3TSSA

Toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
b'NIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRIKKSQHTSEGTWIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFKIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 63
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tssA01
3R2IA 1PZID 2TSSA 1PTOC 1JCKB 1PTOF 1YN5A 5I4DA 1LTAD 3BZDB 1S5CD 2R61A 2NTSA 1EFID 4C56C 1FGBD 1PRTD 1B1ZA 1I4PA 1PYWD 1RF2D 1QILA 3BVZA 2J4XA 1L0XB 4RGMA 4RGTA 1EWCA 1G8ZD 1PZKD 1SXTA 1YN3A 1V1PB 1DYQA 1LT3D 2NTTA 5D3DA 1FNUA 1EEFD 1S5BD 2G9HD 1S5FD 4L63B 4BWGB 1TS2A 4DXFA 1HTLD 4O1NA 4NZLB 1XXGA 1BCPD 1LTGD 2IJ0A 5FKAC 3BYTB 1SE3A 2XN9C 1ET9A 1S5ED 1SE2A 4Z9CB 4RGNA 1PRTB 3TSSA 3EA6A 1LLRD 1UNSA 5ELCA 1SJHD 4UDUC 1LT5D 1HQRD 4OHJA 1PRTC 1PRTF 1SBBB 5D3IB 1STEA 1D5MC 2QEJC 2AQ3B 3R8BA 1S5DD 3MFGA 5ELBA 1AW7A 1LTTD 1KLGD 1FNVA 1MD2D 1ENFA 2AQ2B 3DWAA 4L6TB 4RH6A 2AQ1B 1D5ZC 1TS5A 4K6LA 1L0YB 1FNWA 3R2TA 1M4VA 4RHRA 1V1PA 1JWMD 1B44D 1D6EC 1TY0A 4RHSA 2XRQD 2WV6D 1TS3A 4DXGA 1JQYD 2Z8LA 1SEBD 4TSSA 3CHBD 3MC0B 5ELEA 5ELFA 4RGOS 3BYYB 3GP7A 1CK1A 1DJRD 2RDGA 3DWPA 1BXTA 1I4GA 5ELDA 3BVMA 3URYA 1LTBD 1LO5D 1D5XC 1I4HA 3DWQA 2RDHA 1LT6D 1LTID 1KLUD 1ET6A 1TY2A 2XRSD 1BCPB 1PTOD 5TSSA 1HA5A 1LT4D 1KTKA 3SEBA 1YN4A 1I4RA 1HXYD 3O13A 1ESFA 2IPKD 2O2LD 1AN8A 1BCPC 1BCPF 2ICIA 3BVGA 1EU3A 1JWUD 1CHQD 1CHPD 1EU4A 1EEID 3OWEB 5FK9C 3KLSX 1PZJD 1CT1D 1FD7D 1LTSD 1PTOH 1T5XD 2CHBD 1I4XA 1JWSD 1CQVA 1LTRD 1XTCD 1F77A 1GOZA 1SJED 1RDPD 4RFBA 3V05A 3EFXD 2XNAC 1UUPA 1PTOB 2QILA 1TS4A 1V1OA 2SEBD 4ZYSA 1I4QA 1RCVD 3W2DA 1RD9D 1SE4A 4RCOA 1JR0D
chains in the Genus database with same CATH superfamily
3CCEA 3QAQA 1NI2A 1TGZB 1R4NB 2NYZD 1WGHA 3CQZH 1N61A 3L2PA 3H0GB 5EPKA 5JEAG 1SYCA 2V3SA 4WJQA 2OCEA 1SNMA 2CFMA 5AJ3Q 4AWJA 1TWCH 4IFDI 5KHQA 3CU7A 4IFDH 4RGTA 4DK6C 1PH1A 2JXXA 2CJOA 1PA6A 3PRZA 1F52A 4B95A 2L1BA 4K6DA 3DBLB 4JI2Q 5AZHA 4DDGD 1JICA 4YCUA 1JRUA 1ZXIA 2AX5A 1FCCC 2EYLA 4C2MH 2AMCB 1TS2A 2DY8A 4A3CG 2JX5A 5GROA 3FILB 1YBYA 5C4ZA 3QO2A 1B9NA 4L5QA 1SB3C 1N62A 2MP2B 1WI0A 2L32A 4L23A 2ALYB 3EGRA 2KAJA 3ZTDA 1DOIA 2VUMB 5LLIA 4ANXA 1VQPA 4DR3Q 3R3OA 2Y5CA 4K81A 4GDKA 3DPDA 4IO9A 4A93H 1QOHA 2WINB 1DONA 2NR2A 4LNKA 3G48A 4YTPB 3C3LA 1M8AA 2MSED 4W9CA 2CU3A 2DENB 4X3TA 2BGFA 2QEJC 1V9PA 2EY6A 1IL8A 1XCQL 2GI9A 4WJNA 3F2BA 3S2DB 1MD2D 2Y0SB 4IN3A 2JA5H 3HRZC 4ZDVA 2L83A 2D62A 5C44G 1XD3B 1CJEA 1PMRA 4R3DA 4R4CA 3EECA 1WGKA 1SMYC 4KV6A 3GTPB 4EVOA 4BZAA 5DPWA 3A5UA 1UE5A 4UAIA 4JI3L 4R4OA 4JW0A 3F2DA 3GTQB 4IDIA 2F4VQ 1TIFA 1V8QA 2JA6G 3JAME 3VVWB 3A9JA 2KTRA 1I94Q 2A5UA 3STBC 1VS0A 1SEBD 2EY5A 4H2AA 3ZJVA 1N63A 4B3MQ 4TSSA 3CHBD 3D3RA 3KLSA 5ELEA 4OWXB 1R4MB 5E3FA 1F2LA 4DR6Q 1E10A 5KHOA 1A70A 1QUQA 3GP7A 1OXXK 3DVGX 4TVAB 3PO3H 1Y8NB 3DM1A 1WVLA 1EL0A 2K52A 4GLVB 3GTOB 5IGGA 3KJPA 4JBWA 2KDMA 2KCNA 2LUEA 3LDZE 2G4DB 1LT6D 3GO5A 3A7AB 4YCWA 1WRIA 3RMKC 3KF8A 1OTCA 5IGFA 1HUMA 2FCMA 3VH4B 4KI0A 3UQBA 5IKCM 4WRDA 1ESFA 2BKRB 1I35A 1N60A 1Y1VH 4DUYQ 3T1HL 5IT9c 1EFWA 1XPOA 5EKKA 3C46A 2MJ3A 2RD0A 4TV3A 3B9JA 1T6BX 2K25A 3NWTA 2NBWB 3P4PB 2G9DA 1C4PA 3S15B 1CT1D 2YEPF 2NBVB 1PHJA 1WMHA 4FBJB 1I3QB 1JJ2A 2SDFA 2HUGA 4K7UA 1MG4A 2YU9B 4REZA 1FCLA 1VQ7A 4JI1L 2MJ8A 2L9HA 4BKTA 4PK1A 4WJOA 4K8IA 3FKYA 1WTHA 2JA7G 2SEBD 1P0RA 3AEDB 2VZAA 1VQ5A 4U68A 3MHSD 4WWNA 4DV6L 2Y0SE 1SE4A 2P5ZX 1RYJA 3NTHA 2KDIA 3DBSA 4DWFA 1B9RA 3P42A 4ZRQA 1FFUA 3S1QB 1PTOF 2A69D 2NCNA 4HJKA 4DKAC 4DV0Q 4TQ1A 3GD7A 5C44B 1FGBD 4A3GB 1PRTD 3Q3OC 1L2FA 3OIQA 4G50A 4PZ8A 4Y7NH 4A3OA 1WR1A 4NJ6A 3C1FA 3S1MH 5IOCA 4NXMQ 5C6AA 1RTNA 3SD5A 5FR6A 3DBRI 3RZDH 2A68D 2JA6B 4X66Q 1K0SA 4WJWA 4JV5Q 2L5TA 5KRUA 5C1ZA 2AKWB 1E7VA 1X32A 4MM3A 2GBNA 1QQRA 4FA6A 2WAQG 1TKGA 2F3IA 1SYFA 4GLAC 1ZDXA 4O42A 2CR5A 4YSYB 1XXGA 4OELB 3KH0A 2MO1A 5IP7G 2FUHB 4MGYE 1TKWB 1A6XA 3J80E 2PVOD 4MELA 5D65A 1PYSB 2ZJPA 4EQOA 1N36Q 1FJGL 2E6XA 1SRUA 1LV9A 4RGNA 1L0VB 3EA6A 1SGHA 2CU1A 1EWHA 1BR9A 3ZTCA 2UXBL 3A8JE 3GE8C 4DR4L 1FIQA 1V81A 2LD9A 2R92G 1JJCB 2KDBA 1PFDA 4HPLB 3ZNGC 3W1SC 3PVLA 4XT3B 1D8LA 4GKJQ 2CH4W 3CF6E 2ASQA 1HZ6A 1D5ZC 3A9KB 2KBNA 1MPEA 3DHIC 2RHSB 5IY0A 4DNTB 4B3RQ 5HHDG 3DLLA 3E56A 3T3NA 2IYDB 1B44D 3MHBA 5I2XA 5IYBG 5J22A 2EYJA 1PH4A 1KQSA 4FJZA 1TS3A 1IYVA 2B2UA 1X3GA 2N7DA 1WXSA 2JWZA 4IWOA 3C1EA 4CJ0B 4WJ4A 4A4IA 4KN7C 4GOCA 1KNEA 4URKA 1TWHB 1J8CA 3S14B 3M3YH 2KMMA 4JIOU 2I0QA 5J18A 4HTHA 2EYFA 3BDOA 2JYEA 1CMXB 3R3MA 2R2OA 2WDTB 3GTPH 2R7ZG 1EQRA 1P3QU 3S9WA 2K50A 4KKUA 3SFDB 1YJNA 4MT5A 3P1MA 4IG7B 2KWCA 4A3IB 1J19A 1PGXA 2B2WC 3S16H 1X54A 5LNK1 4KX6B 1E0BA 1A15A 3VA7A 1CA6A 4FXDA 2PEAA 3B2GA 1HXYD 4ICUA 3Q8CA 5C4XH 2O2LD 2Q8RE 2NVYB 2IGGA 4TQUS 2WFWA 4I6LB 1X6OA 5JVH3 1KXLA 1MI0A 4ZRIA 2KK8A 1EM7A 1WM2A 1V80A 2IO1B 3JW0X 1PZJD 3TN2A 4WJ3M 2R2QA 1E8YA 4M00A 1SMYD 1L5PA 2K3UA 4TRDA 3EFXD 1K50A 4AP4C 1IKMA 3PGEA 4DK1A 3VR3A 1MVKA 2KUMA 4PMCA 3OSOA 1IBLL 1SR3A 4HMJA 5FJ8G 3GZNI 1EYAA 1NR4A 3I91A 2HDMA 1J9OA 1KDAA 2A73B 2R92B 2V4DA 1TZOA 2UUBL 2VRRB 2K1FA 5C0XG 4HEA1 1WFYA 2E5LL 3LGJA 3PRPB 4KJNA 4ABNA 1X55A 3A8KE 3RZOB 3NY5A 4GN1A 3KVFB 4HIKA 3H6MA 2BH2A 1V2YA 3KWLA 1P8LA 3LX0A 5EKIA 1N33L 3SE0A 4I65A 4DV1Q 3ONAB 3MJ5A 5LL6X 4YL8A 4JVZA 5HKHA 1Q7YC 3VAWA 1PYBA 1OQRA 2N9LA 1FR3A 2FMMA 1E9MA 2MBQA 2QCPX 5D3DA 4KZ0A 4PZ6A 1FNUA 4POGA 2MBEA 2HCCA 2UXDQ 1WX9A 2SOBA 4F1SA 3T9LA 2KX3A 5AJ3L 3RNUA 3Q24A 2NS5A 3E9SA 1MHWC 1LTGD 1STBA 4KHPQ 3GTGB 3MHZA 3BZCA 5M5XB 3HG9A 3U50C 3K6OA 4G57A 1G2TA 4WWOA 2O2VA 2R7ZB 1H95A 2RA4A 3ABVB 3Q6SA 4A75A 1HTQA 1DOLA 3ZYYX 4GOPC 1R9TB 2WB1G 4HCSA 4IFDJ 1X3PA 1IPGA 4E71A 2KJHB 5AUIA 2GLSA 4U673 4P73A 2Z1CA 5EJWA 5FO8B 3D4WA 2MGSA 2EKEC 2PTLA 3QR8A 4B3TQ 1C4QA 1RHPA 3DBHB 4A3KG 3ND9A 4DR3L 1VQDA 2RPQA 3VYTA 3PLVA 2PNRC 1B7YB 4OVUA 1MJCA 1FMAD 4KKJA 3N30A 1SDFA 1I6HH 1HR0Q 2WIIB 2PCFB 4C1NK 5IODA 3ZIMA 2KXJA 1WR6E 3VUXA 3ZNHB 1P98A 1QLBB 4QY7A 4XYQA 4R4IA 1TJEA 2GBJA 4CDEC 3AB5A 1KRHA 1OEYJ 3N1ZC 4IPHA 2O4XA 2N78A 3M4QA 3A33B 5HGTA 2VNUD 3A74A 3Q23A 2F4VL 1QOGA 4HIDA 2LJ5A 4LF4Q 3P4SB 1I94L 5LL6S 4XYCA 4A55A 2I1KA 2OEDA 2MJDA 4B3ML 4POFA 2JN4A 2BKFA 2HCIA 1L6UA 3MEFA 4DR6L 2PW7A 1VQHA 2QC8A 2DZKA 2Q8TA 2A6HC 2O5IC 1K3RA 3Q8DA 2RQXA 4E74A 1H9SB 3CRKC 2JA7H 2ZVNA 1VQ9A 1ICFB 1I50H 4LFCQ 5BR8Q 4AYBG 4OL7A 3AE5B 4HJ8A 4WURA 5T8IA 1K73C 3A7LA 1UGMA 4AQ7A 1D2BA 3KUDB 5CV7A 4UP8A 4ZQ3A 5IWAQ 2E2IB 1EZ8A 1ZPSA 5G5HA 2RGFA 3EQLC 4FHKA 4HSPA 5JJIA 1HPCA 4O0AA 4DUYL 2M9VA 2OJWA 2GN5A 3PREA 4IOIE 2EJFC 3LJ3A 3HUIA 2WLBA 2M19A 2IX1A 2CHZA 3PSIA 1PH3A 3ZLZA 1H4RA 3UDFA 3AMUA 2WXGA 3Q8EA 4LNNA 1L1OC 1HQMC 2JJQA 4GNXA 3MXPA 4LF9Q 2F0MA 4QQBX 2LGIA 3AEBB 3MWYW 1H9JA 4CKBA 1DGSA 4A3KB 4FHJA 5AEKB 4YWLA 1Z9FA 3W3AA 1B4OA 2DAJA 4X3SA 3EFCA 2J4XA 5GAEC 2D07B 2PPHA 2E2HH 3MC8A 5C3EG 2RVLA 4BAXA 1EY6A 3I4MH 1JC7A 3T51B 1YN3A 4DV0L 2PZWA 1N5XA 2R92H 5DCNA 4CKEA 1B70B 3UINB 1TT2A 2JZPA 2BVCA 1WY8A 4FO2A 2BE5C 4F8MA 4ZLTF 1BNZA 2R7FA 4TMAB 1LQBA 2RSOA 4X66L 5M5YH 1XLPA 4P16A 1S5ED 3CIRB 1YX6B 4G0NB 4JV5L 1HZAA 1STYA 4C3HH 1ZDVA 4WJPA 3SHLA 5D14A 4RCNA 2LMCA 5IYBH 3H3VC 1NBFC 4CBVA 4MJSB 2OHFA 3M4YA 4LAAA 1HH2P 2CHWA 3L0OA 1CSQA 1STEA 5JPMC 2LSSA 1N36L 1WJNA 4ZRKA 1J8IA 2NPTB 4PS3A 3ZDMC 1AWDA 3AI5A 3PUZA 4MSQB 4NB3A 2AQ1B 4KGSA 4AYBB 3TCAA 2QCZA 2L3ZA 4DK0A 1M4VA 3DUZA 1KH0A 1P7EA 2BS4B 5IA7A 5CR3A 4X57B 1D6EC 1E3PA 1F9SA 2V3PA 2HT1A 3H94A 2C7HA 1JB7A 1R9TH 2XIWA 4KTAA 4GKJL 3PV1A 3NHHA 1WYDA 1T0YA 2XTIA 1S72A 4DV7Q 2QF7A 3ERSX 4HMIA 3PF5A 5FOBB 4IFDG 1E8ZA 1MFWA 3OWFA 4HJ9A 4ZRJA 4KD3A 5ELFA 4B3RL 1TKEA 1HHVA 2CS4A 4XWTA 1VQEA 3FDTA 3VR4A 1BXTA 1I4GA 4PS8A 4IWPA 1HNXQ 3S17B 5LMUQ 3HVZA 1ISNA 2B63H 3I57A 1Y56A 2K39A 1WTOA 1VF7A 3MXNA 1CZGA 4I6PA 3K9PB 4PT5A 1M94A 3QARA 4PYZA 3NZSA 3NE5B 5BMHA 4KDIC 3TDQA 4LK0M 2CH4A 5DPSA 2F0EA 4KSKC 1G291 2MEKA 4B9WA 1AYFA 4C80A 4FF1A 5HG2A 5C3EB 4DR7Q 3ML9A 2B2VC 2KWVB 2RSUA 4A93G 2F0OA 4RMFA 2KENA 2MBOA 2B8FA 1TU2B 2KQ3A 1IGDA 1TWAB 5C0XH 1YQBA 1EEID 2Z6KA 4P2CB 4R4TA 1OGWA 2LVPA 1HZ5A 4EZJA 4O2DA 1EY4A 4ACFA 3MEHA 3APFA 1WH3A 2LASA 3I5JC 1IHZA 4OWTB 1T3QA 5J17A 4HIMA 3PUXA 2WDQB 4S0RA 1U4PA 5IGDA 2QILA 4GZYC 1Y14B 4YCVA 5J3BA 4DAPA 4IM0A 3ULJA 4HRSA 2PJHA 3NVWA 3MJWA 4DGZA 3B1LX 2BB6A 4AYBE 3ZGZA 2QEXA 2MBHA 3OJ3A 1YITA 4ULLA 4ZAIA 2BH8A 2PIAA 4HPPA 2I5MX 2NTSA 2N7EA 1X56A 4XQQA 1PYWD 5G2NA 3NK9A 4W9HA 2ICEC 2N1WA 3BVZA 3CQZB 5GAGC 3T8MA 3GB1A 3D32A 1XPUA 1V49A 4DHJB 1TIID 4DK3C 3HK0A 3ZUNA 4LF6Q 3RLNA 4M01A 4F88A 2KMAA 2JEAI 2A6HD 1TWCB 1IUEA 1L6VA 5M5WH 3BDCA 2Z0SA 4L63B 4BA2I 2ONQA 4L5SA 5HURA 1JW9D 1NEKB 2WXMA 3TEWA 1Y1VG 1UGJA 2FXQA 3DEPA 2IJ0A 3P7JA 2Q2UA 2BPSA 2KVZA 1GUAB 3H7SA 4C2MB 2LGSA 1SSNA 3A5ZB 5J1ZA 1E22A 4OZAA 4RAUC 1ZEQX 1PH5A 5CHWA 4GN3B 3DDCB 1K53A 2HD5B 2VH1A 1MSGA 2UXDL 3K5MA 2SAKA 3IVFA 3R7RA 2KHWB 3A55A 3I4LA 1N34Q 4WAFA 4KHPL 2AYOB 1K83H 3KK7A 4QUCA 5D3IB 1UELA 3U2SC 2DY7A 3SK5A 4DN4M 3PRMB 1NMFA 2Q2TA 3MFGA 1S1QB 4GS3A 4A93B 1QNUA 1KLGD 2FNJB 2INPE 4KHVA 3HOVH 2K8CA 3CMMB 3KUPA 3ICEA 3QWZB 1FEHA 1WXVA 1V1QA 4MDKE 2ZXRA 4AOFA 4LUVA 4IW0A 2JA5B 1JORA 3QCAA 2KOLA 1RKNA 4K8JA 3FILA 4QB4A 3TZDA 4B3TL 4ITKA 4KGRA 1F2MA 4W9IA 3AU4A 2J52A 3UF8A 5HFYA 4M8AA 2MP2A 4JI5L 3G4SA 4FXCA 3MC0B 2X6LA 1NNXA 1GUNA 2J53A 2IZVB 2CW0D 1WE7A 4KKSA 3PIOA 4XGAB 1WZ0A 2K22A 1SNPA 2JQRB 1GJXA 4IOAA 2EMTA 1HR0L 3IT6B 2VS1A 4EKUA 1VQFA 4IZ8A 4OIKA 1E1TA 2WNMA 3FP9A 4HAEA 2G4SA 2Z6BA 2HDEA 3L08A 4L8JA 1WCMG 1YX5B 5CV4A 1QT9A 3PO3B 3BK2A 2JZZA 4NAWB 3A4SC 2K5VA 4RF1A 2XRSD 1HA5A 1LT4D 1KTKA 3CXCA 5K36G 2HTME 3OJ4B 4B3SL 2SNMA 4LF4L 2K6QA 1HEZE 1XLOA 4B9XA 1BUVT 1HRJA 4ZCKA 1HUNA 5D7GA 1BCPF 4A3JH 1QB5D 4BY7G 2KQSA 4UY8C 3N3KB 3JVZX 5IGCA 1EY5A 3U4EG 3RFZB 1Y1VB 3K0XA 2FAZA 4HIOA 1VQAA 2CKZB 1I4XA 3PCOB 3HOXH 3KFUA 4YXDB 3IHPC 1RDPD 4EQ5A 5FLXL 3ZJTA 3RNGC 2N9PC 5BR8L 3W1GA 1HNWQ 1WGDA 1AP0A 3CMAA 3AXCA 2MW5A 3W2DA 2Q2HA 4IPCA 5IWAL 3HKSA 1WX7A 2JU6X 3RZWC 3U7DA 1PZID 1BBUA 2TSSA 5E1FA 1SFOH 1PTOC 1PH2A 2BYVE 4JE3B 1LTAD 4JOIA 3BIID 1ILPA 3LNNA 4A3BH 3NPPA 1MKHA 2K0PA 3F2CA 2OTJA 4IM2A 2K14A 2F0TA 3CSTA 1LM0A 3G6JB 4Q0FA 2IO0B 4DR2Q 3RMHA 4LF9L 4H7BA 2EY2A 3D0FA 4P71A 4FF4A 1WYWB 4Y7NB 2D3GA 2DZJA 1V1PB 1YEZA 3AE4B 3HIZA 1K3BC 1DYQA 3H09A 3S1MB 3VA5A 2RPVA 3IAYA 3RZDB 2O6VD 2W55A 2KJXA 2HQEA 2WACA 1WM3A 3NVVA 1N33Q 1PDQA 3FMCA 3R93A 2B2YC 2K32A 3DEOA 3S2HH 2REXA 3S2AA 3OMGA 1MIUA 2PQAB 3N52A 5M3FH 3GTLH 4Z9CB 4IPGA 2V1CC 1O7YA 5EE0A 3M7NA 4S17A 2J7QB 2H5XA 4PV1C 2KANA 1T9HA 2KCMA 1FYCA 5D94A 1KAAA 1K52A 3CSFA 4JK1C 2I5HA 2HIXA 2JE6I 1JMLA 2ZJRA 4JI4Q 3R8BA 3HOWH 1AW7A 1LABA 1ZYRC 4N8FA 4J1MA 4RKLA 3ENEA 3FEWX 3WA0A 2ZM6Q 1EOVA 1HCZA 3U7ZA 1G6PA 3AEFB 5I9OA 4ODGA 3TQYA 3CCMA 2N9XA 4XDDA 3RD4A 4RHRA 1SIJA 1WSPA 2V1YA 2I5LX 1X3QA 2INDC 3PLUA 5DPRA 1Q12A 4BOSC 2LFNA 5A35A 3I56A 4B0EA 1C76A 5CHFA 3VDYA 1UD7A 4MTKA 3KUCB 4RGOS 2LXAA 1CZWA 2DZIA 1SYGA 1QZEA 5ELDA 1PH7A 4GB9A 2V0GA 4KIKB 3IAM1 1AH9A 4DV7L 3TZUA 3M4OH 4MHEA 3NTKA 3M3YB 4R9WA 3RUZA 3K7AH 3TMPB 2WP9B 4WAAA 4PYUA 3GDEA 4W9LA 1NUCA 3EJIA 3H9DA 3X0WA 4FXGC 2WS3B 4QUFA 5FLXc 2VXWA 3RUIB 3A9KA 1Q81C 2BOSA 1HNXL 3NZ3A 3O13A 4II3B 4XC2A 5LMUL 3S16B 2FBWB 2IHFA 2EOTA 2FCSA 4A8XC 4LF7Q 3RN9C 5DPTA 1CKNA 2Q8IB 1CHPD 3KF6A 1GHJA 2GA4B 4MTNA 1UWXA 3OWEB 1MJEA 4BS9A 5J39A 2MP1A 5C4XB 3AN1A 2D3AA 2EJMA 3NQIA 4CKCA 1FRRA 1PTOH 1SNCA 4DHJD 4JYAQ 4DR7L 2KECA 4AH6A 2J0TD 1QOAA 2BYFA 3VXWA 2BTEA 4GU2A 1WX8A 5H8YE 4F7ZA 3HFZB 3CCLA 4NXNQ 3SXHA 5JHAA 3H6NA 1B53A 3GTKH 2JP1A 3DVNU 4LNIA 4IUTA 2K8BA 2QW7A 4M02A 4HN7A 3PGZA 4QJFA 1F1HA 4M8NA 4RM9A 1VZ6A 5C0XJ 3PIPA 4TKNA 1O7ZA 2XVSA 2F0VA 3GZNB 2GBKA 3EFUA 1SAPA 1X3FA 2E8GA 4B6WA 1YVCA 4CHTB 2F0LA 3U4ZA 1B3QA 2AUJD 1SNQA 5C3XA 1VZ7A 1X3EA 2KFJA 1C1YB 5CYUA 5L37A 3AE7B 2EPBA 1JQ4A 1S5BD 1F2YA 3VYSA 3RN2A 5NUCA 2X38A 3ZQ4A 1DCZA 3EC8A 5KGUA 1HTLD 3WCQA 3AE1B 2KQ4X 4NJCA 5FKAC 1N5WA 4LF6L 3U58A 1W6KA 2JSOA 4HCEA 4EEWA 2ZZPB 4LNFA 3TSSA 2Y5PA 2NZ1D 4QF4A 4EOYA 4TUUA 1VQLA 4US8A 5JJLA 2GRIA 3NUCA 1TTNA 2E75C 2QKIC 4HLEA 1PRTF 2JY6A 1D5MC 4HJ7A 2B3GA 3NVYA 1V5OA 2ASBA 2V9HA 1TS5A 4KK7A 4KKIA 1RFKA 1L0YB 3MC9A 3V60A 1N34L 3F8TA 3KBGA 3QX1A 3J80L 4YSZB 2FJ2A 2L7RA 1XNRL 1WCMH 4RM8A 4DU9A 4DXGA 1JQYD 3AFPA 4BBRG 1ZOYB 1HFNA 1Z5SB 5K36H 3JAMc 1I6HB 3AE8B 1I42A 4NJ7A 2NMQA 4C7ZA 2CQAA 2EXZA 3I4MG 3BYYB 3PUYA 4PG3A 4QIWB 4PZ7A 1Q3LA 1F2ZA 3B6YA 1B2TA 4EE2A 4HCPB 4IUQA 2AL6A 2GBMA 3UGBB 1E7ZA 3I73A 3NELA 3TL5A 1ROEA 1RLFA 4BY7H 5BN4A 4FDBA 2R93H 2LRWA 3D4DA 3AQQA 1WTQA 3PTFC 1K9MC 1PFNA 4JC0A 4EX5A 1GUGA 5TSSA 3UDIA 2I2YA 1YN4A 3AB9A 2F03A 1WZ3A 4C3HG 1WXMA 1R7SA 3MP9A 5DM63 3H8HA 4YTNB 2BW2A 1N9WA 1D3ZA 4ME3A 2BCOA 2EDGA 4Q5VA 4LNQA 2ICIA 2WYQA 1TT5B 2KZRA 2N9EB 3MA2B 2PO4A 1UEAB 4OX9Q 2JA7B 2KJ6A 1I50B 1YI2A 2KEEA 4PS7A 3D6WA 4H02A 4C3JH 4HJGE 3AEGB 1KJTA 3V2TA 4GGQA 1Q82C 2QMTA 3UE0A 3EBEA 2NVTH 3A9JB 2KNBA 4DK5A 4AS1A 3QB3A 4XT1B 2KTRB 3NXWA 2PYKA 2Z0EB 4JI0Q 2YVCA 3OG5A 4NNJB 1EQVA 4K2KA 4RCOA 3M63B 5IYCG 3IAS1 2HQLA 3R2IA 4CO7A 1IZ6A 1TXYA 3HOYH 4N59A 3EUB2 4DPGA 2KLCA 1F2RC 2W3RA 1STGA 4H13C 1HNWL 2I07B 1XQQA 1F9PA 1RF2D 3OPOA 3ONSA 3ZJUA 2WAQB 1MGSA 2AEHA 3NENA 1H9SA 4LJPB 2ATWA 2B63G 1GG3A 2W82A 4F87A 1L0XB 1G6ZA 4DV2Q 2INCC 2B76B 4E3CA 4JBKA 5E6JA 2PMZB 1GO3E 1G8ZD 5T1IA 3KF8B 2CWPA 4DV5Q 1ENCA 2K04A 4HPMB 2L12A 4N9TA 2KC1A 2RDFA 5C5LA 2IO2B 1S5FD 2E2HB 2PZUA 3I4MB 3A4RA 4NZLB 1EWIA 4DR2L 2MA9B 3STBD 1YNTE 3AULA 1SYDA 1X1MA 4AJWA 4GOPB 2L00B 1SE3A 5E7NA 1DGJA 2IO3B 2B8GA 2BBCA 2NVQH 1HFGA 3J80c 4NW2A 4XDXA 5DNFA 4DBGA 5M5YB 2Q5WD 1EO6A 5ELCA 2WXQA 3AM9A 3HM6X 3WAMA 4JBJA 2XWJB 3ZRCA 1STHA 4C3HB 2AHOB 1PVOA 1SBBB 5I6WA 4X64Q 1XO3A 5AZFA 3CW2C 1G6JA 5C4JH 1P7FA 1G91A 1WXAA 5IN7A 3KWVA 1CZPA 2AQ2B 4B0MA 3UI2A 3I55A 1ILQA 5JJKA 2E76C 4MNOA 2L05A 1NI3A 2WXJA 2CQOA 4KV2A 5GMVA 1UWMA 4JI4L 4RHSA 5LHY1 4JI6Q 2WV6D 3S1RH 1MSHA 1TWGH 3IRBA 2F0IA 2KCCA 2ZM6L 3HOUG 1PH8A 3CCSA 1ZKHA 3OHXC 1TWFH 2KYWA 4XDCA 3IKJA 2K5PA 4YWMA 2RDGA 4M1UB 3RD2A 1V8CA 2PPBC 3G71A 2WAQE 2M00A 2ZT9C 1IBMQ 4BKSA 4MGZE 4LFAQ 4IURA 5LMNL 1RM6C 4JI5Q 4WWMA 1Y1WH 1VQJA 4OVVA 3CCJA 3SEBA 1K8GA 3DCGA 2B63B 2BT6A 1WJ6A 1GUTA 2D5GA 3I72A 5K5PA 2LXJA 4YHHQ 3QG1A 5BMGA 5EPJA 3DWMA 2W54A 1AN8A 3ULLA 3N32A 1U4LA 2NVXH 1HZBA 4Q2JA 1EU4A 3QK0A 3FC4A 2EYHA 1QOFA 3N6RA 1UE7A 3MTNB 4G7ZC 1EY9A 4MGKE 3VRBB 2K6AA 3OOCA 2CHBD 3HOVG 3CPFA 4B3SQ 1F2RI 4HWIB 4C1NI 1L1OB 2EIFA 2XNAC 4LF7L 2B39A 2QHOA 4DAVA 1Q86C 2LEKA 2M17A 1DXMA 1GC6A 4A3FH 2CKHB 4KSLC 1RD9D 4HDQA 3TBLD 1UH6A 2B2TA 3OMCA 2KFKA 4NKLA 1A2TA 4JYAL 2ES2A 1A3TA 3NBIA 1PFBA 5IE8A 1HA6A 2PLPA 1G51A 2LXKA 2QDLA 2N3SA 1EFID 4OIJA 4HEDA 2BS2B 4NXNL 3CWIA 3K81C 1OQYA 5C5MA 4KVGB 1Y8PB 3P75A 1QVGA 3GQBA 2YTVA 4RGMA 1P1AA 1WYGA 3LB8C 2N0SB 2UUCL 3RT3B 1VZ8A 5KEEA 5FO7B 1SN8A 3M7GA 3HOUB 3U30A 1Q46A 2G9HD 1YD8U 5EE9A 3CC2A 3DVNV 3DVGY 3SR6A 1PFSA 2WB1B 2LGDA 2JF5A 2ZCCA 2MQHA 3AE6B 1C4CA 4UP7A 3UIPB 4A3JG 2L0FA 3R7QA 3BYTB 1JMCA 5M5WB 1SE2A 3K80C 4NMZA 1WGYA 2C7NB 3L54A 2WXLA 4JG2A 4HCNB 3Q3NC 2PE6B 4B9KA 5CV9A 4DR5Q 2B2UC 4A9AA 3HOXG 2QDBA 1P16A 3T1YQ 1V6EA 1GB1A 1GXDC 4BBRH 3PSEB 4BBNF 1YNJC 2D3BA 5BYRA 1GD7A 3FVQA 2WKCA 4L6TB 3VHTC 1O78A 2RSNA 4USAA 2C9OA 1K83B 5L83A 3PZDA 1H8CA 3CRLC 3VUYA 1BF4A 4ANUA 1OQQA 5DM73 3CF5A 3V6CB 2KC2A 1X9NA 5EKLA 1E7UA 3TEYA 4A3BG 3HOVB 1EIGA 1NTGA 1TY0A 2QA4A 1ONLA 2KVRA 2ZW1A 3NS1A 4BY1G 3GS2A 1RODA 1V43A 4IUPA 1Z7TA 4N58A 4G11A 3NBHB 1W2BA 5HGQA 3AU7A 3GTJH 4OZCA 1XPRA 2EJGC 4LW1A 3K0YA 4JCVE 1OXUA 1KIXA 2HHHQ 4RNAA 2F0UA 3AFQA 3UE1A 2IY0B 1JJGA 1BVSA 1YJWA 2F1MA 2UYZB 2PVGC 2MJEA 3NOBA 1WF9A 2AWOA 2O6VB 3VR2A 1E6EB 4LMQD 2M1MA 1WD1A 1TVXA 1EYCA 4KD4A 1XYIA 1KLUD 1WTWA 1ET6A 1TY2A 2N49A 4DFAA 5M3FG 2OWOA 1KF6B 2BF8B 2L11A 1OEYA 3RNFC 1CM9A 1Q1EA 2K5NA 2IPKD 1F9QA 2WB1E 4K5XA 4NPNA 1GB4A 1WXQA 1BCPC 5G3LD 1QZGA 1EU3A 5IYCH 1KOTA 2LVOA 5M9OA 5E4WC 4AQYQ 3APCA 3PZ7A 4M0WA 2IY1B 3HOWG 1J7AA 1VQKA 2F0NA 2ZXPA 2BDOA 2RHQB 4A3JB 1M90C 3A1QB 1IYFA 1SJED 3NG0A 1VQNA 4J15A 4RA8A 1II3A 2JPHA 1E7PB 4A90A 2Z59B 3BY4B 1EY7A 1ZGUB 4NPSA 2D2CC 1NE3A 3AECB 3HOXB 2ENBA 4ZYSA 1PDXA 4JI7Q 4OX9L 1KLVA 2OT2A 3M95A 2OOBB 3VRAB 1C79A 2JUOA 3K5OA 4NAWA 4UP9A 3FHWA 4BBSH 5JZEB 2EELA 2VB3X 4YY3Q 4EFOA 3CCRA 1LUZA 1BMLC 3IBEA 1AFPA 1SFOB 1L4ZB 4JLCA 4JI0L 1HZCA 3W1YA 1FXTB 4A3BB 4LF8L 1JWAD 1N6ZA 2EYPA 1QNKA 2JEBI 1DOKA 1KDBA 3ERQA 3S24A 4BY1B 2GMIC 2HJ8A 5DAUA 3K5LA 3X23A 1GC7A 2WXHA 3QOJA 4FJYA 2CHXA 2UU9Q 2UU7A 4LUOA 3TBIB 3PS6A 4DV2L 2N4FA 4K7WA 4K3CA 3X3NA 5TR5A 3AE2B 3X3MA 3FRPB 4DV5L 2EVBA 1EF1A 1QJOA 1V5TA 2DAFA 1B50A 4WIPA 1LLRD 3OTOQ 3UIOB 4CHKA 1IP9A 3S2HB 3Q0AA 5CC4A 4WQMA 5M3FB 3GTLB 1C0AA 3K59A 4UDUC 3IFTA 2FIFA 3I3TB 4DQOC 1HQRD 1HJPA 5CBEE 2DYOA 2MLBA 3HOUH 3AYHB 2D3CA 2NBUA 4QAYA 1WFQA 4OONA 1EWYC 1ESRA 2C5LC 2J0JA 1ENFA 5EBDA 1KRTA 2NN6I 1EF5A 2FFKB 1Q1BA 2NN6H 2B29A 4ZUIA 4R8IA 3HOWB 1V1PA 1JWMD 1UBIA 2IDYA 2JYTA 4FN2A 1IBXA 4X64L 4A20A 3SK8A 4X62Q 3VUWA 1JROA 2D5DA 2SNSA 3Q8FA 1B8AA 3WALA 5EBCA 1WI5A 1RFAA 2ACZB 3PUWA 2PQAA 4CDCC 4GMVA 1ASZA 3F1ZA 1UBQA 2XK5B 4OO1I 4ZKBB 2V3NA 1OTRB 3C8YA 2LRUA 1DJRD 2LS01 4JI6L 1XNRQ 4BVUC 1FM0D 1LTBD 3DWQA 1I4HA 1DD2A 1HZ9A 3P20A 2IL8A 4NDXA 2RDHA 2VQFQ 3PHWB 3MFYA 3CPWA 3WOEA 3TJPA 3I90A 4LTUA 3T4AC 1STNA 1SYEA 3WDNA 3MVVA 1VQ6A 4KGTA 2K03A 1M1KC 3FKIG 1I4RA 3M4OB 1YJ9A 4GNXC 2WX0A 3K7AB 3DHGC 4JL9A 1D1KA 2F0HA 2VQEQ 1IBML 3TMEA 1XCTL 2YEPB 1XNQQ 2LY7A 1PGBA 4LFAL 2W3SA 3BK1A 3ZNZB 2M0XA 2UXCQ 1YNJD 4LF5Q 1NYQA 1J5EL 4MZ9A 4NQLB 5BYQA 3IFDA 3QJYA 2C9WB 4LLGM 4ARIA 2WGSA 2LZ6A 2ZPYA 4UPAA 3I4NG 4OW0A 3VR8B 4YHHL 4F8CB 2PNHA 1F77A 3A54A 4RFBA 5FLMG 2A4ZA 1E5WA 3UI3A 2ZXOA 1JOKA 3DQVA 4ANWA 2BE5D 3PO2G 1O7IA 3M4PA 2FCNA 1PTOB 1K0RA 4KIKA 4XYOA 4IOCA 2KDFB 4KMUC 3J81L 1WOCA 3BS1A 3Q2AC 3HZXA 4NY0A 3AE3B 2F0QA 2R3ZA 4A3EG 1JWBD 1C8CA 4IM3A 1WTRA 3GTKB 1K8RB 2R61A 1KM7A 2IGHA 3Q6BA 4N9F4 2GVAA 4CDFC 3RULA 2KN4A 3NTIA 2RKSA 4DA2A 2LVQA 5CV8A 1O7LA 4C4VB 3QHTA 2R93G 1WWTA 5E6OA 3SK6A 1VQMA 1RRBA 2WXPA 4FULA 2MQJA 1SXTA 1KL9A 5A2QL 1SE8A 3I8ZA 4JI8Q 3H0GG 4JWUC 3QIAA 4XXEA 4GDLB 4W9GA 1MG8A 4D2KA 5BMIA 1BOSA 2KDEB 2NZHA 4G7OC 3ZRFA 1DOYA 3PPAA 4DV3Q 1VQCA 1BCPD 1VQBA 2N1VA 4GKKQ 2D10A 2J7ZA 1PFMA 3ITPA 4RWSC 2RDBC 3DHQA 2H4OA 3SDZA 5CX3A 3KUZA 2I46A 1DZ1A 3GOEA 4IJHA 4A3DH 3KLWA 1YJ1A 2KMCA 3L9AX 4LFBQ 3ZVVA 4C3JG 2WKDA 4IUUA 1VQOA 4BY1H 3CC7A 1FGUA 1LT5D 1PRTC 4OVZA 2WU2B 3DXJC 1XMQL 4R8NA 5CORA 2AQ3B 4KY7A 4FADA 3K58A 4K0KQ 1F0ZA 4MN3A 2JZ3B 4H0LC 5FLXE 4UHVA 2L1AA 2N8NA 1CA5A 3L16A 4FNFA 4N8X1 4DR5L 1QVFA 4K6LA 4W9KA 3T1YL 3P4QB 3W9CB 4LDTB 2OQKA 1PUTA 1YOVB 3DBRB 3HOYG 4DV4Q 3VTVA 1S4ZA 5M3MH 2FINB 1C3TA 1YHAA 5GADC 3IL8A 2C5CA 2X6GA 2Y0SG 1EUVB 2F4IA 4IJLA 5JOBA 1SIFA 2C35B 2LKVA 4JPSA 1WCMB 4DAMA 4XZ4A 2NBFA 2PI2E 5LXIB 3U4VA 2DX5B 2Z6KC 1CK1A 3ND8A 3W1SA 3HKZG 3H7PB 4K3BA 3HGBA 4II2B 3KDFB 1K51A 2KX0A 3VDZA 3URYA 3T3OA 1AEXA 2H89B 1LO5D 1EYDA 2DNCA 1W6JA 4DNRB 4X6AH 1A0IA 3JSVB 1A8VA 2F0WA 1GHKA 1ZW7A 1CSPA 2ID0A 4KDLB 3ZO5B 3A8IE 1LTID 1IYJB 1KD1C 1DM0B 4R1JA 5IP9G 3TIXA 2MO0A 2HHHL 4BY7B 2PMVA 3Q3JA 5C4HA 2R93B 1IKLA 2KQ7A 1R4QB 3OIPA 1ASYA 1WJJA 2F0SA 5IT9E 2WX1A 2K5DA 3VH3B 5FR3A 2E2DC 3E0JA 3J81c 3PIO3 1CHQD 2L4NA 4XE0A 5LMNQ 3NZUA 2F0PA 4WFN3 3DM3A 1VD2A 3LWUA 1MI2A 4DAYB 5D2MB 5EDSA 1R4PB 2OXPA 3OW7A 1T5XD 3BDLA 1LTSD 4FXKC 2RR9A 3I9V1 1SROA 1VCBA 5DEHA 2IWHA 4JGHB 5IP4D 1GOZA 4KLKA 3I63C 3RI7C 1E8WA 2Z4IA 3Q3MC 1QZHA 5JXVA 2A1AA 1F9RA 1KAWA 1ENAA 2B2WA 3J81i 4AQYL 4K1RB 1RTOA 4C3JB 3T13A 1E0ZA 1NY4A 1JR0D 1TYGB 3FAHA 3S1NH 3JAML 1P9DU 2NVTB 4A6QA 1AE2A 4ZKCB 1IXRA 3HHMA 4ID6A 3NRZA 2BQQA 4K5VA 1FXAA 1CTMA 1S3OA 1YIWA 1ZKOA 2VZKB 3GE3C 1EY0A 1BT0A 5IOIA 4JI7L 1CUKA 2RBMA 1VMPA 2ZNVB 3HOYB 3EN2A 3V6EB 2DN8A 2J0MA 2EY1A 2J0KA 1Y1WG 1C7YA 3ML8A 3E9IA 1YHQA 5E6NA 4YY3L 4A3GG 2QGQA 4HROA 3SFEB 1IGCA 3SVMA 2JXMB 2MCNB 2N88A 3HOZG 3TS2A 1XF5L 4DDID 1KNAA 4N9PA 5C3WA 4ZHOA 1B9MA 3RLOA 1C9FA 3HKZB 1EY8A 2V4LA 5CV5A 1ET9A 1C48A 2N9KA 2VB2X 5GAHC 3L10B 3K57A 2A8VA 2UUCQ 3C19A 5I6YA 1K8AC 2L0TA 4QCLA 3VR9B 3ZXVA 4NQKE 1VRAB 4K14A 5KNBA 2UU9L 4FLHA 1Z2MA 2K1BA 4OHJA 2NVQB 5COYA 1C4AA 1K28A 2EMSA 2ZJDA 3I3CA 3Q8AA 3MZ5A 5ELBA 2AWTA 3H91A 4A3FG 2E2JH 2WXNA 1W3SA 3OTOL 2BWES 3W5VB 5IGEA 1JOOA 3VYUA 2JA8H 2ZNVC 1B3AA 4XQJA 5C4JB 2OQ0A 4A3MH 1GUWA 1KRSA 2LI5A 5IYDH 2ZTEA 1FXIA 2HE7A 1XWEA 4C3IH 3J7A5 4XTCS 3IT4B 2Z8LA 2DGYA 1XT9B 3QC8B 3T53B 4OZBA 3MAQA 2AUKA 4GOPA 1D4BA 2K7VA 4IQZA 1HR0W 3CP0A 1AZPA 2C7MB 3FKIH 4KY5A 2NVUI 4DUZQ 2PKOA 3G6EA 3E3XA 3V3XA 3MXGA 3S1RB 3U52E 1TWGB 2XWBB 1E90A 3DWPA 5BN5A 4X62L 1YQ4B 4EQPA 1CI3M 3BVMA 4JBMA 5JPNC 3L4PA 3TEZA 1MHHE 2L52A 1ICWA 3BWUD 4J8QA 2K01A 1TWFB 2FE8A 5E6PA 2EYMA 4CQNA 4R4QA 2I38A 3HVDA 3UQAA 2A6EC 1DOMA 3I4NH 2VL6A 2DWQA 2QIEB 3IFWB 1X65A 2KHIA 5ELOA 1YJIA 1PTOD 3M85A 4DF7A 5FLMH 3EHVA 5F2DA 5E4XA 1E2VA 1WD0A 3PO2H 3PHXB 1D1IA 5H92C 4KKTA 2QDFA 4QMGA 1Y1WB 1RL2A 2JRIB 4JOIC 3E5SA 1JWUD 3HKZE 4ILWA 2VQFL 2K5HA 4A3IG 4A3EH 3HS0C 3HOZB 4ASWC 4ZHPA 1LYLA 2WDRB 2NVXB 5KIXA 2UUAQ 2L8JA 2XBBC 1HTPA 3RPFC 2FIDA 2VQEL 1XNQL 4FJVB 2YTYA 1R4NI 1CKOA 2UXCL 3B0AA 3CCVA 4LF5L 4BXXH 1S40A 3RNCC 5ISRA 2HD3A 3L17A 3JAMi 5GXGB 4A3PA 2OF1A 3H0GH 3U9OA 4I7ZC 1Y69U 5JH5C 3NS8A 4GDKB 3CCQA 2MRPA 1L0WA 1XLNA 2KWDA 4HKZE 4A3FB 2YYZA 1NVID 4EGVA 2N7JA 3B2FA 4PMWA 3ZW3A 4MH0E 1B1ZA 2RCNA 2GB1A 2R7DA 3AEVA 1QILA 1UE6A 4K5WA 3DBLI 3RYTA 1JT8A 2DHZA 1ZYRD 2WWZA 2F0GA 2RF4A 3PO0A 4W9DA 5CHVC 1UZXB 2TMPA 1QKZA 2VH2A 4S3SA 1PLFA 1GKHA 4IUVA 2FMCA 3W5OA 2V4IB 3DOWA 3PMFA 1KDCA 2L55A 1N32Q 2CVRA 4BWGB 3I7FA 3TP8A 4N6EB 1L1OA 2VUMH 3M9BA 2LFIA 2XEWA 1YQ3B 5EE3A 1T0QC 1NJIC 1CKNB 1E24A 3KF6B 2KHJA 3V96A 4LDTD 2WP8J 4YTMB 3PIP3 4XQNA 4FYDA 3Q14C 1VCIA 2FHTA 4L5TA 1SSOA 4X65Q 3QWNA 4LF8Q 4A3LH 4JI8L 2BDNA 2UWQA 3NJTA 1QUQB 2LXCA 2KKCA 2NWGA 2BB5A 2F0KA 2KA7A 4EQNA 1EQQA 1AZQA 2C60A 3NHEB 4CYEA 1LTLA 3VFKA 4P72A 4DV3L 4LUZA 3S2DH 1WGRA 4MSMB 4BBNC 3GV6A 4PNYA 4GKKL 1GNUA 3Q8BA 1KFYB 3SDLC 4J6HA 3WANA 3A56A 2AL3A 2WHIA 5CBAE 1S5DD 2G45B 1BBXC 4ZK9B 2EXDA 3GTQH 3DWAA 4BBRB 2O5JC 4QIWE 2WU5B 4JX1C 4LFBL 1Y8RC 2LGXA 2K5WA 2QJLA 4YWKA 1K8OA 4BBSG 1QCBD 4X3UA 1R4MI 1U4AA 4HKQA 5JVG3 2IX3A 1GAQB 3VTUA 1IW7C 1Z47A 2XRQD 4NP5A 4K0KL 1J7CA 3PT2B 3EVQA 3P4RB 5IP9H 2K75A 4LWCA 3H1UA 1RWSA 1WMHB 2MNAA 2CWAA 1VQ8A 2KD0A 3GTOH 2Z0DB 1XJVA 2Q2IA 3J7AV 2DZMA 3T16A 3RZFA 2NZOA 1EQTA 1G2SA 2RCFA 4F7XA 5JEAH 2XGTA 4DV4L 4P74A 1RAXA 1YNNC 2FCQA 1I6VC 3B08A 4MH8A 3GTJB 1WGGA 2F3VA 1EIYB 1SNDA 4H44C 3VYRA 1QWYA 2ZTCA 2NB0A 4YT0B 1JB3A 4RKBA 1Q0WB 3DWGC 4PMBA 5D6JB 3J80i 4HXDA 4ARCA 3M3JA 1C78A 2K4KA 2EZVA 4WQOB 3VQIA 1XMOQ 2PZTA 3M62B 1NENB 1Q90A 2DJFC 4A3CH 4LJOB 4HVBA 3FPPA 3AV8A 3SK4A 3S15H 3QJZA 5G5GA 3ECIA 1I3QH 1ZUD2 2MX2A 4GIVA 3MXUA 3Q22A 2VZKD 3HM3A 4LNOA 1J6QA 2E74C 1SNOA 3FPUB 4KJOA 1IBKQ 2YU9H 3QQ8B 3KLSX 5G55A 3NBHA 4MM3B 3NSWA 4J3OD 1JWSD 2CJNA 4ZRZA 4MJSA 4ZYNA 2NN6G 4BKGA 4C7YA 3W1BA 4YWGG 5EQ0A 1Q10A 2JK8A 2ZCBA 4DR1Q 3S1QH 1J5EQ 2F0JA 2X8XX 2PMZE 4YIJA 1GVPA 2NPTA 4WH4A 1YIJA 4OEMB 2MPMA 5C44H 4A3GH 2O6VA 1VR9A 2B2VA 1JCKB 3HOZH 5I4DA 4JI2L 1WE6A 5CTRC 4BOZB 1L2NA 3JYUA 2ZPNA 4OO1G 1ZE3D 2WXKA 2JA6H 3V62A 3VTWA 3T56B 1QF6A 4BBSB 3IG3A 4LK1C 4I6NB 4XX5A 3N1XC 4RMAA 2KHSA 3TEHB 1H9MA 3K8AA 2A6ED 1V86A 5I2YA 1WRDB 1HNZQ 3QIJA 3BZKA 5EE1A 3WAOA 2MWSB 1KHIA 1LT3D 3NUHB 1KC8C 4L1BA 1NBWA 2ZW0A 3A1QA 4DNIA 1VJKA 4L2YA 3U9SA 3AU5A 2YTXA 1TKYA 2DLBA 3J7ZC 4AUQC 3E6ZX 3A0JA 3NP8A 2M56B 2RMMA 2XN9C 2Y5BB 4A76A 2WQYB 4BA1I 3PZ8A 1YJJA 4ALPA 2BA1A 4US9A 1XX8A 3I2ZA 2JYOA 2JRHA 1XTDA 2WXRA 1UNSA 3KYCD 1FD6A 3E9HA 1BBWA 1T0RC 3D8GA 2D11A 1STAA 2F52A 3HP3A 1EZ6A 1OO9B 4IPDA 3LYYA 4HJ5A 3AEEB 4APVA 2ON8A 1FNVA 4RH6A 4ANVA 2MFIA 3MTSA 4NAMA 2D0PA 3F2UA 4C00A 2K8HA 2ZJQA 3U8ZA 1U4MA 5AUKA 3CAMA 2JXTA 5C3JB 5BO4B 4XIGS 1XMQQ 1VDZA 1TWHH 2K28A 3S14H 2FUG1 2IHEA 5DLQE 1WJ4A 4Y52H 3KYHC 2KCTA 4P7IA 3KJOA 2F0FA 1U5KA 4HK2A 3P2BA 2OEOA 1J7BA 4A3IH 1JOQA 1D5XC 1CKMA 1O80A 4X3KA 1E8XA 3TREA 4GN5A 1Y8OB 4DUZL 2JSVX 2KJRA 1BCPB 1SYBA 2NVYH 5H1SE 2M0AA 1IYUA 4GSWA 4CJ1B 2F0DA 2LWPA 2MH7A 2EYOA 4A3DG 3TP6A 3ALBA 1VDVA 3I4OA 1AE3A 5JAVA 2W9NA 2KN5A 4KZCA 2EKIA 2YLMA 5IP7H 4TKOB 1I7HA 3NWSA 2LUMA 2DUDA 1TR5A 2K6DB 3BVGA 4OWWB 3QA8A 3N20C 4P1BC 1SLJA 2A5HA 5C2TB 3CKIB 3NVZA 1RIPA 1WJUA 1XLQA 1FD7D 1GJZA 2DYBA 2CW0C 3KQ4A 1MJDA 2CCZA 1LTRD 1Z6HA 3E0EA 4FVMA 1V97A 3PF4A 1C77A 3L13A 3TEXA 3GTMB 3P63A 2XK5A 2IGDA 3ZDTA 1OXTA 4EUTA 2D9UA 1U9RA 4OXPA 5M3MG 2L0CA 5IIFA 4W9EA 1IW7D 3RZOH 2MBBB 3OAWA 1I4QA 2O2VB 4NXML 5MPOA 4MIUA 1WTXA 1XTCD 1FPYA 3DHHC 4MACA 5T1GA 2UUAL 5KNDA 1LFDA 4JWSC 3D4RA 1S5CD 4XWWA 1OXSC 1YNND 1OXVA 4WWPA 1I4PA 4E6IA 3WIMA 5G3LF 3V61A 2L76A 3AH7A 2Y3AA 2KEDA 3UDXA 5FO9B 1V9JA 1ZP0B 1VLBA 1VQIA 2PW5A 1BUIC 2WXIA 3KW5B 1NDDA 3GTGH 4JQWC 1E1OA 5M5XH 4WORA 5JJZA 3TRZA 4IC7B 4ICVA 1YHBA 3NQTA 2OTLA 1YMHE 3ETRA 3CCUA 2R7ZH 4HJAA 4O1NA 2AWNA 4QL5A 4IWQA 3RR5A 3ZXRA 4P1CC 1WTPA 4CJ2C 1VQ4A 1UWVA 1BO0A 4G7HC 2ZVOA 3OYYA 5CGKA 1FVIA 1A63A 3PQIA 5BYSA 1PQSA 3ER0A 4DXAB 2IX0A 2IT1A 1N32L 4JPBW 2KO3A 3DBHI 2GOWA 3EROA 1PGAA 3VR5A 1KABA 2PI2A 3ZJYC 1SJHD 3RNBC 4JI3Q 1NAPA 1QG7A 1E2WA 1TQOA 1A62A 4KY6A 4A3DB 3HRDD 3J7AF 1I5FA 1ZXTA 4X65L 5KNCA 4IUNA 1SE9A 1C9OA 4C4VA 2GBRA 1GPXA 2WXFA 1LTTD 2HTHA 1FFVA 2K33A 1HE8A 2KFKB 1JALA 4DHZB 3OW2A 4W9JA 2KVMA 1EIHA 1K8MA 4KHZA 1FNWA 3R2TA 2B2YA 3PV0A 2DYMA 1JE5A 4GDLA 1MBYA 5J2RA 2BA0A 3L3OC 5FJ8H 2R6GA 4HR7B 1LM8B 4M8MA 5C0XI 3RNAC 1UF0A 2YV5A 5M3MB 3BINA 3N1YC 2JA9A 2JA5G 1EYGA 3W5UB 5LMNW 2DJGC 2Z4HA 1A2UA 5KYIA 3RN5A 3TP7A 1PXUA 2JQOA 1CFMA 2DNFA 4GNXB 2PQEA 3T1HQ 3K9OB 3RNEC 2I1JA 3BJUA 4RF0A 2PE9A 2IY5B 1EIFA 1UE1A 4V0BA 3G7LA 3BU2A 4FF2A 1J0GA 2B2TC 1UEBA 1LXDA 2E2IH 3Q69A 3PO3G 2JT4B 4W9FA 2IBIB 4JI1Q 5JHBA 2BYTA 2K9XA 5EPLA 1NYRA 2D2QA 4G4KA 5JEAJ 1ZXHA 2G5DA 5C23A 1OFFA 1H9KA 4MEMA 2LHDA 4GN4B 4DV6Q 4I7AA 3CD6A 1XMOL 4IKGA 5ELNA 2OJRA 4OO1H 2JA8G 1CQVA 3H3VI 1JE4A 3DMUA 3V05A 3H3VH 2H1EA 5AZGA 5IO9A 4A3MG 3KYDD 1SMXA 2KWUB 5EGTA 3H7PA 1Q5WB 3KDFA 5IYDG 1TS4A 1U0LA 2HJ1A 4DV1L 1V1OA 4C3IG 2LJIA 1IBKL 1RCVD 4A3KH 3JSVA 4EZLA 2WXOA 2LMCB 1F9JA 4DHZE 1GUOA 4B08A 1QE6A 4IUMB 2BWFA 1WTVA 1Q8IA 4EZKA 1YN5A 3HEJA 5IGBA 1A5RA 3IXSA 3BZDB 1LGRA 5HI1A 3KBXA 1N8RC 1QOBA 4C56C 3AE9B 1VF5C 4KN4C 4DR1L 4AIMA 3TP5A 1GM5A 3ULPA 3S1NB 1NR2A 3QOLA 3I70A 4BFRA 3GTMH 1BDOA 3C0RB 2H88B 1HTOA 3EIVA 1LACA 2G3QB 3ZKJC 1EWCA 1FJGQ 2ZTDA 1PZKD 2M2LA 1YNXA 1RJTA 4DAYA 4ZRPA 3D31A 3WOFA 2HDLA 2B3AA 2BYEA 3WAPA 1VQGA 1A3UA 2NTTA 2LGYA 2QSDA 2UXBQ 1EEFD 1T0SC 2LHEA 3RCZA 2X69A 4DR4Q 4DXFA 5EAYA 3VR6A 2G1EA 1NCVA 1QVCA 2VW9A 4K2LA 4OGQC 3RLFA 4M0WB 2EE1A 1HNZL 3ZNID 2KTFA 5LXHA 1PRTB 5AFWA 3K5NA 1L4DB 2KACA 3AMZA 4G3XB 1E2ZA 3C2PA 4PQXA 5I9PA 3O65B 5BN3A 2BS3B 3KLRA 1AARA 3L0WB 3PUVA 3BG3A 1T5EA 2WDVB 2F3WA 4BXXG 3MXNB 3KOJA 1SF0A 3APDA 4TQ0A 4LJZC 2MUYA 3TS0A 1WIAA 1XEEA 3TUOA 4HSVA 3P1HA 4P6VF 1FL0A 3SU8X 3N9YC 2DBYA 1BQQT 5GQOA 5IAAC 1PH9A 1FRDA 5KYLA 3R66C 3JC66 2E2JB 3J9CA 4J6IA 3J81E 4GLXA 1CQFA 3L7ZC 1FO4A 3H15A 1BKBA 3WWVA 1IL2A 2JA8B 1D7QA 2E3TA 1JRPA 1UAPA 3CMEA 2J42A 3AEAB 4GLSC 3Q3FA 4A3MB 3NEMA 1Q1OA 1ACCA 2K5QA 1S3SG 3S17H 2MHVA 3CC4A 1U4RA 5HY6A 2K05A 4CDDC 2A69C 1ML0D 4C3IB 4P75A 4FF3A 4FP5D 2DNEA 1EUJA 3SGIA 4AJYB 3UDGA 3FKIB 2A19A 2INNE 4V190 2A74C 4LFCL 5A2QE 2GVBA 2VUMG 4YSXB 1PV4A 3GV3A 4ZUJA 3SHQA 1MHXA 5C3EH 2A68C 5L95C 2JWUA 4A3LG 1DOXA 4MGIE 1H9RA 2D0OA 4K7SA 1TWAH 3J81j 3I4NB 2IW3A 1TZ1A 3LXFA 1EOTA 2NUCA 4QGUA 2VY3A 2MHJA 4HDOA 5CMDA 1TBEA 2PW9A 2KLGA 1GUSA 2EQSA 2N55A 3PO2B 1Q8KA 1YZ6A 1IBLQ 2Z9HA 3LWEA 5FK9C 4GXBA 2HIVA 4BKSD 1NMGA 2ZEQA 4RG1A 3D6CA 4CGYB 2UUBQ 1NSNS 2XSCA 4A3EB 2E5LQ 2M8SA 1IBXB 2L15A 3SR1A 3OLMD 2KOXA 1UUPA 1PH6A 4LCDE 3J7YW 4ME5A 4L5RC 1L7YA 1A3VA 1VMCA 5C4XG 4IALA 5CV6A 2M4NA 2JVCA 4ZOHC 5IT9L 3K7UC 2KT7A
chains in the Genus database with same CATH topology
2NYZD 1N61A 3H0GB 5EPKA 5JEAG 1SYCA 1SNMA 4IFDI 3CU7A 4IFDH 4RGTA 2CJOA 2L1BA 4K6DA 1JICA 1ZXIA 2AX5A 1FCCC 2EYLA 3FILB 1TS2A 2DY8A 2JX5A 5C4ZA 3QO2A 1B9NA 1SB3C 1N62A 4L23A 2L32A 3EGRA 2KAJA 1DOIA 2VUMB 3R3OA 2Y5CA 1QOHA 2WINB 1DONA 4YTPB 3C3LA 1M8AA 2CU3A 4X3TA 2QEJC 1XCQL 2EY6A 1IL8A 2GI9A 3S2DB 1MD2D 2Y0SB 4IN3A 3HRZC 2L83A 2D62A 1CJEA 1PMRA 4R3DA 1WGKA 1SMYC 4KV6A 3GTPB 4EVOA 4UAIA 4IDIA 3GTQB 1V8QA 3JAME 4H2AA 1SEBD 2EY5A 3ZJVA 1N63A 5ELEA 4TSSA 3CHBD 3D3RA 3KLSA 5E3FA 1F2LA 1A70A 3GP7A 1OXXK 1Y8NB 3DM1A 1WVLA 1EL0A 3GTOB 5IGGA 2KDMA 4JBWA 2KCNA 1LT6D 3GO5A 3A7AB 1WRIA 3KF8A 5IGFA 1HUMA 4KI0A 4WRDA 1ESFA 1N60A 2MJ3A 5EKKA 3C46A 3B9JA 1T6BX 3NWTA 3P4PB 2G9DA 1C4PA 3S15B 1CT1D 2YEPF 1I3QB 2SDFA 2HUGA 2YU9B 4REZA 1FCLA 2MJ8A 2L9HA 4K8IA 2SEBD 3AEDB 4U68A 1SE4A 1RYJA 3NTHA 1B9RA 3P42A 4ZRQA 1FFUA 3S1QB 1PTOF 2A69D 4TQ1A 3GD7A 5C44B 1FGBD 4A3GB 1PRTD 3OIQA 3C1FA 5IOCA 5C6AA 1RTNA 2A68D 2JA6B 4WJWA 2L5TA 5KRUA 1X32A 1QQRA 1TKGA 1SYFA 1ZDXA 4O42A 4YSYB 1XXGA 1TKWB 1A6XA 3J80E 2PVOD 5D65A 2E6XA 4EQOA 1LV9A 4RGNA 1L0VB 3EA6A 1EWHA 1BR9A 3A8JE 1FIQA 1PFDA 4XT3B 1HZ6A 1D5ZC 1MPEA 4DNTB 5HHDG 3E56A 3T3NA 1B44D 3MHBA 5I2XA 5J22A 2EYJA 1TS3A 1IYVA 2B2UA 3C1EA 4CJ0B 4KN7C 1KNEA 1TWHB 3S14B 2KMMA 4HTHA 2EYFA 3BDOA 2JYEA 3S9WA 4KKUA 3SFDB 4MT5A 3P1MA 4A3IB 1PGXA 2B2WC 5LNK1 4KX6B 1E0BA 1A15A 3VA7A 1CA6A 4FXDA 3B2GA 1HXYD 3Q8CA 2O2LD 2Q8RE 2NVYB 2IGGA 4TQUS 5JVH3 1MI0A 1EM7A 1PZJD 3TN2A 1SMYD 1L5PA 2K3UA 4TRDA 3EFXD 1K50A 1IKMA 4DK1A 3VR3A 1MVKA 2KUMA 4PMCA 3OSOA 4HMJA 1EYAA 1NR4A 3I91A 2HDMA 1J9OA 1KDAA 2A73B 2R92B 2V4DA 1TZOA 4HEA1 5C0XG 4KJNA 4ABNA 3RZOB 3A8KE 3H6MA 3KWLA 3LX0A 5EKIA 3SE0A 4I65A 3ONAB 3MJ5A 5LL6X 1OQRA 2N9LA 1FR3A 2FMMA 1E9MA 2QCPX 5D3DA 1FNUA 2HCCA 2SOBA 3Q24A 3E9SA 3MHZA 1LTGD 1STBA 3GTGB 5M5XB 3HG9A 3K6OA 4G57A 1G2TA 2R7ZB 2RA4A 3ABVB 3Q6SA 1DOLA 3ZYYX 1R9TB 4IFDJ 4HCSA 1X3PA 5AUIA 4U673 2Z1CA 5EJWA 5FO8B 3D4WA 2MGSA 2PTLA 1C4QA 1RHPA 3ND9A 3VYTA 2PNRC 1FMAD 4KKJA 1SDFA 2WIIB 2PCFB 4C1NK 5IODA 1QLBB 1TJEA 4XYQA 3AB5A 1KRHA 2O4XA 5HGTA 2VNUD 3Q23A 1QOGA 3P4SB 5LL6S 4A55A 2OEDA 2MJDA 2HCIA 1L6UA 2PW7A 2Q8TA 2A6HC 2O5IC 2RQXA 1H9SB 3CRKC 4OL7A 3AE5B 4WURA 5T8IA 4AQ7A 3A7LA 1D2BA 5CV7A 4ZQ3A 2E2IB 1EZ8A 1ZPSA 5G5HA 3EQLC 4HSPA 1HPCA 4IOIE 2M9VA 2EJFC 3HUIA 2WLBA 2M19A 2IX1A 3AMUA 2WXGA 3Q8EA 1HQMC 3MXPA 2F0MA 3AEBB 2LGIA 3MWYW 1H9JA 4CKBA 4A3KB 3W3AA 1B4OA 4X3SA 2J4XA 2RVLA 1EY6A 1JC7A 3T51B 1YN3A 2PZWA 1N5XA 4CKEA 1TT2A 2JZPA 4FO2A 2BE5C 4F8MA 4ZLTF 1BNZA 4TMAB 2RSOA 1XLPA 4P16A 1S5ED 3CIRB 1STYA 1ZDVA 3SHLA 5D14A 4RCNA 2LMCA 3H3VC 4CBVA 2OHFA 3M4YA 4LAAA 1STEA 5JPMC 1J8IA 1AWDA 3PUZA 2AQ1B 4KGSA 4AYBB 4DK0A 1M4VA 3DUZA 1KH0A 1P7EA 2BS4B 5CR3A 1D6EC 1F9SA 2V3PA 3H94A 2XIWA 4KTAA 3NHHA 2QF7A 4HMIA 5FOBB 4IFDG 3OWFA 4KD3A 5ELFA 1TKEA 1HHVA 4XWTA 3FDTA 3VR4A 1BXTA 1I4GA 3S17B 3HVZA 3I57A 1Y56A 1WTOA 1VF7A 3MXNA 1CZGA 4PT5A 3NE5B 5BMHA 3TDQA 4LK0M 2F0EA 1G291 2MEKA 4B9WA 1AYFA 4C80A 4FF1A 5HG2A 5C3EB 2B2VC 2F0OA 2B8FA 1TU2B 2KQ3A 1IGDA 1TWAB 5C0XH 1EEID 4P2CB 1HZ5A 1EY4A 3MEHA 1IHZA 1T3QA 3PUXA 2WDQB 1U4PA 5IGDA 2QILA 4GZYC 4DAPA 4HRSA 3NVWA 4DGZA 2BB6A 3ZGZA 4ULLA 4ZAIA 2PIAA 2NTSA 4XQQA 1PYWD 3NK9A 2ICEC 3BVZA 3CQZB 3GB1A 1TIID 4F88A 2JEAI 2A6HD 1TWCB 1IUEA 1L6VA 2ONQA 3BDCA 4L63B 4BA2I 5HURA 1JW9D 1NEKB 2WXMA 3TEWA 1UGJA 3DEPA 2IJ0A 3P7JA 4C2MB 1SSNA 5J1ZA 4OZAA 4RAUC 1ZEQX 1K53A 1MSGA 3K5MA 2SAKA 3A55A 3I4LA 4WAFA 3KK7A 4QUCA 5D3IB 3U2SC 2DY7A 3SK5A 4DN4M 3MFGA 4A93B 1QNUA 1KLGD 2INPE 4KHVA 3KUPA 1FEHA 2ZXRA 2JA5B 1JORA 2KOLA 1RKNA 4K8JA 3FILA 4QB4A 3TZDA 4ITKA 4KGRA 5HFYA 1F2MA 2J52A 4M8AA 4FXCA 3MC0B 2X6LA 2J53A 1GUNA 2CW0D 4KKSA 2K22A 1SNPA 2JQRB 1GJXA 3IT6B 4IZ8A 4OIKA 2WNMA 4HAEA 2HDEA 4L8JA 5CV4A 1QT9A 3PO3B 3BK2A 4NAWB 4RF1A 2XRSD 1HA5A 1KTKA 1LT4D 2HTME 5K36G 2SNMA 1HEZE 1XLOA 4B9XA 1BUVT 1HRJA 1HUNA 5D7GA 1BCPF 1QB5D 5IGCA 1EY5A 3U4EG 3RFZB 1Y1VB 1I4XA 4YXDB 1RDPD 5FLXL 3ZJTA 1AP0A 3W2DA 2JU6X 1PZID 2TSSA 5E1FA 1PTOC 4JE3B 1LTAD 3BIID 1ILPA 3LNNA 3NPPA 2K0PA 2F0TA 3G6JB 4Q0FA 3RMHA 4H7BA 2EY2A 4FF4A 4Y7NB 1V1PB 3AE4B 3H09A 1DYQA 3S1MB 3VA5A 2RPVA 3IAYA 3RZDB 2W55A 2KJXA 2HQEA 2WACA 3NVVA 1PDQA 3FMCA 3R93A 2B2YC 2K32A 3DEOA 3OMGA 3N52A 4Z9CB 1O7YA 5EE0A 3M7NA 4PV1C 1FYCA 1KAAA 1K52A 4JK1C 2JE6I 1JMLA 3R8BA 1AW7A 1LABA 1ZYRC 4J1MA 4RKLA 3FEWX 3U7ZA 1HCZA 3AEFB 5I9OA 4ODGA 4XDDA 3RD4A 4RHRA 1SIJA 1WSPA 1X3QA 1Q12A 2LFNA 5A35A 4B0EA 1C76A 4RGOS 1CZWA 1SYGA 5ELDA 2V0GA 3IAM1 3TZUA 4MHEA 3NTKA 3M3YB 4R9WA 3RUZA 2WP9B 1NUCA 3EJIA 4FXGC 2WS3B 4QUFA 2VXWA 3NZ3A 2BOSA 3O13A 3S16B 2FBWB 2EOTA 4A8XC 2Q8IB 1CHPD 1UWXA 1GHJA 2GA4B 3OWEB 4BS9A 5J39A 2MP1A 5C4XB 3AN1A 2EJMA 3NQIA 4CKCA 1FRRA 1PTOH 1SNCA 2KECA 2J0TD 1QOAA 2BTEA 5H8YE 3SXHA 1B53A 2JP1A 4IUTA 4HN7A 1VZ6A 5C0XJ 1O7ZA 2XVSA 2F0VA 1SAPA 4CHTB 2F0LA 2AUJD 1SNQA 5C3XA 1VZ7A 5CYUA 3AE7B 2EPBA 1JQ4A 1S5BD 1F2YA 3VYSA 2X38A 5NUCA 3ZQ4A 1DCZA 3WCQA 5KGUA 1HTLD 3AE1B 2KQ4X 4NJCA 5FKAC 1N5WA 1W6KA 2JSOA 4HCEA 3TSSA 2Y5PA 2NZ1D 4QF4A 4US8A 2GRIA 3NUCA 2E75C 2QKIC 1PRTF 1D5MC 3NVYA 1TS5A 4KK7A 4KKIA 1RFKA 1L0YB 3KBGA 3J80L 4YSZB 2FJ2A 4DU9A 4DXGA 1JQYD 1ZOYB 1HFNA 5K36H 1I6HB 3AE8B 2NMQA 4C7ZA 2CQAA 2EXZA 3BYYB 3PUYA 4QIWB 1Q3LA 1F2ZA 4EE2A 1B2TA 4IUQA 3I73A 1ROEA 5BN4A 3D4DA 1WTQA 1PFNA 1GUGA 5TSSA 2I2YA 1YN4A 3AB9A 2F03A 4C3HG 1R7SA 3MP9A 5DM63 3H8HA 4YTNB 2BW2A 2BCOA 2EDGA 4Q5VA 2ICIA 3MA2B 2PO4A 1UEAB 2JA7B 1I50B 2KEEA 3D6WA 4HJGE 3AEGB 3V2TA 2QMTA 4AS1A 3QB3A 4XT1B 3NXWA 2PYKA 1EQVA 4K2KA 4RCOA 3IAS1 3R2IA 4N59A 3EUB2 2W3RA 1F2RC 1STGA 4H13C 3ZJUA 2I07B 1F9PA 1RF2D 3OPOA 2WAQB 1MGSA 1H9SA 2W82A 4F87A 1L0XB 1G6ZA 2B76B 5E6JA 2PMZB 1G8ZD 5T1IA 1ENCA 2K04A 2L12A 4N9TA 2RDFA 5C5LA 1S5FD 2E2HB 2PZUA 3I4MB 4NZLB 1YNTE 1SYDA 1SE3A 1DGJA 2B8GA 2BBCA 1HFGA 4NW2A 4XDXA 5DNFA 5M5YB 2Q5WD 5ELCA 2WXQA 3AM9A 2XWJB 1E10A 1STHA 4C3HB 1SBBB 5I6WA 1XO3A 1P7FA 1G91A 3KWVA 1CZPA 2AQ2B 4B0MA 3UI2A 1ILQA 2E76C 1NI3A 2WXJA 1UWMA 4RHSA 5LHY1 2WV6D 1MSHA 2F0IA 2KCCA 3OHXC 4XDCA 3IKJA 2K5PA 2RDGA 4M1UB 1V8CA 2PPBC 2M00A 2ZT9C 4IURA 1RM6C 4WWMA 3SEBA 2B63B 2BT6A 1GUTA 2D5GA 3I72A 5K5PA 3QG1A 5BMGA 5EPJA 3DWMA 2W54A 1AN8A 1U4LA 4Q2JA 1EU4A 3FC4A 2EYHA 1QOFA 3N6RA 3VRBB 4G7ZC 1EY9A 2K6AA 3OOCA 2CHBD 1F2RI 4C1NI 2XNAC 2B39A 4DAVA 2LEKA 1DXMA 1RD9D 2B2TA 3OMCA 4NKLA 1A2TA 1A3TA 3NBIA 1PFBA 1HA6A 2PLPA 1EFID 4OIJA 4HEDA 2BS2B 3CWIA 5C5MA 1Y8PB 3P75A 3GQBA 4RGMA 1WYGA 3LB8C 2N0SB 1VZ8A 5KEEA 5FO7B 3HOUB 3M7GA 2G9HD 5EE9A 3SR6A 3AE6B 2WB1B 1C4CA 3BYTB 5M5WB 1SE2A 4NMZA 2WXLA 5CV9A 2B2UC 4A9AA 2QDBA 1GB1A 1GXDC 1YNJC 5BYRA 3FVQA 2WKCA 4L6TB 1O78A 2RSNA 4USAA 2C9OA 1K83B 3CRLC 1BF4A 1OQQA 5DM73 5EKLA 3TEYA 3HOVB 1EIGA 1TY0A 2ZW1A 1ONLA 3NS1A 3GS2A 1RODA 1V43A 4IUPA 1Z7TA 4N58A 3AU7A 4OZCA 2EJGC 3K0YA 1OXUA 4RNAA 2F0UA 2F1MA 2PVGC 2MJEA 2AWOA 3VR2A 1E6EB 4LMQD 1WD1A 1TVXA 1EYCA 4KD4A 1XYIA 1KLUD 1WTWA 1ET6A 1TY2A 1KF6B 4DFAA 2L11A 1CM9A 1Q1EA 2IPKD 1F9QA 4K5XA 1GB4A 1WXQA 1BCPC 5G3LD 1EU3A 5M9OA 5E4WC 3PZ7A 4M0WA 1J7AA 2F0NA 2ZXPA 2BDOA 4A3JB 1SJED 4RA8A 4A90A 1II3A 1E7PB 1EY7A 2D2CC 3AECB 3HOXB 2ENBA 4ZYSA 1PDXA 2OT2A 3VRAB 1C79A 3K5OA 2EELA 2VB3X 1BMLC 1AFPA 1SFOB 1L4ZB 4A3BB 1JWAD 2EYPA 1QNKA 2JEBI 1DOKA 1KDBA 3ERQA 4BY1B 5DAUA 3K5LA 2WXHA 3QOJA 3TBIB 3X3NA 3AE2B 3X3MA 3FRPB 2EVBA 1QJOA 1B50A 4WIPA 1LLRD 3S2HB 3Q0AA 5CC4A 4WQMA 5M3FB 3GTLB 3K59A 4UDUC 3IFTA 4DQOC 1HQRD 5CBEE 2DYOA 1EWYC 1ESRA 1ENFA 5EBDA 2NN6I 2FFKB 1Q1BA 2NN6H 4ZUIA 4R8IA 3HOWB 2JYTA 1V1PA 1JWMD 2IDYA 1IBXA 3SK8A 1JROA 2D5DA 2SNSA 3Q8FA 5EBCA 2ACZB 3PUWA 4OO1I 4ZKBB 2V3NA 3C8YA 1DJRD 2LS01 1FM0D 1LTBD 3DWQA 1I4HA 1DD2A 3P20A 2IL8A 4NDXA 2RDHA 3MFYA 3WOEA 3I90A 4LTUA 3T4AC 1SYEA 1STNA 3WDNA 3MVVA 4KGTA 2K03A 3M4OB 1I4RA 3K7AB 1D1KA 2F0HA 3TMEA 1XCTL 2YEPB 2LY7A 1PGBA 2W3SA 3BK1A 1NYQA 1YNJD 5BYQA 3IFDA 3QJYA 4LLGM 4ARIA 4OW0A 3VR8B 1F77A 3A54A 4RFBA 3UI3A 2ZXOA 1JOKA 2BE5D 1PTOB 4XYOA 4KMUC 3J81L 3BS1A 3HZXA 3AE3B 2F0QA 2R3ZA 1JWBD 1C8CA 1WTRA 3GTKB 2R61A 2IGHA 2KN4A 3NTIA 2RKSA 4DA2A 5CV8A 1O7LA 1WWTA 3SK6A 2WXPA 1SXTA 5A2QL 3I8ZA 4JWUC 3QIAA 4XXEA 4GDLB 4D2KA 5BMIA 1BOSA 1DOYA 4G7OC 1BCPD 2J7ZA 1PFMA 3ITPA 4RWSC 3DHQA 2H4OA 3SDZA 2I46A 1DZ1A 3L9AX 4C3JG 2WKDA 4IUUA 1LT5D 1PRTC 4OVZA 2WU2B 3DXJC 4R8NA 5CORA 2AQ3B 4KY7A 3K58A 1F0ZA 4MN3A 4H0LC 5FLXE 2L1AA 1CA5A 4FNFA 4K6LA 3P4QB 3W9CB 1PUTA 1S4ZA 2FINB 3IL8A 2C5CA 2X6GA 2F4IA 5JOBA 2LKVA 4JPSA 1WCMB 2NBFA 1CK1A 3ND8A 3W1SA 3HGBA 3T3OA 1K51A 3URYA 1AEXA 2H89B 1LO5D 1EYDA 2DNCA 1W6JA 4DNRB 2F0WA 1GHKA 2ID0A 3A8IE 1LTID 1DM0B 4BY7B 2PMVA 5C4HA 2R93B 1IKLA 1R4QB 3OIPA 2F0SA 5IT9E 2K5DA 5FR3A 2E2DC 3E0JA 3PIO3 1CHQD 2L4NA 4XE0A 2F0PA 4WFN3 3LWUA 1MI2A 1R4PB 2OXPA 3OW7A 1T5XD 3BDLA 1LTSD 4FXKC 3I9V1 5DEHA 2IWHA 1GOZA 2Z4IA 5JXVA 1F9RA 1ENAA 2B2WA 1RTOA 4C3JB 3T13A 1E0ZA 1JR0D 1TYGB 3FAHA 3JAML 2NVTB 4A6QA 4ZKCB 4ID6A 3NRZA 4K5VA 1FXAA 1CTMA 1ZKOA 2VZKB 1EY0A 2RBMA 1VMPA 3HOYB 2DN8A 2EY1A 4HROA 3SFEB 1IGCA 3SVMA 2JXMB 2N88A 1XF5L 1KNAA 4N9PA 5C3WA 4ZHOA 1B9MA 1C9FA 3HKZB 1EY8A 5CV5A 1ET9A 1C48A 2N9KA 2VB2X 3K57A 5I6YA 4QCLA 3VR9B 1VRAB 4K14A 5KNBA 2K1BA 4OHJA 2NVQB 5COYA 1C4AA 3Q8AA 3I3CA 3MZ5A 5ELBA 3H91A 2WXNA 3W5VB 5IGEA 1JOOA 3VYUA 1B3AA 4XQJA 5C4JB 1GUWA 1FXIA 1XWEA 4XTCS 3IT4B 2Z8LA 3T53B 4OZBA 3MAQA 2AUKA 1D4BA 2K7VA 4IQZA 1AZPA 4KY5A 2PKOA 3V3XA 3MXGA 3S1RB 3U52E 1TWGB 2XWBB 5BN5A 3DWPA 1YQ4B 4EQPA 1CI3M 3BVMA 3L4PA 5JPNC 3TEZA 1MHHE 2L52A 1ICWA 3BWUD 4J8QA 2K01A 1TWFB 2FE8A 2EYMA 4CQNA 2I38A 3HVDA 2A6EC 1DOMA 2DWQA 2QIEB 1YJIA 1PTOD 3M85A 4DF7A 5F2DA 5E4XA 1E2VA 1WD0A 1D1IA 5H92C 4KKTA 4QMGA 1Y1WB 3E5SA 1JWUD 4ILWA 3HS0C 3HOZB 4ZHPA 2WDRB 2NVXB 5KIXA 3RPFC 1HTPA 5ISRA 5GXGB 2OF1A 3U9OA 4I7ZC 1Y69U 4GDKB 1XLNA 2KWDA 4HKZE 4A3FB 2YYZA 1NVID 4EGVA 2N7JA 3B2FA 4PMWA 1B1ZA 2GB1A 1QILA 4K5WA 1ZYRD 2F0GA 3PO0A 2TMPA 1QKZA 4S3SA 1PLFA 4IUVA 2FMCA 2V4IB 3PMFA 1KDCA 2L55A 2CVRA 4BWGB 3TP8A 4N6EB 2LFIA 1YQ3B 5EE3A 3V96A 4YTMB 2WP8J 3PIP3 4XQNA 4FYDA 1VCIA 2FHTA 1SSOA 3QWNA 2BDNA 2NWGA 2BB5A 2F0KA 2KA7A 4EQNA 1AZQA 3GV6A 4PNYA 3Q8BA 1KFYB 4J6HA 3A56A 5CBAE 1S5DD 1BBXC 4ZK9B 2WU5B 3DWAA 4BBRB 2O5JC 4JX1C 2QJLA 2K5WA 1K8OA 1QCBD 4X3UA 4HKQA 5JVG3 2IX3A 1GAQB 1IW7C 1Z47A 2XRQD 4NP5A 1J7CA 3EVQA 3P4RB 1RWSA 3J7AV 3T16A 1EQTA 1G2SA 4F7XA 4JWSC 5JEAH 1YNNC 1I6VC 4MH8A 3GTJB 2F3VA 1SNDA 4H44C 3VYRA 1QWYA 2NB0A 4YT0B 1JB3A 4RKBA 3DWGC 4PMBA 4ARCA 1C78A 2EZVA 3VQIA 2PZTA 1NENB 1Q90A 3FPPA 3AV8A 3SK4A 5G5GA 1ZUD2 3MXUA 3Q22A 2VZKD 4KJOA 2E74C 1SNOA 3FPUB 3KLSX 3NBHA 4MM3B 3NSWA 4J3OD 1JWSD 2CJNA 4ZRZA 2NN6G 4C7YA 4YWGG 5EQ0A 1Q10A 2F0JA 4YIJA 4WH4A 2MPMA 1VR9A 2B2VA 1JCKB 5I4DA 4OO1G 1ZE3D 2WXKA 3T56B 1QF6A 4BBSB 4LK1C 2KHSA 1H9MA 2A6ED 5I2YA 5EE1A 1LT3D 3NUHB 4L1BA 2ZW0A 1VJKA 4L2YA 3U9SA 2DLBA 1TKYA 3E6ZX 3NP8A 2M56B 2RMMA 2XN9C 2WQYB 4BA1I 3PZ8A 1YJJA 2BA1A 4US9A 1XX8A 2JYOA 2WXRA 1UNSA 1FD6A 3D8GA 1STAA 3HP3A 1EZ6A 1OO9B 3LYYA 3AEEB 2ON8A 1FNVA 4RH6A 3MTSA 4NAMA 3F2UA 1U4MA 5AUKA 2JXTA 5C3JB 4XIGS 1VDZA 2K28A 2FUG1 2F0FA 2OEOA 1J7BA 1JOQA 1D5XC 1O80A 4X3KA 1Y8OB 2JSVX 1SYBA 1BCPB 2M0AA 1IYUA 4CJ1B 2F0DA 2MH7A 2EYOA 3TP6A 1VDVA 5JAVA 2EKIA 1I7HA 4TKOB 2LUMA 3NWSA 1TR5A 3BVGA 2A5HA 5C2TB 3CKIB 3NVZA 1XLQA 1FD7D 2CW0C 3KQ4A 1LTRD 1Z6HA 4FVMA 1V97A 3TEXA 1C77A 3GTMB 3P63A 2IGDA 1OXTA 2D9UA 1U9RA 2L0CA 5IIFA 1IW7D 1I4QA 5MPOA 4MIUA 1WTXA 1XTCD 4MACA 5T1GA 5KNDA 3D4RA 1S5CD 4XWWA 1OXSC 1YNND 1OXVA 1I4PA 4E6IA 5G3LF 3AH7A 2Y3AA 2KEDA 5FO9B 1ZP0B 1VLBA 2PW5A 1BUIC 2WXIA 4WORA 5JJZA 3NQTA 1YMHE 3ETRA 4O1NA 2AWNA 1WTPA 4CJ2C 1BO0A 4G7HC 5CGKA 5BYSA 2IX0A 2IT1A 3EROA 1PGAA 3VR5A 1KABA 1SJHD 1NAPA 1QG7A 1E2WA 1TQOA 4KY6A 4A3DB 3HRDD 3J7AF 1ZXTA 5KNCA 4IUNA 1GPXA 2WXFA 1LTTD 1FFVA 2K33A 1JALA 2KVMA 1EIHA 1K8MA 4KHZA 1FNWA 3R2TA 2B2YA 3PV0A 2DYMA 1MBYA 2BA0A 3L3OC 2R6GA 4HR7B 5C0XI 5M3MB 3W5UB 2Z4HA 1A2UA 5KYIA 3TP7A 1PXUA 1CFMA 2PQEA 4RF0A 4V0BA 3G7LA 4FF2A 2B2TC 3Q69A 2BYTA 2K9XA 5EPLA 1NYRA 4G4KA 5JEAJ 1ZXHA 1OFFA 1H9KA 2LHDA 4IKGA 4OO1H 1CQVA 1JE4A 3DMUA 3V05A 2H1EA 5EGTA 1TS4A 1V1OA 4C3IG 2LJIA 1RCVD 2WXOA 2LMCB 1GUOA 4B08A 1QE6A 1WTVA 1Q8IA 1YN5A 3HEJA 5IGBA 3IXSA 3BZDB 5HI1A 3KBXA 1QOBA 4C56C 3AE9B 1VF5C 4KN4C 3S1NB 3TP5A 1NR2A 3QOLA 3I70A 1BDOA 2H88B 1LACA 1EWCA 1PZKD 2M2LA 1RJTA 4DAYA 4ZRPA 3D31A 3WOFA 2HDLA 1A3UA 2NTTA 2QSDA 1EEFD 2LHEA 2X69A 4DXFA 3VR6A 2G1EA 1NCVA 4K2LA 4OGQC 3RLFA 2EE1A 1PRTB 5AFWA 3K5NA 1L4DB 2KACA 3AMZA 1E2ZA 3C2PA 4PQXA 5I9PA 5BN3A 2BS3B 3KLRA 3PUVA 3BG3A 1T5EA 2WDVB 2F3WA 1SF0A 4TQ0A 4LJZC 2MUYA 1XEEA 3TUOA 4HSVA 3P1HA 4P6VF 3N9YC 2DBYA 1BQQT 1FRDA 5KYLA 2E2JB 3J9CA