3TT1H

Crystal structure of leut in the outward-open conformation in complex with fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
212
Chain Sequence
b'QVQLQQSGAELARPGASVKLSCKASGYTFTDYYINWMKQRTGQGLEWIGEIYPGVGTTYYDEKFKGKATLTADKSSRSAYMQLSSLTSEDSAVYFCARRTVTMGRYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine transporter LeuT
publication title X-ray structures of LeuT in substrate-free outward-open and apo inward-open states.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transport protein
total genus 35
structure length 212
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt1H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt1H02
3T65B 3C2AH 1NBVL 2NX5D 3PP4L 5IKCA 3PHOA 3RWEB 5AD0A 4C83B 2BMKA 4JO4L 4L3EE 5BS0B 4XNZB 2BC4A 5CINH 5CEXB 4K8RD 4UDTB 1F90H 5CP3H 2EE2A 4YDJA 4RRPG 4MNQE 5F1IA 1IGTA 4NM8L 5BV7B 4KUZL 4L8SA 4Y16C 3GMQA 2DD8L 2VWEC 1FFOB 4Q97A 3SPVA 2YBRA 4ZOAA 5D2LB 4QRQA 4ODVH 1JMZA 4A6YB 1ES0A 4YXKL 3HZKB 2H32B 1EZVY 2HN7A 3MRIA 5EU5B 2DLIA 2NY6C 3L7EB 1KEGH 6CGTA 2NR6C 3G6DH 4LCWB 2YA1A 2DQUH 5HDQH 1NCDH 5EFIB 3VXME 4J3WA 3G5ZB 5L6YL 1WEJH 3BQUB 2LTQC 5FYKU 5D70H 3EO1B 3QXDB 2B4CC 3KJ4B 4BFEA 5JZ7C 1DUZB 2R2HB 4HX1A 2XXCB 1QQDA 1KCSH 2APTA 2AABH 4QRTA 2MPAH 3IAQA 1NFDF 5CSGA 4P23B 1MRCH 4R7NB 3SE8L 4XWGL 4LLMA 4QKXB 4HH9B 1AQDB 4HIXL 5C2BH 1FAKT 3HMXL 1Z3GH 5IT2L 3GMMA 5BZDA 4LSSL 4L8SC 4LK4A 3VGHA 1QFHA 2Z31C 2X9YA 3VFWA 2MCPH 3FB8A 3NFNA 4MQTB 1BAFH 2WBKA 3D5OF 4OGAC 5TDNB 3ULVE 1WZKA 3UJTL 2DIJA 4M1CD 2FD6H 2AQ2A 3QIWB 5DEFB 1EUUA 1T1XB 4OLEA 4JFED 2NXZC 1B0WA 5EUOB 4JHWL 4PJDE 4PRPA 1QFWI 3I6GB 3RWIA 3MV9D 3QP3A 4WDIB 3G9VA 2R0LL 2YS4A 3REVA 3D18B 3QJFA 3T3PE 3TN0D 5D1ZA 5DMKB 4LNVA 5A2IH 5MEPA 2YXFA 4EIGB 4QRSB 4JO1L 1NLDH 4Q74A 5DF0A 1YUHA 4H25A 1AO7A 2D7QA 3KHOA 4LSPH 4PJFE 1CXHA 3ZHLA 4PJ8A 1XR8B 1MREH 3S5LA 3B4NA 1DBKH 2B39A 3GMOA 4FS0A 5KBNC 5L2KE 1FHGA 4N8VG 5T1DL 4OTXH 3D39D 1QSFB 1L7TH 5F97E 3EYOA 4I48B 4FZEL 2ORBL 1UQSB 2OL3H 4KRMB 3DX6A 3WEXA 4PJ5A 1FZMA 1K4CA 1M6OB 3BJLA 4JRYA 4LSVH 2Q86A 5FUZL 4XBEL 4NKDA 5HYSG 3OHXB 4NGHL 2C4XA 5T3ZE 4FQCH 5D1ZC 2XWBA 3V5HB 3QEHA 2A0LD 3B2UD 5ISZE 2O93L 2AV1A 2X1XR 1LO0L 3IDYB 3SDAA 3Q6FB 5I1LA 5F1SA 1I9IH 1Z5LB 2FYYB 2IANB 3QB7C 1J86A 4X98A 3VGFA 1G1CA 5CJQH 4PJ8C 1JN6B 5L2JA 2YEZA 1W0VB 1V3KA 4GW1A 1A6WL 4KRLB 3CK0L 4H20L 2D7NA 32C2B 2QKIB 5FKAB 2AXFB 4PTTA 3JWOH 4PR5A 3HUJA 1FNEB 1JNLL 1T2JA 3QA3B 5F88A 4NCDA 4OD1H 2ARJB 3C6SB 2YRLA 4M7LH 4Y4KB 1QNZH 4O5LH 5DJZB 4J1UA 1YDPA 3ZDZE 4WUKL 3SGDH 1KIUA 4YBLC 3C8HA 1FE8H 4XP9L 1AJ7L 2EO9A 2CRYA 1LO2L 1HOCA 2OI9B 4P5TB 5I8KH 2EDYA 3S37L 3CX2A 4Y5YC 3SDAC 1FGNH 4S2SA 4Z5RA 3P9LB 1G7LA 4G6KL 5LJYH 1R3JB 4DAGL 4RGNE 5LVEA 1WBXA 1WWCA 3B9KD 4XC3H 4L4VB 4P4KB 1FZJB 3GSNA 4WUUB 1NDMA 1RIUL 5EPMA 4RIRB 4U7KA 4ELKB 2V5MA 4HLZH 3RA7H 4DN4H 4ELME 2XFXB 4G3YL 5E4EC 3EAKA 4YXLL 4LLAA 2UWEB 5FDYA 3H9ZA 4UB0H 3UTTB 5GGSA 5CJ8A 1F4YL 2ESVB 1REIA 2MQ0A 4Z7UB 1PBYA 3F6IA 3D3VB 5I8OL 3BEVB 3SE4A 2BDNL 3VWJA 2YRPA 2E27H 5HTSA 5D7LB 5CEZL 4X7SH 2CUMA 1CBVL 2DLTA 4PG9A 4XNYH 2IAMB 3A6BL 5EOQH 2C5DC 3JV4A 4X4YA 3B9VA 3IDMB 4PV9A 4RQQB 3WDIA 3BDBA 1RMFL 2FZ3B 4HUVA 5J6HA 3KVQA 3ARBB 4YHZL 1KN4L 4QHNB 4K8RH 3B5TA 4XCYA 2PYFA 3D2UD 1U95B 3DUUB 1F00I 4NSKA 4AL8H 2V2XB 1GZQA 1KT2B 4PJ7F 1F6AB 3VXQA 3WJJA 2EE6A 1P1ZB 3TBTA 4CMMA 2DICA 3RDTB 4XP4H 2IPKA 1IQDA 5GS0L 4KRPD 3DMMD 5AZ2H 4LP4A 3SE4C 4I3GA 2VLRD 4DJMA 2CIKA 3VWJC 1T04A 1XGYH 1K5NB 4NKOB 3V5KB 1A7BA 5AUMB 2BY2A 1NBYA 3S36X 1WITA 2HVKB 4B5EA 2YXMA 3AS0A 4R4FL 4XPAL 4EQ2A 1WTLA 3MGOB 1YEJH 3OZ9H 3QDJB 1ACYL 3MYJB 1G7MA 1MNUH 3V4UL 2VLME 2EDLA 3WXWL 2ZG3A 4QTHA 3LHPH 2PYEE 4GH7B 4GQPH 2R0ZH 4MWFB 3GIVA 1OAZL 1IC7L 4HJGA 3CDFA 2I5YH 3I3DA 3X12B 4MXQD 4P2RB 2SEBA 4J4PD 5BO1L 2XTJB 3WJJC 4YX2H 3FT3B 3RQ3A 1EH9A 2GSIB 2R9HC 5J1AB 3S35L 1CFSA 4HDIB 4WEBL 5FYKE 1TQCC 1RUKL 2OQJB 1JYXA 4OD2B 1HSBA 3NIGE 4XCEB 3F7YA 5IR1A 1DEDA 3HFML 2HWZL 1JYVA 3R06A 1Z0NA 5FHBH 4LDEB 5DDHA 2EKJA 4BZ1L 3WSQL 5DJCB 3MRMA 3CAFA 5KVDH 2VDLL 3W2DL 1EHNA 3L3IA 5HJ3A 3F8UB 1YNTB 3PP3K 3NCJL 3QUMB 4NBZB 1HYSD 5KS9B 1S9XB 2E7HA 5CBAA 2X4RA 4QRUA 2VDOL 5D1QA 4QHKJ 1S9WA 1LE5B 3O4LB 1IAIL 2P24B 4I2XE 2P5EB 5F89A 1UWEH 2QQLH 2HH0H 5E24E 2RR3A 5JXEC 4QOKB 1Z9MA 4PJGF 4K2UL 2WUBH 4HXAH 2PO6D 1SHMA 3OB0H 3JUYA 3MBEB 5D7KD 4G9DB 1Z9OA 4PG2A 3FFCE 3IETB 1HH9B 2GTWB 3VRLF 5EN2A 1EGJH 3DXAD 3KXFA 4O58L 4X9BA 5E9DE 1IEBA 2GUOA 5KAQG 5F9WC 3VFMB 3BAEL 4L3EB 4F2MA 1N8ZB 2P8PA 4PY7A 5E8DH 1RZ8A 5J13B 3EFFB 3KLDA 2HFGH 1CCZA 1FNLA 3OKOA 4MNQB 1NAMH 2JELL 5HBBA 3VXOA 3BZ4A 2O5YL 4HZAA 5TDPB 4G6AD 4DQOH 8FABB 4GAYA 3C2AL 1A2YA 2B20A 1MCSA 3MRBA 3WBDA 3PF2A 4QXWA 4XVJL 2W38A 2YPKA 2YSSA 3HZYB 3NA4A 5M95B 4I9WE 5CINL 5GIRA 4N8VB 2NXYC 3MUJA 3CLFH 4ZD3H 4TSCH 1EBPA 3LH2H 1GJIA 3VXMB 4KK8C 5HHOD 4UNTA 2R2BB 3RVXC 4NQCD 3MRKA 1TIUA 2NY3C 3WL9A 4L9LA 1KPRA 4AT6B 5CEYA 4AIOA 1F2XK 4U0QB 1XF3A 2ADJB 1MCNA 1E27A 1KEGL 1EVUA 5HYSB 2CXGA 3GUTB 1QR1B 4APQC 2JIXB 3E2HB 1I8KA 2DQUL 2WBJB 1QPXA 5HDQL 2YPLA 1M71B 3ULSB 4EQ3A 5FOBB 4Z7VA 1JPGB 4IIQB 2AJZA 2V17H 5D70L 5I1IH 1J87A 1KCSL 2MPAL 5JOPD 3EYVB 4JFQA 4NM4H 3BN9C 4UT6H 5F3HB 3TPKA 4LIQH 5IB1A 4Y5XA 4Z7NF 4M4PA 1CDIA 2J8OA 1P7QB 1U91A 3KWWA 5C2BL 4U6XA 4F80A 1Z3GL 1C5DA 4I8DA 1H3XA 4PJDB 5DYOA 4JDZA 4G8EA 1YEKH 2DWEB 4LCWD 4XVUD 2IJ0C 4BQ8A 1TETH 5EDXA 4EUPH 1BAFL 3QEQB 2AP2A 4LOUD 4U0RB 2DIBA 3BQUD 1DQTA 3V6ZB 3BUYB 4RMRA 4N5EC 3UDWC 2EC9T 1H3TA 4NT6B 4EEEA 1JYWA 3LEXB 1YY9C 3R0NA 4P23D 1DE4B 1U42A 4YEEA 3V9FA 4GOSA 5I75C 5IFJB 4P46D 4XB8A 4K7PH 5D2LF 4PGCB 3MJ9H 4AIZB 1C7SA 4PJFB 3QUKB 5D5MA 2AXGB 2DMCA 4KTEH 4LCUB 1AGFB 3ISWA 1D9KB 2XY2A 4LARH 4HLJA 1NLDL 1R6VA 4AQ1B 2GK2A 3SQBA 2DOCA 5T1MA 2V5YA 2EH7L 3AMKA 5HGGS 4M7KH 4CVXB 4UV7H 3A67H 1OQOA 2ZP0T 3ARWA 5C0DA 4PJAF 4PB0H 1T20A 2C7UB 1DBKL 1EFXB 1X6NA 2H9GB 1ZVYA 4OTXL 1DP0A 3MPCA 1L7TL 1EAPB 5A3ID 3VD4A 4PP2A 2BRRH 3QR2A 4QWWD 5BOZG 3ES6B 2OL3L 1SJXA 4P49A 3L3DB 1CE6A 4YDLB 4JO2L 3UC0H 1MQKL 3NPSB 3QHFH 1EJOL 5J1SC 3SDDA 5TE4H 1EO5A 2BCKB 1FO0H 1MJUL 5DUPH 4PGEA 1JV5B 2HJLB 5FGBA 4FQCL 1GC1C 1SJEB 3OF6D 2QSCH 5IBTH 2XRAH 3OB8A 2OZ4A 2O61A 4JFHD 3RWGA 4NC1E 4PRPE 1UWGH 3OGOE 4KK6D 1I9IL 4P5KB 2EDXA 3MNWB 1QSFD 1S7RA 4HW6A 3L9RB 3REWB 5I18L 1RU9H 5KSAB 1UM6H 5DSCB 5GGVH 5I16A 1I8MA 2A74A 1T1WB 5CJQL 3BPLB 3ELAT 4M7JH 4QNPF 5E2UH 5IIEB 4HKZA 3LN9A 4DGYH 4RAHA 1ZOXA 1CF8H 2OTWA 3BGMA 4F7CA 1AO7E 3O4OB 1L7IH 3JWOL 1YNKH 5D7IF 2F53A 1S7SA 3IKKA 4U05A 3VH8A 4M7LL 1QNZL 3QFDA 4RGNB 4O5LL 5C0FA 4HWZA 1IC4H 2IAND 4ZS6C 5B4MC 5ESAA 1J8KA 5FGBC 3TPUB 1XF4B 2F8VA 4CDHA 3WUWA 1FH5H 5DMGC 4OUUB 3D1MC 3SDXA 1JVKA 4JGMA 4NO5A 4PJ5E 3R4DA 3PWVA 4ONHB 5I19H 1FGNL 4WIQA 1L0XA 2DQTH 1RZ7L 3W0WE 3C6LA 4JFDE 1MCOL 1I3VA 2XACC 4JN1H 4LF3B 2CR3A 2CKBB 4Y5VA 3DIFB 3WNLA 3VG9B 3LV3B 3QWQB 3C8KA 3LS5H 4Y4KD 5GGRA 5I1DB 1Q9LB 1R5IB 2VDKH 3BPCA 4RFEB 5H35B 3S37X 1GRWA 1HSAB 4K7PY 3RA7L 2W59A 1IEAB 3G6JF 1N59B 2I9LB 4WI3A 3UJJH 4Z95H 2G75A 2NMSA 1XCQA 3MRCB 1JPSH 3BXNA 2QV2A 1VCAA 4UB0L 4E42B 4YHPB 3MLSH 2CIIA 1I1FB 1LEGA 4N90D 2WWMD 3SE3A 3PWLA 3BOVA 4X6EB 2B0SL 3L1OH 2VKWA 1KGCE 1NSNL 3BD5A 4YZFE 4OZHF 1G7IA 4L4VD 1MHHB 1GGTA 4LHJB 1RURH 4X7SL 3WMSA 1KTDB 1H3WM 4WUUD 4BZYA 5ALBH 1AD0A 2C3HA 1U8HB 4Y5VC 2CGRH 4PLJD 2W0FB 1N6UA 4K8RL 2EIEA 4GBXA 2ESVD 3NVQA 1KNOB 1FYTA 3QDGA 4Q6IB 4RX4A 3D3VD 4G7VH 1FG2B 1D5IH 2G2RB 4HCRH 4HUUA 4JG0H 3S5LG 1G9EA 4LPVA 4Y2DB 1HHHB 2Z8WC 5D7LD 3T1FB 3BKCH 2NY4B 5FB8B 4JGUA 4X7EC 2EIBA 1LMKA 2X05A 4XP4L 4OM1L 3VXTA 2IAMD 5J56B 4KI5E 3HS0B 3SE3C 2PYEB 3RU8H 3RVVD 4DOHE 1U3HB 4XP1H 3MLZH 2UWEF 3DX9B 1XGYL 4MA1C 1MAJA 1K9TA 4AENB 5JOEA 3GMLA 1EXUA 3ARBD 5IQ9A 1U8MB 2EDQA 3PL6B 1P4IL 4UDUA 4GO6B 5GGVY 4KU1A 3SGDI 3QEGL 1P4BH 4CJ0A 3OZ9L 4Z7UF 3VXRA 1A4JB 3RIAF 1PJ9A 1QRNA 3CFDB 4M7ZB 1KXVC 5FO7B 2I9TA 5EA0H 3SGJA 5DD1H 4ZAKB 3NIDF 2NY0B 3RDTD 3ZHDA 3TCLA 4GBXC 1OQXA 2I5YL 1MPAH 3C60A 1U8QA 3GBMH 4HS6A 2P42B 2ZUYA 4YX2L 2D03H 4HUMB 2W9EL 1EZVX 2R8SL 5DHVA 3OKDB 1ZVHA 3MRDB 3VFOA 1NCBL 2R39A 3QDJD 4H1LA 1KJ3H 2EKSA 3UX9B 4JFFE 1CS6A 3HN3A 1BF2A 5JOFB 3F7VA 4X4ZA 3FQWB 3QUYB 3ARQA 3DVIA 5C07D 4I2XB 4OZGB 1FC2D 3HA0A 4P2RD 3E8UH 4XTRD 1UXSA 4LCYB 1HKFA 4G6JH 2X9WA 1J5OL 4TNWK 3SGJC 4JM2C 2ZOKA 3SO3B 4W70A 3ESUF 4FQIL 1ADQA 1EEQA 3DVGB 3G5XB 3GSVA 5JIPA 3FFCB 4CJ1A 2XKNA 3EDEA 1JF5A 3GGWA 4BELD 5E9DB 3ZKXB 2CH8A 3KNBA 3SKMA 1UWEL 5E2WH 2EYRB 1KJ2A 1MVUA 4QXUH 4U1LA 1B6DA 2WUBL 2L7UA 4Y88A 3BMWA 1AKJA 1OAKH 3O3DB 4HXAL 4KZEH 3ZT7A 1YEFH 4KKAC 4OB5H 1MCJA 3P4NB 4M1DH 3WLWD 4IEFB 5DQJA 1DVFC 3OV6A 4LLUB 4ODXA 5E99H 3QPQD 5C0GB 3GHBH 1BBDH 5HYJA 1MI5E 4QHKI 4G8GA 4KDVA 4OKDA 5TH2A 1WBYB 3O4LD 5ICXB 3NAAL 4S0TD 3P4OB 5E8DL 2ZUQC 2IFGA 2W9DL 2HFGL 4QOKD 1NAML 2FATL 5IGXH 4G8IB 4K94H 5DJ8B 3DO3A 5T1KA 5IMLA 3MBED 1RIVL 2CMRL 3RRQA 2BOBB 5SWSA 3C5ZD 2ATPA 5HVWA 1WC7A 4HIHA 4URTB 5IVXE 2PR4H 2FH8A 5F72S 3CUPA 1QZ1A 2IPTH 1HIMH 2HT4D 3NTCL 3OPZL 1NKRA 4UQ2A 3C8DA 4DWHA 1M05B 1TJHH 1CGTA 2HJKA 4Y16B 3PGFL 3CLFL 4ZD3L 2IG2L 4KTDL 1ZT1A 3BP6B 2AQ3A 3QG6A 4MNQD 3OQ3B 3D0VA 3ZTNH 1NMAL 1P9MA 2BNQA 4NFCA 3TO4C 1J7VR 3JSSA 3AS2A 4FG6C 1HQRA 1ZGLM 3QNZA 2C4FU 1UKTA 3OKLB 3FOLB 4HC1A 3IRZA 4LRNH 4I4WA 4XXDB 1ZANL 3KXFE 1JIBA 4PLOB 3MXWL 1QSED 2V17L 5I1IL 5IKCB 3PHOB 1CGYA 5AD0B 2BMKB 3VXMD 1HINH 1U8LA 1RHFA 1R3KA 4YHYB 2WW8A 4OCXH 2BC4B 5C9KA 4NM4L 3G5VA 4UT6L 4YDJB 4Y7MA 5F1IB 1A22B 1IGTB 5CMAA 3BWAA 4L8SB 4D3CH 4MAUL 1GGYA 1WV7T 3GMQB 3ZDYE 3VFNA 4Z8FL 3SPVB 3GKZA 3ILPA 2GY7B 2YBRB 1YEKL 4QRQB 4J3OC 1ES0B 4OZFG 2WBJD 4QXGH 5LCVH 2HN7B 1TETL 3MRIB 1WAAF 2PXYD 4N0FA 1NMCC 2XG4A 4EDXA 1P9MC 1O7VA 3ZTJH 1WISA 2VXUH 2NXZB 4NO2A 2J8UA 1MAML 3D25A 4GW4A 3ARDA 3LEVL 1FZKA 4K7PL 3Q48A 1D5BA 2FEDC 3WO4C 4HX1B 1QQDB 2AJVH 4QRTB 3RVUD 1P7QD 2EDJA 1X5LA 2Z35A 4PJIF 3IKCA 3IDXH 4LCCA 5E95B 4LLMB 3BDXA 2ZCHL 5GXBB 1CR9H 3QEQD 4LARL 2F54D 2YPLE 4Z7VE 3HPJA 3GMMB 5BZDB 5C7XH 4UQ3A 4D0BA 3VFWB 3DTXA 5IBLC 3JXAA 3FB8B 3NFNB 4PBVC 3IS0X 4M7KL 4CVZA 3U0PA 4RCAA 4JO3H 3A67L 3TZVD 3ULVF 1ZGLA 2X70A 1DBAH 1MCCA 1CI5A 2AVGA 1I7RA 4F37F 2CDGA 3CSPA 4Q9RH 2LQRA 4PRPB 1MVFA 4MB5A 2J6EH 3RWIB 2Q6WA 1QBMH 3UC0L 5JMRA 3QHFL 3REVB 2LU4A 5EU3A 3QJFB 5D1ZB 5EC2A 5TE4L 1P6AB 5MEPB 1ZVSA 3I85A 3W82A 3QUZD 4KKCD 5DFWH 2XRAL 4F57H 3OXRA 1YUHB 3F5WA 3MV11 4H25B 1AO7B 5E2VL 4XMLH 1MFCH 4LVNC 1EUTA 4MX7A 3DARA 4PJ8B 1RU9L 1UM6L 3WFEH 5CFHA 4LEXL 3S5LB 4X7TA 1I1AC 3GMOB 1KF9B 2FNBA 2AXHA 4IOSD 3ALWA 4DGYL 4PFEA 2I60L 1CF8L 1IBGH 3EYOB 3SHSA 5CZVH 5E7BA 5F7KC 4MJIA 3FOMA 3BPNB 5I8CA 1L7IL 3DX6B 1YNKL 3WEXB 4PJ5B 3QRGH 1FZMB 1K4CB 4PJHE 1OWRM 4XBPA 1HDMA 4JRYB 4P9HC 2Q86B 4NKDB 1F8TH 1RZJH 4MDJA 4YBLB 3IU3A 1IC4L 1PLGH 4KROC 2M26A 4B7IA 5C09D 2RGSA 2XWBB 3QEHB 1I7ZA 4OLXH 5FYLD 2AV1B 4CU6A 2FCBA 3SDAB 2A9NL 4UAOC 1FH5L 4YHLH 5I1LB 2BXYA 3DVFA 3DSFL 1I9JL 1XGQA 3LQAH 1X3DA 4IBLT 1N0XL 5I19L 2EDHA 5I9QC 5IF0A 3UO1H 2DQTL 3VGEA 43C9A 4X98B 3H9SA 1ZLSH 3VMNA 4ZDHA 5L2JB 2YEZB 4JN1L 4RMSA 1XGUA 4GW1B 1RUPH 4PJ9D 3GMRA 4GXVL 4JR9L 5LBSL 2VXVL 4U49A 3EW3B 4ESKA 4M3JA 4XPGH 5JHLH 3LS5L 1TITA 2P47B 3HE7D 4PTTB 2VDKL 1H5BC 4PR5B 3HUJB 5F88B 3ULUC 5CLWA 3QUMH 3P40A 1JRHL 2BVTA 4I77H 4Z95L 2DB8A 1I3UA 1JPSL 2JJTA 3U9PL 3TA3C 3ZDZF 4J1UB 2DQJL 1YDPB 5EZIL 1ORSA 3RTQC 4LSUL 1YC8A 5C6PB 4KVCH 5DD3H 1DCLA 2BHUA 1HOCB 3LMJL 4EXKA 3O9WA 4LFHG 2F53E 4M93C 1ETZA 1K8DA 2PKDA 4S2SB 4R0LA 1D7FA 1K6QH 1NCUA 4Z5RB 3T0DA 1G7LB 4R7DA 1X5GA 3KPMA 1WBXB 3H7LA 5ALBL 2VERN 4OIIH 4Q0XH 3K3QA 1FIEA 3GSNB 2CGRL 5DJAA 3W39A 1OM3H 3FONA 3O6LH 1NDMB 5EPMB 3MUZ1 4ELMF 3SDXE 1NUGA 4DOHB 5KVEH 1QLFA 5EO0A 1B3JA 5F44A 1HWHB 2VTFA 4G7VL 1J1XL 1D5IL 4HCRL 3EYQD 1NUDA 3I6LD 4JG0L 2NPLX 4D94A 3BKCL 5GGSB 2EYTA 3KLHC 1OY3B 2NW3A 1OSZA 1S78C 4JKWA 1BVZA 4O2EA 1H15A 2H2SC 3NCBB 3VWJB 4Z0XA 1WT5C 2AV7A 3RU8L 3N9GH 4YQXH 4XP1L 5LGHH 3MLZL 4X5WA 1QSZA 3V7AE 5CLTA 4PG9B 1D6EA 2J12B 5ITBH 4NQEA 4X99A 4M5YL 3JV4B 4X4YB 5A2KH 3GBNH 4PV9B 1P4BL 5TE7H 3KLAA 3QDMD 4ZXBA 3LVEA 5BV7L 4HUVB 5J6HB 1QTYT 5IUSA 4OV5A 4XCYB 1NJ9A 2PYFB 5DD1L 4A6YL 4LGSB 3GSRA 4NSKB 3WIIH 4HMEA 1GZQB 4GG6A 4PRHE 4HQQH 3FCTA 3RX8A 3VXQB 1MPAL 2PYED 1U3HD 3UTQA 3GBML 1YECH 4G43A 3TBTB 4CMMB 1TQCB 1A4KA 2D03L 3VXUA 2APVA 2IPKB 1IQDB 2FB4L 4NZRH 4X80L 2C3WA 2NX5A 3PWPD 1A9EA 3FZUD 4OFVA 2NZ9D 1R3HA 3I02A 3BD4A 2D7TL 5LQBH 2CIKB 3SDCD 1T04B 1FYTE 1V5JA 3QDGE 1KJ3L 1LK3L 1NBYB 3GHEL 2W91A 4EN3D 1C5CH 1NCTA 2EECA 1C1EL 3H3PL 3V4VL 2FJFA 1KTRL 3JVGA 4JEGB 1WSST 2UUDH 3T4AA 2Q3ZA 1G7MB 2NY1C 3KPRD 3OR7A 5I30H 1QFPA 1W2KT 4JREC 3WUWG 4QTHB 4G6JL 3GIVB 2EH8L 4HJGB 3K1DA 2DM4A 2QADD 2SEBB 4OGXH 1XF5A 3TV3H 5LWYL 1LVEA 2VDPH 3OB0K 4WV1A 1B0GA 3VXRE 3WIHH 4PJBF 1CFSB 1O0VA 5J1TC 3FO2A 1QRNE 3BD3A 1S7WA 3O3UN 5E2WL 4QF1A 4UOJA 1CFTA 5F6HI 3UPCA 5C0EA 5KW9L 3QUYD 1M4KA 1HSBB 4QXUL 3G04A 3F7YB 5IR1B 2L4OA 1OAKL 3R06B 1YEFL 4M1DL 5DDHB 4U2YA 5AAMA 5IJKC 1INEH 3MRMB 3EHBD 5E99L 4ZUWA 4NN5B 5F9WB 3JVGC 3KYAA 1JPFA 3L3IB 3O0RH 4M5ZH 5HJ3B 2WINA 5DHXB 2E9IA 1OWWA 3GJFK 5IFHH 5CBAB 1OTSD 1Y18A 2X4RB 1C7TA 4QRUB 4GMTH 4JKLA 5D1QB 1S9WB 3OSKA 2BSTA 5IEKA 1JMXA 3MYZA 3LPFA 1MIML 3PWNA 2X4UA 4JFEA 1QRKA 3U48A 2ED9A 2XN9A 5B38A 4DZBA 3HLAA 5F89B 1AHWA 3BGFC 3MV9A 3CVIL 2PR4L 5JW3H 1QP1A 2NXYB 2IPTL 3CVHA 3TN0A 1BIHA 2MNUA 1YMHA 1TJHL 1R24A 5B22A 4GQ9L 2O5XH 4I9WD 5EN2B 3KXFB 4LSRL 4HWBH 4R4ND 4DN3L 3VD5A 2NY3B 1IEBB 2DM2A 2DDQH 5CGMA 2GUOB 2ED7A 2QL1A 3LAFA 4X6CE 3T2NH 3TT3H 5JPMA 5DJ0A 3ZTNL 3OMZA 3N50A 4F2MB 2P8PB 4PY7B 1RZ8B 3EOAA 5FYLH 5DVLA 5HI3C 1NFKA 1CFVH 1C8PA 3OKOB 4HMCA 4O2CA 3D39A 3AU1A 4JM4H 3VXOB 3BZ4B 3O3EA 2CLZA 2I07A 4OCWL 4LRNL 4WFEE 1EHLH 4GAYB 2NY5C 3RFZC 2HT2C 1A2YB 5LG1A 3TJEH 1GVIA 5HYJE 3MRBB 4TVPE 5K9OA 2BK8A 4TNVF 4Y16D 1EGJA 5BZWA 4G8GE 4O9HH 2VISA 2CXKA 4FA8A 4JY5H 3UXFA 1NCAH 2X4SA 1HINL 2YPKB 3QWOA 1L9MA 4MJ2A 2YSSB 2J1KA 4OCXL 3RUGF 1JP5A 5GIRB 3RL2A 5INDA 3DUHA 12E8L 2ZNXA 2NY6D 3UZQA 2W92A 5CSZA 2NR6D 1NKOA 1MFEH 4PYGA 1GXEA 4GW5A 4JZJC 3QWRD 1WFUA 5SWSE 5ECJE 3MRKB 3WL9B 1BP3B 4L9LB 1KPRB 4QXGL 5EORH 5CEYB 5LCVL 3C08H 4H1LG 5JZ7D 1XF3B 1BEYL 3WDHA 1E27B 5J7CC 2VL5A 2CRMA 3QXWA 1XCTA 1NGQH 3F6LA 5GS1A 1A6UH 1I8KB 2CKBH 2EIZA 2YPLB 2MOVA 4Z7VB 5CP7A 2PCPA 2AJZB 1ZS8A 2L7JA 4OD3H 3CFKA 3RGVC 4J3SA 1NGZA 2AJVL 1MJ7H 3VMPA 2UZIH 1YQ2A 2Z31D 2BNQE 3T8XA 3SDYH 3IDXL 3TLRA 4JFQB 1ZHLA 4PYHA 2E5EA 5IB1B 4Y5XB 1QFUH 4OGAD 5EBLA 1GIGH 1U91B 1MRFH 3KWWB 4U6XB 4K7PX 2VH5H 4U1JA 1C5DB 5GISL 4NN7C 5DYOB 5DFVC 4JDZB 5C7XL 4G8EB 1I9EA 2NXZD 1JGVL 3WCYA 3X3FH 1PEWA 1MAKA 3U4EA 4ZO9A 2MHAA 1NMBH 4JO3L 1C08A 2DF3A 3MR9A 3B9KA 3OL2A 4JDTH 1RHHA 3K81A 3SGKA 5GHWL 4XAKD 3BP7A 4Q9RL 2CO7B 1Q9OA 4R26H 3WFDH 3FN9A 4M6NH 4IJ3C 4JHZA 1QBML 5D5MB 4YDKL 4ALAL 2Z8VC 3JTSA 1UXWA 3Q6GH 2BSRA 5KANG 2J8UE 4WW2A 2HG5A 5IQ7H 4ETQA 4TYUA 4NN6C 4Y4FC 4OCNC 1KCVL 3RZWA 4PGDA 4F57L 1Q1JH 3BZDA 5T1MB 4M61A 4XMLL 2QLVB 4WW1A 1DQLL 3WFHA 4I13B 3NIFE 3MJ9A 4H8WL 3WFEL 1ZTXH 1T20B 3GMPA 4XWOC 1QBLH 4EZMA 3TO2A 3PWJA 1G7HA 2OMBA 4PP2B 1IBGL 5CZVL 2CQVA 3QHZH 3SGKC 5D1ZD 3Q5YA 4PGJA 1TQBC 3ILQC 1CE6B 3D2UA 3U82B 4TQEH 4XMPH 2UY7A 3DVNA 3HNVH 3SDDB 1F8TL 1RZJL 4PGEB 5E0QA 4WCYH 2DM3A 4PJ8D 4MAYC 3DMMA 2MKLC 4RMWA 4WW2C 2O61B 3RWGB 3RL1A 4GJTB 4YHLL 1S7RB 1MCPH 1JNHA 3LQAL 2YZ8A 3HNSL 1ND0A 5I16B 3QPXH 1I8MB 2H1PL 2A74B 1ZLSL 1LDSA 2X4OA 2VLKD 4HKZB 1FRGL 1KIPA 5HSFA 2OTWB 5GRJH 5B3JE 4JRYD 4C57C 1FO0A 1I9RH 3BGMB 4ONGL 5DUBA 3BKYL 4HXBL 5DC9B 4U7MA 4F7CB 1CGUA 3AM8A 2F53B 4U1SA 1S7SB 3QUML 1K3IA 4I77L 3VH8B 1BOGA 3QFDB 3SDAD 4QHUA 5C0FB 2EEBA 4HWZB 4FNLH 4KPHL 5ESAB 1MRDL 4D9QE 3EO9H 4DGIH 5DD3L 3WUWB 3SDXB 5F9OH 3ARTA 1A7QH 2E6PA 4NO5B 1RZKC 5DD5H 3CSYA 3GO1H 1F3DJ 3JWDH 3PWVB 1BWMA 2BOCA 1K6QL 3C6LB 1I8LA 2VO5A 4P2QD 5HHVH 4PY8J 4Y5VB 1TENA 4OIIL 4Q0XL 1CE1H 2VE6A 3C8KB 3SQOH 5GGRB 5H94A 1MHPH 3KPPA 1OM3L 3BPCB 1GGBH 2LAGB 4E41A 5KVEL 1XH3A 1LEIA 4K3JL 3AM8C 5D72H 3L5XH 5IMMA 2G75B 3H9SE 1XCQB 3HE6A 1RZGA 2VXTL 3BXNB 2BHYA 4MXQC 4LU5H 3P77A 2CIIB 5ADOH 1LEGB 1UEYA 5J4MA 3K8LA 3PWLB 2IF7A 4YZFF 1NEUA 3FB7A 1G7IB 4MA1B 4DKFH 5FCUL 3KPNA 3U6RA 5LGHL 2EZ0C 2PO6A 5H37G 3R8QA 1VFBA 1T22A 1N7ML 4M4RA 4KGLA 5ITBL 1D6VH 1YMMA 1AD0B 3HI1A 5JQ6H 3DXAA 4EI5C 1DBJH 4F9LA 3QQ3A 2BVUA 5GRUL 4GBXB 1FYTB 3QDGB 4PB9H 3SO5A 2E9BA 3QCUH 3WIIL 2CK2A 1CICD 4KZDH 4HUUB 4HQQL 3VWJD 1NCWL 4RGMC 4AEEA 4DK3A 1IVLA 3HE6C 1YECL 4KI5F 3VXTB 3CX5J 5CCKH 1LGVA 2B4CH 4NZRL 3WKNA 3RX7A 1JF1A 5DVKA 5JIIA 2Z93A 1BLNA 4XVTH 1H8NA 3QHTC 5ITFA 3GMLB 1EXUB 2W0LA 3HI6L 1DBMH 5IQ9B 4OIBA 1WWWX 4AMKL 4UDUB 4HCRA 3LZFL 4MB3A 1E6JH 3VXRB 3FFDA 5E5RB 4B41A 1QRNB 5I30L 2FIRT 4LCIH 4NQCA 2R1XA 4F9LC 2R9HD 1Z9SA 4KKNA 2I9TB 3SKOA 1MSPA 4F7TA 4GRLA 3TCLB 3RKPA 5B39A 5F6IB 4IOIA 1QHPA 3C60B 3O2WL 4Z7OE 5KN5A 4NQEE 1U8QB 3TV3L 3IFOA 3O2DH 4HS6B 1X5AA 2KZ1B 1IGMH 5D1XC 4ZUTA 5JIHA 3VFVA 1QG3A 5DHVB 5DD0H 3VFOB 3T3ME 1IT9H 3GMNA 4H1LB 4NHCH 5TF1L 4BFGA 2EKSB 5EWIL 5HGDA 4GG6E 4EDWH 1ORQA 3GIZH 2XKSA 3KDMA 3F7VB 3A0OA 2JB5L 1INEL 1MQ8A 1S5IH 4MJ5A 3VXUE 1GGIL 2NX5E 1CGWA 4M5ZL 1MJ8L 1UXSB 1Q72L 2R29H 5IFHL 2ZUQB 1JGLL 3HC4H 5JXED 1A6PA 2ZOKB 4ZYKA 2JJVA 3GJEA 4GRLC 3LKOA 4GMTL 5D71H 3GSVB 2DI8A 1G9NC 3PXHA 5T3ZL 2XKNB 1CQYA 2D2OA 3ZE0E 4KXZI 3GGWB 4P46A 4KY1L 3KNBB 3SKMB 3M17A 2I24N 2Q76A 5C0AA 4WFGD 5C86A 1KJ2B 4HS8H 3NZHH 1MVUB 1YA5A 2P45B 4U1LB 5JW3L 2X1WL 1AKJB 4NZDA 4DTGL 3ARFC 3SJVD 2FX7H 4MD4A 2DMBA 1U92A 4OAWA 5DQJB 2PNDA 4ODXB 4ZFGL 4HWBL 3LN4A 4FFZH 4U7SA 1GH7A 2DDQL 5HYJB 4N8CH 3V6BR 3NZ8A 3T2NL 3TT3L 4G8GB 5TH2B 4N1HB 3I75A 5BOPA 3D69A 4EXPX 4NNYA 3GNMH 3TM6A 5D6DA 4RISL 5EH1A 1CFVL 3H7BA 3H9YA 4F7EA 1NANI 4POYA 3VD7A 3FHQA 2NXYD 3F58H 3FO0H 1EHLL 5T1KB 5IMLB 3QQ4A 1CGSH 4N0YH 3TJEL 5SWSB 1E28A 4KK8D 2ATPB 4IRSA 5IVXF 3OKMA 4O9HL 1WC7B 4HIHB 3U0WL 4JY5L 1NCAL 3ALPA 3RVXD 3CUPB 3ARVA 3N0PB 4IRJC 4FMFA 2NY3D 1LE9A 3PDGA 1VHPA 4UQ2B 3I6KA 2HJKB 4FQLH 1OVZA 2B2XL 1ZT1B 4JFEE 2KBGA 3L3JA 4APQD 1MFEL 3QG6B 4MXVF 3BVNA 5F7LB 1S9VA 5E1HB 3D0VB 2B8OT 3MV9E 3TVMA 4JPVH 3U7YH 2QHRH 1NMCB 4CN4A 1FZOA 1WIPA 1N2RA 3C08L 2BNQB 5TF0A 4RDQG 1HQRB 3QNZB 1A6UL 3BN9D 2CKBL 1BVLA 2HRPH 4UILH 4I4WB 5TQ2L 4FMKA 4WHCA 3DGGA 2MTPA 4F7PA 1E4JA 2FLBT 4Z76A 3CJJA 4M48H 4OD3L 3OKNA 4NJAH 2YWZA 1U8LB 2UZIL 2UZXB 3GSXA 1R3KB 4IRSC 4RGOH 1UT9A 4MQSB 3SDYL 3G5VB 1VFUA 4K55A 4MA7L 3D39E 1QFUL 1QACA 1TZGL 1CT8A 5CMAB 3BWAB 4OIAA 4N5ED 1MRFL 3ZDYF 4UV4H 1P7KA 3VFNB 1YY9D 3BH9A 1FCCA 1KFAH 3ILPB 2XA8H 4PJCA 2NW2A 1UM4H 4JFZH 2YPLD 4K94C 1CDYA 1NMBL 4N0FB 3TVMC 1TCMA 2GJ6D 3GFUA 1YYMH 4EDXB 1AY1L 5BW7A 5C0CA 3MCKA 3P30H 4NO2B 2J8UB 4HPYH 3D25B 4GW4B 3ARDB 1A7NL 3GSNH 3FQXA 1FZKB 4PJEA 2ICWJ 4WY7L 1VA9A 1D5BB 4R26L 3WFDL 2Z35B 3IKCB 1RUMH 1OAYL 3ROOA 4LCCB 1IAOA 2OR8A 4PLNC 3WN5C 1QVOA 2VN4A 2XZAH 4Z7VF 1JHTA 4PJXA 1B0RA 2DKMA 3HPJB 5B38G 1Q1JL 2EDEA 4UQ3B 4D0BB 3DTXB 5JR1H 2FBOJ 4CVZB 3U0PB 5CZXC 3DURA 1JGEA 4JKMA 1ZGLB 2X70B 3QFJD 1PKQE 4XNMA 1QBLL 1PG7W 1I7RB 4K23H 1PG7H 2OXGA 2CDGB 4KJWC 3V0VA 3IF1A 1EBAA 2QJDA 4P3CH 2D0HA 3QHZL 5FYKL 4OI9A 4UIKL 2OK0H 2Q6WB 4TQEL 4XMPL 1KIRA 5HDOA 1QYGH 2Y4SA 1T83A 5E94A 4BH7A 4KROB 5EU3B 1TTFA 3HNVL 5IW6A 3ARUA 5EC2B 3IU4H 1ZVSB 2IADA 5KVMC 1BJMA 2OR9L 1S7UA 3I9GH 4W6WB 4LIQE 3OXRB 2X1PA 3MLVH 3F5WB 5J12C 5TQ0H 2J88L 3S8WA 1FSKC 4D2NA 5D93C 5I9QB 5K93A 5KTEH 2CUIA 1MCPL 1FL3A 4MX7B 2X4TA 4Y4HD 2A6DA 2J6EA 4ZFOA 3QPXL 4X7TB 5D96C 2ZZUT 3Q5TA 4YO0A 1P4LA 2BFVL 3L5HA 4JFYA 3VGAC 5GRJL 5EOTA 1UH2A 1B90A 4ZS6D 5B4MD 4MJIB 3FOMB 4Q2ZA 5I8CB 2RFXA 4X7CC 1U2CA 3EOBA 4PJHF 4YFLF 5FYJD 4G8FA 5DMGD 2RJMA 4XBPB 1HDMB 3OR6A 4GLRH 2ADFL 2OTPA 1CFNA 4MDJB 1HZHL 4FNLL 4XGZA 5E08H 3IU3B 2Z8RA 1MCEA 1DLFH 1R3LA 1I7ZB 1MJJA 3EO9L 3M8OH 3OGCA 4MCYA 4WTWA 4F8TA 1BPVA 4FP8L 4M93B 1F4XL 4FABH 4LLYA 3ZYJA 4FXGA 5F9OL 2FO4A 1J12A 1XGQB 5DD5L 3SCMA 2AXJA 4OZFH 1LO3L 3JWDL 5EZLA 2APXA 3FAXA 2ICEA 5IF0B 2GW5A 43C9B 1UEMA 3H9SB 4WI8A 4P99A 1I7UA 4ZDHB 1XGUB 2R1WA 2VDQH 1X5XA 3GMRB 1ZT7A 1CE1L 1JK8A 5C07A 4QXTA 1GGBL 3OXSA 4ERSH 3RPKA 3UMTA 4KV5F 4GRWB 5IOPA 5LGJA 4EIZC 5D72L 4Z7WE 3U4BH 2A9MH 5MP6H 4XRCA 5T5NF 4X5LA 5HD8C 5F96L 1EDQA 4KUCD 2NTFA 1ORSB 2FIKA 5BRZD 5EG6C 3C09C 4HF5L 2XZCH 2OS7A 4U6YA 2YMXL 3NN8A 1MY5A 3QG7H 1FNGA 4PY8I 3O9WB 3HHRB 4G7YL 1ETZB 4DKFL 1K8DB 4R0LB 5BMFH 5GPRA 3SCMC 4R7DB 3LRSA 1T1ZA 1S8DA 3KPMB 2ZPKH 4OZIA 4YK4C 1HWGB 1D6VL 1L0YA 3SBWA 4BSWA 2BNUA 3S97C 5DJAB 3W39B 3FONB 5AZEH 3QRFM 3SDXF 1S7VA 1AXSA 5E5MA 5FXCH 4Q7DA 3RHWK 1QLFB 1U8JA 2VUOA 5IESL 1UJ3A 5EO0B 1A14H 3S4SA 1CDGA 4KZDL 4XMKL 2EYTB 2BY0A 2VZ1A 2GTZA 2NW3B 1OSZB 4O2EB 5CCKL 1H15B 2B4CL 2UUDK 3C5ZA 4Z0XB 4R8WL 2MQCA 2AV7B 5F7EH 4E41E 2GK0A 2F58H 1G6RA 4X5WB 5T33H 5EOCH 1RULL 1D6EB 1DBML 4KH2A 4GBXD 4NQEB 4ODSL 4X99B 1UYWH 2NY1B 2VQTA 1EVTC 1RZFH 1FYTD 1OLZA 4RX4D 3KLAB 3Q1SH 2QEJA 2D9CA 1E6JL 5DJ2A 4ZXBB 1T89C 3X3GL 3SBWC 3AY4A 4KC3B 4X9HA 2Y36L 4OV5B 5I74C 1NJ9B 1H3UA 3GSRB 4X6DA 2DL2A 3F12A 4PRID 2AS5M 3RZCC 2XA3A 1UJ3C 4GG6B 4YHKH 3FCTB 5D7KE 2N1KA 3UYPA 2DRUA 4JZOA 1YMME 3UTQB 4G43B 3DXAE 1A4KB 3VXUB 1LWRA 1CK0L 2NX5B 3T4YA 1A9EB 2IFFH 1QSEA 5I1GH 4WI4A 1AGEA 1P7HL 1JPTH 1R3HB 1LNUA 1T2QH 1VPOL 3NACL 4WU7A 3TNMA 1DQJA 1CDCA 3I02B 5DD0L 4LNRA 5HVHB 3I50H 4RAUA 5GJTH 4NHCL 3MACH 3VA2C 4EDWL 1QFWH 5I1AA 3GIZL 2FJFB 4JM2D 1Q8MA 3MX0A 1R3IH 3T4AB 3W9DA 3IB4A 2CLRA 1MWAH 1S5IL 3GKWL 3MUY1 3OR7B 1EEZA 5DK0A 2YHGA 1E4KA 5F9JA 3CNKA 2N4IA 4P2YA 3KJ6L 2R29L 1D3CA 1L6XA 2PXYA 4KQ3H 3RAJH 1V05A 4BSVA 4HBCH 3VI4E 4YBQC 2BNRA 5D71L 1XF5B 4JB9H 1FAIH 4KKAD 4WV1B 5EOCJ 1B0GB 2VZ3A 3BGFB 3IDJA 3FO2B 4RA3A 1DVFD 2GQHA 4XZUA 1ZLUH 2VR4A 1S7WB 2V7HA 4M62H 4POUB 4NQCE 4QF1B 1CFTB 5C0EB 3NZHL 3G04B 4HG4J 3VCLA 4NWTH 5D7JA 1WZMA 3C5JA 1FV1B 3P4MA 1U6AH 5JDSA 1TVBA 2FX7L 4C56D 1GC1H 1YEHH 3N1FC 3MGAA 2F54A 1T5WA 1WF5A 3IXTA 4ZUWB 1OSPH 4FFZL 4NIKB 1JPFB 4X8XA 3SKJH 2WINB 4N8CL 3OWEA 5DA0B 3T1WA 3WIHA 4POZC 2Z9TA 3BSZL 2AEPH 5JOPE 3OAZH 2IQ9H 3TZVA 1E4KC 1Y18B 4DUXA 5ICZA 3GNML 1T7WA 4PD4J 2BSTB 5IEKB 3PWNB 4FFVC 1HXMA 2X4UB 1KOAA 4JFEB 5DD6A 1YEEH 4WI7A 1AKJD 3F58L 3FO0L 2XN9B 5B38B 4DZBB 3HLAB 4N0YL 1AHWB 4LCWE 3VI3E 3MV9B 1X5ZA 2IEPA 3MLRH 2BVQA 5HHQA 1TVDA 1IARB 3MSPA 3MREA 5FGCE 3CVHB 3TN0B 5E8NA 1ZMYA 1YMHB 4HHAA 5D7JC 3TO4D 4FQLL 3MUHL 1R24B 1KACB 1VGKA 3QUZA 1I85A 2YPVH 4KMQA 4FG6D 1KCUH 3OX8A 5FYJH 3QIUC 1R0AL 3MODH 4X6CF 2OZ4H 4G9FD 5JPMB 5C0AE 5DJ0B 4JPVL 3U7YL 2QHRL 3OKEA 2VDNL 3IJYA 4OGYH 1NFDA 3ZMRA 3EOAB 4P2OA 1JZ8A 4O2CB 2DQFA 3AU1B 3D39B 3O3EB 2CLZB 2I07B 1W8OA 4K3EH 4KI1A 5F9AC 4TRPH 3T2OA 3QDAA 5EO9A 2RCSH 2CJUH 4M48L 1W8NA 5K9OB 4W68A 1HHKA 5BZWB 1EEUA 2VISB 4NJAL 1A3LL 2X4SB 3QWOB 3QZWA 5B39G 4RGOL 1AGBA 4KJPC 1UWXH 3RL2B 5JXAL 5JPNA 3IDNA 5INDB 5C09A 4DVRH 5CSZB 1LDPH 1R5VA 2BNQD 3ZE2E 5D2NA 2EE9A 1FFPA 4UV4L 4GW5B 5CBEA 1I85C 3VXSD 3CSBA 1FN4A 5GS3A 1KFAL 3PDOA 3QNXA 1M7DA 1BD2D 2XA8L 2QSQA 2F8OA 1NGPH 3K74B 1UM4L 4JFZL 2FEDD 1CXFA 4OCMC 1INDH 3U30C 4GS7C 1YYML 2VL5B 3IJSA 1NC2A 1XCTB 5GS1B 2UZYB 4PJ9A 4UU9A 3P30L 4J8RA 2EIZB 5L7XH 3BKML 2YD2A 3H6JA 3BDYL 4HPYL 5HY9A 2R4SH 4P2OC 3VE0A 4GT7A 3ZE1F 4W6YB 3HE7A 3GSNL 5CP7B 2PCPB 3WD5H 1ZS8B 4IJ3B 4JFHE 4JVUA 1IAKA 4J7RA 4ODBD 5GSRA 4U6VL 3CFKB 1QSFE 1NGZB 2Y23A 1CXIA 1IE5A 2Z91A 4CAGA 3L6FA 5IBLD 4TNWF 3T8XB 1ZHLB 4XNXH 5DR5H 3TJHC 4NN6B 2ZSWA 5EBLB 5F8QC 4I18C 2XZAL 4JPKH 4U1JB 4LVEA 4DEPC 2VAAA 4NQXA 1MFAH 2AK4D 2XXMB 1NGYA 1EERB 1Y0LA 5TPWH 3U4EB 3DBXA 2AEQH 2MHAB 1C08B 4D0CA 3MR9B 1CQKA 3B9KB 2ICWI 2OXHA 2IANE 1RHHB 2HKFL 4K23L 1CTOA 4JVPA 4P3CL 3BP7B 1Q9OB 2EXWC 3GSUA 2X4PA 1ZLWH 1QYGL 3HMWH 5FUCE 3PV6A 3GM0A 2B1AH 3DYPA 3NCFB 3JTSB 3IU4L 3CFEA 1UXWB 2J8UF 5C0CE 1HHGA 2BSRB 3V6OA 2G5BA 1WTGT 2FSEA 2YUZA 1I1AD 2HG5B 4WW2B 2F19H 2ZG2A 4O4YH 4PGDB 3MLVL 2AERT 5TQ0L 5C0NC 4LHUA 1DBBH 4M61B 4F8QA 2W9LA 3NIFF 4WW1B 3K4ZA 3WFHB 1Q0XL 4NFBA 1RI8A 4HWEL 4HK3N 4IRZH 3GMPB 4GAJH 3TO2B 3PWJB 2JCCA 3QDMA 1IZJA 1G7HB 3BPOC 1J18A 4KROD 5GGQL 5JO5A 1T2XA 2A77H 4WRLA 3BRFA 4L4VE 3D2UB 4UTBH 1V7NH 1LILA 2GAZA 3DVNB 4WUUE 3I3BA 4CRPA 3D48R 1UZ6F 4PGBA 1AFVH 2VUYA 1KCRH 4QRPA 1OP9A 1Y6MR 3CX5K 3U1SH 5E2TH 5D9SA 4KRPB 3PWPA 5CUSH 2CUHA 2J5LC 3DMMB 3V6OC 3V95A 1KEMH 4IMLA 3RL1B 3O3BA 2ESVE 3SDCA 4D9QD 1MELA 1JNHB 4LSQL 4DKDC 3D3VE 4H1LH 5J6GA 2XPGA 4JPWL 1ND0B 2DQCH 4MJID 3ULUD 4G5ZH 4EN3A 2EC9U 4WNQA 5KVFH 1BM3H 2X4OB 1OCWH 1KIPB 3MRLA 3KPRA 3V8CA 3TA3D 1EO7A 1FO0B 1MHEA 1SY6H 5DUBB 3RTQD 5AAWA 2K7QA 4ERSL 5EUKA 2F5BH 5GGRY 4YC2C 3VW3L 4U1SB 3AB0C 4YUEH 1JZ6A 2DWDA 3QJHA 2A9ML 5MP6L 1BOGB 4QHUB 3QI9C 4FQXC 4P2CG 4KTYA 3TWCH 3DX7A 2XZCL 4MMXC 1CLOH 3H9SD 4KQ4H 4Y8AA 1JL8A 4JKPH 3QG7L 3RP1A 3VDCA 1JZ7A 1CLCA 3CSYB 5IFAH 5ACLA 1KJ2H 1JI2A 1UZ8A 5J8OA 2BOCB 5IWLC 3E3QC 4KMTH 1JZ4A 4PJ7A 3WFBH 3KPOA 3MOBH 4MA8H 2EEDA 2VE6B 5H94B 2DBLH 2NY7L 4Q6YA 3KPPB 1K4DA 3ZTJG 4X6FA 2YD9A 3KLHD 3RY5A 1S78D 4E41B 5FDWA 2W0KA 1XH3B 3QDJE 2H2SD 1LEIB 2IALA 3CDGA 5IMMB 1WCBA 4YPGA 3HE6B 2DI9A 1RZGB 2XKUA 3P77B 3U36A 1S7XA 2GSGA 5C07E 1CG9A 1CLZH 4P2RE 4D0DA 3FB7B 2E7CA 5EZOH 1PY4A 5F7EL 4BKLA 2OP4L 4OV6F 3KPNB 3QQNA 3U6RB 2PO6B 2NY2C 4GLRI 1VFBB 5EOCL 1T22B 1BIIA 4XCFH 3DI2B 1WJ3A 4FQ1H 3BE1L 4J6RH 3WKML 3O81A 1UYWL 1YMMB 3HI1B 3DXAB 5DRXA 4HFUH 4XPTL 3EJZC 1F5WA 3QQ3B 1U8NA 3IT8D 4U1NA 4WWKA 3FT4A 2FWOA 1NCCH 3V79C 2VOTA 4P4RA 2C3VA 1GGCL 4O02L 1TZHA 4DZ8A 2LE9A 4HT1H 2EIDA 4CKVX 2VABA 4MCZA 1T6WA 1KYOJ 2WK2A 2QQKH 2Y72A 1PX4A 4D9RE 2FBJL 5F21B 3ZL4H 1AI1H 2HYMA 5ELIA 2NY1D 1T2QL 4B7LA 3QIBA 1JF1B 3O4LE 3I50L 4XX1E 3CCHA 2Z93B 4F3FA 1BLNB 5ITFB 2VXSL 3KHQA 1NPUA 1QR4A 3KPSD 1QFWL 1ZHBA 2AGJH 4QOKE 4PIRF 4F33A 4KFZC 1R3IL 4ZNEE 4GMSL 3FFDB 1PFCA 3BIAX 4TUKH 1JFQH 3BT2H 4Z7QE 3QWRA 4RWHA 3NH7H 4NQCB 2R1XB 1VEPA 3SOBH 3SKOB 4MQ7A 3UJIH 4M9PA 4WWKC 4F7TB 2YOCA 4GRLB 2AK1L 4PJGA 5B39B 3VXUD 2PTVA 4IOIB 3GSWA 2Y07H 2Q20A 5D7SH 3RAJL 4AH2A 4Z7OF 5FOJA 1HCFX 3LKNA 4HBCL 3CU7A 5KN5B 4HZLA 2QR0A 4JB9L 5C70A 3IFOB 2BP3A 3MO1A 1A1OA 4ZUTB 5HGAA 2EDOA 3VFVB 5AYUH 4OCYL 3VFSA 1W72H 4M62L 3T3MF 3UAJC 2Z31A 3GMNB 3FB5A 3QUXC 3QIBC 4GG6F 1KPVA 2FEEI 4NWTL 5HGDB 3TF7C 1ORQB 1U6AL 3KDMB 1GC1L 3FO9A 1RFDL 4MJ5B 5E1AA 4L3AA 3H2WA 1QSEE 3O2DA 3SKJL 3EOYG 2JB6A 3D9AH 3GBLA 2AEPL 5IK3A 2IQ9L 2BJMH 1T80A 5FGCB 1PW3A 4ZYKB 3GJEB 3LKOB 1DQQA 4WFFD 3KLSA 2VITA 3OAUL 5DWUH 3ZE0F 5E03A 4P46B 1YEEL 3P3YA 4YHOH 3C87A 3M17B 2Q76B 2R0KL 5C0AB 1VDGA 4XX1G 4XAWH 3S4SG 3K1KC 4P9HH 4DKEH 3V6FA 1IJ9A 5H37H 4Y19D 4NCC2 1MEXH 2BNRE 4FQHA 2IH1A 4MD4B 4MZ3A 1OGAD 3BO8A 3NABH 1E4WH 1UA6H 1U92B 5BJTA 4OAWB 3CH8A 5HI3D 2YPVL 4MD5A 5A40E 3T0EA 2WIIA 3BYTA 1UCBH 5FYJL 2UVEA 3LN4B 5JW4R 2XV6B 2OZ4L 3NZ8B 2KQNA 4U3CA 2HT2D 3I75B 3UBXI 4NQSA 3D69B 3IAGC 4UINH 4NNYB 4OGYL 1O7SA 3CMOH 2XN9D 4KHTL 4U3HA 1WUNT 3RWDA 4J3XA 1N64L 4H0IA 2YWYA 4TULL 4S1SH 3DPBA 3H7BB 1KELH 4KRNA 1YEDA 4F7EB 3QEQE 2F54E 4K3EL 4TRPL 2CJUL 2WSKA 3QQ4B 4M43L 3ULUH 1E28B 4IRSB 3OKMB 1Q94A 5IHZA 3PQYD 3CC5A 4X5XA 1LE9B 2OJZH 5L0QC 4AG4H 4ODTH 3I6KB 4M1GH 2XI9A 3ZKNC 1T0NA 2HFEA 3L3JB 3G6AA 4CBPA 3BVNB 1S9VB 4Y1AA 3T0EC 4C4KT 4ZUSA 4TVSa 3TBWA 3TVMB 2WWKT 2A6IA 1FZOB 3LRGA 1N2RB 3RGVD 1B4JL 3D85A 1INDL 4R90H 3QISA 2VLKA 3WE6A 3VFPA 1BVLB 5L7XL 2NCMA 1KUMA 3VWKA 2R4SL 2HP4A 3QSKB 3DGGB 3EUUA 3J8F7 3PHQA 2ICWA 4F7PB 4Z76B 2HVJA 4KAQH 3WD5L 4U1GC 1NAKH 4R6UA 1UKQA 3OKNB 1ERNA 5DFVD 4GRWH 3GSXB 4OF7A 5ENWA 1N0LA 2VQUA 4Y5YA 1NFDE 1Q0YH 2UY6A 4XNXL 2DQHH 2OR7A 4PJAA 5E8PA 5DR5L 4YDIL 4XNZC 2JF1A 1CT8B 4NZUH 1MCQA 4FFWC 2VDRH 1P7KB 5ESVA 1MFAL 2NLJA 5BV7C 3BH9B 5CAYB 3DHJA 4XP5H 1OAXL 4PJCB 5I76A 2NW2B 2ERJC 1OP5H 1FNFA 2AEQL 2IH3A 4GRMA 5HDLA 1X44A 4P2QA 1UACH 3P0VH 1AGCA 5C0CB 3MCKB 5I8EA 2V7NA 5C09E 5FYLE 1GOFA 2YD7A 5D2NE 3FQXB 2VSDA 1PKOA 5C08D 4PJEB 5IMOA 3VWKC 4Y4FD 4GKSA 4OI7A 3KJ4C 5H8DA 3MV7A 3ROOB 3HMWL 1U2HA 3FQUA 2Y06H 3VRIA 1IAOB 1GAFH 2Y6SC 4NKIH 1QVOB 1PG7X 2ATKA 2RIKA 4KKBC 5J12B 4XWOD 4YNYA 2VR9A 1CVSC 1JHTB 2PW2A 4PJXB 1B0RB 2FL5A 1EO8H 4AEHH 4YXHL 5CD3A 1DBBL 2R0WH 2NNAA 5D7IA 5EIQA 4LPXA 2HJFA 1QLEL 4FQJH 3DURB 5D96B 4HULB 3ILQD 1JGEB 2QSVA 2XWJA 2VQ1A 2APFA 1JHKH 4GAJL 4XNMB 3VGAB 1QBAA 1WIUA 3MJ7A 1BJ1H 3MCG1 5JDJA 4O51A 3VFTA 4FFYH 2EXYC 3V0VB 1V8HA 3IF1B 4V1DA 3QIWC 4NKMA 5C3TA 4MAYD 2A77L 4Q9CA 3N1PC 5MEOA 1KIRB 1CICA 3LB6C 4C54A 5E94B 2C1PA 4BH7B 5IW6B 5FUOL 1T1YA 2IADB 4WJ5A 2HLAA 3FN0H 1NDGA 1KCRL 3IDUA 2JTDA 3HG1D 1S7UB 2MQ3A 3U1SL 1LO4L 5CUSL 1A6ZA 4JG1H 2F9BT 2ZUWA 1KEML 3QO0A 1PSKL 4MVBC 4L29A 1FL3B 3QZWG 4PRAA 3BKJH 2X4TB 1GL4B 3G6JA 2DQCL 2A6DB 4JQIH 4ZFOB 4G5ZL 3I6LE 3TBYA 5KVFL 4RAVA 4YO0B 1AGDA 1OCWL 3FHAA 1P4LB 3F7PC 4Z18A 1RIHH 2E8ZA 3V6OE 3EZJB 3MOQA 4XPFL 4JFYB 5TDOA 2C9AA 5EOTB 3FN3A 3MA9L 3LS4H 4Q2ZB 3BIKA 2GITA 1M7IA 2Q1EA 3W5MA 4HIIA 2RFXB 3TFKC 2F5BL 1V3JA 3IXAA 3EOBB 4OZHA 4XXCC 4UNVA 4G8FB 4YUEL 2B5IC 2DLGA 3OR6B 1CGXA 3CDYA 1GHFH 1CFNB 3C09B 4ZTOH 3O6FA 1CICC 4XGZB 1ADQL 2A1WL 2JCCE 3QDME 1R3LB 1MJJB 3P0GB 3OGCB 4MCYB 3EDJA 1S7QA 1BJ1J 5DK3A 3AC0A 43CAA 4LLYB 4FXGB 2FO4B 3BX7C 4HK3J 3SCMB 2FGWH 1FDLH 5EZLB 5IFAL 1KJ2L 2ICEB 4HJJH 4KHXH 1HCVA 2JJSC 3RWHA 1VFMA 4KMTL 5ESQA 1I7UB 3WIFA 5T5FH 4N1EA 3BISA 1JWMA 3M1BA 1VSCA 1VGEH 2R1WB 3WFBL 1ZT7B 3MOBL 5C0JA 4P48A 4TSBH 5LXGL 1JK8B 5C07B 2F5AL 3PWPE 2DBLL 4QXTB 3BUTA 3QCVH 3OXSB 4TVPL 5IOPB 4Z7WF 5JXEA 5LGJB 4TOYH 1CDHA 4XRCB 1J9CT 1KB5H 4OZFA 5GS2D 3V52L 2EZ0D 2NTFB 2FIKB 3PG2A 2Z4QA 2NY5H 3O6FC 4U6YB 3KPRE 4M6AA 2CRIA 1SEQH 3LQZA 3NN8B 4KK9C 4EI5D 1FNGB 1UFUA 4GFTB 4HKXA 4ZS7H 5EZOL 4IDJH 4ZSOA 5I6XB 2AJSL 3LDBB 2P7TA 3ARXA 4Y89A 4P5TC 1AC0A 3LRSB 5F7MC 3SJVA 1T1ZB 1S8DB 4E41D 3CVHH 4FQ1L 2W65A 4G6FD 5MI0C 4OZIB 4J6RL 1TLKA 2VLJD 2DBJA 4BSWB 2BNUB 4HFUL 1OARH 4P4KC 1QA9A 3HE6D 4IOFC 3O6KL 2Z0BA 4K7FA 1S7VB 1QPPA 1AXSB 3O11A 4LHUG 3HZVA 2Q8AL 5E5MB 4J12A 1U8JB 3HC3H 1UJ3B 3S4SB 1NCCL 4ZQKA 5J3HC 4PD4K 1K3ZA 4OZGE 5E4IA 4YLQT 4NBYB 5DC0A 5F9DC 4PJ7E 2YD6A 4HT1L 1UENA 1GOGA 2GTZB 1IGFH 4YJZL 4HC1L 1A7OL 2DQIH 4DW2H 3EYFA 1QFWM 3CPLA 1AI1L 3C5ZB 3ZL4L 1YMMD 3VD3A 2GK0B 4EBQH 4OF5A 4KDTC 1G6RB 2G9HA 1WCQA 3UP1A 2HRLA 5I1KL 4JJ5A 3VFRA 4XNUH 1X5JA 2AGJL 3TESA 4G6ML 4NO3A 1DQDL 5DJ2B 3EGSA 4OF0A 4APQA 3MXVL 3MLYL 4TUKL 1JFQL 5EBWA 1ITCA 3NH7L 1WK0A 5GGTA 5D1XD 3ECBA 3UJIL 2DYPD 4X6DB 2E3VA 3F12B 3TT1H 2Y07L 5D7SL 5FO9A 4JZOB 4OUOA 1JTOA 1X9QA 1YJDC 3VXNA 1PZUB 1F90L 1IGIH 5T1LD 3T4YB 4WI9A 1QSEB 1AGEB 5SWZD 1LNUB 4WU7B 3TNMB 4B50A 1DQJB 1A3RH 4LAQH 4LNRB 4RAUB 3KYOA 2VAJA 3B9AA 4TN9A 2ICCA 3JUZA 5HGBA 4L5FH 2AW2A 4ODVL 1SBSH 3OAZK 4H8WC 4HWUA 5I1AB 1FLRH 4GRLD 3W9DB 5KANI 1NBZA 4QRRA 3UDWA 2CLRB 1KJMA 3EBAA 3ZKQD 4IMKC 1EEZB 2R4RH 3G6DL 5DK0B 5F9JB 2VWEE 3D9AL 3AROA 2CRZA 1NCDL 1T5XA 2X4NA 2PXYB 4UIMA 1LO5A 3K0WA 2GJ6A 4H0GA 5CHNA 3E1F1 1WEJL 2BJML 2Y5EA 3VI4F 4BSVB 5ID1A 2BNRB 3UBXA 3UYRH 1J88A 2AABL 5F7HA 1ZE3C 1MRCL 3ARFD 5DFTA 3TH4T 4JRXA 4JFPA 4NRXA 3IDJB 2F8XC 3CFCH 1J11A 2XTJC 4XZUB 2AJ3A 2V7HB 1MWAA 1BMGA 1J10A 4XAWL 1U8PA 5HHPA 4D8PA 4P9HL 3VCLB 5D7JB 3C5JB 3P4MB 1SJVA 3R1GH 3ZKMC 2MCPL 5JDSB 1TVBB 1NH6A 2JJWA 1MEXL 2GJJA 1MCWW 3NABL 1E4WL 2F54B 1T5WB 3OJ2C 2ICES 3IXTB 1UCBL 1SYVA 4X8JA 3VRLE 3CZFA 4M6MH 2FD6L 1EEYA 1JWUA 2DQEH 1UH3A 3ALXA 3TZVB 4OCLC 5HI4C 1FNAA 4UINL 3QFJA 5ICZB 5L88H 4ORGA 4JLRA 3IDGA 4IRJD 3K2UH 5C0AD 4S1SL 1UWXK 1KELL 1QD0A 5CJOH 1HXMB 5DD6B 5K59F 3VI3F 4CGTA 4JDVA 4BUHA 1QUNA 2GFBA 2BVQB 5HHQB 3KR3H 4LDLB 1JF6A 3AXLA 3MREB 1WAAA 4R4BA 4AG4L 5E8NB 5I73B 4ISVA 4TUOA 4LSPL 4HHAB 3U7AA 4M1GL 1VGKB 3QUZB 4H26A 3LN5A 1F42A 4W81A 2ADGA 2E9JA 1MREL 3LKRA 3OX8B 2OTUA 4HJ0C 4XAKE 5JNYA 1RZKH 4S1QH 2VSCA 1XIWA 3OKEB 3IJYB 4KJQC 4Y4HA 1NFDB 4I3SH 4PJIA 3FL7A 3ARRA 4IRSD 2H45A 3G5YA 4P2OB 5CEZD 2DQFB 1X6LA 4TSAH 4LSVL 1G0DA 5EO9B 1AIFA 3LSOA 4KAQL 3RNKA 1HHKB 2HT3C 2OSLA 1KN2H 5EUOF 4JO4H 3QZWB 5KOVC 4CU7A 1AGBB 5DMYA 1PEZA 1Q0YL 3ARGA 2Q87A 2Q7YA 3WUZA 4PREA 5JPNB 2NQCA 3TVMD 1TFHA 3IDNB 1HHIA 5C09B 3NPZB 5IW1A 3ZE2F 1R5VB 3RVWC 4NZUL 1TPXB 2X44D 5D2NB 1FFPB 2VDRL 2DD8H 5CBEB 4LKXA 3BN3B 1FN4B 3MLWH 3PDOB 1TVHA 3QNXB 1M7DB 3CGTA 4YXKH 5GS2H 4ZOEA 2BX5A 4N9OB 4WU5A 5C0RH 5IG7A 4MGXA 5JIKA 1BBJA 1H8OA 1XIWC 1ZLWK 1UACL 3P0VL 2YD4A 3IJSB 1NC2B 4Y4HC 4PJ9B 4UU9B 4OD1L 4J8RB 4BQBA 1RAMA 4JQVC 4TTDC 5HY9B 4JPIA 4DGVH 4KKLC 3VE0B 3O8XA 5GSVA 3HE7B 5L6YH 1T66D 4Y1AE 5GSRB 1IAKB 2H6PA 1FGVH 1G7QA 1TTUA 2VZVA 1FE8L 2Z91B 3L6FB 1Q38A 3SE8H 3B5HA 5CZXD 1GPOH 1AC6A 5D6CA 5I8KL 5L2KA 2VLKE 1GAFL 4PV8A 3P73A 5BRZA 2N7AA 1PAMA 4HIXH 2ZSWB 3ARGC 4NKIL 3ULVC 5IB3A 3MV01 4JRYE 4CW1A 2VAAB 4NQXB 5IT2H 5IHBA 1IKNC 4LSSH 4WFHD 4AEHL 4XC3L 5C0CD 1NGYB 1VKXA 2R0WL 4KJWD 1TDQA 1Y0LB 5EU6A 1DANU 3DBXB 4GSDH 3ZT5A 1SBBA 4FQJL 4MNHA 4D0CB 4HGMA 1YY8A 5FFLA 4WEUD 4W4OA 1JHKL 1Z2KA 4DN4L 5INCA 4RBPH 3BPOB 4FFYL 4WENB 1CVRA 4J23A 5ISZA 3HZMA 4ONOA 2V9RA 3O8XC 1P6FA 5FM8A 3GSUB 2X4PB 5DJYA 5DO2C 3ZSTA 2X9XA 2ITCA 3ABZA 5FHAH 2YD8A 3PV6B 4P2QE 2E7MA 2E27L 3HUJE 3NCEB 5DI8A 3CFEB 5F7FA 1HHGB 3E6FA 4YIQA 2G5BB 2FDBP 2FSEB 3FN0L 1OD9A 5J11B 3TH2T 4XNYL 3CXDH 4JG1L 5EOQL 4NRZA 1D9KC 4LHUB 1FFQA 1J0IA 5CGTA 2X6MA 1EJ6A 5DT1H 4R2GC 2C3GA 3BKJL 3CLEH 3VMOA 4JZNA 1MCKA 2JCCB 5T1DH 4AL8L 4W4OC 3QDMB 3QXAA 4RFNC 4LVOB 4FZEH 5JO5B 4ONFH 3AB0B 4HPOH 3T04D 3UTSD 5KZCD 4PRIA 2GAZB 5T3XE 5AZ2L 1OD7A 3OG4B 4X7DC 4YWGH 1G9NH 4XBEH 5E6IA 1GHFL 4ZTOL 4PGBB 3NPSC 4MZ2A 3FKUS 4QRPB 4XVSH 4C58B 2P5WD 3PDDA 5D9SB 2RQ8A 3PWPB 4RMUA 4V1DE 1A8JH 5L8LB 2D7PA 4XP6H 4F15C 4IMLB 4HKBA 1YEJL 3O3BB 3SDCB 3V8OA 4ELMA 2FGWL 1MNUL 3UPRA 5FO8A 5J6GB 2XPGB 5DEGA 3MROA 4EN3B 4WNQB 2P8LA 2WV3A 3LHPL 4JM2A 3S7GA 5KSAC 2R0ZL 4AM0A 3H9HA 4HV8A 1WLHA 1VGEL 3MRLB 1A6WH 2CLVA 5HD8D 3O45A 3KPRB 4TSBL 4Z9KB 2IPUG 1SEBA 1MHEB 4YGAB 4NQTA 2XT1B 2HTKD 2LABA 5EUKB 3X14A 5GRWA 2V5TA 3O4OC 1JZ5A 3ETBF 1QO3A 3DI3B 5I71B 2DWDB 2H2PC 3MNVA 3QJHB 2QADB 1KB5L 3SCMD 3N1MC 4DK6A 3MFFA 4WUKH 2ZSVA 5E6IC 4RGNC 3DX7B 5HYEA 2NY5L 4OQTH 2DM7A 5CS7A 1DVFA 3FQTA 5FHBL 4LQ1A 2C1OA 5F6HJ 1CD9B 1MLBA 2NY2B 2E7LA 1G7PA 1SY6A 4OZHE 5FYJU 5KVDL 1F97A 1UZ8B 4I3RH 4EKXA 4JKKA 3ARZA 4G6KH 3ZYOA 1FORH 4XHJC 3M07A 3QNYA 2R2EA 4PJ7B 4Y2OA 2M2DA 3CVHL 4C56A 5FF6A 4ZOBA 1F3RB 2DLFH 3OG6B 1L6ZA 4G80A 5F1OB 3KPOB 5CJXA 4E5XA 3UPAA 1K4DB 4X6FB 1OARL 1RIUH 3VG9C 1U8OA 1F58H 5IVOA 2VZUA 5FDWB 2P46B 4YXLH 3HC3L 2IALB 4RMTA 5CIPH 5HHNA 1KLFA 1YC7A 3CDGB 5DQ9A 5EO1A 1WCBB 4MLSA 4YPGB 2QQLL 2HH0L 5F7DA 3HC0A 1S3KH 5ANMA 3U36B 1S7XB 2GSGB 1CG9B 2DQIL 4DW2L 4D0DB 4FXLA 1T7VA 3MFGB 3AS3A 1UG9A 5GQBA 4NNPH 4BKLB 5CEZH 1EGJL 4EBQL 3TCXA 5HXMA 1N4XH 3L5IA 4L3CA 3VFUA 4D9RD 1A9BA 3GRWH 2E7LC 1BIIB 3A6BH 3UROR 3TO4A 1GZPA 3TNNA 3RZCD 1J0YA 3P9MA 5DRXB 2AKRA 3BZEA 1U8NB 3LY6A 5CJXC 2LVEA 4GKNA 5K9KA 4U1NB 4PJBA 4YHZH 4WWKB 4G9FA 2DS4A 2JJUA 3FT4B 5E6ZA 4WFGE 4ZSOE 4JAMA 2FWOB 1FNSH 4DQOL 2EDDA 3FT2A 3KYMA 1Z6JT 4P4RB 2C3VB 3RNQA 5B8CA 4L1DA 5DJXA 1TZHB 4Q6IC 4DZ8B 1I75A 5KS9F 3SJVE 3VDBA 2VABB 4MCZB 5D4QA 3RWFA 4CVWA 3PABA 4Y2DC 1IGIL 4ZNCD 2NY4C 3LPGA 1KTLA 1TJIH 4F9PA 3VDAA 4QCIA 5LAXA 4LLVA 1KCLA 5JW4N 3NBNA 3QIBB 4TSCL 3LH2L 4LAQL 5IM7A 3CCHB 4F3FB 5FK9A 1U3JA 3L3KA 2R15A 4L5FL 1LP9A 1ZHBB 4XPAH 4R4FH 2XYCA 2NY6B 4F33B 1FLRL 3PL6C 4YBQD 3VXPA 2FHBA 1I1YA 4Z7QF 3VXSA 2R4RL 3WXWH 1BD2A 2WNGA 1WGOA 5C9JA 2LTQB 1A6TA 4MQ7B 4M7ZC 4PJGB 3P11H 4AH2B 5JW4Q 3GSWB 2YRZA 4ZAKC 1U58A 3BHBA 1JGDA 3LKNB 2NY0C 1KLGA 2ZG1A 5DVMA 4HZLB 2QR0B 5B8CC 1K8IA 3MO1B 1A1OB 3STZA 4L8CA 4C55A 5HGAB 3S35H 4LIQL 4WEBH 1CGVA 5DMJB 2X41A 1EPFA 3VFSB 4F9PC 1AR2A 1S9YA 2Z31B 1EHAA 3FB5B 2EICA 1BFSA 3JBG7 1KPVB 4POZD 4U31A 2FR4A 3C5SA 4OF3A 3R1GL 2ZUUA 1IZKA 1HXYA 1IGCH 4WWID 4BZ1H 3WSQH 4BFBD 3FO9B 3AVEA 2KKQA 4J2XA 3W2DH 1IILE 2AK4A 4FFVD 5E1AB 4M6ML 2BNRD 1IAMA 1Y6KR 2JB6B 3NCJH 2DQEL 4WTZA 5IK3B 1W72A 4NQDA 5L88L 5MEND 3MJ9L 1DQQB 3RUGA 5TE6H 2M1KA 3K2UL 2QTEA 4I1NB 2VITB 1XF2A 4JFXA 4LGRB 5D7JD 4FTVD 3RPIA 1ZT4A 4HGWA 4KTEL 1ZEAH 3RHWF 3QIUD 3W81A 4B53A 3KR3L 2PTUA 2GJ6E 3WLBA 3V6FB 3T0AA 2GKIA 4FQHB 2IH1B 4HUNB 2A2QT 2KL6A 3BO8B 1I1AA 4UV7L 5BJTB 2FHCA 2LU7A 4MD5B 3T0EB 2WIIB 1MY7A 5EU4A 4O58H 4PB0L 4YR6A 1RZKL 3LIZH 1E4XI 4S1QL 5HPMA 5H2BA 1YZZA 1MCRA 1L9NA 3IGAA 3OKKA 4PJDF 5SX5H 4NQSB 2BRRL 4U1MA 4I3SL 1J8HD 1U9KA 4HAFA 1OHQA 3RWDB 3S96A 1CL7I 4KJPD 1YEDB 3UZVB 2O5YH 4U1GB 3T3PF 3ZHKA 1WFOA 1F6FB 1WFNA 4N8PA 4Z6AT 3MA7A 1FO0L 2GYSA 5DUPL 1IM3A 1F02I 4S11A 4XVJH 1HKLH 4XH2A 2QSCL 1Q94B 5IBTL 1KN2L 3SKNA 5IHZB 3CC5B 4X5XB 1J1PH 3QFJE 1T21A 3G08A 3B43A 1UWGL 4PJFF 1OP5K 3IFLH 3MJGX 2A6JA 3T0VA 1T0NB 2HFEB 5D5ME 5GGVL 4JGJA 3G6AB 2ERJB 4Y1AB 4M7JL 5E2UL 4ZUSB 3MLWL 4P2OD 5EU7C 3RBGA 3TBWB 1BWWA 2A38A 1H5BA 3V7MA 2A6IB 1ZHKA 4QT5A 3D85B 5C0RL 2QSTA 4ZO8A 1WAAE 2VLKB 3WE6B 3KG5A 3FQNA 3VFPB 4MQXC 1BVKA 1FL6A 3TA3A 3TJHD 3VWKB 4DGVL 3MV8A 4P5MA 3PHQB 3RTQA 2ICWB 2HVJB 4X7FC 4HEME 4BFIA 1G9MC 3MNZA 1FGVL 4L8BA 1KV3A 3T0BA 4PRNA 1RPQA 4H88H 4H5SA 3V4PH 1V3LA 5ENWB 3LCYA 4Y5YB 3U46A 1UH4A 4PJIE 3QT2A 5E8PB 4PJAB 1GPOL 4K9EC 1M1SA 2E9WA 3UBXG 4YHYC 3BP4A 4I5BA 3CFJA 4RZCA 5ESVB 2NLJB 1NC2D 4CVUA 5I76B 4HUKB 5FYJE 5A2JH 1KBGH 2IH3B 4GSDL 2J8HA 2EXWD 4GRMB 5E4EB 1F2QA 4P2QB 4M6OH 1AGCB 5K9QI 5I8EB 2V7NB 4RWYH 1JUFA 4ZUVA 5DXWA 3UJJL 3VD9A 3WHE1 5IMOB 2LAAA 4GKSB 3MLSL 2HLFC 5KSUA 4U1IA 5C0ND 1WT5A 2HTLC 4ZPVA 1U3YA 3Q2CA 3L1OL 2P48B 3MV7B 5FHAL 3S3PA 2WIMA 3RI5K 3FQUB 3VRIB 1HN1A 2GEEA 4OI8A 1RURL 2ATKB 4YNYB 2KDGA 4ODHH 2PW2B 2FL5B 3CXDL 5CD3B 2DJ4A 2KZWA 3S3JA 2NNAB 2EH7H 2D4DA 2H26A 5D7IB 2HJFB 4MA3A 1FVDA 1G6RH 1V7MH 4XI5C 5DT1L 1CU4H 2XWJB 1H0DA 2VQ1B 4HBQA 3CLEL 4HGKC 5CSBA 1CYGA 4WI5A 3QXTA 3MJ7B 5BRZE 1SMAA 4O51B 3VFTB 1AXTH 1OW0A 2C3XA 2ED8A 4OLWH 3WFCH 4DUVA 4V1DB 1ZSDA 3QBTB 4YH6A 5JLZA 1C16A 4NKMB 4ONFL 4HPOL 2B5IB 1FP5A 1F4AA 1MCBA 4JO2H 4NC1C 5EU6E 5MEOB 3KPTA 1MQKH 1IKFH 3NCYS 1CICB 3W0WA 4L4TA 1EJOH 2C1PB 4LHUD 4JFDA 4NO0A 4YWGL 1G9NL 4AQOA 1T1YB 1MJUH 4WJ5B 2HLAB 1NDGB 4XVSL 2E7BA 4E9LA 3BI9X 1MOEA 3RJQB 4MXWH 1A6ZB 4YFLI 4OF6A 3CXHJ 3QO0B 4XP6L 3PHSA 4L29B 1Q9KA 4KXZH 3SGEH 5I18H 4PRAB 4WEMB 3JV0A 3L3GA 3VFGH 3G6JB 4YDVA 2XQBH 3KPSA 3TBYB 2BVPA 4RAVB 3OKYA 4UT9H 5EA0L 1AGDB 1JHLH 2QBWA 3QI9D 5TDOB 1F3JA 4FQXD 2YK1H 5I15H 1OW0C 3BIKB 2GITB 1M7IB 5DRZA 1ODAA 4HIIB 4MS8C 4OLYH 4QRPD 2WANA 3IXAB 4IHOA 4OZHB 3BPNC 5JUEH 5GZOC 1CD1A 2ZCKH 2GY5A 5K33A 1N5AA 3ZO0A 4CADA 3O6FB 2JCCF 1BZ7A 3T08A 3WS6A 3F7RA 4OQTL 5IJKA 1S7QB 1P2CA 1T3FA 43CAB 1ZA3A 1NANH 3N1QC 4NDMA 4PRIE 5EBMA 5KAQF 4I3RL 5F7WC 1RZ7H 3E0GA 5MI0B 3RWHB 3E8UL 3EO0A 5ESQB 3S34H 1MCOH 1FORL 3WIFB 2D0FA 1JE6A 4Q58C 1JWMB 2AI0H 3M1BB 2DLFL 2E6JA 1DSFH 4ZG1A 5C0JB 3QULA 3EJYC 1F58L 2OYPA 3K2MC 4BA8A 2R23A 4MJ6A 2A6KA 1U93A 1UB6A 3IJHA 4OZFB 4EOWH 5JHDA 3NIGF 2NY2D 2XZQH 2Z4QB 1S3KL 2FJHA 2R56H 3UTOA 4KZEL 3WS6C 2B0SH 3LQZB 4OB5L 3UCRA 1JNNH 1NSNH 4HKXB 1TMCB 3EJZD 3NFPA 3FO1A 4NNPL 4XBGA 4ZSOB 5IB4A 1RUQH 5DJ6A 2P7TB 1VB9A 1N4XL 2PTTA 4Y19A 2ILLA 3GHBL 1BBDL 3GRWL 1K85A 2D3VA 3SJVB 4RNRA 2W65B 1OGAA 3DRQA 3N85H 2EDBA 1KB5A 4W4NA 3KPQA 4I0PA 4OFYA 1QA9B 2ZCLH 4K7FB 3O11B 4Z77A 3DOSA 3HZVB 3RVTC 4QHMA 3KPLA 1JZ2A 4KI5C 5IGXL 4K94L 1FNSL 4OZGF 4ZQKB 4JFFA 4WHTA 4C56E 1OPGH 4CN1A 2VN7A 1HIML 1H8SA 3GI9H 4OM1H 3EYFB 2HFFA 4HIJA 1HHJA 1TJIL 3CPLB 3L95A 1PZ5A 4JZJA 1I3GH 3PQYA 2G9HB 2CK0H 4WWKD 2MJWA 3B3IA 3UEZA 4JJ5B 4ODWA 3VFRB 1P4IH 3E6HA 4DFHA 3NCCB 4NO3B 3QEGH 4KJYA 1DANT 5ANME 4APQB 3EGSB 1XGPA 3F7QA 5JORA 1WIOA 3EJJX 1B2WH 5EBWB 3TEUA 5DA4A 4I0PC 3T77A 3ECBB 5AG9A 2M8XA 3RGVA 4KGJA 2P43B 3P11L 3UAJD 15C8H 3QUXD 5FO9B 3QIBD 1MH5A 4ZUUA 3MRGA 1XMWA 5DHYA 3THMH 3VXNB 3GSQA 2W9EH 2R8SH 4PJBE 1PVHA 1MI5A 5DK2A 4G9FE 3H0TA 4YE4H 5EIVA 4M02A 1NCBH 1RVFH 3KYOB 4D3CL 3KYNA 1MCWM 3O3AA 3PNWA 5HGBB 2OM5A 4U3XA 2AEIT 2W1NA 3AREA 1NC4A 5E6YA 1II4E 1NBZB 1IGCL 4QRRB 5DS8A 2CSPA 1KJMB 1AQKH 1EFQA 1SVCP 3MLPA 1X5HA 2P49B 2BVEA 2VXUL 3EKCA 5I75B 3GEWB 5IVXA 1RJZA 1T5XB 2X4NB 4UIMB 1LO5B 5CHNB 1NCNA 2GJ6B 3B83A 1J5OH 2XTLA 5EBGA 2PUQT 2VZOA 1JTPA 5ID1B 4FQIH 1LP9E 3UBXB 1UB5A 5TE6L 1A21A 1VEOA 4JRXB 4JFPB 5C08A 4NRXB 3VXSE 2AJ3B 4Y4FA 1BD2E 1CR9L 1MWAB 1ZEAL 5KOMC 1U8PB 5HHPB 4D8PB 4BZ2H 3AUVA 3O41A 2FRGP 4PUBH 1XR9A 3MLXH 4JANA 5FA4A 1JI1A 4GG8A 1RK0A 2F74A 2J3SA 3AREC 1DBAL 1SYVB 4X8JB 5IBUG 3CZFB 5KG9A 3HAEA 3DRTA 1OP3H 1EEYB 1JWUB 3LIZL 4NN5C 4NOFA 3ZKSD 3OTTA 3D0LA 3NAAH 3MRQA 3QFJB 3DV4A 4ORGB 3V0WH 2W9DH 1ZLVH 5C0BD 2J6EL 4JLRB 4ZFOL 3IDGB 2FATH 4LL9A 1OTTC 1IQWH 5D1QC 4MHHG 4HUWA 5DGQA 3ZKND 2AK4E 3GJFH 4MAYA 1RIVH 2CMRH 3ET9F 4JDVB 1VERA 2GFBB 1HKLL 3T0ED 1T4KA 2Z92A 3AXLB 4WO4A 4NQDE 4R4BB 1J1PL 3PE9A 3NTCH 3OPZH 3VG0H 4ISVB 4TUOB 2HFTA 3QEUA 3RUGE 1MFCL 3IFLL 1AR1C 3HG1A 3PGFH 2A83A 3DETC 3LKPA 2IG2H 4H26B 3LN5B 2CR6A 4KTDH 5C0DB 2ADGB 3LKRB 5D8JH 3FRUA 4PG2C 2OTUB 1OLLA 4ZPTA 5JNYB 4K71C 1OT1A 5I0DA 1F3DH 1XIWB 1NMAH 4PP1C 4Y4HB 3GSOA 3OJDA 1TZIA 4PJIB 3PGDA 3QRGL 3G5YB 1PDKA 5EU7E 1ZANH 3GM8A 5BS0D