3TT1H

Crystal structure of leut in the outward-open conformation in complex with fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
212
Chain Sequence
QVQLQQSGAELARPGASVKLSCKASGYTFTDYYINWMKQRTGQGLEWIGEIYPGVGTTYYDEKFKGKATLTADKSSRSAYMQLSSLTSEDSAVYFCARRTVTMGRYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine transporter LeuT
publication title X-ray structures of LeuT in substrate-free outward-open and apo inward-open states.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transport protein
total genus 35
structure length 212
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt1H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt1H02
2EDDA 3H0TB 1TITA 3R0MA 3HZVB 1YEHL 5LAXA 3LKOA 4MYWB 5GS0D 1FNSL 3BKML 2Y1VA 4X0KA 4HH9B 5DD5L 3GBNH 4NQEA 3TWCL 4Y19B 4C56D 4WEMB 4PJFF 5ERWA 5L0QC 2X1OA 4NZTL 4JN1L 4PR5A 4P3CL 4U31A 4ZPTA 4XZUB 1WLHA 4FZEL 4N0CD 4H26B 4ONFL 4MNQE 5DMKB 1YY9C 1F3JA 1FZJA 2AAVA 3A67H 2G60L 4LCYB 4KPHL 5ISZD 4NQTA 2NY4D 2P7TB 1R3HB 4MS8C 5E8EB 4JFEE 4G6FD 4JRYE 1G7PB 3F58L 4O5LH 2P45B 3QO1B 4PJ8D 3RBSA 1CN4A 5HHNA 3THMH 2D7PA 2JIXA 4OCWL 3RWGB 4GBXA 4G8EA 3VXRE 4Q9QL 5L9DL 3MGAA 5CINH 5LQBH 3AXLB 4MHHI 1A3LH 3KDMB 4MNQD 4ZFOL 5TGBA 5EOCH 1JE6A 3OKOA 4YNYB 4XRCB 4N90E 2IG2H 3L5HA 4X7FC 5FKAA 3GO1L 5DJ0A 3Q6FB 3GRWL 4MHHG 5L6YH 4JRYD 1RUKL 2F53B 4DK6A 4RZCB 1C5CL 2R2BA 4QHLB 1SEBA 4E41D 5HGBA 1NMCB 5E5RB 5DD1L 1OLLA 3U9UA 1U92B 4MVBD 3KWWA 2B2XL 2GITB 2BVOA 1PX3A 5EG6C 2Q6WA 3TPUB 3HA0A 3HI5H 1FORL 4JRXB 4N90D 1IKFL 3EOBA 1MFDH 3AB0B 3IFLH 2PO6C 5BJTA 3P0GB 4KC3B 3FQRB 1FLRL 1ZA6A 4WI3A 5IK3A 2R0WL 5I30H 1QLRA 4EI5B 1OW0A 5GGRY 1CCZA 3IFPB 3GRWA 4BZ2L 5HYJA 1Q0XH 5IVZA 1NAML 3QPXH 4P5TC 3GBLA 2J4WL 3TNNA 4ODTH 4CU6A 3WIFB 3H9SA 2H41A 3NZHH 1L0QA 1NCBL 4WRLA 4X7EC 4NO3B 4RIRB 1S7WB 3D25A 1JWUA 4E5XB 1BJ8A 3MODL 4LVOB 2VL4A 3CLFL 5BS0E 1W2KT 2DQUH 3SKMA 1JGLH 3IDGA 4DOHB 1O5DT 2DL9A 4M9OA 2CH8A 3WL9B 4DGIH 3S36L 2BNQE 5DZLA 1REIA 3TA3B 5EO1B 4JM2C 1YEJL 3QEQD 3MLWH 3JV4A 1EZVY 4K3JL 2XI9A 3GHBL 2ZUTA 1F3DH 1S5HA 1QRNA 3G6JA 3IFOB 1KENH 5E8OA 2PXYA 4JFQB 1NLBH 2WIIA 1GCFA 4Y4FD 3OKLA 1QBLL 3EO1B 5E00A 3MROA 2ID5A 3HPLB 1RK0A 3LPWA 3EDFA 5FA4B 4GW4A 3ZKMC 2BNQD 4UOJA 2M1KA 1H3PL 2EYSA 4RNRA 4Y5VB 5JTWA 3IXAA 4PLOB 5D5MA 3MUGB 3VD3A 3QUYA 4QGTA 5CIPB 4JFOB 1YC7A 2DBLH 2KUTA 3W2DH 3DO7A 4Y1AE 1IGYB 5BCAA 3G6JF 4KJYA 4F7PA 4OCXL 5E9DD 4OFPA 3VU2A 4HEME 2A74B 4OZGE 3P11L 3UAJD 3U4EB 2ICWA 3BW9A 1G7HB 5T33H 5CJXC 5I2IB 1FN4A 3ARYA 3LV3B 4U1IA 4ZAKA 4KUCF 5J56B 1JPST 4IEFB 3MRKA 4ZOAA 3RA7L 3BUYA 4JO3H 1PQZA 4LGSB 2FATL 1J5OL 4Y1AD 1CK0L 1D5ZB 2BNRD 2RCSL 5D5MF 4Y8AA 1P9MC 3WFZA 1GH7A 4Z76A 5F44A 4CDHA 3QFDA 4B0MM 1A2YA 4G9FB 2P8LA 1FFQA 4XB8A 3RIFK 2E27L 3C08H 1HHJB 1IGMH 4IRZL 4KXZH 4K3DH 4PYHA 3X3GH 1AHWB 3TYFB 5KSBA 4QTIL 1CL7H 1GGUA 3MV9E 5D1ZC 3ZTNH 1MVFA 2WP3T 2JB5L 4H25B 3TYGH 4MCZB 1S7TA 3A6BH 3GIZH 4FXLA 2OZ4A 2A77L 4L8SB 1FC2D 2NW3A 4NQSB 4O2FB 5BVPL 3WO4C 2AI0H 2B7DT 1NJ9B 5IB1B 43CAB 2VE6A 2WQRA 3IAQA 3HAEG 2J88L 4FABL 1TLKA 2VWEC 4U1JB 3K8LA 3ZE0F 2ESVB 4H1LH 5F1NB 2EO1A 5I9QC 3GUTB 3BOVA 2ZG2A 3CXHK 3MXVL 3MRPB 2O61A 2FSEA 2A6DA 2YD8A 4I2XE 1RVFL 5J8OA 4MQXC 3CVHB 3WXWL 4X8JB 5ALCH 4F2MB 4JREB 4LNVA 3IS1X 5C9KA 4DKEL 1K4CA 5IFJB 5BZWB 2NXZD 3BO8B 3LDBC 3U6RA 1EMTL 1OAUL 4ZSOA 2P5EB 4ZD3L 3TO4C 4LHJB 4NN6C 5DR5H 5E7BA 4MXQD 4I77L 4TQEL 1ZXQA 2NLJB 3PWPE 1DVFA 5C07A 5D6DC 6FABL 2VXQL 3U0WH 2OJEB 3BPLB 1DLFH 3OB0K 4K2UH 2JJSC 3S5LB 5H94B 5JUEL 4U0QB 3MA9H 1TJIL 2OK0L 2VLRE 3HKFA 4PJ5E 1RZKH 4RAHA 4XMPL 3RZCB 4Z5RB 4G8IA 4OIIH 4HHAB 1EA9C 3FQNB 4MJ4A 5IG7A 3HZKB 5E8NA 5F96L 1I3UA 2VXSH 3M8OH 3PWPD 4ELMA 3QIBC 4TTDD 3GMMB 2XNAA 5HGDB 4FXKB 1QR1A 1P4LB 3RWIA 1RZ8B 2O5ZH 5T5FL 2Z93B 4XPAH 4C57C 2CDGA 3DURA 3PWJB 1B4JH 1QSFB 2VLRD 4G7VH 4PJ5D 2P46B 4ZFFA 5C0JB 1NL0H 1ZAGA 3L95A 4OCYL 5ANMA 3BH9A 2EDRA 4OSUL 1JPSL 1X4YA 5FGSA 3QUMA 2BDNH 3EDJA 3FT3A 3T2OA 2XICA 1F8TL 2NYYC 4U4BA 2F5BH 1MFNA 1QVOA 4HPYL 2BP3A 3CD4A 4ELMF 5A2KH 2DIJA 1VFBB 1CGSH 4KTYA 5D1QB 3U2SA 1FAIH 1Q72H 1GOFA 1Q0YL 2CR3A 1JV5A 3AFLA 3BKYL 3HG1E 1U8QA 2VDKL 3MBEC 4NQCB 1RHHB 4OZHF 5JO5B 1QSEE 3WJLC 4AYFA 5LBSH 4YR6B 4Y4KC 5IWLC 4APQB 4ORGA 1JZ4A 1BF2A 4YHML 3IJHB 1TZHB 3CH1B 1BF8A 4RQQB 3VW3L 1OAXH 4PJEE 1JUFA 1WT5C 3GSNH 3QXWA 2VDOL 4OLYH 3HG1D 3A6CH 4HKBB 3SEPA 1YZZA 3PIQB 1JNLL 3CFEA 1WZ1H 4M4PA 4MCYB 2DYPA 5CLWA 3AY4A 4G7YH 2QSVA 2R1WB 4BH7A 1YEIL 3O3UN 4EEEA 3QEUA 4HKZB 4R8WH 3MLTB 4PJFB 3KYOA 1MREH 1NMAL 1CFNB 2XIDA 4XBEH 5E4EC 3B5TA 4MSWA 4OUUB 3GSOA 3CK0H 1FC1A 4PGCA 1MLBA 4GAYB 2P48B 4XAKE 1OCWH 4KK8C 3GHEH 2CRZA 4KMLB 3QIUC 4HKXA 1MFEH 3SJVB 4NZRH 2CD0A 5LAXB 1J0KA 3DECA 4MD5A 3LKOB 4OFYA 1IM9D 1B88A 2Y6SC 3PQYE 5DLML 4NQEB 4JFFA 4M48H 4JO2H 5ERWB 3SCMC 5A16B 5KSAB 4FQLH 3SKJH 5EOQH 3ARDB 3O45A 1PFCA 5IMMA 3U1SH 4XAKD 4CVXB 5JPMA 1RIVL 3KR3H 4BSJA 1J8HA 2YPLB 3FFCE 2DMKA 5JOFA 4HS8H 4H20H 1F3JB 1FZJB 3V5KA 1OTTC 4X98A 1XT5A 3L3KA 4ENED 1C16A 3LMJL 2OM5A 3NPSB 4LLMB 5HBBA 3TH4T 3VFOA 3WXVH 3HMXL 2OBGA 1CIDA 4QOKA 4DJMA 3DI2B 3DOSA 1MEXH 3C09C 4AG4L 2OTUA 4L4VE 4XH2A 2JIXB 3MFFA 3ZL4H 4CKVX 4K9EH 4GBXB 2HTLC 4GRLA 5KW9H 1JHTA 3SKUD 2DJUA 4BUGA 2HMID 4Q97A 2F8OA 3FFCD 3NTCH 5E2TL 1GOGA 3PE9A 5TGBB 1DDHA 2A9NL 1AGDA 3VH8G 3SQOL 3OKMA 4PB9H 1OP5H 4Y5XA 5FKAB 4IRSC 2NY0B 1HZHH 5GS0C 1A4KA 5HJ3A 4NIKB 3MACL 3R1GL 4X4ZA 4KUZL 1A0QH 3SKNA 5CJOH 4L4VD 2R2BB 3BXNA 3I50H 1SEBB 3MPCA 1E28B 5HGBB 3U9UB 1MRCH 2BRRH 3LKRB 3KWWB 3FJTA 2WMPA 3HMXA 2HN7B 2BVEA 2E7BA 3FTGA 3UBXG 4ACPA 1N2RA 2NY4C 1OARH 2YBRA 3EOBB 1A02N 1WAAE 2RR3A 4MGXA 5SWSD 1QFOA 5D7JA 4KRLB 2VMFA 4OLVL 2X2YA 2X1PA 4ZFZA 5JHDB 2BHYA 1BM3L 3TC9A 3EFDL 3QWRA 4LP5A 2I5YH 2V2WA 1QLRB 5EZLA 4XWGL 5ELIA 1CLYH 3ZT7A 4QY8B 2V5MA 3LQAC 1CGVA 1KTRL 1KJMB 4GRWB 4LPTA 1NEZG 4P2YA 3TNNB 5F1IA 3FONA 1MAJA 3FN0L 1RU9H 4H8WL 1FFPB 3B9EA 2ZCHH 1PJ9A 1QHPA 1AGBA 5B21A 3BRFA 3I02A 1D6EA 4HIHA 2F58L 2JK5B 3BKJH 3IDGB 2V2TA 4MVBC 3WUWG 2GY5A 4Q6YA 5IHUL 4UQ2A 1W0YT 5EZIL 2WWKT 2DICA 3EDDA 4WHCA 3D3VE 4L5FL 5DS8A 5F3BA 1QRNB 5CBEA 5E8OB 4WGWB 3LZFH 1DQDH 1U6AL 2Z4QB 4V1DB 4QXGL 3O6KL 3PL6A 1IFHH 3OKNA 1QYGH 4NWUH 3V79C 3OKLB 4BKLA 3MV11 1EERB 5L88H 3MROB 4K8RC 5IFHH 1NAKL 1RK0B 4HG4J 3G6DL 1EHNA 2XWJB 5F7YC 2HAZA 1CDGA 1T1ZA 5E8PB 3X11A 3T0EA 1MJ8L 4CL7A 2EYSB 4LARL 4RNRB 1N6QH 2AGJL 5D5MB 2YKLH 4HMDA 3QUYB 3TBYA 3LKQB 1MQ8A 3MRFA 4F37K 1DUZB 3DO7B 3V4PL 5FYLE 1GL4B 4KJYB 4UNUA 5IVNA 5C0AE 4IMKA 2K3TA 4AL8L 1J7VR 3BIAX 1IEAA 3ALPA 1FQ9C 4LF3A 3MUHL 2ICWB 1RIUH 1JF1B 4KY1L 3C8DA 1V8HA 1MUJA 2EH7H 4B5EA 1FN4B 4U1IB 2V17H 3MLYH 4ZAKB 4MJ2A 3S34L 3T0AA 2JB6A 2QR0A 3MBXH 1GGTA 4WHTA 2ZG1A 1JGDA 2D7MA 4Y4FC 3DVFA 3MRKB 1WISA 1GIGH 3BUYB 1PQZB 3VGAB 1PY9A 4L29B 3HC0A 2OQJA 3VXTA 1HCVA 4Z76B 3V0VA 4AK1A 5C0AD 3QFDB 1P7KA 4G6AD 1A2YB 4PBWD 1A3RL 1OP3K 2VSCA 5DURD 1IGIL 1WIUA 3STLB 2EYRA 3UZQA 1MVUB 1AGFA 4Z7VE 2AJZA 1S7XA 4U1KA 4XCEA 4Z0XA 2PW2A 4XHJC 2AJVL 5KSBB 3EYVA 5B39A 4WTZA 4LKCA 1Z5LA 4QO1A 1BFOA 3AS2A 5EIQA 1S7TB 1UH2A 5EU6D 1X5XA 3WIHH 1QOKA 1TTFA 4K23H 2NW3B 4GXUN 1EAJA 4KXZI 4KJQD 1XCTA 4Z8FH 1KEMH 3P2TA 2CMRL 2VE6B 5HYFA 1CL7I 5KS9A 1WJ3A 4RFOL 4W4NA 3KXFA 3SDAC 2VLLB 5J3HD 4DTGL 2O61B 2EDWA 2A6DB 2RHEA 1PDKA 5GISH 1GZPA 2HP4A 1XGRB 4HZLA 1K4CB 4TSCH 1YEKH 4HGWB 1JNHB 1WWCA 4FTVE 4ZSOB 2IADA 2LABA 4JANA 1FNEB 2IBGA 2W0KA 4OGYH 1LO4L 3MLZL 3EHBD 3NGBB 4H1LG 3TP4A 4HJ0D 5C07B 2X42A 5J6GA 1N5YL 2AJUH 2QTEA 3NH7L 5FM4A 4HMEA 2IAMA 4MA8H 3ILQD 1E4XL 2NY5H 1H15A 4KROB 3BP5A 2FO1A 1PD6A 4NOBA 3FO0L 1QRKA 3SHSA 1CDYA 2LFGA 4AIZA 4Q9BA 3QHFL 2VXTH 4G8IB 1VEOA 1FCCA 4TULH 3R0NA 3MRLB 5IG7B 4PLJC 1AJ7H 1Z2KA 1MRDL 3HI6H 1UEMA 4OTXH 5TE6H 1R3KB 4Z7WA 5I15L 4O9HL 1NGXA 1OM3L 3WUZA 2XNAB 1QR1B 1EO8H 3RWIB 5EOTB 3GGWA 3BP6A 1MRFH 4K7PH 1YNLL 4L4TD 5EU3A 5I1JH 1BMGA 2CDGB 2N4IA 3DURB 5DWUH 4X9GA 1UXWA 2EDFA 5CCKH 1BP3B 1X5JA 1VB9A 1MJUH 2CDEB 4ZFFB 3LVEA 1HXYA 3B6SA 5ANMB 3L95B 1C5BH 3BH9B 1VGEL 3HE6D 3T1FB 1T0NA 3QUMB 3C2SA 2X4QB 2XZQH 2HKFL 4HXAL 1F4XL 3TLRA 2FWOA 1U58A 4X99B 1MCDA 2AW2A 1YEEL 3VFMB 1ZLWK 1QVOB 3BQUA 3RVVC 3WDIA 3FN9A 4Y2DA 4QRRA 1A7NL 2OXGA 4ZFGH 4YFEA 3HNTH 2UVFA 1L7TH 3MZTA 1FSKB 5ENWA 4CMMA 4JQXA 2BX5A 3MREB 4OD3H 4CU7A 1U8QB 2C4FU 4R4FH 4TTDC 4QNPF 1XGQA 2AEIT 2DQTL 1FYTE 3GKWL 5BRZA 4RBPH 3RUGE 2OL3H 5GQBA 4PJ9A 5GXBB 4ORGB 3C6LA 1XIWA 4KDTA 4KQ4H 4NCC1 5HPMA 4M02A 5E08H 3QCTL 4NNPH 4LCWA 2J8UA 1GGIH 5ITBH 5L2KD 1JUFB 4KRNA 3O2WL 1ES0A 3QR2A 4G42B 3WJJC 3JZ7A 1KCSL 1YDPB 3CFEB 1FYTD 3KG5A 1HSAA 2ZPKH 4XVSL 2EDJA 4BZ1H 5F72S 4BH7B 4WJ5A 1MCNA 1RI8A 4K94L 3QEUB 4W4OC 3KLHC 1F02I 1S7UB 1T5XA 2NY6B 2YA2A 3KYOB 4A2LA 3DTXB 2FEDD 5L2JB 5CUSL 2R1XA 2YD6A 4F7TA 1YN6A 5FUZL 4MSWB 1K2DA 3GSOB 4PGCB 1QEWA 3WFDL 1BIHA 1K6QH 2J8UF 1VERA 3QI9B 3GI9H 4PY8J 4Z78B 2JLLA 4HKXB 4HG4K 2PR4L 1KEGL 1MCRA 5DI8A 3QUZB 5DMYA 4HUVA 2GI7A 1S8DA 4MD5B 3SKOA 3WFHA 4U1GB 2CLVA 3S3JA 4ZYKA 4QTHA 3O45B 2A6JB 2HFFA 3S37L 3FHQA 1ZLVH 4BFGA 2R69L 5ILTL 2J12B 4PGDB 2XZAH 1FH5L 3MCLH 3V5KB 4TPRH 5EN2B 1VADA 4MZ3A 4X98B 3SE8L 3L3KB 2NY3B 2DLFH 1C16B 1CDHA 4D0CA 5LXGL 5J13C 3TCLA 1DBML 1BFVH 4HBCL 3QDHA 1B0WA 3MFFB 2A9ML 4FP8L 4GRLB 3MRCA 1JHTB 5DUML 1XF1A 3IDIA 5D93B 1AD0A 4XMKH 3BP4A 3VRJA 5C0CE 4JFZL 5GGTH 1A7PL 3RNQA 3N1GC 5GSVA 1KXVC 1AGDB 4U33A 1G7JB 5F9WC 3LKNA 3H3PH 2E7HA 3OKMB 4G8GA 4Y5XB 5D7LE 4D0BA 1A4KB 2DM7A 3K74B 3L5JA 3M07A 4NUJA 4I3RH 4XT1C 3CFBB 3RBGA 2CIIB 4NHUA 2FR4A 4F9PA 4LCIL 3SKNB 1BAFH 3RKPA 2NY1C 3L3OA 3BXNB 2F19H 2D7TL 5FYKH 4EN3D 2ZOLB 4QKXB 5D9SA 1J1PH 3MLRL 1X5YA 4JGJA 1BFTA 1I8IA 4EKXA 4PJGE 5C0CD 3MGTA 5DMGD 3P77A 3PABB 1N2RB 1T66D 1DBBL 5IB3B 2YBRB 1MIML 1LHZA 2NXYD 4LEOA 1ULVA 5LWYL 3D69A 2LU7A 3SQBA 1HH6B 5D7JB 3W0WA 1Z9OA 4HUXA 3QBTB 4ZFZB 1ZTXH 1LDPL 3BRGC 1A6VH 4ONOA 1UADC 4L9LC 4WCYH 4CVZA 2Q86B 2FIRT 1JGVL 2V2WB 2XY2A 4J4PC 5FYKD 2V2XB 3BPCB 5EZLB 2FGZA 2QQNL 1YMMA 4NO0A 4M62L 4LKXA 4N1CA 1FZOA 1MHHA 1G6RH 2ATPA 1AQDA 3MRDA 1A22B 4R4BB 4X9BA 3V0WL 5DC9B 4G9DA 1ZANL 4L3EE 2W07A 4M5YH 3UTZB 4P2QE 5C92A 1U2HA 3BISA 3QRGH 3I02B 1ZHLA 3VRLF 4HIHB 1G7LA 1QG3A 2GTWA 3O8XD 3OAUH 5EUKA 4JAMA 4UQ2B 1WBXA 3KPSD 3N1MC 3IETA 4L4JA 4UV4L 1DE4B 3DUSA 4IDJH 3QUXD 3BYYA 5CBEB 4YHPB 1NBVH 4QRPE 3V95A 4XP5H 4OCSH 2DQFA 1SJHA 3KHOA 3QDAA 1CXLA 1E6JL 1ZVHA 4LCUA 5IFAL 3MNWA 2R4SL 4BKLB 4P2QD 4ZTPH 5I1GL 4P9HL 5FHBH 3NCYS 2Y9RT 3HAEA 3X14A 4YXHH 5HDLA 3KYAA 4P48A 1MNUL 4MXWH 2YZ8A 2BSSB 1T1ZB 3X11B 4D3CH 4JHWL 5F9OL 3P3YA 4CUCA 4U3CA 2GW5A 4LSSL 4TTGA 4UOW1 3FOMA 2O5YL 4P4KC 4R90L 1KB5L 4Q6IC 3UJIH 3IJSA 4RX4A 2CK2A 5TF1H 4HF5L 5JW4N 1CICC 4NJAL 1QZ1A 5JXEC 2FBJH 1IEAB 2PNDA 2VDQH 1WC7A 1PAMA 3L3JA 1KC5H 1WCQA 1KLGA 1J0HA 4TOYL 3BIBX 1U3HA 2HFEA 2CDFA 3RDTC 4JKLA 2DD8H 1YEGH 2JB6B 1X9QA 4WI9A 1JGDB 3BWAA 1CT8A 4Y19E 4Z9KB 5KZCB 4HWEH 1JJUA 3O9WC 1P7HL 4EVNB 2LU4A 3HMWL 2VJXA 2XFXA 3HC0B 4CVUA 2OQJB 4Z7NF 1IEHA 5D7SL 3QB7C 3HS0B 4YHOL 3VXTB 3RP1A 4XWOD 4LASL 1P7KB 2EXWC 1LEGA 4F15C 1ZHBA 1KB5A 3H3KA 4HXBL 4IJ3B 5HHOE 1J1XH 3MA7B 4QRTA 2R0LH 2EYRB 1AGFB 3I2CH 1S7XB 4Z0XB 2PW2B 3L6FA 4O58H 3AMKA 5FXCH 3LEVL 3EYVB 5B39B 2CUIA 4Y19D 4PGJA 5FYJL 1Z5LB 4RFNB 1PZUB 2IQ9L 5SX4H 4H5SA 5SX5K 1GGBL 2IPKB 2V6HA 5AYUH 2QADB 4LL9A 1FAKT 4WI7A 1S7SB 1XCTB 1SEQL 1CGYA 4KZEH 1KJ3L 4M93B 5HHOD 3UROR 1HYSC 3N0PB 5KS9B 3EYFA 2EDOA 4PJXB 3BT2L 4S0SD 5BQ7B 5HGAA 3D2UA 3RL1A 2F53E 2C3WA 3EJZC 3ZO0A 3F7VB 2X5PA 3LH2H 1KTKE 3ILPB 3QISA 1TPXB 4HPOL 4IRJC 5DDHA 4HZLB 1IC7H 2VC2L 2I60H 4L3AA 2BVPA 2D4FA 4GMSH 2I9LA 1TJHL 4JANB 1MFBL 4GXUM 3BYTA 3ZKSD 1UWEH 4DAGH 1MHPH 2DTSA 1X7QA 4M7JL 1F45A 1OSPH 1NC4D 5EORL 5J6GB 3QCUH 2F53D 1MCCA 2OJZH 2ZP0T 4OI9A 2EDXA 3B3IA 1DBKL 4H88L 5DK2A 4G5ZL 1JHLH 4ORZC 3BP5B 5GJTH 1FIGL 4AIZB 2Q8BH 4HCRL 2COQA 1KLFA 2EDQA 4F8TA 4YDIH 4X80H 4Z7WB 1DQQB 3T3PE 4RDQF 5MI0C 1U3ZA 1A4JB 3OSKA 3GGWB 2YUVA 4H0GA 4DOHE 3BP6B 2Y07L 2VLKA 1BQHG 4FXGA 1U91A 2FO4A 2ITCA 1UXWB 5CJBA 4AEFA 1X5GA 2CK0L 4FQCH 1EDQA 2C1PB 1R5IA 3NAAL 2QEJA 1HXYB 3B6SB 5CSZA 4HJ0C 5E6IA 2YPKA 1T0NB 4Y4HD 1UH4A 2FRGP 5DQDL 4K3EL 3EJJX 1ZSDA 1HDMA 2NTFA 5FOJA 4DVBB 1M7IA 2FWOB 4HCRA 3ILQC 3VFUB 4PG2C 4HWBH 1I8MA 1JWSA 2WUCH 4Y2DB 4QRRB 3AS3A 3WDJA 2JJTC 1K85A 3TA3D 4S1SL 1I1AA 1XF3A 3VFNB 3EOTL 1RJYA 3MV7A 5ENWB 2KZWA 2Q1EA 4CMMB 5KOVC 4LOUD 1PX4A 1RMFH 1AGEA 2NTSP 3ZDZE 1OAYL 1E4WL 1KN4H 5DD3H 5BRZB 4TSBL 1YJDL 2CGRL 1IL1A 3QO0B 3N85H 4PJ9B 1T6WA 3MX0A 4ZO8A 5J9PB 3C6LB 2NMSA 1L7IL 5BVJA 1XIWB 4KI5E 5HPMB 3FT2A 3JUZA 1UB6A 2J8UB 2WUBH 1A6WL 3F7PC 4NFBA 3N06B 5E2UH 2O93L 4WUUA 2HFTA 3P30H 5TDPB 1H8OA 1ES0B 2BC4A 4YHNA 1SVZA 1QLFB 1IMHC 1DSFH 5KVDL 1RUMH 3O2VL 1JFQL 2R56H 3VH8A 5IJVA 2B5IB 3BJLA 1HSAB 3G5VB 4JVUA 4WJ5B 4XBPA 3O4OC 5D1XD 5I8KL 4DGYL 4XI5D 5D72L 4G9FE 5HHQA 4XNMB 4KI5D 2YRZA 4YK4B 3QJFA 4JHAH 3ROOB 3QEGH 3HUJA 1YN6B 4E41A 3LRSA 1K2DB 5JDJA 3TJEH 2BK8A 5HVGB 5MP6L 1QEWB 3UBXA 1SBBA 3RIAK 4KTEL 5BO1L 2R1YB 5GGVH 1JYWA 3QAZB 4WFFE 4NCC2 5C0ND 1Q9WA 3RVXC 2IFFL 5EB9A 5DI8B 3TT1L 4F57L 4X7SL 2R9HD 1Q0XL 4GRMA 4G9FD 1GRWA 2ENSA 5K9JH 2R39A 1LO0L 1S8DB 4JY4A 1NCDL 5C86A 3KAAA 3VXPA 4MA7H 3O4LD 3SKOB 1VKXB 5GRUH 2CLVB 3CFCL 3JWDH 3WIIL 4XNUL 2ESVE 4MB3A 4HS6B 3MLVL 3ECBA 4ZYKB 4DEPB 3C60A 5GGVY 2AABL 3HUJF 5IHZA 2HFFB 4XC1H 5IP4A 3J7HA 1NEZA 5C0EA 5F7LB 4URTB 3RPIA 3H7BB 3FRPG 5A3IC 5DJ8A 1QBMH 5DEGA 5IBLC 4LVHC 2EZ0D 1VADB 1ZKAA 35C8L 1MCKA 2P5EE 1ZGLA 1INEL 5C09A 4B50A 1G1CA 5DJAA 4D0CB 3WUWA 4JFHE 3TCLB 2MKWA 5KVFH 4AM0A 5JQ6L 2NZ9D 5IVOA 1YEDB 3MRCB 3IDIB 1RUQH 1J9CT 1AD0B 3RNQB 1I8KA 3MXWL 1BJMA 3CC5B 5GSVB 2X89A 3C9NA 4N0FA 2ZSVB 4G8GB 2JKXA 5I18L 2EE6A 4DKAA 2P5ED 4NUJB 3VXMA 1BGXH 3Q3GA 4JFHD 4TVPL 2IEPA 2KDGA 1WZLA 4RMWA 2HRPH 1AXSA 3L3OB 5HHVH 1S5IL 5J1AB 4GS7C 5D9SB 2NNAA 4FZ8H 5GGUA 1I8IB 3MGTB 3PGFL 1YNKL 4JDTL 3WKMH 3P77B 1QSFE 3RZCD 1T0MB 1QSVA 1I7UA 2QHRL 1NGWB 2D03L 3D69B 2Q76A 4ZS7L 3LKPA 5E9DA 5JORA 3QG7H 1UG9A 3W0WB 1DUYA 1KCVL 2W9DH 4R9HA 1QQDA 4YHKH 3DJ9A 3GMLA 4Z6AT 3IT8D 3WFEH 1SQ2N 2A1WH 2BSRB 4EQ2A 1A9BA 3QDGB 1SY6H 3T09A 4XPBH 2ZUUA 1OAKL 4NO0B 1OD7A 4WEBH 5HDQH 4OB5H 4OZIA 3MLXL 1MHHB 4AT6A 2ATPB 1AQDB 3MRDB 1T83A 3QIWD 3BZ4A 3KYKH 4G9DB 3SO3B 4CGTA 4OQTH 3QZWB 4NQCE 4FMKA 4P9ML 4TNVF 4XNZB 3SBWC 1ZHLB 2G75A 2R8SH 2GTWB 1KNOA 2XG5A 3NCEB 1NEUA 5GRJH 5DMGC 2K9UA 2WBJC 3ARGC 3L9RA 5CILH 1OPGH 2HT4D 4KGLA 1EHXA 4GG6A 1WBXB 3U0TB 3IETB 3JWOL 4MAUL 3DUSB 4N8CL 5D1QD 1G9ML 2DQFB 1SJHB 2FHFA 4DN3H 1U8HA 4LCUB 1P6FA 1SM3H 1GAFL 5C0BD 3BRDA 1OB1A 3KLDA 4OZIF 5JLZB 4WW2A 3HAEB 3X14B 5ETUA 3A6OA 3VFWA 5IROC 4AZ8A 4APQD 4GFTB 3OQ3B 4JDVA 3LEYH 2NQCA 5IOPA 4PJFE 1WTLA 1KIRA 4G8FA 3X17A 4JG1L 4P2RB 3QP3A 4PRIA 1LK2A 5B8CC 4TUKL 2YUWA 3N50A 3FOMB 4K71C 1HXMA 1PSKH 3IJSB 1U8NB 4RA0C 3GMRB 1DL7L 5FGRA 3WFCH 2H9GA 3B5HA 5I8OH 4R0LC 4LRNH 2F54D 4D2NA 2C3HA 4TSAH 4DVRH 2IALA 4LQFL 4NGHH 3U82B 1A7OL 4H1LA 1HQ4A 1KLGB 1KCUH 1GHFL 4WW2F 2HFEB 2CDFB 3QUXC 3SJVE 4F58L 1TETH 4P23B 3BWAB 4NQEE 2YS4A 5KJRH 2GFBB 3VA2C 1XR8A 1HHKA 2DDQH 3MLPA 2XA8L 3Q6GH 1JCKA 3Q1SL 1J0IA 2XFXB 2XKNA 4S1QL 2P5WD 3BMWA 2YPLE 4NRXA 4Z7OF 3IVKB 5FM5M 1AP2A 5HVHC 3I6LE 2DLHA 3L1OH 1LEGB 2ILLA 2Z31A 1KB5B 1X5IA 5JW4M 1KT2B 4CMHC 4F7CA 5I76A 4UTBL 4Q9CA 2C4XA 2GHWB 1NDMA 3L6FB 3NCYP 3SY0A 2ADGB 2FX7L 1X6NA 1KPRB 2ICEA 3V6BR 2F9BT 1BZQK 1YEHH 1ZLUK 1J05A 1YYML 1FNSH 3BKMH 3OXSA 3HCVA 5DD5H 5FCSH 1OOAA 3I6LD 3TWCH 1KSRA 4NZTH 4ZUWA 5D96C 5HYEA 5IMLB 1IM3A 4JN1H 3VG9B 4P3CH 3SE3A 1IVLA 4JO1L 3F6LA 5F7KC 5SX4I 1CGUA 1P7QD 4FZEH 1UJTA 5D2LB 4ONFH 3UP1A 1SMOA 3CFIC 1K3ZA 2G60H 1OVZA 4KPHH 2JIXD 1TTGA 2D0FA 4GBXD 1U8PA 3WN5A 1URLA 2QV2A 5IIEB 2OYPA 3F58H 5IM7B 3O2DL 2BVPB 1JPGA 2I9LB 4OCWH 1RZGA 3CZFA 5H37H 2A2QT 3KPLA 4IM8A 2NY0D 4Q9QH 5L9DH 3PHQB 5E8DL 5I19L 1D5MA 4NM4L 5JHDE 2XA3A 3H9ZA 2UYLA 2AK1L 3B3IB 3GO1H 3F7YB 1D6VL 5A43C 5DK2B 5IQ9A 5DO2D 3GRWH 4FFWD 3C6SA 5JA8B 1Y0LA 1RUKH 3IJYA 2YR3A 3DSNA 4JE4B 3PDDA 1C5CH 3G5ZA 3H9SE 5C08D 5DD1H 3WDHA 2B2XH 4P46B 3TBWA 4PRNA 2E7LA 2FX9L 5E94A 2Z92A 3O2DA 1B3JA 3MOBL 1FORH 5DC4B 1IKFH 1XR9B 2YD1A 2LTQC 3EFFA 2WIMA 4FXGB 4Y16B 3RWJA 1U91B 2FO4B 3C8KA 1FLRH 5HYJD 1FVEA 3RY5A 2P49B 1HSBB 3LQMA 1R5IB 1QRNE 2F8XC 1B0RA 2R0WH 4OLEA 1F4WL 4HK3J 4XX1G 3H9SD 4V1DE 4BZ2H 1MJ7L 5E6IB 3BZFA 4HS3B 2YPKB 1NAMH 3CUPA 5C6PB 1ZSDB 2NTFB 1UM6L 2J4WH 1M7IB 3FO1A 1NMCC 5AZ2L 4R3SA 1NCBH 1JWSB 1W0VA 4JQVA 3RIAF 2ZJSL 1HK6A 3QDJA 4C56B 2I25N 3ULVC 1QKZL 3WHE1 3MODH 5FV2A 1JZ7A 1I1AB 3O3DA 1OWWA 3CLFH 1RJYB 1A6PA 1QRND 3AB0C 5D5ME 5HGHA 2HH0L 2XG4A 2PXYD 4WU7A 5DUBB 5CMAB 3S36H 1D7FA 1Q9LA 1MCHA 4NO5A 1YEJH 2CIKB 1IL1B 4K3JH 2B0SL 3GHBH 1A9EB 2ADIB 4D9LL 3V6ZB 2EYTA 4EI5C 4KUCD 4G6FB 3CXDL 5BVJB 1D5BB 5EULV 2MMXA 4PJ8B 3BMVA 1UB6B 4OAWA 3DUUB 3OKYA 4F7MA 4IOIA 4MD0A 5DGRA 2XQBL 4YHNB 4QHKJ 2DM4A 3S97C 1MIEL 4LRIA 4N5UA 3QUYD 1JN6B 4LVOC 4UQ3B 3VH8B 3RGHA 5F9JB 1H3PH 2BFVL 2X4RA 5C1MB 4XBPB 3ZE0E 1QP1A 5H2BA 1ROWA 3TA3C 1V7NL 4G6KL 2BY3A 3QJFB 1H8NA 1L9NA 3HUJB 1F4YL 5DT1L 5CEZL 4E41B 1O7SA 4GQ9L 4LOUC 4OCXH 4JGUA 2XKUA 4GXVL 4R4ND 5KSBE 4L8DA 2ZCKL 5JNYA 3P11H 4PRHA 3UBXB 2DWEA 3NZ8A 4LDLB 4FFVC 5CEYA 4DZ8A 4FQ1L 1RUAL 1Q9WB 5SWSA 3ZSSA 3I9GL 2HA1A 1JTOA 3IDNA 4WI5A 3RA7H 2X1WL 1RJCA 2X4OB 2CUMA 2FATH 5INCA 3EYQC 3SDXA 3VXPB 1J5OH 4WIQA 1CK0H 2RCSH 1OGAA 1JYVA 2F8VA 4A2MA 5DSCB 3ECBB 1OD9A 5C7XL 3C60B 3KPOB 4JY6A 5IHZB 1NEZB 5C0EB 2E27H 5SWQA 3RPIB 4Y89A 4IRZH 4XI5C 5DJ8B 3VD4A 4LLDA 3RGVA 4QTIH 2HLFC 3H6JA 4ZDHA 4ZSOE 1ZVYA 1ZGLB 2JB5H 4O02L 2VDPL 2XRAL 4ZUTA 3WUWB 3QJHA 2A77H 2RGSA 4AM0B 2GK2A 4LBEA 5BVPH 4XTRD 1KOAA 5C07E 4C55A 4DN4L 1J12A 3QEQB 5TJWK 3SDXF 1CVRA 1T89A 2Y5TA 4RMSA 2J88H 4FABH 5E4IA 1I8KB 3MXVH 2K7QA 1XFPA 4N0FB 2X4TA 1RVFH 1EJ6A 2BSED 5DHYA 3VI4E 3WXWH 2AS5M 1AHWC 3T2NL 3VXMB 3NIGE 4PJ7A 3EYSL 4DKEH 3GB7A 1DVFD 3FQUA 5C07D 1OGTA 1VPOL 1K8IA 2WK2A 1EMTH 1I4FA 1OAUH 3MJ9L 3IKKA 3SDYL 4ZD3H 5I71B 3WE6A 2NNAB 5GGUB 4L8SC 4XXCC 4I77H 4TQEH 1N26A 1KTLA 2EZ0C 4YLQT 6FABH 3EKCA 2VXQH 1I7UB 1M7XA 1ZVSA 5ANME 2Q76B 5JORB 1GC1C 3JWDC 5E9DB 3R8QA 4WDIA 4WFGE 3HPJA 5JUEH 2NZ9C 2DQCL 1TJIH 1QQDB 4LHUG 2OK0H 4CN6A 3X13A 2VNCA 3GMLB 3C2AL 4XMPH 3BJ91 1R3LA 2N7AA 4JN2A 4D94A 2HRLA 3ARSA 1A9BB 4JREC 2AXHA 3MV01 5F96H 1MQKL 4EIZC 5C2UB 2D7OA 1A6AB 4OZIB 1UWXH 4LDEB 4AT6B 3MJ9A 1KV3A 2BNRB 3C5SA 5BW7C 3QQNA 5T5FH 4M00A 2GEEA 2OXHA 4KKNA 2G5BA 3IU4L 3MRJA 4OF3A 4WFGD 3WLWD 3MJ7A 5JOPE 2G75B 3BHBA 1KNOB 3EUUA 3GMPA 4KMTL 1KFAL 2OSLA 2YSSB 3V5HA 4OCYH 2FZ3B 4CADA 3TH3T 3L9RB 5D4QA 3X12A 1NKOA 4OSUH 2XTJB 4GG6B 1JPSH 5I16A 4XVTL 3RZCC 1E4KA 1I1CA 2ICES 3GMNA 1F8TH 4X7DC 1BVLA 1IQWL 1U8HB 2GK0B 4PJHA 3LQZA 4HPYH 3V6FA 1ZHKA 3K80A 4OGZA 1OB1B 3PDGA 1LWRA 4CN4A 5ETUB 1EFQA 4KK6D 1T7YA 1Q0YH 3MJ8A 1YPZF 1RSFA 1V7ML 3JXAA 3BKYH 4XAWL 4JDVB 5IOPB 2VDKH 3UCRA 1KIRB 4G8FB 4MNHA 4X6DA 4PRIB 4P5TA 1LK2B 3WIHA 2QBWA 2J6EL 4YHMH 1EVUA 3NPZB 4R7NA 2H26A 3W82A 3VWJA 3VW3H 2DYPD 4PJHF 1EEZB 3NACL 1EFXA 4H1LB 1HQ4B 2VDOH 3DV4A 1S9WA 5BXFA 5JZ7D 4HIJA 2DLGA 2WSKA 3QUKA 3M1BA 3UDWA 5GZOD 5D1QC 5ADPL 4HUNB 1JNLH 4OJFL 5HPOA 4LSTL 3BKCL 1ZOXA 4JM2A 2FIKA 3CFJA 5IW6A 1YEIH 4JFFE 1XR8B 1HHKB 3CDCA 4OF8A 1HYRC 1P5UA 4U6VL 4C54A 2UZIL 1NMAH 3VMPA 3WNKA 4X6DF 2I26N 4KKBD 1RK1A 4HFWB 1PZ5A 4APQC 2Z31B 2J6EA 3LPFA 1NBQA 2EDYA 4F7CB 5I76B 3ZTJH 4ODHL 1WITA 4AMKL 4OFYD 3ARFC 1BQHA 4PGBA 4L4TA 5M7QA 3SY0B 1XGUB 4ZPVA 4N9GB 1ITCA 2X1QA 4JFFD 4U6TA 5GIRB 4ZUUA 4R2GD 3WNPA 4FQXA 3GJEA 4PJ5B 4ZS6D 4JM2F 1J05B 1J8HD 4XBGA 5D8JL 3HE6A 3HCVB 5DLMH 1XGTA 4ZUWB 1RD6A 2EXYD 2IMMA 2IPUK 1RIVH 2NY3D 3MYJA 1LO3L 1A5FL 3MNZA 5CJXA 4M6ML 5T1MA 3ELAT 3Q5TA 3QWOB 2QLVB 4QOKD 1Q9OA 4P5MA 1T4KA 4HWNA 2PTUA 3LS5L 2Y25A 3U83A 4GRLD 3U48A 3U7AA 2X4NA 3LMJH 1U8PB 2PTTA 3RL2A 1NGQL 5DK0A 1SYVB 3HMXH 1JF6A 3DPBA 4CAGA 1P9MA 4AG4H 4KK5D 1N3NA 1RZGB 3CZFB 4X6CF 4XXDA 2DMCA 5JR1L 3KPLB 1XMWA 4X6EA 1VA9A 4MJIA 2PYEA 2HLAA 5E2TH 5KSAC 3B4NA 4PV8A 1D5MB 3ARDC 2A9NH 4C83A 3SQOH 5C0IB 5CHNA 2HJLB 1IJ9A 2X9WA 5FECA 5L2KA 5F6HI 5E5UB 5IQ9B 2KQNA 2HT3D 3C6SB 3UTTA 1Y0LB 3MACH 3PGDA 3R1GH 5EZJA 3IJYB 3WLBA 4KUZH 1FBIL 2ADJA 5L8LB 3S35X 4DCQB 3EJYC 2VTFA 2E8YA 2X40A 3NPSC 5H37G 1KPVA 2L0DA 2CUHA 5D7JD 3TBWB 4PRNB 2UWEA 3T4AB 2Z92B 1JTTA 1WBZA 1DQJA 3B9KD 1HH9B 4GBXC 4CNIA 1LNUB 3QWRD 4MQ7A 3RWJB 3EFFB 1UENA 2BXZA 4XNQA 3GI8L 3C8KB 1FVEB 5HD8C 4OLVH 5DF0A 3TT3L 4EJ1C 1BM3H 1INQA 1B0RB 2NY0C 3EFDH 4S10A 2FD6L 2GJ6A 2YD4A 4NQXB 2DQEL 4XWGH 3CUPB 3GSWA 5ESVB 5LGHL 1S7QA 3CX5J 1ZWIA 4MLSA 1XCQB 1IGJB 3FO1B 3EZJB 2L7UA 3FN0H 2IH3A 1W0VB 2UWEF 5F3HA 3LHPL 4H8WH 3QDJB 3HLAA 4JFYA 4OZ4A 3T0EE 4RGND 4PGEA 4S0TD 1D9KA 1K4DA 3O3DB 2D9CA 4PP2A 2F58H 2NY7L 3FRPA 2QQKL 1G0YR 5IHUH 4UILL 3OJMB 4WU7B 3PL6D 1Q9LB 2AEPL 1I3RA 5EZIH 4JR9L 4NO5B 3GSQA 1T22A 3OB0H 3G5YB 4L5FH 3SDCA 3G04A 2Z8VC 4BYHA 3QIBA 2EYTB 3EYUL 1F97A 1OW0C 3RJQB 1SJEA 1U6AH 4TYUA 4MDIA 5I73B 4KTDL 3O6KH 4QXGH 4HLJA 4QRQA 2L4OA 3T0ED 5GSRA 4FFYL 4F7MB 1Z9SA 4IOIB 1WIPA 4MD0B 3B9AA 1NAKH 4RRPG 3G6DH 3IDUA 1RZ7L 3K0WA 5GJSL 1MCWM 4RGOL 2W65A 4BQ9A 1MJ8H 4R96B 1KN2L 4LNRA 4LARH 2X4RB 2AGJH 4OF7A 3FQWB 4R6UA 3OPZL 2AXGB 1DLHA 4Q2ZA 2B8OT 1CFSA 4CDGC 1F4HA 1M71A 2B4CC 4RMTA 3V4PH 5C8JB 4PJIB 1N4XL 3PHOA 4AL8H 5FYJU 3L3IA 4L8DB 5JNYB 4AEHL 1MCJA 5KZCD 4PRHB 3QXDA 2DWEB 3NZ8B 1N59A 4KY1H 3HR6A 5GHWL 1HWHB 5CEYB 3DVNB 1NGYA 1AY1L 3S34H 1VFMA 4CJ0A 1MAML 5B3JF 5SWSB 4NPYA 3JBG7 4BH8A 3IDNB 4Y4KA 5IWLA 4I13B 1FZKA 5KS9E 1OGAB 4HK0B 3STZA 3QUYC 3P9MA 3LN4A 4CN1A 2I9TA 4YFLF 3GSVA 2H6PB 4NWTL 1A3RH 3GKZA 5MEQA 2ICCA 3FQXA 1IGIH 2KH2B 1LP9B 1DBAL 2X9YA 5SWQB 3WMSA 43C9A 1QPXA 3UTSA 4LLDB 4M8QA 1MCBA 2AJVH 4NZJA 4UAOB 2QADD 3RGVB 3C5ZC 5EO9A 5GGSA 2E6JA 2P8MA 4ZDHB 1FE8L 2ZUVA 4ZAKC 4ZUTB 2XPGA 1NBVL 1I1RA 3FL7A 2H32A 4GKNB 5ID1A 3QJHB 4LBEB 1RURL 3KXFD 4S1DC 4WI4A 2FNBA 3TFKD 2CMRH 3N1FC 1I7ZA 1IRAY 1T80A 1A1MB 1H5BB 1KTDB 2N7BA 1G6RA 4RFOH 4ZG1A 1IAIL 3QDMA 3MSPA 4WTXA 1IILE 4MXWL 4OM0L 4LPCA 4DTGH 2X4TB 4EXKA 3TVMC 4WWKA 5DHYB 2EE2A 25C8L 5J4MA 2APBA 4PJ7B 4Z7WE 5DJCA 3GB7B 4OCNC 3FQUB 3ULSB 1K8IB 1I4FB 2WAHA 3PF2A 3SCMA 5MERA 5L0QB 3WE6B 1H3TA 2YPVL 1LO4H 2IAMD 3MLZH 1TQCB 5JIHA 2A73A 2QQLL 5AG8A 3JTTA 1KTLB 1FNGA 4W6YB 5BOZG 2XV6B 4C58B 4JFPA 4QNPE 1CTNA 3LKSA 1N5YH 1NANH 1GGCL 3NH7H 1ZVSB 4KHTL 3TM6A 3SGEH 1E4XH 4PTTA 1UM4L 4XTRC 5K59F 2EDEA 3VFRB 1KGCD 1LE9B 2MQCA 3FO0H 4M7LL 3X13B 3QHFH 5I8EA 3DETD 5FV1L 2KPNA 4JN2B 4E42A 1KACB 2WANA 2M8XA 2A38A 1ZT4B 1MRDH 2HTKC 2HT2D 3E6FA 1JPTL 1QBBA 2BVQA 4QRRE 5I15H 2ARWA 4O9HH 1OM3H 1L0YA 3TJHC 2ZKHL 4IHOA 2Q3ZA 3MRNA 5C0AB 1YNLH 3MRJB 4IRSA 3W11D 2AEQL 5F6IB 3MJ7B 5BRZE 2FL5A 4M3JA 4HMCA 1C5DA 1B90A 4Z7UA 3RWEA 4IS6A 3LQAL 3BHBB 1S9VB 3AS1A 2OSLB 5HI3D 1YNTB 4BUHA 3CFDA 3D18A 1VGEH 4KROC 1OHQA 4RWYL 4CADB 3BQUD 1CD8A 4TUJA 3L5XL 1LK3L 4MX7B 1P4BL 4KWUA 5MENA 4Y2DD 4QRRD 2J8UE 4LLUB 2HKFH 3MRIB 4HXAH 9CGTA 1F4XH 3GMNB 5EU6B 3T8XA 1HKLL 1BBJA 1BVLB 1NGPL 1YEEH 3V6FB 1ZHKB 1A7NH 2VB5A 2APFA 5BRZD 3BEWA 1UB5A 2BHZA 1HI6A 4KKAD 3C6LD 1XIWD 2QSCL 4Z7UF 4ZQKA 2WQ8A 2DQTH 3GKWH 4X7TB 5M95B 5AUMA 1A6TA 2EIEA 4ISVA 1I3GL 4NRZA 4YPGB 1HILA 4LCWD 4X6DB 4P5TB 4MXVF 1HQRA 4P5KA 5ABDE 1E6OL 4JHBA 2VABA 3K2MC 4IOFD 2XY1A 4K8RL 4WENB 3WLWC 5I66A 5B4MD 4X6BA 4JM4L 4OLUL 3QCTH 1DANT 3VWJB 1NKRA 5FUCE 4AIXA 4FOMA 2DQGL 3O2WH 4NNYB 5FEBA 3VXRA 5LJYH 3ARTA 3DV4B 1S9WB 4PJBA 5EPMB 1CE6A 4HIJB 4PREA 2JCCA 3QUKB 4M1CD 5BXFB 3M1BB 1V3LA 1R3IL 1KCSH 3IDMA 4XVSH 1DP0A 1A6ZA 1NCCL 4JM2B 1KB9J 3CFJB 1GGYA 1Z6JT 1CG9B 2HKHL 4QWWC 1UGNA 4K94H 4L9DA 4J6RL 4P2OC 1CLCA 3EGSA 4KK6C 5CUSH 4W70A 3HFML 1RK1B 1PZ5B 5FUZH 5CD3A 1MCQA 3IRPX 3SOBL 2FJFA 3WFDH 5F21B 1G9NC 2WWMD 3ME0A 5IR1B 2VLJA 3AGVA 4EI6A 1BQHB 2PR4H 4L4TB 5F97E 1KEGH 4PJBF 1WCBA 3O0RL 4ZPVB 4NRYB 3VRIA 3BDBA 4ZUUB 3VJ6A 3VG0L 4FQXB 2ZUXA 3GJEB 4U2ZA 5AEAA 5KG9A 3MO1B 3SGDH 2YMXL 4XBGB 3HE6B 3S3PA 1XGTB 5JZ7C 3GDBA 2NY6C 3EYOA 4NT6A 5CGYC 4G8GE 3VD5A 3S37H 4EUPA 3MYJB 4ODXA 1IC4L 2R69H 1JTPA 3MNZB 5ILTH 4AEIL 4PJDB 1FH5H 1Q9OB 1T4KB 5CSBA 2EEDA 5AAMA 3H2WA 3SE8H 3FKUS 3QI9C 1BREA 3RL2B 2PTTB 5F7HA 4QRSA 2V5YA 5DK0B 4D8PA 5BS0A 5LXGH 3QUZC 1DBMH 1UZ8A 5D2NA 1AKJA 4HBCH 4JKPL 4YXLL 4FP8H 2A9MH 3ET9F 3CX2A 3UTOA 3VRLE 4LLQA 4XXDB 5DUMH 3BZDA 4G8GD 3DMMA 3IDYB 4X6EB 4U1GC 1F58L 3S98A 4M1DL 3W0WE 4MJIB 3EBAA 2PYEB 2HLAB 4JFZH 1NGZA 1A7PH 4PV8B 2C26A 5ADOL 2Y4SA 1X5KA 4FRWA 3P4MA 4YH6A 2AXFB 4ZS6C 4G43A 3RVTD 1JGEA 1QBAA 5L2KB 4KKLD 1EGJL 3QDGE 3OAZK 3PGDB 1IGTA 1BECA 2X9XA 3WLBB 4N0UA 1BLNA 2NY3C 4UBDD 2D7TH 4LSRL 2AEWA 3MLRH 2DI8A 3W0WD 4I18A 4YE4L 1WBZB 5E70A 1LEKA 1DQJB 1DBBH 4GRLC 3SDAA 4CNIB 4WY7L 5JA9A 4MQ7B 1MIMH 3ESVF 5D93C 2R0ZL 4NM8L 5KVEL 1J8KA 2IPTL 4OGXL 5LWYH 5EC1A 4IDLA 1MCIA 1YMMD 3L5IA 4NO0D 3IKCA 1LDPH 5HYSG 4Y5XC 1INQB 1CDJA 1JGVH 2GJ6B 3DI3B 3W9DA 4YPJA 3RWFB 1EGJA 2QQNH 1TNNA 3GSWB 2P44B 3L3HA 5IW3A 4LAQL 3M17B 1S7QB 5EWIL 4GSDL 4M62H 1ZWIB 1ND0A 3HAEH 4GAGL 1HHHA 3V6OA 3O4LA 4JG0L 3V0WH 2IH3B 1WUNT 1ZANH 4MA3B 5F3HB 4EDXB 4JFYB 4ODVL 4OZ4B 4PGEB 4Z7QE 1D9KB 1K4DB 3BWUC 4M6NL 3Q5OA 3G9AB 4PP2B 2CPCA 1OTSD 3E2HC 5D7JC 1YYLL 2DN7A 2CRMA 1A6UL 2ZSWA 4HKJB 4X9FA 3GSQB 3P73A 4OZGF 4UV4H 2MQ3A 3SDCB 4OZFG 3G04B 4I0CC 1ACYL 4V2BA 5IV2A 1U93A 3MV9A 4P99A 5DD6A 4KZDL 5HYIA 1SJEB 2YWYA 1E6JH 4QRQB 4TUOB 5IFAH 1TNMA 2R4SH 3B9DA 4XPTL 3IAGC 5GSRB 4ERSL 5I1GH 4P9HH 4Y88A 2EC9U 1RULL 2H2SD 4M61A 3T4YA 1MNUH 2OMNA 1FYHB 2WZPD 4RX4D 1RJLA 4JHWH 5F9OH 2Q7YB 4LSSH 3DGGA 2O5YH 4Y2OA 4U6XA 4AENA 4R90H 1KB5H 1DLHB 4Q2ZB 4EIGB 3BDXA 4HF5H 2Y06L 1U3HD 2UUDK 1YMHA 5EBWB 4NJAH 3IRZA 4PG9A 5AWNL 4EN3B 3PHOB 2OMBA 3L3IB 1C08A 3LAFA 3KYMB 3QXDB 2AJXL 4TOYH 1IAOA 2X6MA 1NGYB 1KJ2L 1ZLWH 3U4AA 4YBLC 5JW3L 1T7WA 2ZNWA 4NPYB 1MLCB 2MCPL 4W81A 4LHUA 1MFCL 3HMWH 5F8QC 1OLZA 4L3CA 1FZKB 3S7GA 1QA9B 5FDWA 5D7SH 4YHOH 5ICYA 4FNLL 4LASH 1MWAL 3DRTA 3P9MB 3LN4B 4FQPA 2I9TB 15C8L 4OKVB 1CIUA 1NFDA 4HXBH 5MEQB 3QHZL 3FQXB 2MKLC 1X44A 3WJJA 4IMKC 3KNBA 1EEYA 2KQMA 5I1AB 3UTSB 4M8QB 1V3KA 4HW6A 3LEVH 5D7IA 2IBZX 4K3HA 5EO9B 4YJZL 5GGSB 2VXUL 2P8MB 2EDKA 5FYJE 5FYJH 2DQIL 3PWNB 1FVDA 2IQ9H 3O8XB 1RZIA 2XPGB 1KJ2A 1GGBH 2H32B 5ID1B 4Z95L 1IGFL 1M4KA 1A1NB 2EEAA 1KULA 1SY6A 3D2UD 1SEQH 3KPSB 4OFDA 4WGVB 3H7LA 1I7ZB 3MYZA 1KJ3H 1H3VA 1G84A 2MPAL 1G6RB 3BT2H 3GSRA 3NMEA 1MWAA 3QDMB 1NFDF 4RAUA 1U8KA 3CZJA 2WBKA 3SN6N 4ZOBA 1TCMA 4K07A 5FYJD 4WWKB 4LDOB 4HPOH 4LP4A 5D7IF 1FFNA 5DJCB 4UZGA 2VC2H 4YHIA 1XF5A 4X4XA 3SCMB 5MERB 3TV3L 1JRHL 5JOEA 1TJHH 1MFBH 2VLKE 1WWBX 2A73B 1QSEA 2QADC 3JTTB 1FNGB 3LD8B 1BWWA 4M7JH 4JFPB 5EORH 3LKSB 3QEHB 4M93C 8CGTA 1DBKH 3IGAA 4H88H 4PTTB 4WVRA 4G5ZH 3S36X 4YBHA 3TFKC 2CJUL 3ARQA 1XZ0A 1FIGH 5I8EB 5FO8A 2AK4D 1YECL 4HCRH 1P6AB 1TPXC 4RMVA 2BMKA 1CFVL 3CSGA 3WS3B 2VLKD 3SGEI 3O6FC 4P49A 1FNLA 4GAFB 3V8CA 2W91A 4AJ0A 4UT7L 5IESL 3OJVC 2Y07H 5FF6A 3S88L 5E6ID 2BERA 5I6XB 2APWA 3G5XA 2CK0H 3RWEB 4IS6B 3NAAH 2W1NA 3D0LA 4OCRL 1BQUA 1NFIB 2BXYA 1YUHA 2ED7A 4PJEF 5INDB 5MENB 2VITA 1FG2A 2YK1L 5CP3A 5DQDH 1VEMA 4K3EH 2LVEA 2ORBL 1I1AD 1BD2A 3MV7D 3I75A 1BBJB 1Q1JL 2JELL 5GRVL 1R24A 3DV6A 1CE1L 4S1SH 5DRXA 1PYWB 3UYRL 3OX8A 3EOTH 4OGAD 5HHOB 3RX7A 1UB5B 1TZGL 1U36A 3QG6A 1P7QA 4LAJH 2EH8L 5GZND 1TMCB 2D0GA 4J4PA 2X4SA 4ODSL 1OAYH 4ZQKB 1E4WH 2DLEA 3P0YL 5F7MC 1A6TB 3HUJE 4TSBH 1YJDH 2CGRH 2GSIA 5EBGA 4P5KB 1HQRB 4E41E 4WUUD 1CR9L 3W11C 1JHKL 1L7IH 4WFHE 4MJ5A 5I66B 4X6BB 2JJVA 5CD5D 1A6WH 5HI3C 1R3JB 5CP7A 3K4ZA 4XB7A 3VGHA 4PJBB 1CE6B 4PREB 5KVDH 2JCCB 3O2VH 1NC4B 1JFQH 4XNYL 3IDMB 1NMBL 5F9DC 1A6ZB 3T0WA 2F15A 2LE9A 4JQXC 3P4OA 3I6GB 1CD9B 4R26L 5CJQL 4H0HB 4YGAB 4DGYH 5D72H 5I8KH 4WW1A 4WFHD 1AR1C 1MH5A 4NUGL 1CFBA 4PJ9C 7CGTA 4YQXL 5B38G 1T04A 5C08A 1HE7A 3C6LC 5CD3B 4JGMA 1XIWC 2X4UA 5MP6H 3UYPA 2HVJA 4ETQA 4ZFOA 1OP9A 1A21A 5T1LD 4KTEH 5BO1H 2NW2A 4O51A 5JPNA 2V7HA 2VLJB 1RZJC 4EI6B 4XVUC 3K1KC 4YX2L 1WCBB 2IFFH 3TT1H 4F57H 4X7SH 4ODWB 4XPHL 4YDVB 3VRIB 1ZT1A 2FLRT 3VJ6B 3C60D 2A0LD 3QEQE 2B5IC 4P4KA 1LO0H 3PWUB 4LPXA 5KG9B 1NCDH 3PV6B 3WIIH 3CFCH 1CICA 4XNUH 4Q0XL 1N5AB 3WHE0 3MLVH 5JXEA 3EYOB 4Y4HB 4N1HB 4YK4C 4JPVL 1DQML 4NT6B 2AABH 5I74B 2H2PC 2AV7A 4JZOA 5C09D 4ODXB 3VXME 3SGDI 5ICZA 4OT1L 3RDTA 3BH8A 2H8PB 5FKPA 3MLSL 4OV5A 35C8H 4N68A 1INEH 3BSZL 1JZ3A 3QAZC 2V5SA 3O9WA 3AREA 5FUCC 2HG5A 4D8PB 3VFSA 3UZVB 5C0FA 5JQ6H 1ZLVK 1UZ8B 5D2NB 3P0VL 1AKJB 2DTML 2X89D 3G08A 1JP5A 1NAMA 4LLQB 2M2DA 3DMMB 1H9VA 5E9DE 1OTUD 3DHMA 1DN0A 1QO3A 5FYLL 3LY6A 3VXMD 1EO5A 2B1HL 3MXWH 4DEPC 5DHVA 3S5LG 3OTTA 4G43B 5IVXA 5I18H 4KK9D 2H3NA 4JKKA 4RRPA 3QPQD 3VMNA 5F89A 4TVPH 4N0UB 4S11A 1BLNB 4OZIE 2I24N 1S5IH 2BNRE 5BZDA 4EZMA 4RSVA 3O81A 5D1XB 4I18B 1SVCP 3PGFH 1YNKH 3WNNA 4JDTH 4HJGA 1HN1A 5SX5H 3SDAB 4ZMAT 2QHRH 2D03H 2W9EL 4ZS7H 1OSZA 4U1LA 5EC1B 5J7CC 2EE9A 1KCVH 2XTJE 2WNGA 3CFKB 4GG6E 4IRJA 4RISL 3IKCB 4X4YA 5IVXF 4TVPD 2OCFD 1UT9A 2GUOA 2XYCA 3MLUL 1EHLL 3AU1A 3OKEA 5GGQL 4HT1L 2ERJB 4J8RA 4AY0A 1CGXA 1BX2A 1PG7X 1UKTA 4QYOA 1R0AL 1OAKH 1AC0A 1VENA 3OZ9L 1ND0B 5EU5A 2FH8A 1CDBA 3MLXH 3TN0A 4KKLC 3O4LB 2V5RA 1QFPA 3SO5A 4OD2A 1Z0NA 2I27N 3OKKA 4JY5L 5I1LA 2DKUA 5E2JA 3QXAA 2XTJD 2AJ3A 5B22A 4U1MA 4P9MH 3FB5A 3EO0A 3PDOA 4PRIE 2A6IA 1HOCA 4Z7OE 1F4AA 3B2UC 2IJ0C 5IF0A 1ED3A 4FQJL 2Z91A 2ZSWB 3AMLA 2AV1A 3JWOH 2XTLA 4Z77A 4MAUH 3VD9A 1UM5L 4N8CH 5IV2B 5IMKA 1U93B 1G9MH 2GKIA 5DD6B 1KXQE 1QD0A 1GAFH 2J5LB 1FPTL 2YUZA 2EKSA 1FL3A 5I1HL 4PRID 2VRAA 4PY7A 4M61B 3T4YB 3CNKA 2MTPA 1W8NA 1WFUA 4XNZC 1RJLB 1EUTA 4JG1H 4TUKH 4ZXBA 2C9AA 4AENB 4U6XB 2GCYA 4D9QE 1SYSA 4R97B 2DJSA 4WFEE 2X4PA 1X3DA 3OJ2C 3WNLA 1DL7H 3BESR 1YMHB 5DFVD 5GRWA 5HSFA 1OT2A 2JJTA 1TVDA 4E0RA 4LQFH 4FTVA 3DX6A 1A7OH 2ITDA 3VGFA 2GAZA 4NKMA 1GHFH 3W5NA 1SJVA 4F58H 2AXJA 5AG9A 5J1SC 4POZD 4D9QD 5KN5A 1CS6A 2Z31D 2XA8H 4WFED 4G6JL 1CF8L 3Q1SH 1F6LL 1LEIB 4L3CB 4S1QH 2Q8AL 5HXMA 1N0LA 5FDWB 2H2SC 5ICYB 3DYOA 3DRTB 4JKMA 5F7WC 4NN7B 5C70A 1NFDB 4QRUA 4M03A 4OZHA 4UTBH 4G6ML 2X70A 3KPQA 5C0DA 3QIWB 4Y7MA 3BEVA 2FX7H 5D7IB 1CD1A 1FVDB 5FK9A 1RZIB 3HC4L 1KJ2B 1JGUL 4P23C 3B43A 4JJ5B 1CYGA 1YYMH 4YDKL 2R2EA 2P1YA 5IB5B 3KJ6L 3RU8L 2Q87A 2Y72A 4JO1H 3GSRB 4EBQL 4RAUB 1U8KB 4OCMC 3FB8B 5C0BB 3BPOB 4LFHG 1T21B 4RDQG 1VFOA 4N1EA 2JJUA 1LE5A 3SGJA 5FFLA 1X5FA 3D85A 3O2DH 4MDJA 4U05A 3UPRA 3BZEA 1XF5B 3IS0X 2E5EA 3RUGA 2MCG1 5E8DH 2LAAA 5I19H 1PEWA 5J12B 1TVHA 4NM4H 4NKIL 2C7UB 3D9AL 2Z8WC 3VG9C 1BVKA 1QNZL 3MRRA 2VDML 4PB0L 2AK1H 2F54B 1D6VH 1CGTA 4V2CB 1QFUL 3RAJL 1XZ0B 3FB7A 4U7KA 1AC6A 2G2RB 1EJOL 3T77A 5TFSL 1HCFX 3VXNA 2BMKB 1GOHA 3D5OF 5HDBF 3VI3E 3WD5L 4MA1C 3QDJE 4HLZG 3PGCB 2FX9H 5E56A 1KIPA 3MOBH 3QHTC 2P5WB 1U8OA 1UQSA 2X7LB 1DFBL 5F9WB 3RUGF 3K7UA 1CXFA 5FF6B 5I1CL 3REWA 1TENA 1FO0L 3H42L 1NBZA 2VAAA 3G5XB 5T1KA 4WWID 5IHLB 3LCYA 1F4WH 3D0LB 4GW5A 1YUHB 1TZIA 3TESA 4X0KB 4KI1A 1LGVA 1P2CA 1WBYA 1H8SA 4DZBA 4Q9RL 1MJ7H 2VITB 3QDJD 3ZKND 5EU4A 1JI1A 4CRPA 3LB6C 2C5DC 2JTDA 1UM6H 4PR5B 1BD2B 4ZPTB 3V4UL 3I75B 3EDEA 5AZ2H 3QYCA 2AKRA 4P46C 1R24B 3DV6B 2ZJSH 4KJPD 4X6FA 1QKZH 5FYKU 5DRXB 3CIQA 5C0GA 5E6ZA 1W8OA 1AQKL 3QG6B 1P7QB 4Y16C 5CZXC 1ONQA 4PUBL 3ZMRA 2HH0H 3OG4B 1FO0A 2X4SB 3T1WA 2PN5A 5HHNB 1JNNL 2GSIB 2WM0A 2B0SH 2DJ4A 4G8EB 3KVQA 4D9LH 4PJIE 5FUOL 4UT6L 3OBAA 2XWBA 3CXDH 3QXTA 4PRHE 1FVCA 3TEUA 3GMOA 1ADQL 3OKOB 3Q5YA 3WHXA 5IHBA 2XQBH 4WEUD 2W38A 3MFGB 4RMRA 5DJ0B 5SWSE 5DJXA 1MIEH 3TPKA 4LMQE 4ZO7A 3RPKA 1NCAL 4G80A 1I1AC 3Q2CA 2WBJA 3UBXI 3ARGA 3P9LA 2BFVH 3EAKA 1OGAE 4S1RL 2EO9A 4N0CC 2EE3A 3P4OB 4QHNA 4UT9L 1PLGL 5D7LA 1MCOL 2BVOB 1V7NH 4XPGL 4PRHD 4G6KH 1MH5B 2Q6WB 1Y18A 4DGVL 1F4YH 1LP9E 5DT1H 5CEZH 5CEZE 1DEEA 1T04B 4GQ9H 5C08B 1CLZL 1FGNL 3OXRA 5BJTB 2X4UB 4GXVH 3O3AA 2VN4A 1AXIB 1M1SA 2HVJB 4PJ8C 1U3JA 2ZCKH 4GT7A 4ETQB 4ZFOB 1ZA6B 4FHBD 4GLRI 1MI5A 3B9KA 3ORJA 2NW2B 4PBVC 4O51B 2V7HB 3RVUD 5IK3B 4FQ1H 1RUAH 1OGAD 5SWZA 1H0DA 1H3XA 1ZT7A 3I9GH 5HYJB 1ZT1B 5IVZB 2EIZA 3KPMA 3K3QA 1F00I 2VUYA 3FQTA 3LEXA 5HYSA 4JZJC 2DQDL 4NQDA 5CEZD 2FJHA 3S35L 3H9SB 3W9EA 4MWFA 2MJWA 2XXMB 2DQJL 3G6AA 3K1DA 5C7XH 3RGVD 3D25B 1JWUB 1F42A 1YQVL 2AV7B 4JZOB 4WI6A 4GQPH 3SKMB 5ICZB 3MCKA 3RKDD 2OR8A 4PJ7E 2HJFA 5DRWA 3BH8B 5FKPB 4YUEL 4KJWD 1JWMA 3GJFK 1UZ6E 4OV5B 1NUDA 3JV4B 3CDGA 4O02H 1S5HB 2VDPH 2XRAH 3AREB 3CVIL 2HG5B 3G6JB 4PLNC 4LSPL 4XCFL 3JV6A 1LILA 3VFSB 2PXYB 5C0FB 3RIFF 3IU3A 2WIIB 3G08B 4DN4H 1NAMB 5L8JB 4PTUA 1S7VA 4F15B 4OZFA 4I0PA 2NX5A 5E00B 5ACMA 3JTSA 2XOTA 5IW1A 1DN0B 3PXJA 4FFZL 4U1HA 2NR6D 4QRPA 4IBLT 5DHVB 2APTA 2A0LC 4Y5YA 3OR7A 4GW4B 1HIML 5IVXB 5I8CA 1VCAA 3PP3K 2H3NB 3T2NH 1I9IL 3IXAB 3AVEA 3GMQA 3EYSH 5JIKA 5F89B 1IE5A 4LSUL 1Z9LA 3OKDA 3QQ4A 1YY9D 1VPOH 1IC5L 3MJ9H 5BZDB 3HI1A 3SDYH 4TNWK 1TVBA 4F7PB 5JHLH 4NDMA 1HHGA 3FCTA 2ZUQB 4MS8D 1ZLUH 3BW9B 5CSGA 2YEZA 4I3SL 4DW2L 2Y5EA 1KCRL 2BOBA 1OQXA 1OSZB 1XF2A 1YQ2A 2DQCH 4X4YB 4OUOA 4LPVA 3JWNC 5F7NC 5KVMC 2GUOB 5CZKA 3C2AH 3OKEB 5EU6E 1OTUC 3R06A 4J8RB 5IT2L 2VSDA 1BX2B 2IWGA 1XH3A 4GMTL 1MQKH 2P8LB 1CGWA 4BELD 1KPUA 4OKDA 3U0PA 5EU5B 4KK9C 3TN0B 4ALAL 5I71C 1O7VA 4OD2B 3TIDA 3OKKB 5I1LB 1I9JL 3IU4H 2DM2A 3EO9L 4H26A 4YDJA 4U1MB 3FMGL 3FB5B 3EO0B 2YA0A 3PDOB 4PY8I 2A6IB 2BY0A 2DRUA 1HOCB 4OM1L 1G0XA 4X6DE 4KMTH 1KFAH 4J2XA 2LV4A 1ED3B 1DN2A 1R3HA 5DZNA 1ODAA 1WTGT 2Z91B 3UAJC 3H3BC 1G7PA 1S9YA 4XVTH 4Z77B 3ULVL 2C4FT 5IMKB 4J3VA 4U2YA 4JQIL 1BWMA 2YD3A 2QSTA 1IQWH 3F65A 4NKOA 3UTPE 3EDKA 3BD3A 3KDMA 2FSEB 3AM8C 2VZSA 3V9FA 1FL3B 2LU3A 4P5TD 4PY7B 4YNYA 4XRCA 2FLBT 5F71A 1V7MH 4XAWH 2YXMA 3Q6FA 3V5DA 3U30B 3BPNB 4LVEA 3U6RB 3VWJD 1H3WM 4ZXBB 1FNFA 4MAYA 1SYSB 4UV7L 1BJ1J 2J6EH 1EFXD 1FP5A 1WQVT 2X4PB 3UTPD 1DVFB 2GITA 1PKOA 5J0BA 4M43L 1O0VA 4E0RB 4JM2D 4L4TE 4JRXA 3DX6B 4NBXB 5C6TL 2ITDB 1NUNB 3NACH 3LN9A 1LQSR 5HHMB 3FQRA 5DRZA 5ADPH 3E3QE 4OJFH 4LSTH 3BKCH 3MNVA 3DX9A 5E8NB 5KN5B 3TH2T 2Y7QA 4EI5A 3SE9L 4U6VH 4ELMB 2UZIH 4O2EA 1IEBA 4OD1L 3ZKMD 3H9HA 3ZE1E 4PJDE 5FHAL 4NKDA 2NXZC 1ERNA 3JWOC 4NC1E 4NO3A 4RIRA 4FQXD 3ULVF 4OZHB 5E03A 2AVGA 4CBPA 2X70B 3KPQB 4ODHH 4XP9L 4MXQC 4AMKH 3BEVB 1UH3A 5C2BL 1J0ZA 2JE8A 2UV3A 3FT3B 4M4RA 4K7PY 4MJIE 5D8JH 2PYEE 2R2EB 3P4LA 2Z35A 2FX8L 2RB8A 4B7IA 4POZC 3U2SB 5L2KE 2R0KL 3EO1A 1LO3H 1A5FH 3UTTE 1JV5B 4M6MH 2Z31C 4UDTA 2KKQA 3LS5H 5FB8A 2JJWA 3T3PF 1B0GA 3D1MC 4WHYG 1NGQH 1N6UA 4MJID 4PD4J 1YC8A 1LE5B 2UWEE 2PYED 4A6YL 4C59B 4MDJB 3MUGA 3UPRB 3BZEB 1RZKC 3S8WA 5CIPA 4JFOA 3B2VL 4HUKB 5JR1H 1PEZA 1WICA 3UTTD 3QQ3A 4OI7A 1KF9B 1JBJA 2A74A 1C1EL 4I0KA 1OAZL 2GJ6E 2DYPB 1LVEA 2B1AL 1FDLL 3FB7B 4KDWA 1FBIH 1RFDL 3JUYA 3T77B 4OLWL 1B6UA 1ORQA 3MRBA 5CGTA 3EOAA 1MCPL 2VIRA 4MQXD 1GC1L 5T1DL 5DYOA 4A6YA 1UXSA 5J89A 1MLBB 4M9PA 4UNVA 1UQSB 3JSSA 1F90L 2J1KA 5B38A 2C3GA 3CVHL 2GJ6D 4GKOA 3REWB 5ESAA 3SPVA 4QCIA 3GI8H 3RTQA 5HVFB 1NBZB 2VAAB 1Q38A 5T1KB 3TT3H 5I1DA 4KH2A 2W9LA 3CSBA 5E5MA 2EDHA 2FD6H 4WI8A 4GW5B 2ENYA 1NCWL 4DZBB 5EU7E 2DQEH 2D3VA 3RRQA 4JFFB 4L8SA 5EU4B 4XXCA 4O2FA 4R2GB 1D9KD 4LGPB 5LGHH 3RX8A 2ZCLL 5IMMB 4X83A 1NJ9A 4KAQL 5JPMB 1J8HB 2AKRB 5JOFB 5L8KB 3ULUL 3LHPH 3V8OA 3GJFA 5F93C 4X6FB 4XCNA 3GUTA 3G9VA 2RFXA 3SDCD 3LRGA 3QIBD 2NY7H 3VFOB 3CVHA 2QQKH 4UILH 4QOKB 3DNKA 1I8LC 4O4YL 2AEPH 2OTUB 2W0PA 4JR9H 2M26A 4XH2B 5IFJA 5F7EL 2ADFL 2VUOA 3ARRA 2XWBB 3EYUH 5DVOA 5BW7A 3MMEA 4KTDH 3WEXA 1EHAA 4HD9A 1VHPA 3KJ4B 1DDHB 4FQQA 1FVCB 4BSVA 3GMOB 2IQAA 4FFYH 2VZ1A 3GM8A 5L7XL 5BOPA 1FIEA 5DJXB 2OJEA 5HJ3B 5ID0A 4JQVC 5DVKA 3ZKNC 1RZ7H 5GJSH 3A0OA 3S5LA 4G80B 3B8YA 3OF6D 3P9LB 4RGOH 3TCXA 5J11B 1KN2H 5FYKE 4QHNB 2DBJA 1MPAL 3CCHA 4Q58C 1MY7A 4LMQI 5HDOA 3OPZH 3FTGB 5JW4Q 4X4MA 4ENEC 1ZA3A 2BZDA 1DEEB 3GMMA 1N4XH 4FXKA 3UTSE 3OXRB 4JB9L 3UC0L 1Q8MA 4N9OB 5I73C 3O3AB 4AEEA 3ES6A 4AEHH 1ORSA 2Z93A 3U7WL 3FOLA 4Y4KD 1MI5B 4PRPA 3B9KB 4YEFA 5GHWH 5F88A 3LSOA 1QSFA 1AY1H 2H32H 2HMIC 5SWZB 1MAMH 5C0JA 4HDIA 3ULUF 4F37F 1ZT7B 2EIZB 4ZOCA 3KPSE 4FQIL 2AQ3A 4TNWF 3FQTB 5HYSB 1JYNA 2Z0BA 4NQDB 3PWVA 5F1IB 3FONB 2FJHB 3W9EB 5GGSY 3RWDA 4MWFB 3QDME 3UTSD 5K59E 3FB6A 1MAKA 3MRMA 5TQ2L 4NWTH 1AGBB 5MHSD 3GFUA 5FO9A 4K9EC 3NIDF 1D6EB 1DBAH 5FDYA 2V2TB 3MCKB 3ZDYF 5DRWB 1FCGA 4QLRA 4RGNB 1JWMB 5D6CA 5F1KC 1FE8H 1BQLL 3CDGB 4NQCA 5DS8B 3TBSA 4C4KO 5F3BB 3ARBA 2VLME 5C9JA 4KK8D 4P3DA 1OY3B 1EH9A 1RURH 8FABA 3QDMD 3PL6B 3IU3B 3OKNB 2DL2A 5HHXL 5I75B 5DZOA 1MFAL 1S7VB 2DI9A 1AD9A 5I0ZA 4I0PB 2K1MA 4QGYA 3JTSB 4WWKD 5IW1B 2EDNA 1CXKA 4U1HB 3TZVA 5BMFL 1IAIH 4F3FA 4M3KB 5K9QI 4OM0H 1OAQL 4Y5YB 4F9LA 3ARFA 2Y6SD 5F8RC 3T0EB 3DSFL 4XHQA 3LIZL 3SCMD 5I8CB 3CSPA 25C8H 1A8JH 5IB4A 3GMQB 2VLMD 2YXFA 3DIFA 4HWZA 4YC2B 5K9QG 3RGVC 3TBYB 3N1PC 3OKDB 3MRFB 2APVA 3QQ4B 4HKZA 3S96A 3MLTA 1ZLSL 4PFEA 1OTTD 2OR9L 3HI1B 2KBGA 4JFXA 4M5ZL 3RY6C 4NDMB 1YN7A 2YPVH 3MJGX 2QQLH 1UJ3A 4LF3B 4KJWC 5E2WL 2VAJA 2YEZB 1MUJB 1HINL 1GGCH 1H5BC 4GAYA 4KHTH 5I1EL 3ALWA 1XF2B 4WHTB 2HTLD 2QR0B 1XGPA 1UM4H 2V9RA 5MENE 4M7LH 1QFWL 5LGKA 4PLKD 1D5IL 3OGOE 3R06B 3SJVA 3WV0A 2NR6C 4PD4K 3V0VB 1XH3B 1AE6L 4IRSD 1JPTH 1I1YA 5EFIA 1KPUB 3U0PB 1I9EA 5KSAA 5A16A 3K8KA 3ARDA 2ZKHH 3TIDB 4DWHA 5KANI 1TQCC 4CVXA 2AJZB 4U1KB 4XCEB 2YPLA 3MZGB 2AJSL 2AEQH 4YDJB 5B3NA 2WLZA 5MEND 2I07A 1EV2E 1BEYL 4LKCB 2QJDA 4LLAA 4X5LA 1BFOB 3LQAH 5KANG 3VXQA 3MOAL 4L8BA 3VDBA 4KV5E 4NC0B 4RWYH 1UWXK 4LLMA 3L5XH 1LK3H 3RNKA 1P4BH 1ZE3C 1MCLA 1S9YB 4U0RB 1YA5A 3VXOA 4KVNL 1HKLH 2FJGA 1NGPH 3MRGA 3KS0J 3DYPA 4NKOB 3KXFB 4PJBE 4F8QA 5GS1A 2JCCE 2LTQB 2ARJQ 4NN5B 3S4SG 5MEPA 1DR9A 3O11A 1GZPB 4FMFA 4G6AC 1CZ8L 5F6IC 3V5DB 2OP4L 2QSCH 4JFED 1I3GH 1KYOJ 2IADB 2FCBA 1EZVX 4PIRF 2YUXA 1E6OH 1Z3GL 4MAYB 5FGBC 1E28A 4K8RH 3VXRD 3LKRA 4NQUA 4JM4H 1FHGA 1E4KC 4OLUH 2HN7A 2HFGL 4UMGA 3CMOL 2D4DA 2YWZA 3ISWA 1U8JA 2VLJE 5IGXL 4J3OC 1UWGL 4RGMB 1GSMA 2IAMB 2DQGH 1H15B 4KJQC 5DRZB 3U9PL 12E8L 1R3IH 1KCKA 3MRQA 5FCUL 4PP1D 2MSPA 1NCCH 3T65A 5JHDA 2R2HA 1J1OL 2B4CL 3MNVB 4XX1E 1QFWM 3DX9B 3DRQA 1CXIA 2HKHH 2XKSA 2Y7QB 4K8RD 5J3HC 4J6RH 1Y6MR 1NGXB 1T0PB 2GSGA 2AK4A 4K3GA 4QY8A 1MCFA 4EUPH 4O2EB 3HFMH 1IEBB 2VDLL 3H9HB 1YEFL 2VLJD 1KJMA 5EU3B 4NKDB 3SOBH 4W6XB 1A14L 1GJIA 3VA6A 2MOVA 1FFPA 3VWJC 4JCMA 5DD0L 1NSNL 2DLTA 4LK4A 5KAQF 3IAPA 3EHBC 2JK5A 1A7RL 1VFUA 3O0RH 5D2NE 5DJDA 2FYYA 3OHXA 3UDWC 3BDYL 3VG0H 1S9XA 3NFSL 2YMXH 1U58B 3BQUB 2Z35B 1F6AA 2Z4QA 2N56A 4V1DA 3QNXA 5BV7L 1AFVL 4GRWF 1IC4H 1OT1A 5E99L 4AEIH 5BS0D 4MB4A 1W72L 4UDTB 4N0UE 1N6VA 4HJJH 5FB8B 1AKJD 2XWJA 1XGQB 1B0GB 5GPRA 2VDRL 1YY8A 5E8PA 5A40E 3DMMD 1KXTB 4LSDA 4NNXA 1MF2L 3BI9X 5JIIA 2GT9A 2IANA 2NY5C 1JYXA 2VXVL 3SE4C 2DQHL 4XCCL 4JPWL 4FQXC 4JKPH 4YXLH 4XHJD 4KHXL 1VESA 1T1WA 3E3QC 4OF6A 3HNSL 3LKQA 4LCWB 4AQ1B 1DUZA 3MTRA 1F58H 3HE6C 3IB4A 3F6IA 4M1DH 3Q0HA 1F13A 2RQ8A 3ZHLA 3QQ3B 1KJVA 5ADOH 1QFHA 3RWHA 4QF1A 4RMUA 2ZZUT 3C5ZA 4ZO9A 1JF1A 2B20A 4LLVA 1EGJH 1PKQA 2OZ4L 3ZYOA 3RVWD 1T5XB 1IZJA 1W72A 1S3KL 4NC1C 3SDAD 5K9KA 3HRPA 5DA4A 3V6OE 3VGGA 3W81A 2R1XB 3O4LE 5C3TA 2VQ1A 1ORQB 4LSRH 3MRBB 4F7TB 3EOAB 2VIRB 4L29A 4QXTA 5DYOB 4A6YB 3ZE2F 4YE4H 1UXSB 5GS2H 1R5VA 3BE1L 3ESUF 3QZWG 4NZDA 4WY7H 3IDYC 2R0ZH 4NM8H 5B38B 5KVEH 2IPTH 4OGXH 5IQ7L 1IAMA 3TVMA 3STLA 3L3GA 5ESAB 4QCIB 3SPVB 1LO5A 1MVUA 4WO4A 1NCNA 3ZYJA 3RTQB 3VFTA 4HUVB 5T1LA 5I1DB 1AXTL 4JPKL 5E5MB 1FL6A 3WFHB 4LSVL 4G3YL 3RJDA 5GS2D 1WFNA 4QTHB 1BIIA 2DLIA 4LAQH 5EWIH 3HZMA 3HRZA 4GSDH 3ZSTA 4GAGH 5D71L 4JG0H 1U42A 3KLSA 2XACC 3GJFB 1UA6L 4ODVH 4PLJD 4XCNB 2FEDC 4M6NH 2VLLA 2RFXB 4YDLB 5IUSA 5KBNC 3MV9D 6CGTA 5DUPL 1YYLH 3W5MA 3CU1A 1A6UH 4I48A 1P4IL 3D0VA 5KSBF 1XGRA 3P40A 3K2UL 4HGWA 1ACYH 1JNHA 4LQ1A 1T2QL 1PW3A 2FGWL 4OLXL 4KZDH 3BP4B 1FNEA 3VRJB 3MMEB 4P3WA 3WEXB 1QACA 4FQQB 4XPTH 4BSVB 2IQAB 4YFLI 2ZUSA 3LKNB 4EDWL 4ERSH 1V3JA 1P69B 3T3ME 4D0BB 1RULH 1JK8A 4BQ6A 2EECA 5ID0B 3KHQA 3EW3B 4NHUB 3S9DB 2FR4B 1DTUA 3ABZA 1D9KC 4BZYA 4M8VA 3RVVD 3QUML 1T6VN 5TPWL 4POYA 5I1IL 3CCHB 3MRLA 2JF1A 3MUY1 1NFDE 3ZYZA 2N1KA 3FRUA 1R3KA 1DEDA 5KOMC 2D7QA 2Y06H 3SDCC 1ZA3B 4HQQL 5TE4L 5AWNH 4LEOB 5EOTA 5I1KL 5EU7C 1RUPL 5D7IE 3ES6B 3W39A 1ORSB 4HUXB 3FOLB 5ALBL 4LHUD 2AJXH 5TQ0L 4PRPB 5F88B 4XP4L 3RHWK 1KJ2H 3LSOB 2CKBL 4CVZB 1I7TA 5JW3H 2CDEA 4HDIB 2YD2A 3HE7A 2MCPH 1YMMB 4F80A 4M6AA 3T1FA 1MFCH 1BZ7A 1KYOK 4LKXB 4P59L 2LQRA 2X4QA 1FZOB 1G9NL 1J18A 3PWVB 3RWDB 4FNLH 3VI4F 1MWAH 3FB6B 1I85A 4X99A 3MRMB 15C8H 3NIGF 5C0BE 3VFMA 1B2WL 3DGCR 5CZVL 2OTPA 3QHZH 1IQDA 1UEYA 5FO9B 3KLHD 4EN3C 1GZQA 1G7LB 1DZBA 1FGVL 3KPTA 4MB5A 5EUKB 4JAMB 4MJ6A 4LIQL 1FNAA 4IIQA 1T66C 5D6CB 2VXUH 2MQ0A 3MREA 4LCCA 4QHMA 2DQIH 3TBSB 4P2OA 2YD5A 1WZMA 2NXYC 3V52L 3ARBB 2CKBA 2UVEA 5C9JB 4J1UA 4P3DB 4Z95H 1IGFH 8FABB 3L7EA 1XEDA 3MNWB 1PG7L 3HR5A 1AD9B 5E2VL 2F54E 4N0YL 2MPAH 3TZVB 3NA4A 2E9IA 1RJZA 3GEWB 4F3FB 1T1YA 1WVZA 1BBDL 3ARFB 3F12A 2V7NA 3MR9A 4G42A 3WFBL 3E1F1 4PRBA 3NCFB 1YDPA 5IB4B 1ZV5A 3DXAA 3DIFB 4HWZB 1QSED 2CXKA 1IAII 3S96B 1S7UA 3TV3H 1IBGL 1JRHH 2P5WE 3O8XC 3DTXA 4JFXB