 1BR9A 4UP9A 3R2TA 2EJFC 1XTDA 4JW0A 1XLNA 2GBJA 1WGDA 4Q2JA 5D3DA 1XNQQ 4LF4Q 1F52A 2Z0EB 1N33L 3QCAA 3QIJA 4LNQA 4C3IG 1L1OB 3BYTB 1VQPA 2K6AA 1QF6A 2A74C 3NTHA 2N4FA 4DAVA 2WS3B 1YJNA 5JXVA 1JWAD 2KC2A 2UYZB 3HVZA 4JBKA 3S9WA 1IL2A 4XWTA 4TV3A 2EELA 3M95A 1TGZB 3CCLA 1P8LA 5IGBA 1K8AC 2DHZA 3ZO5B 2V0GA 2A6HD 4B9KA 4AJYB 1JQ4A 2Y0SB 3L17A 1HA5A 4HIOA 2CFMA 3BYYB 2WX0A 5CV9A 2ZNVC 1MI2A 2MCNB 1EM7A 2K04A 2F0PA 3T56B 2N9XA 5DCNA 4HRSA 2M17A 1C3TA 1GUSA 3DQVA 3AM9A 4A3JB 1EZ6A 1WI0A 1WYWB 3BIID 3TUOA 4HPPA 4GDKB 1DM0B 3A8KE 3SK5A 1XMOQ 1QOHA 4IPGA 1C7YA 2D0OA 5BMHA 4GS3A 1K83H 3PSIA 1IYUA 4Y52H 3IKJA 4K1RB 4O42A 4IFDH 1DOLA 5JHAA 1QNKA 1KDCA 1IXRA 2I38A 4IPCA 4MTNA 1PTOD 3NK9A 4X64Q 3GP7A 3KYHC 1Y1WH 2UXCL 1WTRA 5BYQA 3ZW3A 1DOYA 3ULPA 3UDFA 1WTHA 4X65Q 3KW5B 5JZEB 1YVCA 5ELCA 3AH7A 1XCTL 2OOBB 4LW1A 1VCBA 3MP9A 1RAXA 3NY5A 2BYFA 4H44C 2JA5G 3J81L 2HJ1A 4US8A 1FYCA 1VDZA 2PPHA 1SYBA 2EPBA 3N3KB 4PG3A 1KC8C 1H9MA 1GUWA 3AEGB 5BYRA 3I4NB 4K0KQ 2AMCB 4DK0A 2K28A 1ZDXA 1YQ4B 3BZCA 1XXGA 4DXFA 1CK1A 5I9PA 1J7AA 5HKHA 4FJZA 3W5OA 4K5VA 4GLAC 5IWAL 4C7ZA 1WX8A 2WXMA 4A3IB 2ZEQA 1WD0A 1Y8NB 1PDQA 3ENEA 3TJPA 3EGRA 2L5TA 1M90C 3RLOA 2FXQA 2LKVA 3K9PB 3L3OC 1JT8A 3OJ3A 4JOIA 3E5SA 3Q8AA 1KDAA 1DZ1A 3M62B 1E7VA 3M4QA 2A5UA 3B0AA 4GXBA 1E2WA 2O6VA 4JI6Q 1WGKA 1H9SB 2AHOB 1ZW7A 1BBXC 1Q81C 1J9OA 4DV3Q 4DV2Q 2ZTEA 3MTNB 2V3SA 4OIKA 2JA7G 1AYFA 2OQ0A 5D3IB 5BR8Q 4G11A 3VRAB 5C4XH 1EYCA 3U9SA 3KF8A 1PH4A 1LABA 3S15H 3AULA 4HKZE 3PO2G 1WZ3A 3WOFA 1HJPA 2R93B 2C5LC 1V1QA 3UQBA 2JK8A 3D6CA 5FJ8H 4DV4Q 4BY1H 1EEID 3A8JE 4OX9Q 3VHTC 1QWYA 2JXXA 4GLSC 4OVVA 4EFOA 3EQLC 1QQRA 3HKSA 4JG2A 4MT5A 3NWTA 3KLSA 1L0XB 3RNFC 3DWQA 3T8MA 1BBWA 2KHJA 1IBKL 4J6IA 1V9JA 3K8AA 1WMHB 2DZJA 1F9SA 4DV1L 3EC8A 2WXQA 3TS0A 5IYBG 1V5OA 3DWPA 1GUAB 3CQZB 2WU2B 1GM5A 3BWUD 4DR4L 2D11A 2F0NA 3DWGC 3AE9B 3HKZB 1A2UA 3KWVA 2GLSA 1EWYC 4N8X1 3PO2B 1WZ0A 2EYLA 4H2AA 4CO7A 3GTMB 2N1WA 5J18A 4GOPA 3GTPH 2N9PC 4N6EB 2JA7B 4UPAA 4JK1C 2J52A 4KIKA 3E6ZX 4TSSA 1HZ5A 3QJYA 3HRZC 1ZYRD 3U7ZA 5EE3A 2CJOA 3UF8A 4A93B 1VMPA 4EGVA 3EFXD 3RZWC 4UP7A 1PXUA 1SNCA 3VYUA 4BBRH 3KUCB 5CV8A 3L4PA 3W9CB 1MSGA 2JZZA 2DAFA 5FR3A 4IFDJ 2Y5CA 2EXZA 2JJQA 1T5EA 4HJ7A 1N34L 1HRJA 2GBKA 4NJ6A 2F0OA 2C60A 1A0IA 2D3BA 2CS4A 1VD2A 5TSSA 4A55A 2KQ3A 2BWES 2F03A 2AWTA 4FF4A 2XN9C 3M4PA 5M5YH 1QVGA 2D10A 2L83A 3JYUA 3NXWA 4I6LB 4AQYL 4KZCA 3UIOB 3I4NG 1LT4D 4JVZA 4DHJD 1CA6A 2DNEA 4OO1I 3PSEB 1WM2A 3H1UA 4HIKA 2V4LA 1LTRD 1HCZA 4R4QA 1V81A 1A63A 4YXDB 2WWZA 3AE5B 1IL8A 1CZWA 1O7YA 5KHQA 2DZMA 4X3SA 1L0YB 2WXFA 4LUOA 1RCVD 1WFYA 1Q86C 3D31A 4JI5Q 2HQLA 1JALA 4KGSA 1KNEA 3W1BA 2PIAA 4AUQC 3J80E 4WWPA 3H9DA 5EE1A 1DOXA 2BYEA 4X65L 1ZE3D 3AEFB 1T9HA 1B44D 1U4PA 3PUWA 1LTSD 3Q69A 2RHQB 2VH2A 2QEJC 5FO7B 5GXGB 4J6HA 3RYTA 1FO4A 3VYTA 5ELNA 3ALBA 3TEWA 3J80L 3T13A 4YWGG 1JMCA 3AECB 5DEHA 2QCZA 5E6OA 4HCPB 4IM3A 1SGHA 4FXKC 2YVCA 3CSFA 1V8QA 3PF5A 2R7ZH 1UBIA 1PFDA 2OWOA 4HJGE 1CA5A 4HLEA 1VQOA 5A35A 5M3FG 2CW0C 2YTVA 3AV8A 4IG7B 2L0CA 3RZFA 2V9HA 2B2YC 3TEYA 2N49A 3H0GG 4PZ7A 1PH9A 3ZDTA 2BTEA 2KANA 4KDLB 1CJEA 4MHEA 2OF1A 1WXQA 1JOOA 3DMUA 2Z6KC 5E6NA 3NELA 1TVXA 2N55A 1JWSD 2G9HD 3MXNB 2F4VQ 4PYZA 2JWUA 1OXXK 3HOUB 4MEMA 2M1MA 5EKIA 1CKMA 3HP3A 3OW2A 1NVID 2CR5A 2KO3A 3AYHB 5IYCG 3S2HB 2GBMA 3UI3A 4TQUS 3V60A 2XWJB 3UIPB 3I4MH 5BR8L 2RA4A 3Q24A 2HE7A 1FNUA 1ZOYB 4XT1B 2XEWA 2L12A 1F2YA 2Y0SE 3AB9A 4AP4C 5HFYA 4L23A 2IPKD 1KTKA 4NXNL 3CMAA 3DOWA 4LMQD 3L16A 3TMEA 5ISRA 4PS7A 1WGYA 1WTOA 1QZGA 4AYBG 2Z6BA 3S14H 1H9KA 1PLFA 1SRUA 4X64L 1B2TA 4NP5A 3GTPB 3Q3NC 5DPTA 2BYTA 4D2KA 1UWMA 3CCEA 4DK6C 5EKKA 4CGYB 4OXPA 3ETRA 2WXGA 3OMCA 5JJKA 1ROEA 4II2B 1EOVA 1Z6HA 4ZQ3A 2OHFA 3N1YC 2GA4B 1J8CA 4OELB 5IP9H 3NOBA 3AFPA 2NS5A 3APCA 5H8YE 3VH4B 1ET9A 3PQIA 1PA6A 4DHZB 4NDXA 1PH5A 1FJGL 5AJ3L 1VQBA 4A76A 3H7PB 1A5RA 3A8IE 4AH6A 1VQ4A 1GB4A 4XDXA 1FL0A 3CMMB 1G6ZA 3WCQA 2ZXRA 3QK0A 4N8FA 1YD8U 4A8XC 3S24A 2Y5BB 2JUOA 2WB1B 4A3FH 1CZGA 1Y1VB 1PHJA 3MEHA 1P9DU 1N5XA 2KA7A 4LNOA 1S40A 4LFAQ 2BB5A 2JYOA 1YZ6A 2K0PA 2B2YA 3A0JA 4GN5A 4NXML 2BH8A 5DLQE 4N9PA 5LMNL 3W2DA 4A3GB 3RZOB 1Z2MA 2X8XX 3FC4A 3Q8FA 4JOIC 2DY7A 4LJZC 4K3BA 2AQ3B 1N34Q 1F2RI 3AEBB 1E0ZA 1BDOA 3I4LA 4JI4L 3W1SA 5LNK1 4DV7Q 2PQEA 1C4AA 1HXYD 1VQDA 4DV3L 1ZKHA 3DHGC 3QWZB 4ZRIA 2K5QA 3VTVA 4IFDG 1ENAA 2C35B 1E2ZA 3SXHA 3TSSA 1BCPB 1JMLA 1YHAA 3PREA 1HNXL 3DVNV 3P4RB 3C1FA 5L37A 2LJIA 3WIMA 1PTOH 3I56A 1WRIA 3NWSA 1Y1WB 4NJ7A 3K80C 2KLGA 5D6JB 4OX9L 4MJSB 3P75A 2W82A 3D8GA 1UAPA 3HEJA 4NKLA 1L0WA 2NVQH 2NR2A 1IBLL 2KTRA 3SD5A 3B9JA 4B0EA 2JF5A 3I63C 3WAMA 2BQQA 3MVVA 1FPYA 1U5KA 2CKZB 5KYLA 3RNAC 4P72A 4CDDC 2EY6A 2B2VA 2TMPA 1G291 4DDGD 4AS1A 1FFVA 3QOLA 4WWMA 1SROA 5E4XA 2BCOA 1UD7A 1JWMD 3I4MB 4W9IA 5E6PA 4ARIA 2KAJA 5C44H 4ZUJA 5G5HA 5M3MH 2N1VA 1NDDA 5KHOA 3QARA 1XO3A 1D1KA 4W9HA 3L0OA 3UE1A 5ELEA 4DV0Q 3A4SC 2Q2TA 4ZAIA 1L2NA 1JCKB 3SR6A 4B3SQ 4K7WA 3TZDA 1PTOC 2B8FA 1KRHA 3DBLB 1EF1A 1S72A 1STNA 2MJ8A 3PIOA 2NVUI 3N30A 1F2MA 4L1BA 4QGUA 2N7EA 4LFBL 5C0XJ 1SEBD 2KBNA 4KV2A 4WJ3M 2W3RA 1SAPA 5FO8B 3DBLI 1EY9A 1WM3A 2IGDA 4XIGS 2PI2A 3K7UC 4C1NI 2FE8A 2KXJA 2V1YA 2XK5B 3PUXA 4E6IA 3SK4A 4IWOA 4W9LA 2QSDA 1KDBA 1CUKA 2GVBA 5IP7G 3OWFA 4PMBA 5T8IA 1O7ZA 2VUMH 2R2OA 1PYSB 3DBHI 4C3JB 4KKJA 2INNE 2DYMA 1TQOA 3BZKA 1WXAA 1SMXA 2M56B 1YNNC 2B76B 4LNNA 3RT3B 1HR0W 2NVTH 3P1HA 2KCCA 1I3QH 4LLGM 3UDXA 4JBWA 1X6OA 2KNBA 5I6WA 1VQAA 3PT2B 4PNYA 1V43A 3E3XA 2ZJPA 1VZ7A 2N9EB 4R4OA 4CKEA 3GTGB 1K8RB 3HOZH 4EZKA 3N32A 1S3OA 2ZXOA 1EQTA 2HHHQ 2UUAQ 3X3NA 1B50A 2KWVB 3SK8A 3K81C 2E8GA 2R93H 3TREA 2RPQA 4K2KA 4DU9A 1E3PA 3NTKA 5IKCM 2PNRC 4IWQA 5JHBA 4IUUA 4DK3C 4XTCS 5M3MG 1NEKB 2VZKB 2IO3B 4JQWC 1F2ZA 2OT2A 2RQXA 1QILA 5FLXE 1QUQA 5CV6A 1Q1BA 4DV6L 1E6EB 4M8AA 4RHRA 2L55A 2VB3X 3OMGA 2CKHB 3ZLZA 3SVMA 2QW7A 4IUQA 1RRBA 5AJ3Q 3OTOQ 1B3AA 2IX3A 1FNVA 1NI3A 4XYCA 1FXAA 5C4HA 1K8MA 2UXBL 5HURA 2I0QA 5C4JB 4JI7Q 3N6RA 4C4VA 4KY7A 3QQ8B 3GO5A 1HEZE 3KDFB 3UINB 3VR6A 4TQ0A 1H8CA 1PTOB 4YT0B 3DDCB 1RYJA 1TWCB 3QB3A 3Q6SA 1AP0A 1WTWA 5AZFA 4NXMQ 4WIPA 2QEXA 2JA6H 4EEWA 3KYCD 5LXHA 4KHPL 5F2DA 4CDFC 1WXSA 4DV5L 2MEKA 1STEA 5I2XA 1J19A 1I7HA 2VQEL 3M4OH 1N63A 4ANVA 4IJLA 2LFNA 4AYBB 2V4IB 4JWSC 4K3CA 1PZKD 2H89B 4HPMB 5E6JA 3CQZH 1XD3B 4HCEA 1XMQL 3KF6A 1SMYD 2IGHA 5ELOA 5A2QL 2M19A 4AQ7A 4BY1G 4DNIA 2WKDA 2MFIA 2EYHA 4QUFA 1CZPA 3RPFC 1HQMC 4A3KH 3Q8DA 2PW9A 3VR5A 3I4OA 2QC8A 3MHZA 2E75C 3K57A 1TT5B 4P1BC 3HS0C 1WR1A 1ZXTA 1PGXA 3HHMA 4A3PA 4LF9L 1VQNA 4W9EA 3HOXB 1BF4A 4RKLA 3K9OB 2JA5H 1JWBD 1Q1OA 1NENB 4PYUA 3VUXA 2R6GA 1R4PB 3IFTA 2AUKA 2QKIC 4RGMA 2SNSA 2QDBA 4LF6Q 5C2TB 1JB3A 2NPTA 4XWWA 3H0GB 1XNRL 1C8CA 2WXJA 5C3EH 2DZKA 2YU9H 4HPLB 1VQ8A 4RF1A 4P75A 2Q2IA 1WF9A 1VR9A 5C0XH 1ENFA 5AEKB 1Y1VG 5JPNC 2F0JA 2WB1G 3ONAB 1W6KA 3AE2B 1SR3A 1CFMA 2QF7A 1U4MA 3M7NA 5JPMC 2ZM6Q 2FUHB 3A1QA 2VL6A 1RTNA 1UE6A 1CQFA 1X3EA 1VQ5A 2BGFA 3VFKA 4KN4C 4RAUC 4LFBQ 3Q3JA 1L2FA 2MA9B 1MG8A 2NYZD 2K4KA 3A33B 1GNUA 1RF2D 2B63B 3NP8A 1EY7A 4IPHA 1AZPA 1HQRD 2K8BA 5E1FA 4YHHQ 1HZBA 2I46A 3CMEA 1GG3A 2WX1A 2I5HA 5BN4A 2V4DA 2SEBD 3J81c 2KCNA 3DM1A 3AU5A 3ITPA 2K5WA 2WINB 4QMGA 1ZXHA 3D3RA 3PV0A 4ANWA 5D7GA 1V1PB 1C76A 1O80A 5K36G 3AE6B 2XIWA 3G6EA 4DN4M 2AYOB 2GRIA 1VQHA 4DKAC 2NB0A 3I5JC 4G7HC 1RODA 1BNZA 1WOCA 2K8CA 5KIXA 3NG0A 3R3MA 4II3B 4OIJA 4F8CB 3OHXC 4RGOS 1YX6B 1B3QA 3ZNGC 1D5ZC 1VQIA 5G3LD 4MH8A 3ZXRA 2HHHL 5IYBH 1U9RA 3FAHA 3KUPA 4KHZA 4XDDA 2YTYA 2KMAA 2UXDQ 1TY0A 2KCMA 5CV4A 1L4ZB 4ZCKA 2VB2X 3J7ZC 5IYDG 1GUOA 1NUCA 2FMCA 3PZ7A 1WI5A 3K5OA 2JX5A 3ULLA 1C9OA 3S2DB 1R9TH 2LHDA 3P4SB 3PCOB 1SE3A 4DV6Q 3LB8C 3MAQA 1EQRA 4K7SA 5IP4D 1FEHA 1Y8RC 4W9GA 1NTGA 1FFUA 4XQQA 3RN9C 4A3EB 1VF5C 4GNXA 4A93G 2O6VD 1LTAD 3NZSA 3LX0A 3CKIB 4APVA 3OIPA 4BZAA 3NVYA 4TMAB 2HDEA 4X3KA 4B3RQ 3OTOL 3VYSA 2FIFA 2UUBQ 1I50H 1KLUD 3L9AX 1KJTA 3CAMA 2JY6A 3RFZB 3AU4A 1UUPA 4IKGA 2A8VA 4REZA 2AKWB 2DYOA 3D4WA 1KABA 4LUVA 3RZDH 3I55A 1FXTB 2DNFA 4DPGA 1J5EQ 5C0XG 1YJJA 4NMZA 3UI2A 2J0JA 1HH2P 2BBCA 1GB1A 1PH3A 2K22A 1L1OA 4ALPA 2VXWA 4G4KA 1F9JA 1IP9A 4L8JA 3VR9B 3S1RB 3AEDB 2O2LD 1RTOA 1ZEQX 2F3IA 4LUZA 4LK1C 4KHPQ 4M02A 1JOKA 4MN3A 2R2QA 3I9V1 4C00A 2RHSB 2M4NA 2IO1B 3QX1A 1CM9A 4B3ML 4P7IA 3L0WB 4DR2L 2KYWA 5LMUQ 1P16A 1CSQA 4NNJB 2YLMA 1GC7A 1TXYA 4ABNA 2E2JB 2EKIA 4NQLB 1WY8A 1V8CA 2JWZA 1QVCA 3M9BA 2PMZB 5ELFA 3VXWA 2AX5A 1EOTA 4P1CC 2VUMG 5AUKA 2WXOA 4BXXH 3L10B 2LXAA 4JBMA 2LRUA 4N59A 2LI5A 3V61A 1MSHA 4HMIA 3STBC 4DR1L 2JYTA 3AE8B 4YCWA 4LF7Q 5C3XA 1HFGA 1TBEA 4LNKA 5IP9G 3CC7A 5L95C 5LHY1 4LF6L 3D6WA 4W9FA 2J0KA 1B9RA 1YN5A 5H92C 4RMFA 1BCPD 5BN3A 1I4RA 3NHEB 1JE5A 1E10A 3GTOB 4AIMA 3MC0B 3RLNA 4GKJL 3DUZA 2PQAB 4YY3Q 1HHVA 2LUMA 1T0QC 3QIAA 1WJUA 2VUMB 1G51A 1AW7A 1VQKA 4MTKA 3KLSX 1XLOA 2GBNA 4IUMB 1M1KC 3AU7A 2EY2A 2EDGA 2GVAA 1TWAB 2D5DA 5M5XH 3T1YL 2NVTB 2F0MA 3RCZA 1GD7A 3SU8X 3HKZG 3CF6E 4X62L 1UELA 1JROA 1A3UA 1FIQA 1ZGUB 3I91A 2A68D 3FPPA 1WTQA 2JA5B 3E9HA 1YJ1A 1ZPSA 5E4WC 1VCIA 4BFRA 4FXGC 1F9RA 3CCVA 1DD2A 3GE8C 4XGAB 1I42A 4L6TB 2L3ZA 3H3VI 3BVZA 2E2JH 2C7NB 1EEFD 3K0YA 4YWMA 2JP1A 1ASYA 2PVGC 3JVZX 3PGZA 5J39A 1X54A 1L0VB 4XYOA 4M8MA 1J7CA 1JC7A 1XMQQ 3SE0A 4IFDI 2EKEC 1BKBA 3HK0A 2AEHA 2GI9A 4EKUA 4CDCC 1MIUA 3VR8B 4FNFA 4R8IA 4YSYB 1YNND 3NPPA 4A3GH 2R93G 3R7QA 3GD7A 1OFFA 2LY7A 4WURA 4G0NB 3HKZE 1II3A 3F2CA 1WX7A 2KDMA 5G3LF 2WGSA 4WJQA 4URKA 1CKNA 4POFA 2WP9B 4A3JH 4NAWB 1D3ZA 1FGBD 2Y0SG 4LNFA 3OPOA 1S3SG 1IYJB 2NZOA 5D94A 2WFWA 4DV4L 5K5PA 1E2VA 1Q10A 1WJ4A 1JJGA 2XVSA 1XLQA 4DAYB 1TWAH 1ZKOA 2WV6D 3MEFA 5KNDA 4TKOB 2I1KA 4F7XA 3H3VC 5DM63 2Z4HA 4DAMA 1K73C 2UXCQ 4FXCA 4JC0A 3J81i 1KXLA 3HRDD 4HJ8A 1BO0A 2ZM6L 3CXCA 2K52A 4B9WA 3G4SA 3TP7A 3ZNZB 3O65B 4BA1I 2EY5A 2Z0SA 4RMAA 3KJPA 1F0ZA 4QY7A 1A15A 2K9XA 3HG9A 5BYSA 1SYGA 2MUYA 2GMIC 1VF7A 1ILQA 5M5WH 1EQQA 1NI2A 2I2YA 1HTQA 1NYQA 4GDLA 1GJZA 1Q1EA 3TRZA 4FHJA 4RCOA 3IT4B 4M0WB 5IWAQ 1Z47A 2JYEA 3VUWA 1VQCA 5D65A 1P7FA 2F1MA 3S1MB 2I5LX 1R9TB 1HR0L 2FCNA 3IT6B 3F2BA 4US9A 1EYAA 2F4IA 2IL8A 4C3HH 2KVZA 2D2CC 2N8NA 4OW0A 1NR2A 4TRDA 3HOZB 4UHVA 4ZUIA 1UBQA 1JRPA 3ZDMC 3UGBB 1TU2B 2OEDA 2F0QA 5CGKA 4OGQC 5LXIB 1WH3A 1YN3A 2B63G 4ZRPA 3KUDB 4KVGB 2PMZE 4JI3L 3GTOH 1QOBA 1WSPA 3DCGA 3U7DA 1RL2A 2NVYH 5C3EG 1D1IA 3E9IA 1V2YA 2G4SA 4C3JH 2HTHA 2L0FA 3DBHB 3DXJC 1SNDA 1A6XA 1YIWA 3Q3OC 2MQHA 3Q3MC 1ACCA 4OL7A 1Y8OB 1KL9A 2Z1CA 2KDFB 2HDLA 4BBSB 3GOEA 3P4PB 1YJWA 5FK9C 1IYVA 1A2TA 4LF7L 2R92G 5DPSA 3IVFA 1SXTA 5HHDG 3ZNID 1UE7A 1Q82C 3T3NA 2ZW0A 1SIJA 4DAPA 1EU3A 4TVAB 2DENB 3NZUA 3K5NA 4HR7B 2KEEA 1ZP0B 3JAMc 2AUJD 2K39A 2KJXA 4C3IB 4JYAQ 2DBYA 3HOVB 4BY7H 3GB1A 2B3GA 2VH1A 3A56A 4S17A 3KUZA 4YY3L 5AFWA 1UEAB 4JPSA 3QOJA 3ZTDA 3ONSA 3HOXG 3E9SA 3QAQA 5DPWA 3DM3A 2NN6H 1L7YA 4ULLA 3D4RA 3PZDA 1LT5D 4KV6A 1EY6A 2LGYA 5FLXL 1JOQA 3PO3H 2F0UA 2KWCA 1I4PA 4DR3L 2BT6A 1VQLA 3RD4A 3PF4A 1X32A 1OTCA 1LO5D 1FRRA 1EIHA 3QC8B 4YSXB 4UY8C 1K53A 1VJKA 4KSLC 4ITKA 3ZRCA 3TP6A 1UH6A 2E2DC 1OTRB 2DJGC 4KHVA 5FO9B 2KX0A 4NJCA 3FP9A 1EO6A 3PUVA 5IT9L 3HVDA 3AQQA 1PFSA 3VR4A 2HJ8A 2DJFC 2KTRB 1LT6D 4KX6B 2NTSA 3I2ZA 1NNXA 3VRBB 1X9NA 1PQSA 4WQMA 4DNTB 2KMMA 3BG3A 1UGMA 2FBWB 4Q0FA 1TWFB 1K50A 3B08A 1XJVA 5M5YB 3S1MH 4A93H 3NS8A 3I57A 2L11A 3RULA 4KN7C 2O5IC 4LAAA 3TEHB 3VDYA 3DBSA 3NS1A 3UQAA 4AQYQ 2NMQA 4HROA 4DBGA 4A3MB 2N9KA 1VQFA 1ZYRC 2O2VA 4HSPA 5IGCA 3CRLC 2D0PA 1LTID 3WAOA 1WCMB 2QA4A 2KVRA 1UGJA 2PI2E 1IUEA 1RIPA 4G7OC 4DR7Q 2Q2HA 1YOVB 4YTPB 3S15B 3A74A 2QHOA 1IBMQ 1HFNA 1TWHH 1LM0A 1EWCA 4RF0A 5BO4B 1KQSA 3L2PA 4A3DG 4WJOA 1BCPF 4KGRA 3HOUH 1IBXA 1I6VC 5M3FH 3U2SC 3FPUB 3E56A 3VA7A 2LHEA 3CWIA 1WYDA 1PRTB 2ICEC 5CV5A 5EBCA 5LMNW 2ZT9C 4A3FG 2JU6X 2FFKB 2LGSA 4DXAB 1IW7D 4DAYA 4MSQB 1X55A 1ZUD2 2LS01 5I6YA 2KKCA 4ID6A 4IWPA 3I3TB 4IALA 3GZNB 1K83B 3PRZA 2RBMA 2BPSA 1U4AA 4WH4A 2B2UA 2ICIA 2EMTA 2HD3A 1QNUA 1KF6B 4DK5A 3NBHB 3NRZA 1RLFA 2AQ1B 2XTIA 2NVXB 2KTFA 3GDEA 4FHKA 3CHBD 1CKNB 3BDCA 4QJFA 2JZPA 2QDFA 1XNQL 2JE6I 4GU2A 1YNJC 2F0HA 1IGCA 3TN2A 1W6JA 1WTPA 1DGSA 4K5WA 1SYFA 2L52A 5FOBB 4MM3A 3EJIA 4KDIC 4JI4Q 1ESRA 2K5DA 3M4YA 1X3QA 2VNUD 1SYCA 4BKGA 1G2TA 2JZ3B 2JEBI 4P16A 1NBFC 1H9RA 3VA5A 1EU4A 5IT9E 2N88A 1MJEA 3RUZA 3CCUA 1HZAA 1P0RA 3AMZA 1ET6A 4GNXB 2N7DA 3DHIC 3QO2A 1RM6C 3EROA 2NTTA 4A3BH 3WA0A 4QCLA 4AWJA 1U0LA 4MNOA 3C0RB 3HOXH 1XQQA 4ICVA 5MPOA 1YITA 3RMHA 1TS3A 3GZNI 3MC8A 2PZWA 4ME3A 1I94Q 2ZTCA 3P4QB 4HDQA 2D3AA 4FBJB 1VLBA 1W3SA 1ILPA 3I4MG 4LFCL 2MH7A 1A70A 3EUB2 3MZ5A 3OOCA 2M8SA 2CHZA 4JYAL 2RDHA 3MHBA 4KKSA 4IC7B 1EWHA 2K5VA 3T1HQ 1PH8A 5C44B 3I90A 1AARA 3J80i 2WAQG 1WTVA 1QT9A 3T51B 1T0SC 5C4XB 1JORA 1H9SA 2O5JC 1YMHE 2BF8B 2JA6G 4OVUA 4JI0Q 3NVWA 1Q12A 1GOZA 3K7AH 1Y1WG 3VVWB 1DGJA 3AE1B 4A3CH 3TEZA 2ON8A 2HDMA 1IYFA 1TWGB 4G50A 2O4XA 2A6ED 3CPWA 4NY0A 4J3OD 1SE4A 2BYVE 2B63H 2KWDA 2R7FA 2F52A 2IW3A 4IOAA 1C78A 1L1OC 1N32L 2KDIA 1TS2A 1WGGA 3WOEA 4LF8Q 4LF4L 4HWIB 3W1YA 3G7LA 3N1ZC 4C7YA 4KSKC 2JN4A 1DOIA 2SAKA 2EOTA 1S4ZA 1PZJD 3RZDB 5C3WA 3G71A 1LYLA 2DUDA 1YX5B 4KD3A 2HUGA 3N52A 2LUEA 1MHHE 1TS5A 2YYZA 3N20C 2MP2A 1GC6A 2LGDA 3N9YC 1E24A 2Z59B 4DR6Q 2LXJA 3DPDA 1YJIA 1CMXB 2K5PA 4OZAA 2D9UA 2NBUA 1OXVA 2YTXA 2BS3B 3KF6B 2HD5B 1E1TA 4MSMB 3SFEB 2WXPA 1NMGA 2LFIA 4ASWC 2RSOA 4YWKA 2B8GA 2PYKA 1RFAA 3VH3B 2HCCA 3Q6BA 1C9FA 4FF1A 3A7LA 1ML0D 3GTKH 3BDOA 3S17H 5JJLA 1FD6A 4WRDA 4FJYA 3ZJUA 4NQKE 2JSOA 1BUVT 1PV4A 1IBML 5IE8A 2INPE 2LASA 4NPNA 4WJNA 3LNNA 4FXDA 2K1BA 1PDXA 3K5LA 4GOCA 3A1QB 2WHIA 3SEBA 2REXA 2L4NA 2K33A 3E0JA 5LL6S 1BBUA 3A5UA 3BVGA 2ACZB 3S2AA 4KLKA 1LTBD 1WIAA 2D07B 2RD0A 4XX5A 1D6EC 3IAYA 4A90A 4M8NA 2EIFA 1G2SA 3B2GA 4JI1L 3VR3A 2UWQA 3FKIB 2CQAA 1LQBA 1DONA 2C9OA 1NAPA 3TBLD 1B9MA 1S1QB 2ZJRA 1JWUD 3PV1A 2RGFA 4FYDA 3Q14C 4MGKE 3OYYA 3RN2A 1TIFA 3JC66 3HOUG 3GTKB 1SIFA 4WJ4A 2K3UA 5C0XI 1V97A 4OVZA 4ZRJA 3K5MA 4A3BB 2L7RA 3EVQA 1EY8A 2L1AA 4DA2A 1TWFH 2B2TA 5CTRC 5FLMG 1V6EA 5FR6A 1EZ8A 3IBEA 4JE3B 1YHQA 4R3DA 3GTMH 3W5VB 3K7AB 1EIFA 1PGAA 3C19A 3DHHC 3NSWA 2WIIB 2RR9A 1JICA 2FHTA 1KFYB 3U9OA 4KJOA 2J4XA 5M3FB 4IOIE 1HNWL 1UE5A 3M4OB 1V1PA 1FCCC 1T6BX 4PS3A 2W3SA 4A20A 3EN2A 4DV2L 4BY7G 1VQ6A 2EYPA 1Q46A 2WLBA 3T9LA 1AE3A 2V3PA 2LSSA 3MWYW 1NSNS 1T0RC 3TCAA 4EOYA 1VQMA 4ANXA 2D2QA 3U58A 3GE3C 5M5WB 3S1NH 4DR7L 1XWEA 1PZID 2A6EC 3ZJYC 3S2DH 3PPAA 2WXIA 2BW2A 4PV1C 5CMDA 3PHWB 1WYGA 4B0MA 2M0XA 4HJ9A 4W9DA 1B4OA 1SE2A 4KKUA 4ZLTF 4GN1A 3Q0AA 1YIJA 2JT4B 2IY1B 4K8IA 5EQ0A 2KENA 5GQOA 3CCSA 3ND9A 1B8AA 1PFMA 3CPFA 4JI5L 3HOVH 1N6ZA 3GV6A 4JWUC 1D4BA 3W5UB 2E6XA 3VTWA 4H7BA 1N36L 3PIPA 1YQBA 2KC1A 3IG3A 3MJ5A 1PRTD 4K6DA 4W9KA 4BKSA 4M00A 5JOBA 3GS2A 3ZQ4A 3DBRB 4NW2A 4PZ6A 1YJ9A 1N5WA 4LWCA 2BE5C 5E7NA 4GZYC 3VAWA 4EE2A 5AZHA 2IHEA 3ZXVA 1OO9B 2A4ZA 1R7SA 2JQOA 1CT1D 3ZJTA 5NUCA 4GN3B 2LRWA 3U50C 3U30A 3APDA 1FNWA 4I7ZC 1QE6A 1STBA 3BDLA 3URYA 2RPVA 3BY4B 4H13C 1AFPA 4F7ZA 3LXFA 3L08A 5E3FA 2IYDB 1DJRD 1HZCA 3K0XA 1RJTA 3FHWA 2B2WA 1G91A 2ZNVB 4KZ0A 3HOYH 1XF5L 3F2UA 4BBNC 4GGQA 1JJ2A 3TL5A 3LJ3A 1Q5WB 5DM73 3OW7A 2WXNA 4NAMA 1D5XC 2R7ZB 4NPSA 2EYOA 1TIID 1VZ6A 5IP7H 3Q3FA 3APFA 2CVRA 2X6GA 5JJZA 1SB3C 2MJ3A 4HMJA 2AL3A 1IZ6A 2I5MX 1P98A 2VRRB 4LNIA 4S0RA 1R4MB 2K75A 1LFDA 3C3LA 1VS0A 1TYGB 4X66Q 4X3UA 1TWCH 1TWHB 2KECA 2PPBC 1Y8PB 1L5PA 1OEYA 3NE5B 1QLBB 1UZXB 3BVMA 1PYBA 3RLFA 1SFOB 4OWXB 1YNXA 4DNRB 1WWTA 1GUTA 5HI1A 5BMGA 1CI3M 4YSZB 1CKOA 5GAEC 3STBD 2ZZPB 1WCMH 2FINB 3KDFA 2OXPA 3AFQA 5EJWA 3X0WA 3VDZA 2MW5A 3TZUA 1KAWA 3AEAB 4DWFA 4XYQA 1WR6E 4FO2A 1KH0A 3MXNA 1C4CA 5JVG3 4XQJA 1DOMA 4GNXC 3RNBC 1GHKA 1ISNA 2ES2A 4WQOB 3ER0A 3V6CB 1UNSA 4CHTB 5I9OA 4YIJA 1D5MC 3NUCA 2WP8J 1F1HA 3W3AA 3GTGH 4ZYNA 3VQIA 2MO1A 1V86A 4JI1Q 4A3EH 3OAWA 3QG1A 4X62Q 1LTGD 2F3WA 2PE6B 4PK1A 2NUCA 4S3SA 1MHWC 1ONLA 4RH6A 5D14A 4N9TA 5BMIA 1EYGA 4CKBA 2M0AA 3E0EA 1K51A 3SDZA 3RNGC 4M0WA 4C1NK 4DK1A 1N32Q 1QJOA 1JJCB 3MFYA 2EZVA 4JV5Q 1KNAA 2KQ4X 3NZ3A 1R4NB 2JA9A 1EY4A 1LGRA 4Q5VA 2NCNA 2N7JA 2RMMA 5EE9A 3IL8A 4WJPA 1TKWB 2WKCA 2ZPNA 1MG4A 1CHPD 4CYEA 3H15A 1EL0A 1KIXA 1VQJA 4HEDA 1HE8A 2L05A 2PO4A 5IOIA 5GAGC 5JAVA 3DEPA 2EY1A 2M9VA 3IAS1 4IJHA 4KY6A 4A3IG 5C5MA 2PW7A 2F0EA 3ZGZA 2F4VL 2JXTA 3PIO3 3C1EA 1AE2A 3NBIA 4B3MQ 3KQ4A 4DR2Q 4DF7A 2M00A 1V80A 2FNJB 4FVMA 2ZTDA 4PQXA 4BOZB 2XGTA 1IGDA 4WWNA 3DWMA 1PH7A 1WMHA 1UEBA 1CTMA 3LDZE 5AUIA 1CQVA 3AE7B 2QGQA 4CKCA 2SOBA 1AWDA 2FMMA 3U52E 3G48A 1HUNA 2WAQB 3EFCA 1X65A 1NE3A 5C44G 4ILWA 3HOWH 2D3CA 1EQVA 4P2CB 1MJDA 3TMPB 3PTFC 2JRIB 3L13A 3GTJH 2BA0A 3T53B 4BS9A 2IT1A 1B7YB 1OQRA 1H9JA 2QMTA 2BB6A 3W1SC 3H3VH 2CCZA 1FCLA 2DNCA 5FKAC 4LTUA 4A3OA 4EZLA 3OLMD 3OSOA 5IIFA 4L5RC 4DUZL 1YNTE 3KJOA 3X3MA 3AE3B 2PQAA 2D62A 1N36Q 4OHJA 3HOYB 4A3JG 1PVOA 2YEPF 1I4GA 3H0GH 2OCEA 2BDOA 4QUCA 1LT3D 1WRDB 4X3TA 4J15A 4FULA 2CJNA 5I4DA 3V2TA 2F0GA 4G57A 2TSSA 2L0TA 1KAAA 1FR3A 3DBRI 3OG5A 4XC2A 4EZJA 2NVXH 3R7RA 2XBBC 4GSWA 2CHBD 1E8YA 5LMNQ 4IUTA 4LFAL 2VZKD 1PFBA 1PH1A 3R93A 3OIQA 4DXGA 2JA8G 3ML8A 4LDTB 3NHHA 2MBHA 4YTNB 4DV7L 2KN4A 5KYIA 3AEVA 2G45B 2BE5D 1E8XA 1GUNA 1WD1A 3GTQB 1KLGD 3J81j 3CF5A 3IFWB 1YHBA 1STGA 4RG1A 1HNXQ 1ASZA 5CR3A 2WDRB 4ODGA 4PMCA 2RCFA 3LGJA 2MLBA 5IN7A 2HT1A 5IODA 3R3OA 2RF4A 4AYBE 4X66L 2LEKA 1F9QA 1JQYD 2KHWB 2ASBA 2CH4A 1ICFB 4A3FB 2K01A 2ZJDA 1AN8A 2ZJQA 1LXDA 2L76A 4BOSC 4ZHOA 3CRKC 2J7ZA 1KRTA 1T5XD 4C3HG 1LACA 5IGEA 2RDFA 1C4QA 2KJRA 2ZW1A 2LMCA 2PMVA 4YL8A 1S5CD 3RZOH 2KFJA 4A3DB 1ENCA 2H88B 2N3SA 4KY5A 4WJWA 4WAFA 2HIXA 1OGWA 1RWSA 1F77A 3WAPA 4NB3A 3FRPB 2KDEB 3FILB 1A62A 4LF5L 1V5TA 1LTTD 3LWUA 2IZVB 1FJGQ 1HTOA 2DLBA 4JX1C 3TIXA 4DQOC 1PMRA 3TEXA 3CW2C 4BXXG 2EQSA 2C7HA 1K28A 4PZ8A 2GOWA 2LZ6A 4DV0L 1KLVA 2Z8LA 3ZTCA 1SE9A 4A3MG 4XXEA 4H02A 3RNCC 4HSVA 4C2MB 4CJ1B 3PRPB 5G55A 4BBRB 1IKLA 1U4RA 2YV5A 4A4IA 3G6JB 3AB5A 3IRBA 2XRSD 2PCFB 4K14A 2AWOA 2Z4IA 4R8NA 2B2UC 4IDIA 3R66C 1EFID 5CC4A 5EE0A 3ZUNA 4I6PA 1SJHD 1E7UA 1WJ6A 1QOFA 4WFN3 2CU3A 4DFAA 3PO3G 2EYMA 5JVH3 3CD6A 5KNBA 2ATWA 1Z5SB 2K14A 2ZPYA 1UE1A 1TY2A 3FVQA 4MM3B 2E5LL 2NN6G 2D5GA 3J81E 2Q2UA 4FLHA 4RKBA 1LM8B 4BVUC 3CC4A 2VS1A 4C3HB 1SYEA 2UUCL 4HEA1 1FM0D 5HGQA 1SYDA 2KOLA 4C56C 1N61A 2E76C 2MBBB 2UUAL 1K3RA 1X1MA 5J1ZA 3FKYA 4PMWA 5JH5C 1DCZA 3TBIB 3KLRA 4RGTA 2YEPB 3A9JB 3UDGA 2IDYA 2MHVA 2INCC 4XDCA 2PZUA 1FXIA 1TKGA 3ZRFA 4B95A 5C4JH 4FJVB 4YTMB 4ICUA 4X57B 4IW0A 2WDQB 2A19A 3NQTA 1PUTA 4LF9Q 1XYIA 2JRHA 3HIZA 4USAA 5EKLA 3PVLA 3NTIA 4KKIA 3U4ZA 3HOVG 1ZXIA 3MA2B 4MIUA 1OXTA 2Z0DB 1WGRA 4OZCA 1VQEA 3D4DA 3L7ZC 3DLLA 1RFKA 5TR5A 2K05A 2ZVNA 3KLWA 3HM3A 1EYDA 2J0TD 2H5XA 2F0KA 4DGZA 3JAME 3JSVA 2A69C 4O0AA 2BS2B 5C1ZA 2F3VA 2K6QA 2BKRB 3EECA 4XZ4A 4BBSG 3PLUA 3T4AC 2ZCBA 1I4XA 4EUTA 2IBIB 2A1AA 2Q8TA 2RDGA 2K8HA 3NBHA 4A3DH 5G5GA 3M3YH 5CHVC 1M8AA 1X3GA 4UP8A 2UXBQ 1IHZA 2PZTA 2ASQA 4JI2Q 4PT5A 2F0VA 4FP5D 3WDNA 5C3EB 4JV5L 3WANA 3RD2A 5GROA 1PH6A 2WXHA 4TKNA 2FCQA 2KFKB 3MXUA 3P20A 4YCUA 3P1MA 3EHVA 4DR3Q 2QJLA 2WACA 4LDTD 4U68A 3HOZG 3TS2A 2NVQB 3DVNU 3PHXB 2R61A 1S5FD 4HJAA 2KHIA 2F0LA 1TZOA 3NEMA 1RD9D 4ZRZA 5DNFA 1STAA 1J7BA 4K7UA 4JIOU 1I50B 1ESFA 2I07B 4HAEA 1O7LA 4RWSC 1N33Q 3P2BA 4G7ZC 2MP2B 2VQEQ 2IHFA 5BN5A 2E2IB 1NCVA 2IO0B 4BAXA 4A3LH 1S5ED 2K5NA 3S16B 1PRTF 5EDSA 3CSTA 1JRUA 1K3BC 3Q8BA 1X3FA 1Q90A 1J8IA 2BVCA 4JI3Q 3J9CA 1BVSA 3UDIA 2F0WA 2NPTB 3AEEB 4HK2A 1WE6A 2VQFL 2UU9Q 2FCSA 1UWVA 1SSOA 2O2VB 2JA7H 4JGHB 4EQOA 3EFUA 2PEAA 3M63B 1JE4A 2XK5A 4OEMB 2Q5WD 2VW9A 1Q7YC 4ZKCB 2WYQA 2MX2A 4WORA 2BH2A 4HIMA 2UXDL 2KJHB 4ZYSA 2CW0D 1XMOL 3C2PA 1I6HH 3TQYA 2CWAA 3I4NH 4OO1G 2E2HB 2LD9A 3IXSA 5CBAE 4QIWE 4P71A 3K58A 2CHWA 1XEEA 1A3TA 4FF2A 2AQ2B 4RGNA 3C8YA 3NJTA 5C6AA 4B9XA 2JA8B 3I3CA 2DZIA 3OWEB 3RUIB 3ERQA 1GXDC 2NBFA 3HZXA 2G1EA 4LF5Q 3BK2A 2K03A 5IGFA 3AMUA 3S16H 3IHPC 5CBEE 4IUNA 2XWBB 3A7AB 1YEZA 2L15A 1SE8A 2XNAC 3PO2H 2KOXA 2KDBA 3N1XC 1JR0D 4DHZE 4OWWB 2B3AA 4AOFA 2RDBC 4KMUC 3RNUA 3MJWA 4E3CA 2K7VA 1K0RA 4JI7L 2QIEB 4GLVB 1I3QB 4BA2I 1TWGH 2PJHA 3CCRA 1QOGA 4A6QA 1Z7TA 4A75A 4QF4A 2LGXA 1DXMA 3HOYG 4CQNA 1NR4A 1D7QA 1MPEA 3PLVA 4FN2A 4LF8L 2PLPA 4KI0A 1OEYJ 1HA6A 1TZ1A 2DWQA 5HGTA 1SJED 1SN8A 2KEDA 3U4VA 1GHJA 4CBVA 1WXMA 1BXTA 2E2HH 1I6HB 1QKZA 2B2TC 1J5EL 2KLCA 1K52A 4P6VF 2PVOD 1KRSA 1X3PA 4MJSA 1I35A 5IAAC 2MBOA 2KVMA 4UAIA 4FADA 3J80c 1Q3LA 5IGGA 1UF0A 1SMYC 4MACA 3F1ZA 4RNAA 1FVIA 2LVPA 4WAAA 5M5XB 4IM2A 4F1SA 2CWPA 2A69D 4E71A 4IQZA 5C4ZA 2M2LA 4GB9A 4XE0A 3S1RH 1Y69U 4TQ1A 1T3QA 1TS4A 3NVZA 5GAHC 1K0SA 3F8TA 1QUQB 4HCSA 1P3QU 3KK7A 2R7DA 4N9F4 1XCQL 1LV9A 1EIYB 3ZIMA 4O1NA 3WALA 3B6YA 2CQOA 1FGUA 5KGUA 2IX0A 3T3OA 5K36H 2EMSA 2G4DB 5J22A 1E8ZA 1EFWA 2A73B 1NMFA 2FIDA 5HG2A 1PTOF 3MXPA 5GMVA 1EY5A 2B2WC 3PUZA 4A3KB 2C7MB 2HIVA 3F2DA 1G8ZD 2K5HA 1N62A 4KJNA 2K6DB 4BWGB 2J53A 5EBDA 3ZKJC 4R4IA 1QG7A 2K32A 3ULJA 4M01A 2QILA 4JI8L 4B3TQ 4GMVA 3EA6A 1C48A 2IX1A 3KWLA 3T1HL 5KNCA 4B3RL 2JQRB 2OEOA 3V62A 1V1OA 2RSUA 4K81A 2N78A 1MHXA 1HNZL 5C5LA 1XPOA 2F0IA 4P73A 5J3BA 3BINA 3W1GA 3SFDB 2L1BA 4DHJB 4NZLB 5CV7A 4IPDA 1XX8A 4YHHL 3PO0A 3MFGA 5JEAH 1GAQB 1P1AA 1EY0A 3JAMi 1QZHA 2KQ7A 4YWLA 4HIDA 3QJZA 4L5QA 4F88A 1E7ZA 3V96A 2CU1A 2EYJA 1OXSC 4KTAA 5DAUA 1XLPA 1STYA 4V0BA 3DVGX 4R4CA 4BKTA 4ZRKA 5G2NA 2EE1A 1PYWD 4K2LA 2KCTA 2W54A 1QVFA 1J6QA 1G6PA 2EYFA 2X6LA 5LMUL 4FA6A 1N9WA 3RN5A 3VYRA 2R92H 4BKSD 1H95A 2IY0B 3SR1A 2MSED 3P42A 1WFQA 5CORA 2QCPX 3IAM1 3JSVB 2LVOA 4FF3A 1EF5A 4RCNA 3J7A5 3NQIA 1CSPA 3M85A 1IKMA 3TDQA 5M9OA 1V49A 3HM6X 3Q2AC 2AWNA 1JW9D 4POGA 4DR6L 3GTJB 4MELA 2KZRA 5EAYA 3KH0A 3S1NB 2FJ2A 2VQFQ 2UU9L 3K6OA 2J42A 1BQQT 3HOWB 2MRPA 2MWSB 2WNMA 1HZ9A 5KRUA 3VTUA 2OTLA 2RVLA 3A9KA 4CJ0B 1GO3E 2BWFA 4LJPB 3KYDD 3BK1A 1G6JA 4KK7A 2WQYB 2WXRA 2B39A 2B29A 1XPUA 4DR1Q 4HDOA 1AH9A 3J7YW 2R7ZG 4A3EG 3U8ZA 4PS8A 1OXUA 3I70A 2VZAA 1KM7A 1KD1C 1P7EA 4DDID 1GUGA 1FRDA 5LLIA 4C4VB 3K59A 4K6LA 3C46A 1PH2A 4LFCQ 1TKYA 5IYCH 3H6NA 2F0DA 1DYQA 1MFWA 4A3BG 4GKJQ 5L83A 1LUZA 1IBXB 2G5DA 3O13A 1T0YA 4ZRQA 2UUBL 4B3SL 4DR5L 1FD7D 3S14B 4L5TA 3HOWG 1Y56A 3AXCA 1NBWA 4GKKL 1WTXA 1A8VA 4QIWB 1E22A 2MBQA 3VUYA 2CH4W 1C0AA 5IT9c 4IUPA 4CDEC 2K1FA 3A54A 3PMFA 2L8JA 3RR5A 4XT3B 4JI0L 1K9MC 1AZQA 3T1YQ 4B6WA 4L63B 1ICWA 2WXKA 3S1QB 2J0MA 1L4DB 1WX9A 4QL5A 1WVLA 3AE4B 4EVOA 3GTLH 3FKIH 4CJ2C 2N0SB 2NVYB 1BT0A 2I1JA 2MBEA 3HGBA 3RMKC 4MH0E 1MKHA 5FLXc 3Q8CA 1M4VA 1I4QA 2HTME 3L54A 3R2IA 2YU9B 1W2BA 3PGEA 1TTNA 2H1EA 3KFUA 4ZKBB 4JBJA 2KJ6A 1H4RA 4I65A 1STHA 5GADC 4HJ5A 3M7GA 3PUYA 1TT2A 2LXKA 1D2BA 4EQNA 2KD0A 3H7SA 3Q8EA 2BDNA 4W9CA 4OWTB 1E90A 2HQEA 1E8WA 3SGIA 1IBLQ 2A5HA 1FMAD 1XPRA 5C23A 4CHKA 3FILA 1EWIA 4OO1H 5EPJA 4TUUA 1WJJA 4BY7B 1U4LA 5CHWA 4GN4B 3H09A
chains in the Genus database with same CATH topology
5IOCA 3GTLB 1AEXA 1N60A 3LWEA 1MVKA 4HN7A 5EGTA 3TP8A 3H94A 5JEAJ 5ELBA 4A9AA 5JEAG 2KACA 3SK6A 1PRTC 2F0SA 1R4QB 2ONQA 2MJDA 2BS4B 3S17B 2WXLA 3I72A 4V190 1SDFA 4UDUC 3PZ8A 4RFBA 3NVVA 4BY1B 2G9DA 1GPXA 1QB5D 3V3XA 4LK0M 2GB1A 2PTLA 3H91A 1E9MA 3AN1A 2H4OA 2RSNA 3R8BA 1SNPA 5COYA 2NZ1D 3DWAA 2DY8A 4K5XA 2MJEA 2PKOA 4L2YA 4OZBA 3GQBA 2MP1A 3KBGA 2LGIA 3Q22A 3GV3A 1EIGA 1Q8IA 4N58A 4R9WA 4RHSA 5T1GA 2IGGA 1HTPA 2EVBA 2C5CA 1XTCD 1SNMA 3H6MA 4ME5A 1SSNA 1DOKA 2NWGA 2Y5PA 1VZ8A 2ENBA 5C3JB 3I8ZA 4U673 1RDPD 1C79A 3M3YB 4IN3A 5A2QE 2L32A 5M3MB 3ZJVA 2SNMA 1A3VA 3TP5A 2V3NA 1ZDVA 4QB4A 3JAML 3V05A 2BOSA 2MGSA 1O78A 2JA6B 2XSCA 2WU5B 4Z9CB 2N9LA 1UWXA 3LYYA 2X69A 3MTSA 3P63A 2E74C 4KKTA 3ZYYX 1YN4A 5IGDA 2JSVX 2FUG1 2DN8A 2ID0A 1MBYA 2WDVB 3NUHB 4C3JG 2KHSA 2EJMA 2JEAI 4F8MA 2Q8RE 1BUIC 3J7AF 1F2LA 2Q8IB 2F0TA 3FMCA 1PGBA 2HCIA 3HUIA 3BZDB 1VMCA 4J1MA 4ZOHC 4C80A 4IZ8A 4XQNA 3U4EG 1QOAA 1VDVA 1S5DD 2Y3AA 2ZXPA 4GDLB 2IWHA 3B2FA 4J8QA 1L6VA 3KBXA 2B2VC 4M1UB 1CHQD 3FDTA 1TR5A 4ZHPA 1RHPA 2XRQD 1F2RC 1QCBD 2F0FA 3DEOA 1TJEA 5KEEA 2X38A 4EQPA 3MXGA 2W55A 3J7AV 3FEWX 5ELDA 1F9PA 1MD2D 4Y7NB 3QWNA 1C77A 1LLRD 1YNJD 3VR2A 1NYRA 2PW5A 4H0LC 2A68C 2NN6I 1E7PB 1HPCA 1BMLC 1HZ6A 4HKQA 1L6UA 4RA8A 1B1ZA 1K8OA 1GJXA 1IW7C 2E3TA 4KGTA 2KUMA 3PO3B 1SNOA 3T16A 3Q23A 5T1IA 1E0BA 2R92B 1OQQA 1BCPC 1YQ3B 4F87A 3PIP3 1PFNA 2A6HC 1S5BD 3DHQA 3ND8A 1SBBB 2L9HA 3A55A 4B08A 2JXMB 1SNQA 1B9NA 1HTLD 2BA1A 4KD4A 5CYUA 5EPKA 2LMCB 2RKSA 1RKNA 1BOSA 2EJGC 3IFDA 2SDFA 4HTHA 2MPMA 3CU7A 2R3ZA 4IURA 3I73A 5I2YA 1TKEA 4K8JA 5EPLA 1VRAB 1MGSA 3BS1A 3SHLA 5LL6X 1C4PA 3CIRB 4ARCA 1MI0A 1B53A 3ABVB 4ZK9B 3P7JA 3H8HA 1I4HA 4IUVA 1SF0A 1HUMA 2IJ0A 1BR9A 3R2TA 2EJFC 1XLNA 4Q2JA 5D3DA 4C3IG 3BYTB 2K6AA 1QF6A 2A74C 3NTHA 5JXVA 4DAVA 2WS3B 1JWAD 3HVZA 3S9WA 4XWTA 2EELA 5IGBA 2V0GA 2A6HD 1JQ4A 2Y0SB 1HA5A 3BYYB 5CV9A 1MI2A 1EM7A 2K04A 2F0PA 3T56B 4HRSA 1GUSA 3AM9A 4A3JB 1EZ6A 3BIID 3TUOA 4GDKB 1DM0B 3A8KE 3SK5A 1QOHA 5BMHA 1IYUA 3IKJA 4O42A 4IFDH 1DOLA 1QNKA 1KDCA 2I38A 1PTOD 3NK9A 3GP7A 5BYQA 1WTRA 1DOYA 5ELCA 3AH7A 1XCTL 3MP9A 4H44C 3J81L 4US8A 1FYCA 1VDZA 1SYBA 2EPBA 1GUWA 3AEGB 1H9MA 5BYRA 3I4NB 4DK0A 2K28A 1ZDXA 1YQ4B 1XXGA 4DXFA 1CK1A 5I9PA 1J7AA 4K5VA 4C7ZA 2WXMA 4A3IB 1WD0A 1Y8NB 1PDQA 3EGRA 2L5TA 2LKVA 3L3OC 3E5SA 3Q8AA 1KDAA 1DZ1A 1E2WA 1WGKA 1H9SB 1BBXC 1J9OA 4OIKA 1AYFA 3VRAB 5D3IB 1EYCA 3U9SA 3KF8A 1LABA 4HKZE 3WOFA 2R93B 3D6CA 1EEID 3A8JE 1QWYA 4GLSC 3EQLC 1QQRA 4MT5A 3NWTA 3KLSA 1L0XB 3DWQA 1F9SA 2WXQA 3DWPA 3CQZB 2WU2B 3BWUD 2F0NA 3DWGC 3AE9B 3HKZB 1A2UA 3KWVA 1EWYC 3PO2B 2EYLA 4H2AA 3GTMB 4N6EB 2JA7B 4JK1C 2J52A 3E6ZX 4TSSA 1HZ5A 3QJYA 3HRZC 1ZYRD 3U7ZA 5EE3A 2CJOA 4A93B 1VMPA 4EGVA 3EFXD 3VYUA 1PXUA 1SNCA 5CV8A 3L4PA 3W9CB 1MSGA 5FR3A 4IFDJ 2Y5CA 2EXZA 1T5EA 1HRJA 2F0OA 4A55A 5TSSA 2KQ3A 2F03A 4FF4A 2XN9C 2L83A 3NXWA 1LT4D 1CA6A 2DNEA 4OO1I 1LTRD 1HCZA 4YXDB 3AE5B 1IL8A 1CZWA 1O7YA 4X3SA 1L0YB 2WXFA 1RCVD 3D31A 1JALA 4KGSA 1KNEA 2PIAA 3J80E 1DOXA 5EE1A 1ZE3D 3AEFB 1B44D 1U4PA 3PUWA 1LTSD 3Q69A 2QEJC 5FO7B 5GXGB 4J6HA 1FO4A 3VYTA 3TEWA 3J80L 3T13A 4YWGG 3AECB 5DEHA 4FXKC 1V8QA 1PFDA 4HJGE 1CA5A 5A35A 2CW0C 3AV8A 2L0CA 2B2YC 3TEYA 2BTEA 1CJEA 4MHEA 2OF1A 1WXQA 1JOOA 3DMUA 1TVXA 2N55A 1JWSD 2G9HD 2JWUA 1OXXK 3HOUB 5EKIA 3HP3A 1NVID 3S2HB 3UI3A 4TQUS 2XWJB 2RA4A 3Q24A 1FNUA 1ZOYB 4XT1B 2L12A 1F2YA 3AB9A 5HFYA 4L23A 2IPKD 1KTKA 4LMQD 3TMEA 5ISRA 1WTOA 1H9KA 1PLFA 1B2TA 2BYTA 4NP5A 3GTPB 4D2KA 1UWMA 5EKKA 4CGYB 3ETRA 2WXGA 3OMCA 1ROEA 1Z6HA 4ZQ3A 2OHFA 2GA4B 5H8YE 1ET9A 4NDXA 3A8IE 1GB4A 4XDXA 3WCQA 1G6ZA 2ZXRA 4A8XC 2WB1B 1CZGA 1Y1VB 3MEHA 1N5XA 2KA7A 2BB5A 2JYOA 2K0PA 2B2YA 3RZOB 4N9PA 4A3GB 3W2DA 3FC4A 3Q8FA 2DY7A 4LJZC 2AQ3B 1F2RI 3AEBB 1E0ZA 1BDOA 3I4LA 5LNK1 3W1SA 2PQEA 1C4AA 1HXYD 2K5QA 4IFDG 1ENAA 1E2ZA 3SXHA 3TSSA 1BCPB 1JMLA 3P4RB 3C1FA 2LJIA 1PTOH 1WRIA 3NWSA 1Y1WB 3P75A 2W82A 3D8GA 1UAPA 3HEJA 4NKLA 3B9JA 4B0EA 3MVVA 5KYLA 2EY6A 2B2VA 2TMPA 1G291 4AS1A 1FFVA 3QOLA 4WWMA 5E4XA 2BCOA 1JWMD 3I4MB 4ARIA 2KAJA 5G5HA 4ZUJA 1XO3A 1D1KA 5ELEA 4ZAIA 1JCKB 3SR6A 3TZDA 1PTOC 2B8FA 1KRHA 1STNA 2MJ8A 1F2MA 4L1BA 5C0XJ 1SEBD 2W3RA 1SAPA 5FO8B 1EY9A 2IGDA 4XIGS 4C1NI 2FE8A 3PUXA 4E6IA 3SK4A 2QSDA 1KDBA 3OWFA 4PMBA 5T8IA 1O7ZA 4C3JB 4KKJA 2INNE 2DYMA 1TQOA 2M56B 1YNNC 2B76B 3P1HA 2KCCA 4LLGM 4JBWA 5I6WA 4PNYA 1V43A 1VZ7A 4CKEA 3GTGB 2ZXOA 1EQTA 3X3NA 1B50A 3SK8A 4K2KA 4DU9A 3NTKA 2PNRC 4IUUA 4XTCS 1NEKB 2VZKB 1F2ZA 2OT2A 2RQXA 1QILA 5FLXE 5CV6A 1Q1BA 1E6EB 4M8AA 4RHRA 2L55A 2VB3X 3OMGA 3SVMA 4IUQA 1B3AA 2IX3A 1FNVA 1NI3A 1FXAA 5C4HA 1K8MA 5HURA 5C4JB 3N6RA 4KY7A 3GO5A 1HEZE 4TQ0A 3VR6A 1PTOB 4YT0B 1RYJA 1TWCB 3QB3A 3Q6SA 1AP0A 1WTWA 4WIPA 5F2DA 2MEKA 1STEA 5I2XA 1I7HA 1N63A 4AYBB 2LFNA 2V4IB 4JWSC 1PZKD 2H89B 5E6JA 4HCEA 2IGHA 1SMYD 5A2QL 2M19A 4AQ7A 2WKDA 2EYHA 4QUFA 1CZPA 3RPFC 1HQMC 2PW9A 3VR5A 3MHZA 2E75C 3K57A 3HS0C 1ZXTA 1PGXA 3HOXB 1BF4A 4RKLA 1JWBD 1NENB 2R6GA 1R4PB 3IFTA 2AUKA 2QKIC 4RGMA 2SNSA 2QDBA 5C2TB 1JB3A 4XWWA 3H0GB 1C8CA 2WXJA 4RF1A 1VR9A 5C0XH 1ENFA 5JPNC 2F0JA 3ONAB 3AE2B 1W6KA 1CFMA 2QF7A 1U4MA 3M7NA 5JPMC 1RTNA 1CQFA 4KN4C 4RAUC 2NYZD 1RF2D 2B63B 3NP8A 1EY7A 1AZPA 1HQRD 5E1FA 2I46A 5BN4A 2V4DA 2SEBD 2KCNA 3DM1A 3ITPA 2K5WA 2WINB 4QMGA 1ZXHA 3D3RA 3PV0A 5D7GA 1V1PB 1C76A 1O80A 5K36G 3AE6B 2XIWA 4DN4M 2GRIA 2NB0A 4G7HC 1RODA 1BNZA 5KIXA 4OIJA 3OHXC 4RGOS 1D5ZC 5G3LD 4MH8A 1U9RA 3FAHA 3KUPA 4KHZA 4XDDA 1TY0A 5CV4A 1L4ZB 2VB2X 1GUOA 1NUCA 2FMCA 3PZ7A 3K5OA 2JX5A 3S2DB 2LHDA 3P4SB 1SE3A 3LB8C 3MAQA 1FEHA 1FFUA 4XQQA 4A3EB 1VF5C 1LTAD 3LX0A 3CKIB 3OIPA 3NVYA 4TMAB 2HDEA 4X3KA 3VYSA 1KLUD 3L9AX 3RFZB 1UUPA 4IKGA 4REZA 2DYOA 3D4WA 1KABA 5C0XG 1YJJA 4NMZA 3UI2A 1GB1A 2BBCA 2K22A 2VXWA 4G4KA 4L8JA 3VR9B 3S1RB 3AEDB 2O2LD 1RTOA 1ZEQX 4LK1C 1JOKA 4MN3A 3I9V1 1CM9A 4ABNA 2E2JB 2EKIA 1V8CA 2PMZB 5ELFA 2AX5A 1EOTA 5AUKA 2WXOA 4N59A 1MSHA 4HMIA 3AE8B 2JYTA 5C3XA 1HFGA 5LHY1 3D6WA 1B9RA 1YN5A 5H92C 1BCPD 5BN3A 1I4RA 1E10A 3GTOB 3MC0B 2LUMA 3DUZA 1HHVA 3QIAA 2VUMB 1AW7A 3KLSX 1XLOA 3AU7A 2EY2A 2EDGA 1TWAB 2D5DA 2NVTB 2F0MA 1JROA 1A3UA 1FIQA 3I91A 2A68D 3FPPA 1WTQA 2JA5B 1ZPSA 5E4WC 1VCIA 4FXGC 1F9RA 1DD2A 4L6TB 3BVZA 2PVGC 1EEFD 3K0YA 2JP1A 5J39A 1L0VB 4XYOA 1J7CA 1JC7A 3SE0A 4IFDI 2GI9A 3VR8B 4FNFA 4R8IA 4YSYB 1YNND 3NPPA 3GD7A 1OFFA 2LY7A 4WURA 1II3A 2KDMA 5G3LF 2WP9B 4NAWB 1FGBD 3OPOA 1Q10A 5K5PA 1E2VA 2XVSA 1XLQA 1ZKOA 2WV6D 5KNDA 4TKOB 4F7XA 3H3VC 5DM63 2Z4HA 4FXCA 3HRDD 1BO0A 4B9WA 3TP7A 4BA1I 2EY5A 1F0ZA 1A15A 2K9XA 3HG9A 5BYSA 1SYGA 2MUYA 2I2YA 1VF7A 1ILQA 1NYQA 1Q1EA 4RCOA 3IT4B 1Z47A 2JYEA 5D65A 1P7FA 2F1MA 3S1MB 3IT6B 1R9TB 4US9A 1EYAA 2F4IA 2IL8A 2D2CC 4OW0A 1NR2A 4TRDA 3HOZB 4ZUIA 1JRPA 1TU2B 2OEDA 2F0QA 5CGKA 4OGQC 1YN3A 4ZRPA 1QOBA 1WSPA 1D1IA 3DXJC 1SNDA 1A6XA 1ACCA 4OL7A 1Y8OB 2Z1CA 2HDLA 4BBSB 3P4PB 5HHDG 5FK9C 1IYVA 1A2TA 1SXTA 3T3NA 2ZW0A 1SIJA 4DAPA 1EU3A 3K5NA 4HR7B 2KEEA 1ZP0B 2AUJD 2KJXA 4C3IB 2DBYA 3HOVB 3GB1A 3A56A 5AFWA 1UEAB 4JPSA 3QOJA 3E9SA 2NN6H 4ULLA 3D4RA 1LT5D 4KV6A 1EY6A 5FLXL 1JOQA 2F0UA 1I4PA 2BT6A 3RD4A 1X32A 1LO5D 1FRRA 1EIHA 4YSXB 1K53A 1VJKA 4ITKA 3TP6A 2E2DC 4KHVA 5FO9B 4NJCA 3PUVA 5IT9L 3HVDA 3VR4A 1LT6D 4KX6B 2NTSA 3VRBB 4WQMA 4DNTB 2KMMA 3BG3A 2FBWB 4Q0FA 1TWFB 1K50A 5M5YB 3I57A 2L11A 4KN7C 2O5IC 4LAAA 3NS1A 2NMQA 4HROA 4A3MB 2N9KA 1ZYRC 4HSPA 5IGCA 3CRLC 1LTID 1WCMB 1UGJA 1IUEA 4G7OC 4YTPB 3S15B 1HFNA 1EWCA 4RF0A 1BCPF 4KGRA 1IBXA 1I6VC 3U2SC 3FPUB 3E56A 3VA7A 2LHEA 3CWIA 1PRTB 2ICEC 5CV5A 5EBCA 2ZT9C 2JU6X 2FFKB 1IW7D 4DAYA 1ZUD2 2LS01 5I6YA 4ID6A 4IALA 1K83B 2RBMA 4WH4A 2B2UA 2ICIA 1QNUA 1KF6B 3NRZA 2AQ1B 2NVXB 3CHBD 3BDCA 2JZPA 2JE6I 1YNJC 2F0HA 1IGCA 3TN2A 1WTPA 1W6JA 4K5WA 1SYFA 2L52A 5FOBB 3EJIA 1ESRA 2K5DA 3M4YA 1X3QA 2VNUD 1SYCA 1G2TA 2JEBI 4P16A 1H9RA 3VA5A 1EU4A 5IT9E 2N88A 3RUZA 3AMZA 1ET6A 3QO2A 1RM6C 3EROA 2NTTA 4QCLA 5MPOA 3RMHA 1TS3A 2PZWA 3P4QB 1VLBA 1ILPA 2MH7A 1A70A 3EUB2 3MZ5A 3OOCA 2RDHA 3MHBA 4KKSA 1EWHA 5C44B 3I90A 1WTVA 1QT9A 3T51B 5C4XB 1JORA 1H9SA 2O5JC 1YMHE 3NVWA 1Q12A 1GOZA 1DGJA 3AE1B 3TEZA 2ON8A 2HDMA 1TWGB 2O4XA 2A6ED 4J3OD 1SE4A 2KWDA 2IW3A 1C78A 1TS2A 3WOEA 4C7YA 3G7LA 1DOIA 2SAKA 2EOTA 1S4ZA 1PZJD 3RZDB 5C3WA 4KD3A 2HUGA 3N52A 1MHHE 1TS5A 2YYZA 3N9YC 1YJIA 2K5PA 4OZAA 2D9UA 1OXVA 2BS3B 3SFEB 2WXPA 2LFIA 2RSOA 2B8GA 2PYKA 1C9FA 2HCCA 4FF1A 3A7LA 1ML0D 3BDOA 1FD6A 4WRDA 3ZJUA 2JSOA 1BUVT 2INPE 3LNNA 4FXDA 2K1BA 1PDXA 3K5LA 3SEBA 2L4NA 2K33A 3E0JA 5LL6S 3BVGA 2ACZB 1LTBD 1D6EC 3IAYA 4A90A 1G2SA 3B2GA 3VR3A 3FKIB 2CQAA 1DONA 2C9OA 1NAPA 1B9MA 1JWUD 4FYDA 3GTKB 2K3UA 5C0XI 1V97A 4OVZA 3K5MA 4A3BB 3EVQA 1EY8A 2L1AA 4DA2A 2B2TA 1EZ8A 4JE3B 4R3DA 3W5VB 3K7AB 1PGAA 3NSWA 2WIIB 1JICA 2FHTA 1KFYB 3U9OA 4KJOA 2J4XA 5M3FB 4IOIE 3M4OB 1V1PA 1FCCC 1T6BX 2W3SA 2EYPA 2WLBA 2V3PA 3MWYW 1NSNS 5M5WB 1XWEA 1PZID 2A6EC 2WXIA 2BW2A 4PV1C 5CMDA 1WYGA 4B0MA 1B4OA 1SE2A 4KKUA 4ZLTF 3Q0AA 4K8IA 5EQ0A 3ND9A 4JWUC 1PFMA 1D4BA 3GV6A 3W5UB 2E6XA 4H7BA 3MJ5A 1PRTD 4K6DA 3ZQ4A 5JOBA 3GS2A 4NW2A 1N5WA 4GZYC 2BE5C 4EE2A 1OO9B 1R7SA 1CT1D 3ZJTA 5NUCA 1FNWA 4I7ZC 1QE6A 1STBA 3BDLA 3URYA 2RPVA 4H13C 1AFPA 3LXFA 5E3FA 1DJRD 1RJTA 2B2WA 1G91A 1XF5L 3F2UA 2WXNA 5DM73 3OW7A 4NAMA 1D5XC 2R7ZB 2EYOA 1TIID 1VZ6A 2CVRA 2X6GA 5JJZA 1SB3C 2MJ3A 4HMJA 3C3LA 1TYGB 4X3UA 1TWHB 2KECA 2PPBC 1Y8PB 1L5PA 1QLBB 3NE5B 3BVMA 3RLFA 1SFOB 4DNRB 1WWTA 5HI1A 5BMGA 1GUTA 1CI3M 4YSZB 2FINB 2OXPA 5EJWA 3TZUA 3AEAB 4XYQA 4FO2A 1KH0A 3MXNA 1C4CA 5JVG3 4XQJA 1DOMA 1GHKA 5I9OA 4CHTB 1UNSA 4YIJA 1D5MC 3NUCA 2WP8J 3W3AA 3VQIA 3QG1A 1LTGD 2F3WA 2NUCA 4S3SA 1ONLA 4RH6A 5D14A 4N9TA 5BMIA 2M0AA 4CKBA 1K51A 3SDZA 4M0WA 4C1NK 4DK1A 1QJOA 3MFYA 2EZVA 3NZ3A 1KNAA 2KQ4X 1EY4A 4Q5VA 2N7JA 2RMMA 5EE9A 3IL8A 1TKWB 2WKCA 1CHPD 1EL0A 4HEDA 2PO4A 5JAVA 3DEPA 2EY1A 2M9VA 3IAS1 4KY6A 5C5MA 2PW7A 2F0EA 3ZGZA 2JXTA 3PIO3 3C1EA 3NBIA 3KQ4A 4DF7A 2M00A 4FVMA 4PQXA 1IGDA 3DWMA 5AUIA 1CTMA 1CQVA 3AE7B 4CKCA 1AWDA 2SOBA 3U52E 2FMMA 1HUNA 2WAQB 4ILWA 1EQVA 4P2CB 2BA0A 3T53B 4BS9A 2IT1A 1OQRA 1H9JA 2QMTA 2BB6A 1FCLA 2DNCA 5FKAC 4LTUA 3OSOA 5IIFA 1YNTE 3AE3B 3X3MA 2D62A 4OHJA 3HOYB 2YEPF 1I4GA 2BDOA 4QUCA 1LT3D 4X3TA 2CJNA 5I4DA 3V2TA 2F0GA 4G57A 2TSSA 1KAAA 1FR3A 2CHBD 4IUTA 2VZKD 1PFBA 3R93A 3OIQA 4DXGA 3NHHA 4YTNB 2KN4A 5KYIA 2BE5D 1GUNA 1WD1A 3GTQB 1KLGD 1STGA 5CR3A 2WDRB 4ODGA 4PMCA 5IODA 3R3OA 2LEKA 1F9QA 1JQYD 4A3FB 2K01A 1AN8A 4ZHOA 3CRKC 2J7ZA 4C3HG 1T5XD 5IGEA 1LACA 2RDFA 1C4QA 2ZW1A 2LMCA 2PMVA 1S5CD 4A3DB 1ENCA 2H88B 4KY5A 4WJWA 4WAFA 1RWSA 1F77A 3FILB 3FRPB 1LTTD 3LWUA 4DQOC 2DLBA 4JX1C 1PMRA 3TEXA 2Z8LA 4XXEA 4HSVA 4C2MB 4CJ1B 4BBRB 1IKLA 1U4RA 3G6JB 3AB5A 2XRSD 2PCFB 4K14A 2AWOA 2Z4IA 4R8NA 2B2UC 4IDIA 5EE0A 1EFID 5CC4A 1SJHD 1QOFA 4WFN3 2CU3A 4DFAA 2EYMA 5JVH3 5KNBA 1TY2A 3FVQA 4MM3B 2NN6G 2D5GA 3J81E 4RKBA 4C3HB 1SYEA 4HEA1 1FM0D 1SYDA 2KOLA 4C56C 1N61A 2E76C 5J1ZA 4PMWA 1DCZA 3TBIB 3KLRA 4RGTA 2YEPB 2IDYA 2MHVA 4XDCA 2PZUA 1FXIA 1TKGA 4YTMB 2WDQB 3NQTA 1PUTA 1XYIA 4USAA 5EKLA 4KKIA 3NTIA 1ZXIA 3MA2B 4MIUA 1OXTA 4OZCA 3D4DA 3L7ZC 1RFKA 2K05A 1EYDA 2J0TD 2F0KA 4DGZA 3JAME 2A69C 2BS2B 2F3VA 3T4AC 1I4XA 2Q8TA 2RDGA 3NBHA 5G5GA 1M8AA 1IHZA 2PZTA 4PT5A 2F0VA 4FP5D 3WDNA 5C3EB 2WXHA 3MXUA 3P20A 3P1MA 2QJLA 2WACA 4U68A 2NVQB 2R61A 1S5FD 2F0LA 1TZOA 1RD9D 4ZRZA 5DNFA 1STAA 1J7BA 1I50B 1ESFA 2I07B 4HAEA 1O7LA 4RWSC 4G7ZC 2E2IB 5BN5A 1NCVA 1S5ED 3S16B 1PRTF 3Q8BA 1Q90A 1J8IA 3J9CA 2F0WA 3AEEB 1SSOA 4EQOA 1JE4A 2Q5WD 4ZKCB 4WORA 4ZYSA 2CW0D 3C2PA 2E2HB 4OO1G 3IXSA 5CBAE 3C8YA 3K58A 1XEEA 1A3TA 4FF2A 2AQ2B 4RGNA 5C6AA 4B9XA 2JA8B 3I3CA 3OWEB 3ERQA 1GXDC 2NBFA 3HZXA 2G1EA 3BK2A 2K03A 3AMUA 5IGFA 5CBEE 4IUNA 2XWBB 3A7AB 2XNAC 1JR0D 4KMUC 2K7VA 2QIEB 1I3QB 4BA2I 1QOGA 4A6QA 1Z7TA 4QF4A 4CQNA 1DXMA 1NR4A 1MPEA 2PLPA 4KI0A 1HA6A 2DWQA 5HGTA 1SJED 4CBVA 2KEDA 1GHJA 1BXTA 1I6HB 1QKZA 2B2TC 1K52A 4P6VF 2PVOD 1X3PA 2KVMA 4UAIA 1Q3LA 5IGGA 1SMYC 4MACA 4RNAA 5M5XB 2A69D 4IQZA 5C4ZA 2M2LA 4XE0A 1Y69U 4TQ1A 1T3QA 1TS4A 3NVZA 4HCSA 3KK7A 1XCQL 1LV9A 4O1NA 5KGUA 2IX0A 3T3OA 5K36H 5J22A 2A73B 5HG2A 1PTOF 3MXPA 1EY5A 2B2WC 3PUZA 4A3KB 1G8ZD 1N62A 4KJNA 4BWGB 2J53A 5EBDA 1QG7A 2K32A 2QILA 3EA6A 1C48A 2IX1A 3KWLA 5KNCA 2JQRB 2OEOA 1V1OA 1MHXA 5C5LA 2F0IA 3SFDB 2L1BA 4NZLB 5CV7A 1XX8A 3PO0A 3MFGA 5JEAH 1GAQB 1EY0A 4F88A 3V96A 2EYJA 1OXSC 4KTAA 5DAUA 1XLPA 1STYA 4V0BA 2EE1A 1PYWD 4K2LA 2W54A 2EYFA 2X6LA 3VYRA 3P42A 3SR1A 5CORA 2QCPX 3IAM1 4FF3A 4RCNA 1IKMA 3NQIA 3M85A 3TDQA 5M9OA 2AWNA 1JW9D 3GTJB 3S1NB 2FJ2A 2J42A 3K6OA 1BQQT 3HOWB 2WNMA 5KRUA 2RVLA 4CJ0B 3BK1A 4KK7A 2WQYB 2WXRA