3TSSA

Toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
NIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRIKKSQHTSEGTWIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFKIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 63
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tssA01
5D3IB 1BXTA 1LTTD 4NZLB 3V05A 3BYYB 4OHJA 1TY2A 1LO5D 1PRTF 1I4HA 3EFXD 4RH6A 2QEJC 1EFID 4UDUC 3DWPA 2O2LD 2WV6D 1FGBD 1RD9D 1TS4A 2SEBD 1PRTD 4K6LA 5D3DA 1L0XB 4DXFA 1V1OA 2IPKD 1EU4A 1LTBD 2AQ3B 1D5MC 1PTOH 1SJED 4L6TB 3URYA 3R2TA 1SE3A 1SJHD 1CHQD 4RGNA 1KLGD 1GOZA 1ET6A 1PZID 1RCVD 4RHRA 1YN5A 1PRTC 5TSSA 1LTGD 3SEBA 2ICIA 1FD7D 1UNSA 1CK1A 1AN8A 3MC0B 1I4RA 3BVZA 1S5ED 4L63B 5ELDA 4DXGA 4ZYSA 1I4XA 1ESFA 1V1PA 1AW7A 1PYWD 1S5CD 3EA6A 1LT6D 1S5DD 4C56C 3BZDB 1LTSD 5ELCA 3GP7A 1JR0D 1LT5D 2QILA 3DWQA 1JWUD 3KLSX 4RHSA 1YN3A 1PRTB 1BCPF 4BWGB 4RGOS 4RFBA 1SE2A 1LTAD 1G8ZD 1JWSD 1ET9A 5FKAC 1BCPD 1KLUD 2CHBD 1SXTA 1M4VA 2AQ2B 3TSSA 1S5FD 1QILA 3W2DA 1B1ZA 2IJ0A 5FK9C 2TSSA 1XXGA 1FNVA 2NTTA 1D5XC 1STEA 1DYQA 4TSSA 4O1NA 1FNWA 3CHBD 1BCPC 1I4GA 3OWEB 1HA5A 1I4QA 2XN9C 2RDGA 1TS5A 1I4PA 3O13A 5ELBA 1HTLD 1CT1D 1T5XD 1JQYD 3R8BA 1EWCA 2J4XA 3MFGA 5ELEA 3DWAA 1FNUA 1S5BD 1CHPD 1BCPB 2NTSA 2Z8LA 1PZKD 3BVMA 1LT4D 1HQRD 2XNAC 3R2IA 1ENFA 1TS2A 1PTOF 2XRQD 1JWMD 1UUPA 1EEFD 1KTKA 1L0YB 2G9HD 1PZJD 1TY0A 3BYTB 1CQVA 2R61A 4RGTA 5ELFA 1PTOB 1LTRD 1LLRD 1YN4A 1XTCD 1PTOD 1EU3A 1LT3D 1EEID 1SEBD 1D5ZC 1V1PB 1RDPD 1SE4A 3BVGA 1SBBB 5I4DA 1DJRD 1RF2D 1D6EC 1MD2D 1JCKB 2RDHA 4RCOA 1PTOC 1B44D 1TS3A 2XRSD 4Z9CB 2AQ1B 1LTID 1HXYD 1F77A 4RGMA
chains in the Genus database with same CATH superfamily
3S1NH 2FIFA 5CTRC 2UXDQ 2MX2A 2GBKA 1IYFA 4OWWB 1X3FA 3KYHC 2WU5B 2GA4B 1E0ZA 2Q2UA 2KK8A 1X3GA 4HEA1 1HTQA 2DNFA 5LMUL 1J7BA 2J0JA 3OHXC 3U9OA 3HOZB 2W3SA 4TQ0A 2BCOA 4JK1C 4TQUS 2ZNVB 5EBCA 4CDDC 3ML9A 3AU4A 2O2LD 2UXCL 1F52A 1FFVA 4ZLTF 3KQ4A 3BINA 3MTSA 1HQMC 1T0QC 3C0RB 4O0AA 2LGDA 1EY8A 2PCFB 3EGRA 1TKWB 4FJVB 2HCIA 2BS4B 2FAZA 1HZ9A 1CHQD 3LX0A 4WORA 3KWLA 1EQVA 4PT5A 5FR6A 4HKQA 3Q8CA 4MGIE 4P75A 4RHRA 1GXDC 1QOGA 3B2GA 4OO1G 4GU2A 4FN2A 2FNJB 4OVUA 3E9IA 2F4IA 1NAPA 4APVA 3DM1A 3J81i 3L2PA 1D7QA 2KTFA 1NI3A 3H1UA 2RBMA 4HWIB 3VR5A 4DXAB 3AV8A 1K8MA 1JALA 1HRJA 2CJOA 4IOIE 1FYCA 2K5HA 5K36G 2EKIA 5BO4B 1J0GA 3AE9B 3VRAB 2E2DC 1G2SA 4IJHA 1PRTB 2VQEQ 2MEKA 1MSGA 3NPPA 1QVFA 2BT6A 2UU9Q 1OXTA 2O2VB 4W9GA 3NRZA 3ZYYX 1V8CA 2N78A 2CS4A 4A3EH 3KYDD 1U9RA 4DHZB 3HOYG 4CJ2C 2ZCBA 3RNEC 1UE1A 5DPRA 4JX1C 2MP1A 2JP1A 2NCNA 5IP7H 2JF5A 1EYDA 2ID0A 3GB1A 2IJ0A 2KCTA 3KYCD 2KVRA 2LMCB 4YWGG 4FA6A 2G5DA 2PNHA 1TKYA 4X62L 4HN7A 2GOWA 2NN6H 1BCPC 4HIDA 1XNQQ 1MI2A 1PYBA 4CJ0B 3GTLB 1NYQA 5HKHA 4X66L 1YJWA 2MBBB 3M3YB 4GN1A 5BYQA 2BWES 3AFQA 1VZ7A 3AFPA 3M9BA 5DPWA 2KHJA 3KBXA 3MHBA 1TTNA 2MLBA 3VA5A 1BF4A 2CU3A 2NBVB 1R9TH 4DK3C 1D8LA 4DR3L 1O80A 3I73A 2GBJA 2H4OA 4UPAA 1T3QA 3S1RB 3LJ3A 1EIGA 2AHOB 2LZ6A 2JA6H 3M7GA 2E6XA 1YZ6A 2PQAA 3L16A 5IGGA 1UGMA 4K3BA 2AWNA 4YTPB 4GDKB 5KHOA 4A3FB 4MTNA 1WCMG 4IURA 1Z7TA 3PLUA 1FJGL 1JE5A 3VUYA 4ZAIA 2LY7A 3A0JA 3I4NG 1JWAD 2WAQG 2UUCL 3I3CA 1PFMA 4KHZA 1ILPA 1GUOA 4XC2A 1V5OA 3QK0A 5DEHA 4C3JH 1XCQL 3S17H 1WFYA 3RUZA 1P1AA 5C6AA 4RCOA 1MSHA 2N9KA 3NHEB 3PUZA 3OW2A 2MJEA 5GXGB 5LHY1 1EM7A 4YCWA 4M0WB 1WI0A 1BXTA 2R92G 4DQOC 2JEAI 1E10A 2K03A 4MDKE 3RMKC 3EN2A 3QCAA 2Y0SB 5IA7A 1EWIA 5JEAG 3FHWA 3LGJA 4QY7A 5EDSA 2H89B 3DVGY 5M3MH 2MFIA 1JQ4A 2F0WA 3Q3JA 3A9KB 3A56A 2LJIA 4GXBA 4YL8A 2AYOB 3HKZB 1E2VA 5E4XA 2F0TA 5EJWA 2KQ3A 2KDEB 1SE3A 2NWGA 2KFKA 5IO9A 3NBHA 1GOZA 2JXXA 1UELA 3N9YC 2D2QA 4C7ZA 4DV1L 4IM2A 2HD3A 3ZNZB 4DXGA 1AZPA 3DHGC 4YY3L 3EC8A 2YTXA 1D1KA 1E8ZA 2EY2A 2PE9A 4A3CG 3LB8C 3PSEB 4ARCA 1GO3E 4MGYE 4LF5Q 5DPSA 4KLKA 3VVWB 1YVCA 4LNFA 1MGSA 2Q2IA 3LWEA 3HM6X 4ZRZA 2MBHA 3VYSA 4LF9Q 3CSTA 1LTAD 3NTIA 1OXSC 4K2KA 4BY7B 1VRAB 3RNAC 4K1RB 2A8VA 3VDZA 4GNXB 4K0KL 1WTHA 1NYRA 2B2YC 2AL6A 4W9JA 3TCAA 2UXDL 3CWIA 3G6JB 4A3JB 1Z6HA 5BYRA 4WAAA 2AL3A 4P7IA 5EPJA 5FO7B 2OQKA 1XO3A 3KF6B 5E1FA 3ERQA 3JSVB 1FD6A 1IBXB 3FILB 3Q8FA 4KGTA 1OEYJ 2DJGC 5C5LA 1D2BA 4LWCA 5ISRA 3GS2A 4GNXC 2PMZB 4ICVA 4ARIA 1DOMA 4TKNA 4E6IA 1K83H 5DAUA 4EQOA 4DV3Q 1EY6A 4L8JA 1YNJC 1SMXA 1B2TA 1K51A 4N9F4 1XMOQ 2RKSA 4YTNB 1C79A 1IUEA 2QDLA 1HQRD 2KHIA 4NDXA 4I6PA 2QKIC 4L5RC 3TBLD 1STGA 1NDDA 3M63B 5J18A 1H95A 3S2DB 1PFNA 5CV6A 3IVFA 1J9OA 1PZJD 1YIJA 2E2HH 2ES2A 2ALYB 2Z9HA 1XLNA 1GB4A 5M5WH 4FULA 1YNND 4JLCA 5C5MA 2EY5A 2K5VA 4NXMQ 2O5JC 3BVGA 4HJ5A 1JOQA 3LYYA 1UGJA 1DJRD 4OEMB 5CORA 2GN5A 2K6DB 3DHIC 3EIVA 4KHVA 4EGVA 4F7XA 4WJ4A 1HR0W 2CQOA 1Q5WB 2QIEB 1PA6A 2IO3B 4DAMA 1TS3A 1PH5A 4AIMA 2ZVOA 2NS5A 1U4PA 4A3KH 2E75C 4C00A 2J0MA 1KRHA 4HJ7A 4A3DH 2JXTA 5HY6A 3I2ZA 4B3SL 4WJNA 3T8MA 4I65A 2KWCA 2AX5A 2JA5G 1YNXA 3K81C 1QNKA 4A3EB 2XK5B 1XNQL 3PIOA 1L6UA 2L0FA 1TWAH 4HROA 2QEJC 1DM0B 4KD3A 2IX0A 5CV7A 4QAYA 2VRRB 1I6HH 4K7UA 1TWHH 3IAS1 1D4BA 2JVCA 4DAYA 3SK6A 2SEBD 1HTOA 1HFGA 3NZUA 4IUTA 3VYTA 4EQPA 4PMWA 4P1CC 4KV6A 2HDMA 1WZ3A 1M94A 2WU2B 2FHTA 5EE9A 1V43A 1QZHA 2K75A 1IW7C 2D5DA 2R2QA 4DR2Q 2MJ3A 2N7JA 3TP5A 1EOVA 1KHIA 4BZAA 2A6HD 1LXDA 2K7VA 1UEBA 2L32A 2FCMA 1S5ED 5C0XG 4YWKA 2H1EA 2I38A 1R4PB 5IWAL 1QQRA 3HOXH 3PUWA 3AU5A 3H8HA 3ZNID 2NUCA 1MPEA 1WCMB 2MJ8A 3MVVA 1WZ0A 3AI5A 2KECA 3QARA 2HHHQ 2L8JA 5D65A 4LF7Q 1XLOA 2BVCA 4IWOA 1X32A 4CDCC 1CJEA 4Y7NB 1KIXA 2JA6B 3I4NB 1CMXB 2I5HA 1QOBA 1RYJA 2JYEA 2HQEA 4ZKBB 3BS1A 1OXVA 1QOFA 3Q3MC 1MG8A 2NVTH 2FMMA 3PO2H 3APDA 3W1GA 3M4PA 1ET9A 1YEZA 2FUHB 2A5UA 1X3PA 2B2VA 4C3IH 1WXVA 3TEZA 4HCNB 1SNOA 4FJYA 1U4RA 2J7ZA 3L9AX 5E6NA 3QHTA 5EPKA 4EOYA 1SYGA 1SE8A 5HGQA 3S16H 2R92B 4MIUA 2KC2A 1IBMQ 4YSZB 3APFA 2V9HA 1W2BA 4JV5L 1A70A 3PRPB 2NVXH 1PH6A 3AULA 3ZJUA 1D1IA 4JI8Q 1EQTA 4DR5L 1PH1A 1ENCA 2MHVA 3C1EA 1MJEA 4MJSB 1HTLD 1SIFA 3WOFA 1VMCA 1I94Q 5IOIA 3K7AB 3NZ3A 1U4MA 3MFGA 1E6EB 4B3TL 3L3OC 4QUFA 5IODA 1IBLL 3BVMA 3HVZA 1PGXA 3KUPA 1VQOA 1R4NB 5C4JB 4CHKA 1S4ZA 3QG1A 1TS2A 1FFUA 1JWMD 1M1KC 4QQBX 2DBYA 3K0YA 2LXCA 2EJMA 1P98A 4EX5A 3HHMA 3TUOA 1F2RI 3NZSA 3QJZA 1N5WA 1C4AA 3AB5A 3UI3A 3QOLA 4FDBA 3DM3A 2F0OA 4KTAA 1PTOD 1SDFA 1WIAA 1SEBD 2KLGA 4HDOA 1RTOA 3HOVG 1IYJB 3QWZB 2O6VA 3DPDA 4YCUA 4W9HA 1A2UA 4LF9L 4FF1A 4MSQB 4C3HH 3FC4A 4IO9A 2KJRA 1EY4A 2VZAA 5G3LF 1Y1WG 4DGZA 1EIYB 3O65B 4OHJA 1O78A 4A3LG 1K3BC 1OGWA 3HM3A 5HI1A 1KNEA 3ND9A 4NAMA 2K32A 1TY2A 1WGYA 1T0YA 3JAMi 1IHZA 1NVID 1IPGA 4G7HC 2L52A 4R3DA 4JYAQ 2ZTEA 1XYIA 4RKLA 1B50A 3PRZA 5TR5A 3DHQA 4EE2A 4DV2Q 4DV3L 3PV0A 2J0TD 4K8JA 1PRTD 2WB1E 4KJNA 1XMOL 3IBEA 1VQCA 1Q81C 1LTBD 2NVQH 1WWTA 1J7CA 3EVQA 5H1SE 2QEXA 1SJED 2BTEA 4DF7A 4IG7B 4JI2L 2MCNB 1SJHD 4OGQC 2BYEA 2RDBC 3E0JA 1ET6A 1KABA 3K80C 1P7EA 4B9XA 1WYWB 2NBFA 2B63G 1K83B 1FD7D 3AXCA 2CW0C 3VR6A 3FKIH 1WVLA 1PDXA 3A1QB 2A4ZA 2IW3A 1JC7A 4DV5Q 3OPOA 4BBSG 2L7RA 2WDRB 1X65A 2I5LX 3PSIA 1KC8C 2KDFB 3DDCB 1JMCA 4P72A 5ELCA 1NCVA 1JR0D 4RHSA 3TREA 5FO8B 2EMTA 4KV2A 5FLXc 5JZEB 3UQAA 1EOTA 1V80A 3C3LA 1F2ZA 1WJ6A 4EFOA 4P71A 2A73B 3M7NA 4GB9A 4N8FA 1XPOA 1MVKA 1Z5SB 2BA0A 3PV1A 2D62A 5IP4D 1TWCH 4JBKA 2AWOA 3VH4B 5M3FH 1E22A 1NMGA 2E5LL 2KFKB 1K3RA 2VB3X 5G2NA 4R8IA 4WFN3 2QDFA 4IWPA 1CKOA 3KUCB 2LS01 1ZDVA 3OSOA 2D10A 2MW5A 3RYTA 2WXMA 3GTJB 4DV0Q 2JA5B 3QIAA 1I4QA 2F3WA 4KX6B 3OTOQ 2Z6BA 5IYDH 3AEVA 2F0PA 1WJUA 3NVZA 3BJUA 1T5XD 1JQYD 3R8BA 2AEHA 1EWCA 3D4WA 2K9XA 2B39A 3U30A 3RI7C 2JPHA 2V0GA 3DWAA 2KOLA 3TIXA 3RN2A 2IYDB 1RL2A 4H2AA 2F0NA 5HGTA 2L1AA 3U52E 5A2QL 3JC66 1PTOF 1UUPA 1WXAA 1KQSA 4JI1Q 2UUBQ 2MQJA 3TRZA 3ZKJC 2JA9A 2K5WA 1FPYA 2DNCA 1XNRQ 2M8SA 4LAAA 1LLRD 1QB5D 3CPWA 3NE5B 5JVG3 3PZDA 2HHHL 5C44H 5IP9H 2F52A 2WFWA 3U4ZA 4IFDH 2WWZA 3AE2B 3Q2AC 5D94A 3RCZA 2F0FA 2NVYH 3EFCA 4ANXA 4D2KA 1RODA 5FO9B 2D5GA 4LUOA 2RVLA 2LGYA 5JEAJ 3M4OH 2ZXOA 4KKSA 2ZJPA 2KHSA 1OFFA 3CHBD 2Z4IA 1F77A 4RGMA 3VUXA 4FXGC 1JMLA 3FEWX 1E5WA 2DNEA 4PMCA 5GAEC 5L37A 4QL5A 4AYBE 4DR4Q 1HTPA 2B29A 5CBAE 4FNFA 4R4TA 2KDBA 1IBML 3A33B 2DYOA 2NN6I 3AE6B 3AE7B 1PRTF 3B08A 4XX5A 4ANUA 4LJZC 4FBJB 2D07B 2NVTB 3PO2B 5C3EH 1VZ8A 4ANVA 2HT1A 1EFID 3IKJA 4JI8L 3WOEA 3A8JE 4C3IB 4HPPA 1FGBD 1TS4A 3Q3NC 4PZ8A 3TMPB 1B3AA 1KD1C 5FLMG 2KWVB 2OJRA 1EU4A 4LNKA 4GN3B 2KMCA 2N0SB 5C4XH 3OJ4B 4DHJD 1SRUA 2ICEC 2MGSA 3I63C 3SFDB 4ME3A 3UDXA 1GC7A 1SYFA 3PUVA 2NVXB 2ATWA 1RTNA 1Q7YC 1YN5A 2YLMA 5JAVA 5C4XG 1QOHA 4KDLB 3Q23A 1GPXA 1UBQA 2CR5A 4DK1A 1ESRA 1NE3A 1VQDA 2F0KA 2CJNA 4HR7B 3TN2A 3P7JA 4US8A 4G4KA 4MGZE 5FOBB 3RN5A 1WTQA 1PXUA 4YTMB 4A3PA 2JYOA 2VL6A 1IKMA 2RF4A 3H6MA 4DA2A 1F2YA 4KI0A 1BT0A 2RD0A 3J80E 2GBMA 4HTHA 1F9RA 2E2JH 1B9MA 2ZEQA 1Q82C 1G6ZA 5KGUA 2IGHA 3R7RA 3PLVA 2MBOA 4GOCA 1Y1WB 1EL0A 3HOWG 3TSSA 1S5FD 1QILA 1XLPA 2QHOA 4NY0A 2QF7A 4QIWE 3B6YA 4YCVA 1V9JA 1FCCC 4WURA 1VS0A 5EPLA 1GVPA 4XE0A 2PPHA 1A8VA 4H0LC 3P4QB 4EKUA 4X64Q 2JA7H 4ALPA 2PPBC 2BH8A 1R4NI 2BB5A 1B7YB 4HVBA 4MHEA 1A62A 4RMAA 2BYTA 1CA6A 4B3ML 4QCLA 1JJGA 4XWWA 1IP9A 1PFSA 2VB2X 3IFDA 1I4PA 2PW9A 3Q14C 1CFMA 1OO9B 2A68D 4UAIA 1HPCA 4XIGS 1SYCA 1YNNC 4UHVA 2IY5B 4BBRH 4LF4L 3KVFB 2XGTA 4RM8A 2XNAC 4WJPA 4F88A 5EE1A 5LMNQ 1L0YB 3FRPB 1B53A 5E3FA 4XQQA 4LLGM 4KY5A 4A6QA 2LI5A 1C48A 5IT9c 2CHXA 1A63A 2QC8A 4L5SA 1J7AA 3I3TB 2GMIC 2KLCA 3PVLA 4WJOA 2D9UA 2R7FA 1DZ1A 1ML0D 2PI2E 1EU3A 5J1ZA 1WTPA 2E76C 1X9NA 3VR3A 2BKFA 3I4OA 2C60A 1V1PB 4BBSB 2VUMH 1EZ8A 2A69D 3KDFA 2B2VC 3GTPH 2NPTA 3FKIB 3PCOB 1KRTA 1RWSA 2RDHA 1WR6E 4G50A 4EZLA 1NSNS 4A3GH 3NS1A 3HFZB 1RIPA 2EZVA 4LK0M 4F87A 3AYHB 3NUHB 3VTUA 1AH9A 2MWSB 4E3CA 1WMHA 1GC6A 5C3WA 4WWPA 5D14A 4XT3B 1WXMA 1VQJA 1QWYA 4LF6L 5BN5A 1HZ5A 1IGDA 1LFDA 2KTRB 4LUVA 2MP2A 4NNJB 1RFAA 4R4IA 1GD7A 1C76A 3NTHA 3RLNA 2REXA 4HDQA 1L1OA 5K5PA 1Z47A 2A6HC 5IYBH 4DV0L 5M5XH 1HR0L 2NZHA 4KJOA 5FLXL 1VQBA 2M17A 3VUWA 1TWCB 2WV6D 4K8IA 4FO2A 5FJ8H 4DXFA 1YJ9A 1QZEA 2DAFA 1BUVT 2O6VB 4UP8A 4L2YA 1D5MC 5C0XJ 3HRZC 4L6TB 1PGBA 1LM8B 2Q8RE 5C3XA 1WFQA 4JI7L 4PZ7A 1Q1BA 4JI1L 1Z2MA 1Q8IA 2A74C 2XSCA 1UEAB 4JI6Q 2JX5A 3AEGB 4LNIA 5T1IA 3L4PA 4A3MH 3R3MA 3IT4B 4FLHA 4X65Q 1RRBA 1XNRL 5E6OA 1TR5A 2WXLA 1N33L 4LNQA 1DOXA 4K5WA 3N1XC 1NY4A 3AE4B 4AOFA 3X0WA 5CX3A 2L15A 3FPUB 4A3MG 4H44C 3S14B 5JOBA 1U4LA 4GZYC 4GN4B 1ISNA 5AFWA 2KKCA 4LDTD 1MKHA 4DV4Q 1ILQA 5J3BA 3ZVVA 2EY6A 4FF4A 4KHPQ 1WTXA 3V96A 2ZW1A 3F1ZA 4QJFA 3W2DA 5C44B 4DK5A 3U4VA 2SDFA 1FR3A 2TSSA 2NTTA 1K8OA 1BO0A 2NVYB 4JOIC 4X3TA 3R3OA 4REZA 3VTVA 3A8KE 4PS8A 2VZKB 3ETRA 2WP8J 3DMUA 3DEPA 3MHZA 1E7ZA 4IALA 4MSMB 3ZRFA 3W3AA 3ZTDA 1NI2A 3GE8C 2Z0DB 1Q0WB 2EKEC 4DKAC 5ELBA 3D4DA 4XZ4A 2KFJA 3UDGA 1R4QB 4R9WA 4H13C 5C0XI 1FRDA 4IPHA 1VQLA 4BY1H 1K0RA 1BCPB 1WTOA 1VQIA 2X69A 4HKZE 4A55A 1EF1A 2ZZPB 3UDFA 4HJ8A 4JI0Q 3A5UA 1YOVB 2KWDA 1QVGA 2OQ0A 1E2WA 3BDCA 4A3EG 4JI3L 2VQFQ 2R93H 5C4XB 4W9EA 5IP7G 1RM6C 4IN3A 3E6ZX 2L0CA 1YNTE 2C9WB 4RF1A 3ZLZA 2GVBA 2XWBB 5E4WC 1TWFH 1AP0A 4GLXA 2NN6G 4LFAQ 3UQBA 2BS2B 5J22A 2UXBQ 2RMMA 2WXKA 4QUCA 4LJOB 2H5XA 3GDEA 1BQQT 1IYUA 1E7PB 4IOCA 3ZW3A 4EQ5A 1WF9A 1IL8A 4FJZA 3HS0C 3TJPA 4OELB 4H02A 1BBUA 2E2JB 2L05A 3HOWB 3RZDB 5EAYA 4X64L 3IAM1 2AWTA 2L55A 3WA0A 4ZHPA 1SROA 3TZDA 3WDNA 2JZPA 3MJWA 4GS3A 1PQSA 3P42A 1D3ZA 2JA6G 4UDUC 3ZGZA 3A7LA 2K5PA 2JQOA 1RFKA 1RD9D 3GTMH 1SF0A 2MA9B 2ZT9C 4S0RA 5J2RA 1HCZA 3CC2A 3S15B 2RPVA 2F4VL 2A6ED 2V4LA 2JK8A 3PF4A 1LV9A 1N62A 3RNUA 1TIFA 5COYA 2F1MA 5HURA 1GJZA 1N34Q 4C2MB 4C3JG 2SNSA 1ZYRD 4NJ7A 4L63B 5BMGA 3TQYA 1K9MC 3TS2A 5JJIA 3RPFC 4PYZA 2ZCCA 4MTKA 1A6XA 1UWMA 4DHZE 3ERSX 3D6CA 2K8BA 4YHHQ 3PIP3 1WD1A 4F8MA 3NQTA 4C56C 3BU2A 3U7ZA 1HNZQ 1RAXA 2PW5A 3NBIA 1N36Q 1SSNA 1JW9D 2JRIB 4MGKE 1KOTA 1PV4A 3MP9A 2EE1A 2PNRC 1GJXA 3H9DA 2YU9H 1T5EA 1VDZA 2PZWA 2LGXA 3CCVA 1TQOA 5JJLA 1CZPA 4G3XB 2E2IB 5M3MG 3QJYA 2M19A 1CM9A 3CQZH 3RD4A 4XXEA 1ONLA 3G71A 3GTKB 2WNMA 1L5PA 4J1MA 1W3SA 2KWUB 2IHFA 5IT9L 1Z9FA 1YHQA 2F3VA 2VUMB 1XXGA 2K05A 3DOWA 3TEWA 1O7IA 2R7ZH 2N88A 4PZ6A 4HCPB 4CKEA 3GTPB 2NMQA 4TSSA 3I72A 3H09A 5CBEE 1SNPA 3KOJA 4X3KA 3I55A 4A3GB 4NB3A 3D6WA 1Q8KA 1MHHE 1NENB 2IDYA 1PH8A 1AARA 2K28A 4GDLA 5BR8Q 4YSYB 2EJGC 2NBWB 3K0XA 2MNAA 4S3SA 4KZ0A 1YIWA 5EBDA 3CSFA 3AE3B 3DVGX 3VH3B 3O13A 1LQBA 3M95A 5IN7A 3CU7A 2L5TA 3RZOH 3EROA 4BBNC 3MFYA 1FNUA 2J42A 4GLSC 4OZAA 2NTSA 2DYMA 5M5XB 3NENA 2Z0SA 3IXSA 1ZGUB 2SNMA 1PH2A 2EIFA 2ASBA 2LFIA 4BFRA 1OQRA 4DAVA 4X65L 2Y5BB 1SSOA 2L3ZA 3AE8B 3UE0A 1YITA 3UI2A 2IGDA 4DR7Q 1J5EQ 2LFNA 1YQBA 1SNCA 3N1YC 1TZOA 1SR3A 2LVPA 3HIZA 5IKCM 3S1NB 2JZ3B 1RJTA 3JW0X 5C4ZA 2WXQA 2Y0SE 4DV4L 1DCZA 4A3MB 2INCC 4LFBQ 4MM3A 4WH4A 3U50C 3ABVB 3I90A 4B0MA 4KHPL 1CSQA 1Q86C 4ZDVA 1JWBD 1A3UA 2WDVB 3H6NA 3V60A 4DNTB 4M00A 4ASWC 1F1HA 4RM9A 3RFZB 3HKZE 3V05A 3DLLA 3BYYB 4DAPA 2YEPB 1JJCB 3B9JA 4FVMA 1RKNA 2BF8B 2NBUA 1T6BX 5AZGA 2V3PA 2Q8TA 3V2TA 4EVOA 4GSWA 2ZJDA 4RH6A 4CDFC 4ZUJA 3N30A 3NS8A 4HAEA 4CDEC 4B95A 3FVQA 3TEXA 4HJAA 2VQEL 3NEMA 2K04A 1F2LA 5D3DA 2N4FA 3Q24A 3U9SA 1X54A 2UU9L 4KIKA 3J81E 3GQBA 1B9NA 3CD6A 4IDIA 2V3SA 3KDFB 5JJZA 5DPTA 3VR4A 1C1YB 1ZXTA 4OL7A 3L54A 3C19A 2NPTB 2A5HA 4JI0L 5BMHA 4RA8A 1YHBA 4XGAB 1NNXA 1PUTA 2H88B 3F2UA 1TWGH 4P73A 3NWSA 3GV3A 1AN8A 3MC0B 4AQYQ 1WR1A 4X6AH 2WX1A 3PZ7A 2BDNA 5G3LD 4DUZQ 2VQFL 4A3KG 3W5VB 4UY8C 1LTLA 3L17A 2CU1A 1QUQA 1JE4A 3PUXA 4A3DG 1HH2P 4L5TA 4BY1B 3ZUNA 4DDID 2ZXPA 4ILWA 3I5JC 2OEOA 2YYZA 3SD5A 2FJ2A 5CYUA 1Y56A 3H7SA 1VQGA 4OWTB 3U2SC 1L1OB 4IJLA 1WX8A 4BWGB 2B3AA 2M9VA 1O7LA 4RGOS 3KUZA 3TEYA 1G51A 3TP7A 5IGCA 2PI2A 4JC0A 2UUAQ 3I4MH 4WJWA 2CH4A 1DOYA 1UE7A 3Q6SA 2IGGA 1G8ZD 3IAYA 5HFYA 2UXBL 2B8GA 2K6AA 4NPSA 3HEJA 3MEFA 4M8AA 1XPUA 4BA2I 4A93H 1KRSA 1TT5B 4HPLB 4G57A 3T1YQ 1MIUA 3ITPA 1B1ZA 2EXZA 1MI0A 1L1OC 1FNVA 1TZ1A 2XEWA 5JHAA 3J9CA 3N20C 1WGRA 4OZCA 3W5UB 3QA8A 3QX1A 4RMFA 2DZKA 1TVXA 3TS0A 1R9TB 3KH0A 3BK1A 5C2TB 3M4YA 2KVMA 2EDGA 1B70B 5M5YH 1E90A 4PYUA 1BOSA 1LM0A 2KCCA 2BE5C 3CAMA 5EKIA 3HOXG 2BBCA 3BWUD 3ECIA 3RR5A 3N1ZC 4CO7A 1CKMA 1QOAA 3RT3B 3FP9A 2Z8LA 1STYA 2LKVA 3STBC 1V86A 2K25A 4AJYB 4F7ZA 3E9HA 1LYLA 5LL6X 3RZFA 1B3QA 4MZ9A 2L83A 1H9MA 2ZJQA 2VW9A 2L76A 2D11A 5I9OA 3N6RA 5LL6S 5DCNA 3NQIA 2TMPA 4N6EB 3IL8A 4OW0A 3AB9A 3PO2G 2OCEA 4RGTA 4C3JB 3ULPA 4YHHL 3S17B 1Y1VH 2RPQA 4MJSA 1YN4A 4C3IG 3IG3A 1I3QH 4MT5A 1A5RA 1N36L 1EEID 1ZXHA 2JA8H 1D5ZC 1C9OA 1ZEQX 3CRKC 1CKNA 3PQIA 1N5XA 4IWQA 1NBWA 3C8YA 3A5ZB 4BAXA 1F0ZA 2NYZD 1VQ5A 3PO3H 2C7MB 2N7DA 3FAHA 3UGBB 1X3EA 4NW2A 5M3MB 1IGCA 3IT6B 4RAUC 3I70A 1ZW7A 4RKBA 4NZLB 2WB1B 1WSPA 1SYDA 1N8RC 2YU9B 5LNK1 3KLRA 5T1GA 3Q8DA 5I9PA 2KNBA 3T3OA 4R4CA 1DONA 5BR8L 4AJWA 4L23A 4LF5L 3T9LA 3PUYA 1PHJA 3DWPA 3CC7A 4BKSD 3HOUH 1J8CA 1TT2A 1AZQA 2N1VA 3OOCA 2QCPX 3FPPA 4S17A 4OX9Q 3ZJTA 1NR4A 4KKIA 2N3SA 1VQHA 3PZ8A 2B2TA 4MEMA 1BBWA 1C3TA 4AS1A 3EHVA 4N9PA 5CV5A 3K9OB 2IX1A 1UF0A 2Z1CA 3OJ3A 1JOKA 5IYCH 2PTLA 4ME5A 4C3HG 2N9PC 2WAQE 1CK1A 5ELDA 1UWXA 2EQSA 3P4RB 5EE0A 4DR7L 1ESFA 1SNDA 1JJ2A 1AW7A 3NXWA 4XQJA 2WINB 1EY9A 3RZOB 5D6JB 5JPMC 2L9HA 1VF7A 4N8X1 3K58A 5LMNW 2PQAB 3U58A 1XLQA 3AH7A 4OZBA 2LRWA 2UU7A 3OIPA 1E2ZA 2K5QA 3DWQA 4JOIA 1KM7A 4Y52H 3DQVA 1P9DU 1CQFA 4LFBL 4ZOHC 1CTMA 3NUCA 2C7NB 3DVNV 1SE2A 1SYBA 2JE6I 3V6EB 4XYCA 1C8CA 4JW0A 1OTRB 4FYDA 3E3XA 2L00B 3HVDA 1BCPD 5AJ3Q 4V0BA 1Y8OB 1EUJA 4E74A 3RLOA 4FF3A 3H0GH 1N61A 4N58A 2LXAA 1U4AA 1N9WA 1ZKHA 1EIHA 3PTFC 1MBYA 2WHIA 3OWEB 2WXGA 2J7QB 4II2B 3PGEA 4RNAA 4NXML 2XN9C 4JI5Q 5C23A 1XWEA 3FKIG 1V8QA 4TVAB 2AKWB 1OEYA 2ZVNA 4L5QA 1H9KA 3KF8A 2E2HB 4MACA 2FCNA 3SGIA 2ZJRA 1VR9A 4DNIA 2G45B 1MHXA 2ZW0A 4P16A 1FVIA 3AEFB 5M5WB 3CF5A 1F9JA 1HZBA 4H7BA 2KAJA 3PREA 4KZCA 4BVUC 1PH3A 3ER0A 4DUZL 3Q3FA 5DNFA 2DZJA 1L4DB 1XTDA 3NBHB 2LVOA 4USAA 4BOZB 1CQVA 1FCLA 2CKZB 2R61A 3KLSA 3WAMA 3W1YA 4DUYQ 1L7YA 4BKTA 1YJ1A 1HZCA 1LT3D 4A3KB 1W6KA 4B0EA 4HMJA 5M3FG 1WJJA 4O42A 3TZUA 3VQIA 2D0PA 1SLJA 4A3DB 2DY8A 3TP8A 4O2DA 1V5TA 2UUAL 2M0AA 4DR1Q 4B08A 2K52A 2K5NA 3ENEA 3G7LA 3NHHA 1LTID 1HXYD 2B2UA 5IYDG 1TWAB 4HJ9A 4DR2L 3T1YL 3GTGH 1FXTB 1TKEA 2A1AA 1WD0A 1LTTD 4UP7A 1HZAA 2SAKA 1I6HB 1TWHB 1T0SC 2KMAA 3P4SB 4AUQC 3I4MB 4LMQD 3DBHB 4LW1A 2ZM6Q 4WRDA 3VR9B 3KUDB 1HNXQ 4A93B 4MH0E 2MH7A 2F0IA 3SVMA 1VQKA 5H8YE 4A8XC 1JROA 1WJ4A 4XTCS 2BDOA 4LF7L 4MELA 1PDQA 2F0HA 2WP9B 3KWVA 1Q3LA 1Y8PB 2JUOA 3HOZH 1PTOH 3K5OA 4LF8Q 4I6LB 4WQMA 3SDLC 2NVUI 1OQQA 5C44G 5IP9G 1B4OA 1E8XA 4MM3B 4IFDG 4WWMA 3HOXB 2K3UA 2Y5PA 1V49A 1GHJA 4W9KA 5TSSA 2JJQA 4GLAC 1GUSA 3SEBA 1II3A 5KIXA 5GADC 1A15A 3OAWA 1I4RA 3G6EA 1STAA 2BPSA 4KD4A 1I4XA 4ABNA 1GB1A 1M90C 2CH4W 2WKCA 2L11A 5LMUQ 3CCUA 5JVH3 3NVYA 4WQOB 4JBWA 3DWMA 3ONSA 2PZTA 3PIO3 3F2CA 1PFBA 3I4LA 3PHXB 1PFDA 3FMCA 2HTHA 4G11A 3HRDD 1V9PA 5I2YA 1LT5D 5EGTA 1Y8NB 3GTQH 4J3OD 2DGYA 2UXCQ 4BOSC 1BDOA 3NJTA 1BCPF 1CSPA 1U5KA 3CCJA 3CIRB 4IC7B 1P7FA 2BH2A 1I94L 4NQKE 3IFTA 5C3EG 1PH7A 3S16B 4E71A 4HIKA 1Y1VB 4KIKB 4RG1A 3WAOA 4U68A 5FKAC 2JA8B 2BA1A 3MXPA 2GRIA 1F9QA 3KW5B 3T16A 3PF5A 1C77A 4NQLB 3ZXRA 3KLWA 1YNJD 2MO1A 2DLBA 2P5ZX 4A76A 4IPCA 5D7GA 2BYFA 4JL9A 4IW0A 3BIID 2EYLA 2KXJA 1QUQB 3MA2B 4J6HA 3K6OA 3CC4A 2ON8A 3FKYA 2CWAA 2Q8IB 5BN3A 4OX9L 1OXUA 3L7ZC 3Q6BA 2F0SA 4HIOA 4DV7Q 1S40A 4DAYB 4PMBA 3AN1A 1K8RB 4RCNA 3DUZA 1C4QA 3GTLH 4KN4C 1ENFA 4LK1C 3K8AA 2G9HD 3VXWA 3HOUB 3M85A 1Y8RC 2KJHB 3BYTB 5ELNA 4YWMA 2BB6A 2PE6B 3M62B 4HEDA 2KA7A 4C3HB 2DJFC 5HG2A 4X62Q 4JYAL 1QNUA 2HTME 1FXAA 2W55A 4KK7A 2I1JA 2PW7A 3HUIA 3UF8A 3IHPC 1VQEA 1QT9A 4DV2L 4U673 5C4HA 4JWUC 2K39A 3M3JA 3H7PA 4A3FH 4BXXH 3W5OA 1STHA 2JA7G 1C4CA 4ODGA 1SMYD 4N9TA 1VD2A 2K01A 1YJIA 1TU2B 2WXOA 2M00A 1S3SG 3G48A 3JAME 1KDCA 3GOEA 1WGHA 2F0EA 2PYKA 1UH6A 3A8IE 4DR3Q 3JSVA 2IY0B 1IBXA 4XQNA 3L10B 2G4SA 5EKKA 3CCQA 2BGFA 5G5GA 4PQXA 2FINB 4BBRG 1TIID 1K73C 2OT2A 4PS7A 5C1ZA 2WXJA 1XX8A 4DV5L 1DOKA 4IUVA 2NVQB 3EFXD 1DOLA 5AZHA 1K53A 4JI5L 1E8WA 2UUCQ 1IBKQ 1IW7D 1G291 3RNGC 2VY3A 4WJQA 2JWZA 3Q0AA 4ANWA 2I07B 3WCQA 1NR2A 1PGAA 2B8FA 1CKNB 2VNUD 4ZRIA 1QZGA 1SFOH 2LXKA 4K5XA 1MG4A 3TEHB 2VUMG 4YWLA 1WM3A 2RR9A 4TUUA 3ZDMC 3I7FA 2ICIA 3S1QH 3DWGC 3IRBA 4GKKQ 2W82A 4A3GG 2WS3B 4ZYSA 4KVGB 2LUEA 2MUYA 3J80c 4DUYL 1L2NA 1S5CD 1KH0A 3VRBB 2EJFC 3D8GA 1P16A 4C1NI 1ZDXA 3ALBA 2N9LA 2F0JA 1S5DD 5IGBA 1NUCA 4C1NK 3CMEA 2JWUA 4M8NA 1JWUD 4DU9A 1X1MA 3OTOL 2N7EA 3Q3OC 3T13A 3I8ZA 3U7DA 1LUZA 3UE1A 5M3FB 2K1FA 3RZWC 4X3UA 4C4VA 4IKGA 3VTWA 4A3OA 4CQNA 4EEWA 5IYBG 2BW2A 2LSSA 1BMLC 3RD2A 1EFWA 1J8IA 3CCEA 3B2FA 1OTCA 2DHZA 5FJ8G 4JGHB 2V1CC 4IOAA 3V62A 1I7HA 3AEEB 3Q8EA 1NMFA 1WYDA 2UUBL 2KT7A 4US9A 4DV1Q 5AEKB 2DUDA 2HJ1A 2PVOD 3VAWA 4QB4A 4XYQA 4J15A 1KXLA 2C5LC 1X55A 3MZ5A 3QR8A 2K6QA 2KEDA 3D0FA 1YQ4B 3FDTA 4A3JH 4II3B 4ITKA 5EKLA 4AWJA 4CGYB 5CHVC 2LXJA 2IX3A 4A3BH 1ZE3D 2B2TC 1I5FA 5F2DA 3PRMB 2D3AA 4G7OC 4JG2A 3BG3A 1R4MB 2G9DA 1HE8A 3UINB 1G2TA 1YD8U 1ASZA 1KLVA 1YQ3B 1N32Q 2IO0B 1WY8A 3VR8B 2EYFA 2JQRB 4RF0A 3EBEA 1PVOA 2YEPF 1TGZB 1X56A 3RULA 4K0KQ 4G0NB 3DXJC 3HP3A 5CV8A 3KFUA 2HIXA 2OJWA 3EJIA 2CHWA 4ZK9B 2KJ6A 5DM63 1S3OA 4XT1B 3K5MA 3SK5A 1JB3A 2E8GA 4DR4L 4B6WA 1FMAD 4DR6Q 1BBXC 1PTOB 3H3VH 2QMTA 3VHTC 1ZKOA 2Y5CA 3QWNA 2V4DA 5IIFA 3M4OB 2AMCB 2JN4A 2D3GA 3DHHC 4JCVE 4K5VA 3S2DH 5IGFA 1YHAA 4L1BA 1P8LA 4M1UB 4XDCA 3DBHI 1JRUA 3BZCA 1SN8A 3CCSA 2EYMA 1EY0A 4OO1H 2KVZA 3DBLB 3PS6A 3ZRCA 3ULLA 1PTOC 3K5NA 4KSKC 2ZNVC 3APCA 3KF8B 1ACCA 1YJJA 5C3EB 3V3XA 3GTQB 2OF1A 2ZXRA 2R7DA 4IUPA 5K36H 4K14A 1JB7A 1GHKA 2EYHA 2K33A 5M9OA 1WI5A 1GG3A 1GUAB 2ASQA 3QB3A 4BY1G 4G7ZC 2GB1A 4FADA 1I4HA 1BUIC 3A4SC 1KFYB 4JWSC 1Q90A 2JEBI 2K4KA 2F0UA 2IWHA 1H4RA 4CKCA 1VCIA 1H9SA 2WXRA 1XF5L 1VQ9A 4FHKA 3KBGA 4DDGD 2QGQA 3HOYH 4W9CA 2JY6A 2CHZA 1VQ7A 5BN4A 1HA6A 1KDAA 5BYSA 2R93G 1MJDA 2KZRA 2HDLA 4I6NB 4DV7L 5L95C 4R1JA 2CW0D 1OXXK 3URYA 2JRHA 1QCBD 3EECA 1JOOA 1P3QU 1FL0A 1KLGD 3OMCA 4URKA 3ZO5B 1UAPA 4GGQA 3S1MH 3UIOB 1PRTC 4IUNA 1GNUA 4B3SQ 1R7SA 2HJ8A 1KJTA 3W9CB 2LHEA 2K1BA 2KC1A 4TV3A 1TBEA 4KGRA 4ZRKA 3ZXVA 4LNNA 4DFAA 2B3GA 3OMGA 5CMDA 1FEHA 5CHWA 4M01A 2QILA 2WXHA 3AMUA 3ND8A 1WGGA 3EFUA 1WXSA 3S9WA 2B2UC 3S2AA 4A90A 1BKBA 3RNFC 4W9DA 1WCMH 2JA7B 1HUMA 4A9AA 1GKHA 3P75A 5IOCA 3CMMB 3MHSD 5HHDG 1SXTA 2AQ2B 1EWYC 2ACZB 2RCFA 4Y7NH 5LMNL 3I4NH 3A9JA 3VYRA 1TKGA 1FM0D 2J52A 2XBBC 5KHQA 4F1SA 2RCNA 1L2FA 2MQHA 1EYCA 3HZXA 5IWAQ 3VR2A 2UWQA 4LJPB 2JXMB 1HA5A 4BBRB 4QF4A 1IBKL 1PLFA 3UDIA 1CZWA 3T1HQ 3B1LX 2X6LA 4EZJA 3ML8A 2DZIA 3S2HH 3F8TA 2R92H 1IZ6A 1EY5A 3NOBA 3F2BA 2ZTCA 4LNOA 2J4XA 4OIJA 1VF5C 5ELEA 3H91A 1I50H 1E0BA 3C46A 2KQ4X 1SGHA 1QE6A 5JEAH 2N55A 1PZKD 3VYUA 2M1MA 2YVCA 2WB1G 4JIOU 4FHJA 3A1QA 3R66C 5IGEA 1AE2A 2MSED 4GKKL 1QVCA 2VH2A 1TY0A 3K7AH 1YJNA 2DENB 2YV5A 2DX5B 1GUGA 5I6WA 3NVWA 1F2RC 5ELFA 3MC8A 2ZTDA 1SFOB 4HCSA 2GBNA 4PK1A 5C4JH 4JV5Q 3T4AC 1SYEA 3CKIB 2R7ZG 3MXNA 2VZKD 4DR5Q 3JVZX 4C80A 5KNDA 1HHVA 1L0VB 3K7UC 3S1QB 1D6EC 4P74A 2W3RA 3SFEB 2AUJD 1TJEA 3X23A 1KNAA 3OW7A 4B3TQ 1Q1OA 2KMMA 2AQ1B 5ELOA 1IBLQ 1WRIA 2OOBB 4A3CH 1C7YA 1VLBA 3T56B 5GAGC 2KD0A 2V1YA 4JI6L 3J80L 4IUQA 2PZUA 1WJNA 1WTVA 2FCQA 2WXFA 3QAQA 1ZOYB 3W1SA 4JPSA 2I0QA 2FBWB 4JBMA 3DEOA 3BY4B 4KGSA 2IZVB 2DAJA 2L0TA 2I46A 2KCNA 4JI4Q 4IFDJ 5A2QE 1FGUA 4DK0A 5EE3A 1EZ6A 5I6YA 1AEXA 1K50A 4YT0B 1L0XB 5CC4A 1N32L 3T3NA 2O4XA 3W1BA 1BNZA 4DHJB 4DWFA 5D2MB 2X6GA 2BYVE 2R3ZA 2UYZB 3H7PB 2A19A 2JSVX 1Y14B 2WXNA 1HJPA 2F0MA 4RGNA 3CMAA 2NZOA 4A3BB 3NY5A 1NEKB 2ZPYA 2WGSA 2L4NA 2I1KA 1WTWA 3ZQ4A 4DR6L 2DYBA 3JAML 2C5CA 2IT1A 2FUG1 1WE7A 2JT4B 1YX5B 1ENAA 4JPBW 1WX7A 1YN3A 2GBRA 1IL2A 2KQ7A 4OVVA 3TL5A 2F0DA 2V4IB 3PMFA 4P6VF 4XWTA 3PHWB 2EPBA 2LWPA 3SU8X 1VQPA 2QJLA 4JI2Q 3C1FA 3L0OA 3QO2A 4UP9A 5G5HA 2FXQA 2BWFA 2KACA 2I2YA 1EY7A 2PJHA 1LACA 1R4MI 5IGDA 4NJ6A 2D0OA 2NR2A 1DGSA 4R8NA 2EVBA 1Q12A 4ZCKA 2D3CA 1WMHB 4O1NA 2YTVA 3WALA 3CCLA 3H3VC 2Z59B 3A4RA 4FF2A 4IPDA 2MP2B 3E9SA 4AYBG 1LGRA 1HFNA 4IFDI 1VCBA 5J39A 1QLBB 1GUNA 1TS5A 1K0SA 2KN5A 1F9PA 2WKDA 2B2WC 3CW2C 3I9V1 1CT1D 5J17A 4LFAL 4JBJA 2PO4A 4J6IA 3GTJH 2JA5H 2R93B 1CHPD 2PMZE 4C4VB 4I7ZC 5MPOA 1RLFA 4IPGA 3VDYA 1XMQQ 4ZRJA 3WAPA 1UZXB 1A3TA 3HOYB 1SMYC 1EEFD 2A68C 3I4MG 5BMIA 2E5LQ 3DBLI 2R6GA 1AYFA 2YTYA 1TWFB 3OWFA 4A93G 1HEZE 1LTRD 2Z0EB 4HXDA 4YSXB 2KJXA 3J7A5 4DNRB 3PT2B 2K14A 2KX3A 5JHBA 1ROEA 2OTJA 1SE4A 3S1MB 1WH3A 4GMVA 5CGKA 2MO0A 1RF2D 4MN3A 1VQAA 2OEDA 1MD2D 3T53B 4NPNA 4WIPA 5KEEA 1GUTA 2CWPA 2RHQB 1YI2A 1B44D 4QMGA 3K57A 5C0XH 1G6JA 4IM3A 2K5DA 3EQLC 4TRDA 4PV1C 4NXNQ 3DBSA 4YXDB 4X3SA 3KJPA 2VXWA 1Q10A 5D3IB 2A69C 4B9WA 3A55A 1XD3B 1N34L 2ONQA 5LXHA 3EUB2 4HJGE 3GTMB 1S72A 1LO5D 5KYIA 1K8AC 3ZJVA 2WACA 1E8YA 1P0RA 1ICFB 2XIWA 3J81c 2WXPA 4R4OA 2HCCA 3T1HL 1HNZL 4GN5A 4V190 1NTGA 2CCZA 2M0XA 5DLQE 2QA4A 1J19A 1EO6A 3ZJYC 4W9LA 1H9RA 2WAQB 3T51B 4A75A 2AUKA 3CP0A 2K8HA 4PS3A 1Y1VG 2IPKD 2AQ3B 1N6ZA 4GOPA 2FMCA 3PO0A 1L0WA 1C9FA 4DV6Q 4GKJQ 2O6VD 2JA8G 1CZGA 2M4NA 5GROA 3J7AF 3ZNHB 4KKUA 2I5MX 4FP5D 4A4IA 1LTGD 4LUZA 5A35A 3CCMA 3SR1A 1IYVA 2W9NA 4CKBA 2WDQB 3PO3G 3S2HB 4POFA 2KHWB 1DD2A 5AUIA 1WGKA 3E56A 1V1PA 1E7UA 5CR3A 2Q2TA 2FFKB 3MEHA 1N63A 4WWNA 2N8NA 1I50B 2RSOA 4YIJA 2BQQA 1GUWA 2GI9A 4AP4C 2D2CC 3CQZB 5KRUA 4AH6A 2K0PA 1LTSD 2CFMA 2E3TA 3NVVA 1UBIA 4LDTB 4HPMB 1H9SB 4RFBA 1M8AA 1T0RC 2SOBA 4M8MA 2R7ZB 4KMUC 4M02A 1K52A 5L83A 3QOJA 1K8GA 3AEDB 1G6PA 1SB3C 2KN4A 2PEAA 2FIDA 5E6PA 3RUIB 2KTRA 2LD9A 4KN7C 1BVSA 1XJVA 2HDEA 2Z6KA 5FLXE 1QJOA 3F2DA 2F03A 1B8AA 4FXKC 3HOUG 1X6OA 4P2CB 1KF6B 2N9XA 3J80i 2EYJA 4NAWA 3TP6A 1VQNA 2IL8A 1RHPA 2C35B 3MXGA 3HOVH 5JPNC 1STEA 4MNOA 4B3RQ 1DXMA 1WX9A 1DYQA 4IZ8A 3GZNB 1E7VA 1DOIA 3J81j 3DVNU 1J5EL 3Q22A 2M2LA 2EXDA 1I4GA 2K50A 4PNYA 1EIFA 1SNQA 5IYCG 2KYWA 1Y1WH 1EYGA 4JI4L 3JYUA 4BKGA 5JJKA 3VA7A 1EQRA 2W54A 3SE0A 3U8ZA 2IY1B 5JXVA 3MC9A 2MJDA 1YMHE 5NUCA 4DK6C 4A3LH 3L0WB 2G3QB 4HSPA 1PMRA 3J7ZC 1OQYA 3OLMD 3P2BA 4WWOA 1YBYA 3HG9A 5IY0A 1JICA 3GTOH 2RSUA 4ID6A 1VMPA 1KDBA 2MHJA 3QQ8B 4K81A 1QKZA 4FXDA 1EF5A 4ZRQA 4AQ7A 1E1OA 2Q2HA 1V81A 3RNBC 1CI3M 1Q1EA 1PH9A 1XT9B 2C7HA 5GMVA 3NP8A 1TXYA 1NJIC 4KY7A 1XEEA 3Q69A 2VS1A 5GQOA 1UE5A 4FXCA 1I42A 2EYPA 2WDTB 1ZP0B 4BKSA 1F9SA 4HLEA 3DBRB 1EUVB 1X3QA 3A9JB 4RWSC 2LGIA 3I57A 4ZHOA 4HMIA 3MTNB 3H0GG 3ICEA 4B3MQ 2IHEA 1SBBB 1WM2A 3CPFA 3LWUA 1NBFC 4NKLA 3J7YW 4LFCQ 4HIMA 2B63H 2IBIB 4XDXA 4B9KA 3ULJA 4CJ1B 3D32A 4BA1I 3D3RA 4IM0A 3KJOA 1SE9A 1XQQA 3K9PB 2XRSD 3PPAA 2WYQA 4Q0FA 2OXPA 4LF4Q 4ZYNA 3SK8A 3WWVA 5AUKA 4BBSH 5I2XA 1FIQA 4NP5A 1FRRA 2DN8A 2DY7A 3S24A 3A54A 1IXRA 4AQYL 1L6VA 2BKRB 2ZPNA 2HE7A 1AE3A 3I91A 4K6DA 2OTLA 4LTUA 2CVRA 4C7YA 1FXIA 2J0KA 3P20A 1I6VC 1V97A 3Q8BA 2JYTA 4DBGA 1S1QB 1T9HA 3GD7A 2O2VA 2BOSA 2XTIA 1WGDA 3L08A 3TMEA 1VZ6A 1A3VA 1WOCA 4K6LA 4GDLB 1AWDA 2G4DB 1TWGB 2XVSA 2PQEA 4AYBB 2Q5WD 3MXNB 1L4ZB 5IAAC 3Q8AA 1HUNA 2MRPA 1STNA 1XMQL 2LMCA 3P63A 4IUMB 2KX0A 2N49A 1DGJA 1PZID 4JQWC 4NMZA 1ZUD2 3P1HA 4LF6Q 1GAQB 2B76B 3ZTCA 2C9OA 3H3VI 2KCMA 2V3NA 2N9EB 2A6EC 1PYWD 1A2TA 3U4EG 3EA6A 2PIAA 5KNBA 4A3IH 1V6EA 4HJKA 1LT6D 1HR0Q 3NELA 3AEAB 4IUUA 3GP7A 2LJ5A 3LXFA 1SNMA 1ZYRC 3KLSX 1FO4A 5JH5C 1MHWC 1Y69U 4OO1I 1BR9A 3NK9A 4A3IG 4KKJA 4N59A 2F0VA 1HNWQ 3AU7A 2EYOA 1WYGA 1CUKA 2QW7A 4NJCA 3RNCC 1GM5A 2KDIA 5G55A 3SHLA 3AQQA 4NXNL 3X3NA 3W1SC 3BDLA 2PKOA 4JI7Q 4X57B 3S14H 1LABA 5CV4A 2DWQA 2K22A 1KLUD 2CHBD 2RSNA 3ZIMA 4GDKA 4F8CB 1EWHA 5FK9C 1KAWA 3HOZG 3WIMA 5M5YB 5LXIB 1FNWA 2J53A 2HQLA 1N33Q 4W9FA 1V2YA 4GIVA 1AFPA 3GV6A 4KY6A 2QCZA 2M56B 2RDGA 4EQNA 2RDFA 2RQXA 4QIWB 2DZMA 4K7WA 3AE1B 4LCDE 2JU6X 3M4QA 1WTRA 4DV6L 4GKJL 1VJKA 4M0WA 4KSLC 3A74A 4TKOB 4OONA 1F2MA 4OWXB 1UD7A 1S5BD 3HKSA 3D4RA 1I3QB 4WJ3M 2F0GA 3OYYA 3NG0A 1MFWA 2NB0A 2XRQD 2L1BA 1KTKA 3R93A 4ZRPA 5FR3A 4K7SA 2GVAA 1ASYA 1VQ6A 2L12A 4J8QA 3J81L 1IKLA 4HRSA 3BK2A 3UIPB 5FLMH 1B9RA 3PO3B 3A9KA 2CQAA 3QC8B 3RLFA 4OXPA 4JVZA 4W9IA 3R7QA 3N52A 4Q2JA 2RHSB 1EYAA 1QG7A 1RDPD 1JORA 3D31A 2R2OA 5IT9E 1C78A 5I4DA 1HZ6A 2KDMA 3WANA 2MBQA 4OIKA 2MPMA 1JCKB 3ONAB 2KO3A 2ENBA 4IQZA 3MAQA 2XWJB 3P1MA 3KK7A 3E0EA 1E9MA 3MXUA 4HK2A 1E3PA 5E7NA 2K8CA 4ACFA 3NWTA 2LHDA 3MJ5A 3AM9A 1O7ZA 3AMZA 2HUGA 4B3RL 1UE6A 4KKTA 3M3YH 2FE8A 2WX0A 2EY1A 4ZUIA 1XPRA 2B2YA 3LNNA 1H8CA 4JI3Q 4CHTB 2KENA 4KDIC 5KYLA 2KQSA 2LGSA 2INPE 3PIPA 2KEEA 1N60A 2GLSA 2NZ1D 5C3JB 1I35A 3CRLC 1K28A 3S1RH 3ZNGC 3NSWA 2WLBA 3GE3C 4HSVA 2PLPA 4X66Q 3BZKA 2RA4A 3RZDH 1V1OA 3HOWH 3PGZA 4GNXA 3HOVB 3TDQA 1TYGB 2PVGC 3P4PB 3DCGA 3LDZE 3K59A 3R2TA 2X8XX 2WQYB 3SR6A 5AJ3L 2KOXA 1PH4A 3KF6A 1RCVD 4A3FG 4Q5VA 4BXXG 4R4QA 3FILA 4A20A 1UNSA 2QDBA 3E5SA 3NTKA 4QGUA 3I56A 3AEBB 3BVZA 3C2PA 3IFWB 2Z4HA 4GLVB 1SAPA 3S15H 2LRUA 3GTOB 2QSDA 3OG5A 1V1QA 2INNE 4MH8A 3V61A 4DPGA 1FJGQ 1G91A 5H92C 3BZDB 4XYOA 2FCSA 4C2MH 1XCTL 4CBVA 5GAHC 2JZZA 2KANA 2O5IC 4EUTA 4LFCL 4DN4M 3HK0A 3GZNI 2KBNA 3H0GB 3VFKA 3ZDTA 1SIJA 2BS3B 1W6JA 2HD5B 3L13A 3SXHA 2F4VQ 4P1BC 1JWSD 3K5LA 2CKHB 3X3MA 1U0LA 4GOPB 1M4VA 4TMAB 3SHQA 1Q46A 2Y0SG 2B2WA 2LEKA 4BBNF 2KUMA 5LLIA 5CV9A 1D5XC 2E2IH 2B63B 1WXQA 1VQ4A 2BE5D 3GTKH 5KNCA 4I7AA 1O7YA 1VQ8A 3G4SA 2JSOA 1H9JA 3HKZG 4ZKCB 4GOPC 4PG3A 4BS9A 3STBD 2IO1B 1MJCA 4XDDA 2EELA 1VQFA 4EZKA 4ICUA 3A7AB 1EQQA 2F0QA 4HCEA 1KAAA 1JRPA 1JT8A 2MBEA 3DBRI 2F3IA 4ULLA 5CHFA 2OWOA 4DR1L 3AECB 3CXCA 3BDOA 3J7AV 3V6CB 1VDVA 1ZPSA 1PYSB 1J6QA 2PMVA 5DM73 3CF6E 3RMHA 4K2LA 1LT4D 3SK4A 4POGA 2G1EA 2INDC 3R2IA 2LVQA 3AE5B 4K3CA 3N3KB 1E24A 2E74C 1CA5A 1UWVA 2XK5A 4ZQ3A 2EMSA 4OVZA 2HIVA 4NAWB 3QIJA 4YY3Q 4BY7H 2F0LA 3H94A 2ZM6L 2N1WA 2WXIA 2IO2B 1YX6B 3MWYW 1XTCD 1HNXL 2LUMA 1C0AA 1E1TA 2D3BA 3JAMc 1WE6A 3GTGB 1KL9A 4CYEA 1C4PA 5IE8A 3TBIB 3HGBA 1A0IA 1VQMA 4BY7G 2X38A 5E6JA 4TQ1A 4JE3B 1HNWL 2Z6KC 2OHFA 2Y3AA 2LASA 3B0AA 3RN9C 5AZFA 2EOTA 4LF8L 1QF6A 1ICWA 4A3JG 1ZXIA 2WIIB 2RGFA 1WRDB 4WAFA 4Z9CB 5EQ0A 3H15A 1STBA 3SDZA 4A3IB 4A3BG 3OIQA 3GO5A 5T8IA 2VH1A 3N32A 3CCRA
chains in the Genus database with same CATH topology
2WU5B 2GA4B 1E0ZA 4HEA1 1J7BA 3OHXC 3U9OA 3HOZB 2W3SA 4TQ0A 2BCOA 4JK1C 4TQUS 5EBCA 2O2LD 1FFVA 4ZLTF 3KQ4A 3MTSA 1HQMC 1EY8A 2PCFB 3EGRA 1TKWB 2HCIA 2BS4B 4PT5A 3LX0A 1CHQD 4WORA 3KWLA 1EQVA 4HKQA 3Q8CA 4RHRA 1GXDC 1QOGA 3B2GA 4OO1G 2F4IA 1NAPA 3DM1A 1NI3A 2RBMA 3VR5A 3AV8A 1K8MA 1JALA 1HRJA 2CJOA 4IOIE 1FYCA 2EKIA 5K36G 3AE9B 3VRAB 2E2DC 1G2SA 2MEKA 1PRTB 1MSGA 3NPPA 2BT6A 1OXTA 3NRZA 3ZYYX 1V8CA 1U9RA 4CJ2C 4JX1C 2MP1A 2JP1A 1EYDA 2ID0A 3GB1A 2IJ0A 4YWGG 2LMCB 1TKYA 4HN7A 2NN6H 1BCPC 1MI2A 4CJ0B 3GTLB 1NYQA 3M3YB 5BYQA 1VZ7A 3MHBA 3KBXA 3VA5A 1BF4A 2CU3A 1O80A 3I73A 2H4OA 1T3QA 3S1RB 1EIGA 2E6XA 3M7GA 4YTPB 5IGGA 2AWNA 4GDKB 4A3FB 4IURA 1Z7TA 4ZAIA 2LY7A 1JWAD 3I3CA 1PFMA 4KHZA 1ILPA 1GUOA 5DEHA 1XCQL 3RUZA 5C6AA 4RCOA 1MSHA 2N9KA 3PUZA 2MJEA 5GXGB 5LHY1 1EM7A 1BXTA 4DQOC 2JEAI 1E10A 2K03A 2Y0SB 5JEAG 2H89B 1JQ4A 2F0WA 3A56A 2LJIA 3HKZB 1E2VA 5E4XA 2F0TA 5EJWA 2KQ3A 1SE3A 2NWGA 3NBHA 1GOZA 3N9YC 4C7ZA 4DXGA 1AZPA 1D1KA 4ARCA 2EY2A 3LB8C 1MGSA 3LWEA 4ZRZA 3VYSA 1LTAD 3NTIA 1OXSC 4K2KA 4BY7B 1VRAB 1NYRA 2B2YC 3CWIA 3G6JB 4A3JB 1Z6HA 5BYRA 5EPJA 5FO7B 1XO3A 5E1FA 3ERQA 1FD6A 1IBXB 3FILB 3Q8FA 4KGTA 5C5LA 1D2BA 5ISRA 3GS2A 4ARIA 2PMZB 1DOMA 4E6IA 5DAUA 4EQOA 1EY6A 4L8JA 1YNJC 1B2TA 1K51A 2RKSA 4YTNB 1C79A 1IUEA 1HQRD 4NDXA 2QKIC 1STGA 3S2DB 1PFNA 5CV6A 1J9OA 1PZJD 1XLNA 1GB4A 1YNND 5C5MA 2EY5A 2O5JC 3BVGA 1JOQA 3LYYA 1UGJA 1DJRD 5CORA 4KHVA 4EGVA 4F7XA 2QIEB 1TS3A 1U4PA 2E75C 1KRHA 2JXTA 4I65A 2AX5A 1QNKA 4A3EB 1L6UA 4HROA 2QEJC 1DM0B 4KD3A 2IX0A 5CV7A 3IAS1 1D4BA 4DAYA 3SK6A 2SEBD 1HFGA 4EQPA 4IUTA 3VYTA 4PMWA 4KV6A 2HDMA 2FHTA 5EE9A 1V43A 1IW7C 2D5DA 2N7JA 2MJ3A 3TP5A 2A6HD 2K7VA 2L32A 1S5ED 5C0XG 2H1EA 2I38A 1R4PB 1QQRA 3PUWA 3H8HA 2NUCA 1MPEA 1WCMB 2MJ8A 3MVVA 2KECA 5D65A 1XLOA 1X32A 1CJEA 1QOBA 4Y7NB 2JA6B 3I4NB 2JYEA 1RYJA 2HQEA 4ZKBB 3BS1A 1OXVA 1QOFA 2FMMA 1ET9A 1X3PA 2B2VA 3TEZA 1SNOA 1U4RA 2J7ZA 3L9AX 5EPKA 1SYGA 2R92B 4YSZB 4MIUA 1A70A 3ZJUA 1D1IA 1EQTA 1ENCA 2MHVA 3C1EA 1HTLD 3WOFA 1VMCA 3K7AB 3NZ3A 1U4MA 3MFGA 1E6EB 3L3OC 4QUFA 5IODA 3BVMA 3HVZA 1PGXA 3KUPA 5C4JB 1S4ZA 3QG1A 1TS2A 1FFUA 1JWMD 2DBYA 3K0YA 2EJMA 3TUOA 1F2RI 1N5WA 1C4AA 3AB5A 3UI3A 3QOLA 2F0OA 4KTAA 1PTOD 1SDFA 1SEBD 1RTOA 1A2UA 4FF1A 3FC4A 1EY4A 5G3LF 4DGZA 4OHJA 1O78A 5HI1A 1KNEA 3ND9A 4NAMA 2K32A 1TY2A 4R3DA 1IHZA 1NVID 2L52A 4G7HC 1XYIA 4RKLA 1B50A 3DHQA 4EE2A 3PV0A 2J0TD 4K8JA 1PRTD 4KJNA 1LTBD 1WWTA 1J7CA 3EVQA 2BTEA 1SJED 4DF7A 1SJHD 4OGQC 3E0JA 1ET6A 1KABA 1P7EA 4B9XA 2NBFA 1K83B 1FD7D 2CW0C 3VR6A 1WVLA 1PDXA 2IW3A 1JC7A 3OPOA 2WDRB 5ELCA 1NCVA 1JR0D 4RHSA 5FO8B 1EOTA 3C3LA 1F2ZA 2A73B 3M7NA 1MVKA 2BA0A 2D62A 2AWOA 2VB3X 4R8IA 4WFN3 2LS01 1ZDVA 3OSOA 2WXMA 3GTJB 2JA5B 4KX6B 3QIAA 1I4QA 2F3WA 2F0PA 3NVZA 1T5XD 1JQYD 3R8BA 1EWCA 3D4WA 2K9XA 2B39A 2V0GA 3DWAA 2KOLA 4H2AA 2F0NA 5HGTA 2L1AA 3U52E 5A2QL 1PTOF 1UUPA 2K5WA 2DNCA 4LAAA 1LLRD 1QB5D 3NE5B 5JVG3 3AE2B 4IFDH 4D2KA 2F0FA 1RODA 5FO9B 2D5GA 2RVLA 5JEAJ 2ZXOA 4KKSA 2KHSA 1OFFA 3CHBD 2Z4IA 1F77A 4RGMA 4FXGC 1JMLA 3FEWX 2DNEA 4PMCA 1HTPA 5CBAE 4FNFA 3AE6B 2DYOA 2NN6I 3AE7B 1PRTF 4LJZC 2NVTB 3PO2B 1VZ8A 1EFID 3IKJA 3WOEA 3A8JE 4C3IB 1FGBD 1TS4A 1B3AA 1EU4A 2N0SB 2ICEC 2MGSA 3SFDB 1SYFA 3PUVA 2NVXB 1RTNA 1YN5A 5JAVA 1QOHA 3Q23A 1GPXA 4DK1A 1ESRA 2F0KA 2CJNA 4HR7B 3TN2A 3P7JA 4US8A 4G4KA 5FOBB 1WTQA 1PXUA 4YTMB 2JYOA 1IKMA 3H6MA 4DA2A 1F2YA 4KI0A 3J80E 4HTHA 1F9RA 1B9MA 1G6ZA 5KGUA 2IGHA 1Y1WB 1EL0A 3TSSA 1S5FD 1QILA 1XLPA 2QF7A 4WURA 1FCCC 5EPLA 4XE0A 4H0LC 3P4QB 2PPBC 2BB5A 4MHEA 2BYTA 1CA6A 4QCLA 4XWWA 3IFDA 2VB2X 1I4PA 2PW9A 1CFMA 1OO9B 2A68D 4UAIA 1HPCA 4XIGS 1SYCA 1YNNC 2XNAC 4F88A 5EE1A 1L0YB 3FRPB 1B53A 5E3FA 4XQQA 4LLGM 4KY5A 4A6QA 1C48A 1J7AA 2D9UA 1DZ1A 1ML0D 5J1ZA 1EU3A 1WTPA 2E76C 3VR3A 1V1PB 4BBSB 1EZ8A 2A69D 2B2VC 3FKIB 1RWSA 2RDHA 1NSNS 3NS1A 2EZVA 4LK0M 4F87A 3NUHB 5C3WA 5D14A 4XT3B 1QWYA 1IGDA 5BN5A 1HZ5A 1C76A 3NTHA 5K5PA 1Z47A 2A6HC 2PVGC 2WU2B 4KJOA 5FLXL 1TWCB 2WV6D 4K8IA 4FO2A 4DXFA 1BUVT 4L2YA 1D5MC 5C0XJ 3HRZC 4L6TB 1PGBA 2Q8RE 5C3XA 1Q1BA 1Q8IA 2A74C 2XSCA 1UEAB 2JX5A 3AEGB 5T1IA 3L4PA 3IT4B 1TR5A 2WXLA 1DOXA 4K5WA 3AE4B 3S14B 3FPUB 4H44C 4GZYC 5JOBA 1U4LA 5AFWA 1ILQA 2EY6A 4FF4A 1WTXA 3V96A 2ZW1A 3W2DA 5C44B 2SDFA 1FR3A 2TSSA 2NTTA 1K8OA 1BO0A 2NVYB 4X3TA 3R3OA 4REZA 3A8KE 2VZKB 3ETRA 2WP8J 3DMUA 3DEPA 3MHZA 4IALA 3W3AA 5ELBA 3D4DA 1R4QB 4R9WA 4H13C 5C0XI 1FRDA 4A55A 1BCPB 1WTOA 2X69A 4HKZE 2KWDA 1E2WA 3BDCA 5C4XB 1RM6C 4IN3A 3E6ZX 2L0CA 1YNTE 4RF1A 2XWBB 5E4WC 1AP0A 2NN6G 2BS2B 5J22A 2RMMA 2WXKA 4QUCA 1BQQT 1IYUA 1E7PB 1IL8A 3HS0C 3IAM1 2E2JB 3HOWB 3RZDB 2L55A 4ZHPA 3TZDA 3WDNA 2JZPA 3P42A 4UDUC 3ZGZA 3A7LA 2K5PA 1RFKA 1RD9D 1SF0A 2ZT9C 1HCZA 3S15B 2RPVA 2A6ED 1LV9A 1N62A 5COYA 2F1MA 5HURA 4C2MB 4C3JG 2SNSA 1ZYRD 4L63B 5BMGA 3RPFC 1A6XA 1UWMA 3D6CA 3PIP3 1WD1A 4F8MA 3NQTA 4C56C 3U7ZA 1SSNA 2PW5A 3NBIA 1JW9D 3MP9A 2EE1A 2PNRC 1GJXA 1T5EA 1VDZA 2PZWA 1CZPA 1TQOA 2E2IB 3QJYA 2M19A 1CM9A 3RD4A 4XXEA 1ONLA 3GTKB 2WNMA 1L5PA 4J1MA 5IT9L 2F3VA 2VUMB 1XXGA 2K05A 3TEWA 2N88A 4CKEA 3GTPB 2NMQA 4TSSA 3I72A 3H09A 5CBEE 1SNPA 4X3KA 4A3GB 3D6WA 1MHHE 1NENB 2IDYA 4YSYB 2K28A 2EJGC 4S3SA 5EBDA 3AE3B 3O13A 3CU7A 2L5TA 3EROA 3MFYA 1FNUA 2J42A 4GLSC 4OZAA 2NTSA 5M5XB 3IXSA 2SNMA 2LFIA 1OQRA 4DAVA 1SSOA 3AE8B 3UI2A 2IGDA 2LFNA 1SNCA 1TZOA 3S1NB 1RJTA 5C4ZA 2WXQA 4WH4A 1DCZA 4A3MB 3ABVB 3I90A 4B0MA 1JWBD 1A3UA 2WDVB 4DNTB 3RFZB 3V05A 2YEPB 3BYYB 4DAPA 3B9JA 4FVMA 1RKNA 1T6BX 2V3PA 2Q8TA 3V2TA 4EVOA 4RH6A 4ZUJA 4HAEA 3FVQA 3TEXA 2K04A 1F2LA 5D3DA 3Q24A 3U9SA 3J81E 3GQBA 1B9NA 4IDIA 5JJZA 3VR4A 1ZXTA 4OL7A 2A5HA 5BMHA 4RA8A 1PUTA 2H88B 3F2UA 3NWSA 3GV3A 1AN8A 3MC0B 3PZ7A 2BDNA 5G3LD 3W5VB 3PUXA 1JE4A 4BY1B 2ZXPA 4ILWA 2OEOA 2YYZA 2FJ2A 5CYUA 1Y56A 3U2SC 4BWGB 2M9VA 1O7LA 4RGOS 3TEYA 3TP7A 5IGCA 4WJWA 1DOYA 3Q6SA 2IGGA 1G8ZD 3IAYA 5HFYA 2B8GA 2K6AA 3HEJA 4M8AA 4BA2I 4G57A 3ITPA 1B1ZA 2EXZA 1MI0A 1FNVA 3J9CA 4OZCA 3W5UB 1TVXA 1R9TB 3BK1A 5C2TB 3M4YA 2KVMA 2EDGA 1BOSA 2KCCA 2BE5C 5EKIA 2BBCA 3BWUD 1QOAA 2Z8LA 1STYA 2LKVA 5LL6X 2L83A 1H9MA 5I9OA 3N6RA 5LL6S 3NQIA 2TMPA 4N6EB 3IL8A 4OW0A 3AB9A 4RGTA 4C3JB 3S17B 1YN4A 4C3IG 4MT5A 1EEID 1ZXHA 1D5ZC 1ZEQX 3CRKC 1N5XA 3C8YA 1F0ZA 2NYZD 3FAHA 4NW2A 5M3MB 1IGCA 3IT6B 4RAUC 3I70A 4RKBA 4NZLB 2WB1B 1WSPA 1SYDA 2YU9B 5LNK1 3KLRA 5T1GA 5I9PA 3T3OA 1DONA 4L23A 3PUYA 3DWPA 1TT2A 1AZQA 3OOCA 2QCPX 3FPPA 3ZJTA 1NR4A 4KKIA 3PZ8A 2B2TA 4AS1A 4N9PA 5CV5A 2IX1A 2Z1CA 1JOKA 2PTLA 4ME5A 4C3HG 1CK1A 5ELDA 1UWXA 3P4RB 5EE0A 1ESFA 1SNDA 1AW7A 3NXWA 4XQJA 2WINB 1EY9A 3RZOB 5JPMC 2L9HA 1VF7A 3AH7A 3K58A 1XLQA 4OZBA 3OIPA 1E2ZA 2K5QA 3DWQA 1CQFA 4ZOHC 1CTMA 3NUCA 1SE2A 1SYBA 2JE6I 1C8CA 4FYDA 3HVDA 1BCPD 4V0BA 1Y8OB 4FF3A 1N61A 4N58A 1EIHA 1MBYA 2WXGA 3OWEB 4RNAA 2XN9C 1XWEA 1V8QA 1H9KA 3KF8A 2E2HB 4MACA 1VR9A 4P16A 1MHXA 2ZW0A 3AEFB 5M5WB 4H7BA 2KAJA 5DNFA 1L4DB 4USAA 1FCLA 1CQVA 2R61A 3KLSA 1LT3D 4A3KB 1W6KA 4B0EA 4HMJA 4O42A 3TZUA 3VQIA 4A3DB 2DY8A 3TP8A 2M0AA 4B08A 3G7LA 3NHHA 1LTID 1HXYD 2B2UA 1TKEA 1TWAB 2DYMA 3AE5B 1WD0A 1LTTD 2SAKA 1I6HB 1TWHB 3P4SB 3I4MB 4LMQD 4WRDA 3VR9B 4A93B 2MH7A 2F0IA 3SVMA 4A8XC 5H8YE 1JROA 4XTCS 2BDOA 1PDQA 2F0HA 2WP9B 3KWVA 1Q3LA 1Y8PB 1PTOH 3K5OA 4WQMA 1OQQA 1B4OA 4MM3B 4IFDG 4WWMA 3HOXB 2K3UA 2Y5PA 1GHJA 5TSSA 3SEBA 1GUSA 1II3A 5KIXA 1A15A 1I4RA 1STAA 4KD4A 1I4XA 4ABNA 1GB1A 2WKCA 2L11A 5JVH3 3NVYA 4JBWA 3DWMA 2PZTA 3PIO3 1PFBA 3I4LA 1PFDA 3FMCA 3HRDD 5I2YA 1LT5D 5EGTA 1Y8NB 4J3OD 1BDOA 1BCPF 3CIRB 1P7FA 3IFTA 3S16B 1Y1VB 4U68A 5FKAC 2JA8B 2BA1A 3MXPA 2GRIA 1F9QA 3T16A 1C77A 1YNJD 2DLBA 5D7GA 3BIID 2EYLA 3MA2B 4J6HA 3K6OA 2ON8A 2Q8IB 5BN3A 1OXUA 3L7ZC 2F0SA 4PMBA 3AN1A 4RCNA 3DUZA 1C4QA 4KN4C 1ENFA 4LK1C 2G9HD 3HOUB 3M85A 3BYTB 2BB6A 4HEDA 2KA7A 4C3HB 5HG2A 1QNUA 2HTME 1FXAA 2W55A 4KK7A 3HUIA 2PW7A 1QT9A 4U673 5C4HA 4JWUC 1STHA 1C4CA 4ODGA 1SMYD 4N9TA 2K01A 1YJIA 1TU2B 2WXOA 2M00A 3JAME 1KDCA 2F0EA 2PYKA 3A8IE 1IBXA 4XQNA 5G5GA 5EKKA 4PQXA 2FINB 1TIID 2OT2A 2WXJA 1XX8A 1DOKA 4IUVA 2NVQB 3EFXD 1DOLA 1K53A 1IW7D 1G291 3Q0AA 2I07B 3WCQA 1NR2A 1PGAA 2B8FA 2VNUD 4K5XA 2ICIA 3DWGC 2W82A 2WS3B 4ZYSA 2MUYA 1S5CD 1KH0A 3VRBB 2EJFC 3D8GA 4C1NI 1ZDXA 2N9LA 2F0JA 1S5DD 5IGBA 1NUCA 4C1NK 2JWUA 1JWUD 4DU9A 3T13A 3I8ZA 5M3FB 4X3UA 4IKGA 4CQNA 2BW2A 1BMLC 1J8IA 3B2FA 1I7HA 3AEEB 3Q8EA 4US9A 2PVOD 4QB4A 4XYQA 3MZ5A 2KEDA 1YQ4B 3FDTA 4ITKA 5EKLA 4CGYB 2IX3A 1ZE3D 2B2TC 5F2DA 4G7OC 3BG3A 2G9DA 1G2TA 1YQ3B 3VR8B 2EYFA 2JQRB 4RF0A 2YEPF 3DXJC 3HP3A 5CV8A 3EJIA 4ZK9B 5DM63 4XT1B 3K5MA 3SK5A 1JB3A 1FMAD 1BBXC 1PTOB 2QMTA 1ZKOA 2Y5CA 3QWNA 2V4DA 5IIFA 3M4OB 4K5VA 4L1BA 5IGFA 4M1UB 4XDCA 2EYMA 1EY0A 4OO1H 1PTOC 3K5NA 1ACCA 1YJJA 5C3EB 3V3XA 3GTQB 2OF1A 2ZXRA 4IUPA 5K36H 4K14A 1GHKA 2EYHA 2K33A 5M9OA 3QB3A 4G7ZC 2GB1A 1I4HA 1BUIC 1KFYB 4JWSC 1Q90A 2JEBI 2IWHA 2F0UA 2WXRA 4CKCA 1VCIA 1H9SA 1XF5L 3KBGA 5BN4A 1HA6A 1KDAA 5BYSA 2HDLA 2CW0D 1OXXK 3URYA 1QCBD 1JOOA 1KLGD 3OMCA 1UAPA 1PRTC 4IUNA 1R7SA 3W9CB 2LHEA 2K1BA 4KGRA 4DFAA 5CMDA 3OMGA 1FEHA 2QILA 2WXHA 3AMUA 3ND8A 3S9WA 2B2UC 4A90A 2JA7B 1HUMA 4A9AA 3P75A 5IOCA 5HHDG 1SXTA 2AQ2B 1EWYC 2ACZB 3VYRA 1TKGA 1FM0D 2J52A 1EYCA 3HZXA 3VR2A 2JXMB 1HA5A 4BBRB 4QF4A 1PLFA 1CZWA 2X6LA 1EY5A 2J4XA 4OIJA 1VF5C 5ELEA 3H91A 1E0BA 3C46A 2KQ4X 1QE6A 5JEAH 2N55A 1PZKD 3VYUA 5IGEA 1TY0A 1GUGA 5I6WA 3NVWA 1F2RC 5ELFA 1SFOB 4HCSA 3T4AC 1SYEA 3CKIB 3MXNA 4C80A 5KNDA 1HHVA 1L0VB 3S1QB 1D6EC 3SFEB 2W3RA 2AUJD 1TJEA 1KNAA 3OW7A 2KMMA 2AQ1B 1WRIA 1VLBA 3T56B 3J80L 4IUQA 2PZUA 2WXFA 1WTVA 3W1SA 1ZOYB 4JPSA 2FBWB 3DEOA 4KGSA 2I46A 2KCNA 4IFDJ 5A2QE 4DK0A 5EE3A 1EZ6A 5I6YA 1AEXA 1K50A 4YT0B 1L0XB 5CC4A 3T3NA 2O4XA 1BNZA 2X6GA 2R3ZA 2JSVX 2WXNA 2F0MA 4RGNA 4A3BB 1NEKB 2L4NA 1WTWA 3ZQ4A 3JAML 2C5CA 2IT1A 2FUG1 1ENAA 1YN3A 2F0DA 2V4IB 3PMFA 4P6VF 4XWTA 2EPBA 2QJLA 3C1FA 3QO2A 5G5HA 2KACA 2I2YA 1EY7A 1LACA 5IGDA 4R8NA 2EVBA 1Q12A 4O1NA 3H3VC 4FF2A 3E9SA 1HFNA 4IFDI 5J39A 1QLBB 1GUNA 1TS5A 1F9PA 2WKDA 2B2WC 3I9V1 1CT1D 2PO4A 2R93B 5MPOA 1CHPD 4I7ZC 1A3TA 3HOYB 1SMYC 1EEFD 2A68C 5BMIA 2R6GA 1AYFA 1TWFB 3OWFA 1HEZE 1LTRD 4YSXB 2KJXA 4DNRB 1ROEA 1SE4A 3S1MB 5CGKA 1RF2D 4MN3A 2OEDA 1MD2D 3T53B 4WIPA 5KEEA 1GUTA 1B44D 4QMGA 3K57A 5C0XH 2K5DA 3EQLC 4TRDA 4PV1C 4YXDB 4X3SA 2VXWA 1Q10A 5D3IB 2A69C 4B9WA 3A55A 2ONQA 3EUB2 4HJGE 3GTMB 1LO5D 5KYIA 3ZJVA 2WACA 2XIWA 2WXPA 2HCCA 4V190 1H9RA 2WAQB 3T51B 2AUKA 2IPKD 2AQ3B 2FMCA 3PO0A 1C9FA 1CZGA 3J7AF 4KKUA 4FP5D 1LTGD 5A35A 2WDQB 3SR1A 1IYVA 4CKBA 3S2HB 5AUIA 1DD2A 1WGKA 3E56A 1V1PA 5CR3A 1N63A 2FFKB 3MEHA 2GI9A 1I50B 2RSOA 4YIJA 1GUWA 2D2CC 3CQZB 5KRUA 2K0PA 2E3TA 1LTSD 3NVVA 1H9SB 4RFBA 1M8AA 2SOBA 2R7ZB 4KMUC 1K52A 3QOJA 3AEDB 1SB3C 2KN4A 4KN7C 2HDEA 5FLXE 2F03A 1QJOA 1KF6B 4FXKC 4P2CB 2EYJA 3TP6A 2IL8A 1RHPA 3MXGA 5JPNC 1STEA 1DXMA 1DYQA 4IZ8A 1DOIA 3Q22A 2M2LA 4PNYA 1I4GA 2VZKD 1SNQA 3VA7A 2W54A 3SE0A 5JXVA 2MJDA 1YMHE 5NUCA 4HSPA 1PMRA 3HG9A 1JICA 4ID6A 1VMPA 1KDBA 1QKZA 4FXDA 4ZRQA 4AQ7A 1CI3M 1Q1EA 3NP8A 1XEEA 4KY7A 3Q69A 4FXCA 2EYPA 1ZP0B 1F9SA 1X3QA 4RWSC 2LGIA 3I57A 4ZHOA 4HMIA 1SBBB 3LWUA 4NKLA 3J7YW 4XDXA 4CJ1B 4BA1I 3D3RA 2XRSD 4Q0FA 2OXPA 3SK8A 5AUKA 5I2XA 1FIQA 4NP5A 1FRRA 2DN8A 2DY7A 3A54A 1L6VA 4LTUA 3I91A 4K6DA 2CVRA 4C7YA 1FXIA 3P20A 1I6VC 1V97A 3Q8BA 2JYTA 3GD7A 2BOSA 3TMEA 1VZ6A 1A3VA 4K6LA 4GDLB 1AWDA 1TWGB 2XVSA 2PQEA 4AYBB 2Q5WD 1L4ZB 3Q8AA 1HUNA 1STNA 2LMCA 3P63A 1DGJA 1PZID 4NMZA 1ZUD2 3P1HA 2B76B 1GAQB 2C9OA 2V3NA 2A6EC 1PYWD 1A2TA 3U4EG 3EA6A 2PIAA 5KNBA 1LT6D 3AEAB 4IUUA 3GP7A 3LXFA 1SNMA 1ZYRC 3KLSX 1FO4A 1Y69U 4OO1I 1BR9A 3NK9A 4N59A 4KKJA 2F0VA 3AU7A 2EYOA 1WYGA 4NJCA 3SHLA 3X3NA 3BDLA 2PKOA 2DWQA 1LABA 5CV4A 2K22A 1KLUD 2CHBD 2RSNA 1EWHA 5FK9C 5M5YB 1FNWA 2J53A 1AFPA 3GV6A 4KY6A 2M56B 2RDGA 4EQNA 2RDFA 2RQXA 4QIWB 3AE1B 2JU6X 1WTRA 1VJKA 4M0WA 4TKOB 1F2MA 1S5BD 3D4RA 1I3QB 2F0GA 2NB0A 2XRQD 2L1BA 1KTKA 3R93A 4ZRPA 5FR3A 2L12A 4J8QA 3J81L 1IKLA 4HRSA 3BK2A 1B9RA 3PO3B 2CQAA 3RLFA 3N52A 4Q2JA 1EYAA 1QG7A 1RDPD 1JORA 3D31A 5IT9E 1C78A 5I4DA 1HZ6A 2KDMA 4OIKA 2MPMA 1JCKB 3ONAB 2ENBA 4IQZA 3MAQA 2XWJB 3P1MA 3KK7A 1E9MA 3MXUA 3NWTA 2LHDA 3MJ5A 3AM9A 1O7ZA 3AMZA 2HUGA 4KKTA 2FE8A 2EY1A 4ZUIA 2B2YA 3LNNA 4CHTB 5KYLA 2INPE 2KEEA 1N60A 2NZ1D 5C3JB 3CRLC 3NSWA 2WLBA 4HSVA 2PLPA 2RA4A 3HOVB 1V1OA 1TYGB 3TDQA 3P4PB 3K59A 3R2TA 2WQYB 3SR6A 1RCVD 4Q5VA 3FILA 1UNSA 2QDBA 3E5SA 3NTKA 3AEBB 3BVZA 3C2PA 2Z4HA 1SAPA 3GTOB 2QSDA 4MH8A 2INNE 1G91A 5H92C 3BZDB 4XYOA 1XCTL 4CBVA 2O5IC 4DN4M 3H0GB 1SIJA 2BS3B 1W6JA 3SXHA 1JWSD 3K5LA 3X3MA 1M4VA 4TMAB 2B2WA 2LEKA 2KUMA 5CV9A 1D5XC 2B63B