3TT1H

Crystal structure of leut in the outward-open conformation in complex with fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
212
Chain Sequence
QVQLQQSGAELARPGASVKLSCKASGYTFTDYYINWMKQRTGQGLEWIGEIYPGVGTTYYDEKFKGKATLTADKSSRSAYMQLSSLTSEDSAVYFCARRTVTMGRYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine transporter LeuT
publication title X-ray structures of LeuT in substrate-free outward-open and apo inward-open states.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transport protein
total genus 35
structure length 212
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt1H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt1H02
1HI6A 3U6RB 3OR6A 2R2EA 3UZVB 1TETL 2PO6A 4XHJC 5GGUA 1IC5L 5BOPA 1JNNL 2IPTH 4HMDA 1AGBA 3SE4A 4YBQC 3S37H 3B3IA 1IL1B 4WI5A 3T0ED 5DEGB 2DQCH 3QUXB 1LMKA 1A7RL 5TQ2L 3UJTL 1TCRB 3GSNH 5JDSA 4RWHA 2IQAB 3SKUD 1X5XA 2J7LA 5IHZB 4G9FE 5DQJB 3B9KD 2DKMA 1PG7L 1Y18B 3CCHA 4P9HH 4HWBH 3VGAB 3QIUA 4IRZL 1GHFL 3EFDH 1LEKB 1BVLA 1FZKA 1UB6B 5EBWB 4LSSH 1X6LA 5I8KL 1IC7L 3D3VA 1NCCH 3G6AA 4OFDA 3BSZH 3FT3A 2GK0A 3C8KB 5MEOA 2NY6B 1T0NA 1QRND 4GW1B 1FE8L 3FRPG 4BFGA 4OLUL 5DUMH 1CN4A 3HI5H 3V5HA 1HEZB 1ZLSL 2DQJL 5J6GB 2RFXA 3STBA 1QG3A 4AYFA 3NPSC 3GK8H 1CDGA 2M8XA 4PD4J 3MRLB 4ZNEA 1Q9OA 3C5SB 3F8UB 3FQUB 1N64L 1A02N 3CSYA 4RGNC 4XGZA 2PTTA 5DTFA 1PAMA 3OTTA 1NGWB 2RB8A 3O6MH 3G9AB 4I3GA 2ZSWB 1OGAB 1X4ZA 5IQ9A 2VDMH 5L0QC 4HUXA 1KIRB 4RMTA 1A6AA 4KK6D 1OF2B 2YPLD 3BX7C 3CNKA 5INCB 4WFED 2OTUB 3G5YA 3HRZA 4GAFB 5ETUA 5F89B 4PJGF 3SE3A 1BBJB 5KVFH 4M1DH 2ATKB 2AS5M 1AGEA 2EE3A 4GAGL 5AWNH 1BHGA 4YZFF 4J1UB 1ZHBA 5DD1L 5SWZE 4AG4L 5E24E 5D5MB 5GGVY 3H8NA 2P42B 4BSVA 2R4RH 2WW8A 3I6KA 5IBUG 4I0PD 4ZS6C 3VG9B 3OJVC 3U6RA 2WLZA 3QUYC 2DLGA 4I3SH 2NX5B 1NBYB 1RQ5A 1RIHH 1K3IA 5D72H 1IL1A 3PDOB 3WKNA 5DEGA 2A9NL 2ZJSL 3QUXA 3UP1A 5IJKC 1BFSA 1TCRA 2IQAA 1HOCB 2PTVA 5IHZA 4J4PD 3PXJA 1MCWW 1TZGH 1NEUA 5DQJA 1JZ8A 5A1AA 1Y18A 1YDPB 3QO0B 4L3AA 3PJSB 2DTSA 4M7KH 3CUPB 5FYLH 5B4MD 3S88L 1LEKA 3T0WA 1UB6A 5EBWA 4CJ0A 4MCYB 2IBZX 3C8KA 4PB9L 2VE6B 5KZCD 3MOBL 1X5IA 2DMBA 4GW1A 3RKDC 3OKDB 1HEZA 3M07A 5J6GA 3OXSB 3ARED 3MJ9H 3U2SB 4K9EH 3TZVD 2N4IA 1U8KB 3MRLA 1P7QB 3C5SA 3RHWF 3FQUA 3UPCA 3UXFA 1BJMA 4OLVH 5FEBA 5DEZA 1ZANL 1NGWA 3PGFH 3IRPX 4I4WB 2P7TB 3VXUB 2ZSWA 1OGAA 5EC1B 1F3JB 2Z8RA 5ACZB 4L4VD 1OARH 4ONHB 1KIRA 1QFPA 2HMIC 2AQ1A 1OF2A 3DMMB 5D1QD 1SBSL 1JZ5A 5INCA 2OTUA 5GSRB 4HCRL 3ZHKA 3H9HB 5F89A 1BBJA 4DN3L 5FGRA 1M05B 2ATKA 2CJUH 4X6DE 3DARA 1UC6A 1ZHNB 3SCMB 5C8JB 1CD0A 3V5KB 5I1DB 4J1UA 3RWJB 3FHQA 2I25N 5D5MA 3K7UA 3EYSL 2XIDA 4PUBH 3VXNB 4RMQA 3K8KA 5CSBA 4F7PB 4KRPD 2R56H 5EB9A 2NX5A 1NBYA 4IRJB 1P69B 4KVCH 4S1SL 3PDOA 5LWYL 3CC5B 2JLLA 1PJ9A 4KMTL 4GH7B 2FBJH 3S98A 3MYJB 4DUWA 4K2UL 3QHZL 1FNLA 4TVPH 1EFXD 3L1OL 4M02A 4ZS7H 1HOCA 3MJ8B 1U8OB 3B5TA 5FGBC 4HZAA 2DQTH 4QWWD 3MCLL 3J8F7 1YDPA 2F54B 3QO0A 3PJSA 2R0ZH 2O5YH 3ZSSA 3CUPA 2R1YB 2DQUH 2HWZL 4FNLH 4W4OA 4QHKJ 1BD2D 5ISZB 4MCYA 1RK1B 2VE6A 3ZDZF 4NKQB 3EYFB 4CJ1A 3OKDA 5LJYH 3BUTA 2UZIH 3QULB 3OXSA 4XWOC 3UAJC 3U2SA 1X44A 3UYRH 1NAMB 5GGTA 1U8KA 1P7QA 4LEXH 4B0MM 5BV7H 2BXYA 3FMGL 4ZOAA 4H1LB 1A3LL 4I4WA 2P7TA 5HGAB 3VXUA 3B2UC 5EC1A 1YMMB 1F3JA 2DDQL 5DZOA 5ACZA 4ONHA 2OLDA 2BSTB 3DMMA 5AYUH 2WUCL 4XPBL 2AXJA 5GSRA 4FABL 1PSKH 3MO1B 3H9HA 1MCCA 1UKQA 4OIIL 2P49B 1M05A 3LQMA 3OMZA 4JE4B 5A40E 3F6LA 3QNZB 1ZHNA 3SCMA 5C8JA 3V5KA 5I1DA 3MMEB 3BJ91 3RWJA 4AY0A 3AU1B 2HKHH 5ICYB 1VGEH 3H7BB 2KZWA 3O2VL 3VXNA 1U8LB 2YD1A 1MIML 4MX7B 3H9YA 1SYVB 1NFDF 4NZRH 4LCWE 3WFZA 3EJYC 2R0KL 4F7PA 1CGYA 3HPLB 4IRJA 1NMAH 2WAHA 3RQ3A 4MNQE 3CC5A 5C7XL 1FC1A 3HA0A 4IOFC 3MYJA 2XZZA 3WFHB 3MJ8A 1U8OA 3TJEL 1OP5K 3AS3A 2BVQB 4PJAB 4N90E 4GKOA 4KXZI 1TVHB 4YHYB 2IFFL 1T04B 2XT1B 2F54A 3UBXG 5L9DL 4XNXL 2YRPA 3MXVL 2R1YA 4G7VL 5GGRY 3OJMB 4QRPB 3CFKB 4HKXB 5ISZA 4HBCL 4WCYL 3MUHL 3D5OF 2ZUVA 1RK1A 1MFDL 4PRNB 3EHBD 2DMCA 5C0BE 3NCJH 2J8HA 1IQWH 3OB8A 4FQQB 3EYFA 1UQSB 5FOJA 1QPPA 1ERNA 1REIA 3KYOB 3QULA 3D18B 5I75C 1UJTA 3NCBB 1DQJB 1NAMA 2V9TA 4NO0B 4PRPE 5EU7C 5EZOL 5FYKU 3H9SE 1RD6A 3WS6C 4H1LA 8CGTA 1T20B 3DRTB 5HGAA 1BVZA 5MENB 2EDNA 1YMMA 3RX5A 4X4MA 4XMPH 2VXSL 2BSTA 1JV5B 4A6YB 2NY4C 4HWZB 1NGQL 4HXBL 3MO1A 1A7OH 1KIPB 5I73C 4Q58C 2ICWJ 3PXHA 4FXKB 4G6AC 3HUJF 5C70A 3QNZA 5JIIA 1WAAA 4Q0XH 3MMEA 2MQ0A 5C6TL 3MXWL 2LTQB 1CL7H 3AU1A 5ICYA 4YXHH 4HS8L 4D9RD 5FYKL 3H7BA 3PP4L 1UM6H 1AJ7L 3OF6A 4NC2B 4AQOA 1FGNL 1U8LA 4MX7A 2EDYA 1SYVA 4APQC 1HKLH 4LDEB 5ABDE 4Q9BA 3BZ4B 1KSRA 1AQKH 1IEHA 1N6VA 3HPLA 1I75A 3BI9X 4FQXD 4TULL 1I8LC 4K8RH 1XGYH 1EAJA 4GRLB 4HK3N 3UTTD 2E6PA 3EYQD 1VACB 4LVNC 5DQDH 4XMKH 3FOLB 4OJFL 2WBJB 3Q2CA 3WFHA 5FUCE 4C57C 2VO5A 2X1XR 5BZWB 3DO7B 2BVQA 4PJAA 1N5AB 1PY4A 1TVHA 1PZ5B 4J12A 3V52L 4LRIC 1T04A 1JI2A 3DOSA 3ZTNH 3S7GA 2GIYA 2VXVH 4CDGC 2Z92B 4QRPA 3CFKA 3HI1B 4HKXA 5SWZB 5D6DA 3V4UH 1CTOA 4XVJH 1T1ZB 4PRNA 1KTDB 4DGIL 1INEH 2J4WH 5IVXB 1RJLB 3IKCB 4X9GA 5GZOC 4FQQA 4TOYH 5BRZE 1MQKH 3AY4C 5KVDH 3KYOA 1D6VL 5F9OH 3D18A 4N0CC 1DQJA 3OJDB 2EE6A 3QG7H 5FUOH 4NO0A 4YXKL 3SJVD 3D2UB 2VZVA 5DURB 3F58L 2BFVH 2C9AA 1JNLH 1N6UA 1E6OH 1JIBA 1T20A 3DRTA 5MENA 1ACZA 3LEVL 3E8UH 3D25B 3IU4L 4DKFH 1EMTH 3T2PA 1JV5A 1QLRB 1FHGA 4A6YA 3FFCE 2LQRA 1BFOB 3SGJA 4WO4B 3F7RA 2B1HH 4P5KB 1TLKA 3VFUB 2VN7A 4HWZA 4Q6IB 1KIPA 4XB8A 4FQJH 4NZUH 4JAMB 4FXKA 4FFVD 3BKMH 4S2SB 4ZD3L 4N0YL 1DL7H 3RWFB 1CDBA 1UH2A 5DRNB 5SWSD 1T4KB 1G9MH 5D7JD 5GISL 2IWGA 3ULVH 2OM5A 2QKIB 2R0LL 3IFLL 1N8ZB 1DLFH 3BZ4A 5J12C 5ANMB 3RU8L 1I7RB 1DBAH 1MLCB 3KJ4C 3HLAA 2AJXL 3VWJC 4GRLA 2PXYD 3I3DA 4NM4L 1VACA 2R8SH 3B9AA 2AEQL 3FOLA 1CICC 2WBJA 1B90A 5BZWA 2XZQL 1R5VB 4LIQE 4F7TB 3DO7A 1N5AA 1T03H 5EA0H 5IHUH 2X4PB 1PZ5A 5D1ZB 5I16B 3U4AA 4PBXA 1G7PB 3HZMB 1CBVL 1IGCH 3RDTC 3RGVB 3LPFA 3EZJB 2DTMH 2Z92A 3HI1A 3IDYC 3B5GA 5DO2C 3EDKA 5DUPL 4OV6F 1C12B 1X5YA 1T1ZA 4OLXH 1KTDA 4V1DB 5IVXA 3QIWB 3CVHL 1RJLA 3IKCA 5IW3A 2F58L 4NP4L 4M1GH 4JFED 4EBQL 3ZHDA 3DSFH 2CUIA 3ZKXC 3QDGE 4IRSD 3OJDA 3UYOD 1NUFA 2ZKHH 3D2UA 1QFWH 1JP5A 3IFPB 3ARSA 4OT1L 5DMIL 3L3DB 4AEIH 1NGXB 3IRZA 3HE7C 3K1KC 5ENWB 4OZIB 5KTEL 3D25A 3C5ZB 1LO5B 3QHTC 2BVEA 3WV0A 1QLRA 3HR5B 1BFOA 4PBWD 3GEWB 4WO4A 4P5KA 5I19L 2EC9U 3VFUA 3Q1SL 2UUDH 4PJ7B 4Q6IA 3JWDC 4JAMA 2HKFL 4P23D 4K8RC 4S2SA 5FUZL 1CGUA 3RY4A 3RWCB 3ZTJH 4Y1AE 2GEEA 1YNTB 4L5FL 2NPLX 2WZPD 3RWFA 2CLZB 1RIVH 4HK0B 1DBJH 5DRNA 1PVHA 1T4KA 5F1SA 5E56A 1FDLL 2VR5A 2BNQE 5FIEA 3KPTA 2CO7B 1I9IL 2QKIA 1HNFA 1N8ZA 4MQ7B 3CZFB 5ANMA 3T2NH 3OWEA 5AG9A 4QXWA 1I7RA 1MLCA 1ZVHA 3FO2B 3DUSB 3ROLB 4BZ1H 4M00A 3O8XD 2YD7A 1W72H 4X98B 5EZIH 3WLWD 5DR5L 3IDNB 1R5VA 4F7TA 3KPPB 3PNWB 3ZKND 1A7QH 2X4PA 2J3SA 2FD6H 3HMWH 5D1ZA 1IAIM 2X4TB 5E2UL 5F44A 5FA3B 5HHXH 1G7PA 3HZMA 5T1LD 2GTWB 5ECJE 3RGVA 2R4SL 5GSVB 3RVVC 2YUXA 2X70B 3RGHA 3MBXH 1F4YL 1MCOH 5LKNA 4ELMF 1C12A 1OTTC 1A1MB 4V1DA 3QIWA 1LO2H 2AK1L 1I9RL 1RU9H 2QV2A 4L3EB 1SJEB 25C8H 3FN0L 5GRJH 4EEEA 5AZEL 1OWWA 1A47A 2OK0L 3I6LE 1OP9A 5C08B 3FT2B 5BMFL 1UCTA 3IFPA 3E3QE 3L3DA 1NGXA 3DRQA 4S0SD 4FFWD 4Z78B 5ENWA 4OZIA 3BP5B 2E27L 3MRPB 3C5ZA 1LO5A 1TFHA 1YEGH 2X4NB 2CRMA 3UTOA 3HR5A 3C87A 1ZA3B 2QEJA 4EQ2A 5GGQL 3NCYP 1VFAB 4PJ7A 1KGCE 3WNNA 3GKWL 5HTSA 4HG4K 4YFEA 1ZXQA 4Z0XB 4J23A 1XR9B 1QKZL 4N5EC 1TVDA 3VD9A 4YEEA 3RWCA 5EIQA 1YNTA 2A38A 5DJDB 5HI3D 3T77B 4KGLA 4LLQB 1J12A 1JPSH 2XTJE 4HK0A 2EEAA 1CE1H 1BWMA 2L0DA 3ARRA 2VXQH 4P9MH 4EI5C 4XHQA 3HNVL 3LMJL 3U9UB 2V5TA 4MQ7A 3CZFA 4LHUG 1G6RH 1MAML 3FO2A 3D0LB 3DUSA 4MZ2A 3ROLA 1MREL 2BVOB 4JY5L 5B3JE 5EBMB 1XF3B 1IGMH 1JWMB 2CDGB 3I2CL 3ZDXF 3KHOA 2VLJB 4R26L 4X98A 3BPLB 5ITBL 4HT1H 3IDNA 2E8ZA 3WJLC 2DS4A 3QQ4B 1N6QH 3KPPA 3PNWA 1OAYL 5D7LE 4FQIL 5FA3A 1ZGLB 2X4TA 1U6AL 1GGIL 4N0UB 3ULUC 4G6MH 2GTWA 5ERWB 5GSVA 4MGXA 2X70A 1ORSB 4HWEL 2XZCH 1A1MA 2IG2H 4F57L 2RHEA 3TBVB 5IB5B 3HMXA 4L3EA 4QLRA 1SJEA 2DD8H 3STLB 1KEMH 3G6DH 4H0HB 1CU4L 1DDHB 1NCAH 4JB9H 5LG1A 5C08A 1TNMA 3FT2A 1FH5L 3NTCL 1LO3H 1DFBH 3DTXB 3ARWA 4Z78A 1MCJA 3BP5A 2GT9B 5HYJD 4RBPH 4Z7WB 3MRPA 2X4NA 4LAQH 4R0LB 1XH3B 1ZA3A 3P9LB 1I1YB 1ZTXH 2Y5EA 1A22B 1VFAA 2XRAL 5A2FA 4Z0XA 2YBRB 3U83A 3KPRB 3TN0B 2DBLH 1XR9A 1BMGA 1KPVB 2FH8A 2YMXH 4PJ8C 5DJDA 2H32H 5I2IB 1IAIL 3T77A 1XIWC 4LLQA 2NY5H 4NSKB 4R6UA 5HVGB 3OB0H 1Z0MA 4H88L 2XYCA 2IJ0C 1DN0B 5BS0B 1KN4L 4Z7UE 3U4BH 5FB8B 5IBLD 3U9UA 2WWMC 1PD6A 1QHOA 3BISA 4LP4A 3QZWG 1JTTA 4JHWL 4E42B 1J05B 3W2DL 3D0LA 3S36X 2IPUK 2BVOA 5EBMA 1O5DT 1XF3A 5HVHB 1JWMA 2CDGA 5I18H 2VLJA 4PJDB 1F4WH 2DQGH 3MBEB 1BFVL 3FFCB 4LGRB 3QQ4A 3NCCB 2Y36H 1ZGLA 4P2QE 3ULVD 5D8JH 4N0UA 3TO2B 2K7QA 4C56B 4Y4FB 1J7VR 5ERWA 4Y4KC 4PLKD 4AZ8A 3CLFL 1ORSA 2VYRE 4F7EB 1P6FA 1ZMYA 1JGUL 2Q8AL 4AEHH 3S35X 1EHLL 2NY3B 3TBVA 2ZCHL 5IB5A 3VFWB 4QOKB 3S8WA 1ED3B 3BDYH 4HFWB 5FGSA 4IOSD 3STLA 4JKPL 1S78C 2ADFL 1DDHA 5CJOL 5J6HB 1MCNA 2QBWA 5IFJB 1J9CT 3BIAX 3MGAA 5GZNC 3DTXA 3OG4B 1OAXL 4JFPB 1WWBX 3ARYA 4ODTL 3PWNB 4HIXL 4KRNA 2GT9A 3INUH 4Y5VB 3O45B 4Z7WA 3ME0A 4R0LA 1XH3A 4WHDA 4HJ0C 3NIFE 5FHAH 4HFUH 3RIFK 3P9LA 1CDIA 1I1YA 3BN9C 1X7QA 2FGWL 5F7YC 5E1HB 1KPUB 3KPRA 3TN0A 1MIEH 1KPVA 4LNVA 5I2IA 4D2NA 4NSKA 1MRFH 1BQLL 4KK9D 1A21A 3MV9D 2NW2B 3FRUB 1DN0A 5J06A 5BS0A 5FB8A 2NY1C 4YBLB 3BZEB 1PW3A 4UNUA 5KS9B 4DN4H 4JPKL 5D93C 4Z7QE 1I8IB 1H3XA 5ESQB 4E42A 1J05A 3NZHH 4KQ3L 4KROB 1JNJA 3MRHB 1WTLA 5E6YA 2QQNL 5A2JH 5F3BB 3TT3H 4JG0H 3W82A 2PYEB 3KPSB 5DK3A 4PRHB 5E7BA 3HE6C 4PJDA 4EUPH 1AY1H 3MBEA 1CXFA 5T3ZE 3CAFA 5L2KE 4ZTPH 4MAYC 1YNKH 3NA9H 5FKAB 3BGMB 3V6FB 2IANE 5I1EL 4HDIB 3QEGH 1PGRB 3MRIB 1U8NB 2XG5A 2XKNB 3TO2A 5JHDE 1UH4A 4E41E 3EGSB 4C56A 4Y4FA 3MRRB 4F7EA 3DYOA 5D1ZD 4WTWA 1G0DA 4NQDD 2X40A 3RGVD 2IC2A 1QFUH 4X6DF 4QOKA 3B9KC 1ED3A 3VFWA 1I1RA 4HFWA 1E0OB 1YEFL 4JO4H 1ZVYA 1EEYB 2RJMA 4LP5A 5J6HA 4NQVB 1MFCL 1LDPL 5IFJA 4FTVD 3FFDB 3FO0L 3HAEB 5C6WH 4JFPA 3SDAC 4U0RC 4K3HA 2VRAA 5D2NB 5FM4A 3PWNA 4Y5VA 1GPOL 3O45A 4L1HA 1OAUL 1BGXH 4TSAH 3PGDB 2C3WA 1XF5B 2YD4A 1P84J 3GJFK 5GXBB 3RZCB 1K4CB 1V3JA 2FCBA 1KPUA 3E2HB 5JW4Q 3JBG7 3JWOH 3ZKSD 3ARFB 2WWKT 5JXAL 5FM5M 1KEGL 4LSUL 4GRMB 4P46D 3VH8G 2Q87A 3GMNB 4BK4A 1EAPB 1GGCL 1WBYB 3VFVB 4GT7A 3PL6D 4O2FB 2NW2A 3FRUA 4K3EL 5IROA 5C3TA 3BZEA 5KS9A 1BJ8A 1CI5A 2VLRE 2RQ8A 1I8IA 5ESQA 4X7FC 5HGGS 1ZA6B 3GHEL 3MRHA 1NC2B 5F3BA 1T7XA 4TUKH 4RMUA 4EN3B 3UC0H 2PYEA 2J1KA 3KPSA 4PRHA 4OQTA 3FQTB 4LVOB 3VGDA 5FKAA 3BGMA 4RFNC 4P0DA 3V6FA 4HDIA 4U6VH 4L8SB 3MRIA 1QSEB 1U8NA 2XKNA 4OM0H 2GSGB 2R39A 1MCSA 3EGSA 3BKYL 4XAKE 5HY9B 3V8CA 2ICWB 4YHLH 4GMTL 3MRRA 2D03H 1IC4H 3AB0B 3GSVB 1HQRB 1XGUB 4M8VA 3ILQD 1KV3A 3ZKMD 3L6FB 3OSKA 4OI8A 5ID1B 1Z3GH 3QFJE 1EEYA 3NFPB 4POYA 5B4MC 4X5WB 4NQVA 4KKBD 3MV8B 4GJTB 3D1MC 1QSZA 3OZ9H 4X6EB 1FNAA 3FFDA 1OW0A 2VDRH 3HAEA 1F13A 5D2NA 3AUVA 2W9DH 1PKOA 3AC0A 3AREC 2H1PL 1AXIB 1BBDL 3PV7A 3TWCL 1UT9A 2GITB 3QHFL 5IK3B 1NANH 5IW6B 5ADPH 3PGDA 1XF5A 1E28B 3WFBH 1KCSH 3RZCA 1K4CA 5I6XC 2D9QB 1CFTB 1KXVC 3ARFA 3I9GL 3ZE1E 3SO3B 5LBSL 2CD0A 2HTLC 1ZT7B 1WZMA 1R24B 4GRMA 3QRGH 1FIGL 3MLRH 4JEGB 3RIFF 3GMNA 4KWUA 1EAPA 4KV5E 5DLMH 1WBYA 3G6JB 3A0OA 2VR9A 3VFVA 4O2FA 4DJMA 3ARDC 2P5WD 5GIRB 3SDCB 3O3EB 2NXZD 3GB7B 1L9NA 4U1SB 1A6ZB 2VC2L 2NY0D 1ZA6A 3ZYZA 3SQOL 2YS4A 4RGNE 2H6PB 1NC2A 4HIIB 4EN3A 2P5ED 3VFGH 5E94B 4HGWB 2VSDA 3FQTA 1K8IB 3K3QA 1S7VB 4NRXB 2B2XL 1AO7D 4L8SA 1MOEA 4U3CA 1QSEA 3BGFB 2GSGA 4CN1A 3EO0B 4OKDA 2EE9A 5HY9A 3JSSA 2NXYB 1A0QL 2ICWA 1QZ1A 1QFWI 3RWIB 4MDJB 4M7LL 2ESVE 4ZXBB 1FL6B 4LMQE 1MJJB 3GSVA 4GMSH 1HQRA 1XGUA 2CPCA 3L6FA 1S7XB 5ID1A 4QTIL 3G04B 5GRUL 3NFPA 2WINB 4X5WA 3D39B 3MV8A 1RJZB 1QR1B 4Q2ZB 1GOGA 3BKJH 4X6EA 1NH6A 4N5UA 4JHZA 4J3VA 1FO0L 1MCBA 1CXEA 1NLBH 1PBYA 3PP3K 3L7FB 2ORBH 3VFPB 1W0VB 4TTDD 2VDPH 1E4XH 2GITA 5EU4B 5IK3A 4P5MB 5IW6A 1A6VH 1U42A 3C08H 1E28A 1BJ1H 1I7UB 4OGAD 1WJ3A 1CFTA 1F58L 1OAZH 3REVB 4RGOL 1ZT7A 4IBLT 1R24A 3S36H 5AYQA 3VWKD 5CSGA 5IUSA 4XNYH 2Y6SD 3G6JA 4TVSa 5GGVH 4RMSA 4XH2B 3VD7A 5FF6B 4PR5B 1HINH 3P77B 5GIRA 2MHAB 3SDCA 1P4BH 3WNMA 4YHMH 3GB7A 4U1SA 4WGVB 1A6ZA 3S3PA 1NLDL 1BF2A 3IDJB 2FX7L 2H6PA 1S7UB 3WUWG 5HHMB 3AGVA 4HIJA 4HIIA 4BH8B 4D9LH 3T0XA 5K9QG 4P48A 5E94A 3LD8B 1QSFB 1UWEL 4HGWA 1K8IA 5C0CB 1S7VA 1N0LA 4NRXA 2DQEH 2YK1H 1LQSR 4LPXA 4LOUD 3EO0A 2B4CH 4RA3A 1J0HA 3VXQB 1QACA 2EZ0D 2VZ1A 3N1PC 2G5BB 2PO6C 5BVPH 5LVEA 3RWIA 2ED8A 4ERSH 1B2WL 4GAJH 4MDJA 5IGXH 3SE4C 1V7NH 4ZXBA 5E8DL 3T65B 1FL6A 1MJJA 4U1JB 3RY5A 2AV7B 4L4TE 1E4WH 1S7XA 1NCNA 3N50A 4XAWL 4J3XA 4U3HA 3G04A 3GO1H 4M43H 1EIBA 3EDEA 2WINA 4WFHE 1KPRB 4BQ8A 3D39A 3MCKB 1A9EA 1RJZA 2ID5A 4Q2ZA 1QR1A 2I5YH 1T0MB 3EHBC 2F8OA 3DHMA 3L7FA 3QIUC 3VFPA 4UDTB 5FYJL 1W0VA 5JIKA 4HSQA 5HHQB 1MRCL 3B83A 4Q6YA 3WXVH 3DECA 3KPMB 3TVMD 3K1DA 5EU4A 4P5MA 5IBTL 2R2CA 2Z31D 4FRWA 35C8L 2YHGA 1TTFA 4OF6A 5IMMB 1CDJA 1WFNA 1I7UA 5IOPB 4LHQB 4M6AA 2BJML 4PYHA 2CLVB 1YZZA 1OP5H 3QZWB 2KH2B 1JJUA 3REVA 4DEPC 3BKCH 1U36A 2JIXD 5E7FA 3DJ9A 4WUKH 5F7MC 4AIZB 1NFIB 5KVGL 3P0YH 2DKUA 3RWEB 1JVKA 2LABA 4F7CB 5FM5O 4G3YH 5L88H 5E70A 3GKZA 4G9DB 2BY2A 12E8L 5FF6A 2F74B 4PR5A 3P77A 3SO5A 2MHAA 2F9BT 1IAOB 5JUEL 3W9DB 2DQCL 2GCYB 3OPZL 5E0QA 3WHXB 3U7WL 3GSNL 3SGDH 1E6JL 3IDJA 2X6MA 1S7WB 1S7UA 3IKKA 3MUGB 4BH8A 1HQ4B 1A6TB 3I3BA 5JQ6H 3BHBB 1QVOB 2RAMA 4H8WH 4ZSOB 1QSFA 4P9HL 3A67H 5C0CA 2X7LB 1NSNH 5BW7A 2NR6D 4Y19B 4FQXC 2MSPA 5IFHH 4LSSL 5E2JA 3VXQA 3MV7E 3O4OB 4YBHA 3BSZL 2X09A 5EUOE 4UB0H 4FQLH 4YDLB 3EYQC 2G5BA 2F53E 5DUML 2BVTA 3T65A 3MYZA 4U1JA 4DGYL 1CFVL 2AV7A 3VFMB 3QUXC 2D9CA 4RFOL 2DI8A 4N8VB 3GK8L 5C2BL 3PQYE 5IWLA 4WW2B 4G5ZH 1QBBA 1KPRA 4OLWH 2XFXB 3MCKA 4M1CD 4X80L 5FYLE 2A9ML 1T0MA 1D7FA 3VGAC 1BREA 4LLUB 4UDTA 5HHQA 1OT2A 1HHJB 3HC4L 3TBYB 3KPMA 1F6LL 2NY6C 5CIPH 2XWTB 3RVTC 1PKQB 4RX4A 5KVFL 4M1DL 1DEDA 4JRXD 3FTGB 1T0PB 5IMMA 4M7JH 3WCYA 3MQIA 5M95B 5IOPA 1MQ8A 4I77L 1D5IH 2CLVA 4JY6B 4DFHA 3QZWA 2EDLA 4WEUD 5TDPB 1RFDH 1U3ZA 4AIZA 3QI9D 1NFIA 2R4RL 5GRVL 3RWEA 1R3LB 4F7CA 2DMKA 4UU9B 4G9DA 3GBLA 1RJYB 1CQYA 2H9GB 4N9GB 5CEZE 5C0JB 4I3SL 5JZ7C 1INDH 1RIHL 2F74A 4FFVC 5D72L 1YPZB 2GKIA 1IAOA 4JRYB 3VFOB 3W9DA 3O4LD 2GCYA 3WHXA 5EU7E 5CP3A 5C0IB 1S7WA 5EZJB 2F8XC 3MUGA 3X3FL 5I1IH 1HQ4A 1TZGL 1A6TA 5KVMC 3BHBA 1QVOA 1UGNA 4ZSOA 4P59L 5EH1A 2JKXA 4WEBH 2X7LA 5C07E 4DVBB 4M7KL 4E5XB 4FQCL 4Y19A 5F1NB 3T0DA 1FG2B 2NY2B 1YYMH 1DR9A 3VG9C 3W11D 2FEEI 2PXYC 2VLKD 1J8HE 4P49A 4PS4H 4JPIB 4B7IA 4TVPE 1EPFA 1HH9B 5GJSH 1EGJH 3MJ9L 3VFMA 4OGXH 4K9EL 5HYIA 1G7IB 4N8VA 2X4RB 3LEXB 3QCTH 4WW2A 2CR3A 4OLVL 4PBVC 5SX5K 2XFXA 1M71B 1A3QA 4I0KA 4LLUA 1OARL 2XKSA 4NN6B 5C0RH 1N5YH 3UX9B 5L0QB 3F7VB 1DQDH 4HQQL 1FPTL 1HHJA 3LN4B 5BOZG 3TBYA 3KYKL 1MJUH 5D7SL 2I9TB 2XWTA 3WO4B 5B3JF 1PKQA 4JFDE 1U3YA 4PJCE 3FTGA 4F58H 2Q86B 1RMFH 4WW1B 4U1IB 1SEQL 4PGBB 1NC4D 4JHAH 5JOEA 4JY6A 3O0RH 4MD5B 3VXOB 1FQ9C 2XZAH 5TDPA 3W0WE 3PDDA 4WFFE 2PETA 4KC3B 1JGVH 5K9JL 1R3LA 4K7FB 4UU9A 4PJXB 1RJYA 2H9GA 4N9GA 1A6UH 5SX4I 2R56L 5C0JA 3V95A 4PJ5D 2ZG3A 4KVCL 3G9VA 1E4JA 1RZJL 4C59B 1YPZA 3DMMC 4JRYA 1ZGLP 3VFOA 2J5LC 4JFQB 5HYSB 3EKCA 1FFOB 2CH8A 1RUMH 1KC5L 2FBJL 5FO8B 5C0IA 5ICXB 4NWUH 2UVFA 5EZJA 1U93B 3SCMC 2DQTL 3LS5H 2DIJA 2FECL 3DETD 3HRPA 4XCNB 4DVBA 2R0ZL 2O5YL 3AFLA 1SJHB 2DQUL 4E5XA 1BVKB 4MA1B 3I6GB 4ZAKD 4KDTA 4P2RB 5F1NA 1FG2A 4CW1B 4WI3A 4A6YH 2UY6A 2V17H 3LZFH 4IRJC 1UM4H 4JPIA 3VFRB 4QXTB 2UZIL 4X7EC 1HH9A 3HB3D 3VD3A 3UYRL 4LAJH 5JXED 1G7IA 5E6ID 2DYPD 2X4RA 4HS6B 3LEXA 5C09D 4LEXL 1YMHB 3BEWB 2EXWD 1FFQA 2OR8A 4U6HB 5BV7L 1M71A 5EFIB 5ESAB 3VXMD 4Z7UF 5CZVL 1GZQB 2P8PB 3H3KA 4P2OB 3LDBB 5AYUL 3F7VA 3LN4A 4M7ZC 3MLXH 3BP4B 2I9TA 3ET9F 4OF0A 4O51B 2Q86A 3P2TA 2JB6B 3PWPD 4WW1A 4U1IA 4PGBA 1FLTX 2Y1VA 1CVRA 3WFDH 2HKHL 4MD5A 2VISB 3HNTH 3VXOA 1MUJB 3CMOL 1B0WA 4FQ1L 1FL5B 4K7FA 4NZRL 3LIZH 5FHBH 4LHUD 4PJXA 2F19L 2G9HB 1NMAL 4O02H 5HYSA 4JFQA 3C2AH 1FFOA 4NJ9H 5HI3C 5FO8A 5ICXA 1NCBL 4HJJH 1U93A 4PP1D 4XBPB 4KU1A 5IB4B 4XCNA 5HYEA 3QWQB 4OCLC 2D4DA 3MRDB 1L0YA 1SJHA 1BVKA 4HCRA 3PWUB 4P2RA 4CW1A 5LGHL 5IFAL 3SGKA 2AERT 1T1XB 3SY0B 3NIFF 3CFEB 1NBQA 4OZGB 4FN0A 5D6CB 5KSUB 1MVFA 5HHPB 3VFRA 5BO1H 3UPRB 4QXTA 4O9HH 4ZTOL 5IV2B 1FYTD 1HIMH 1A64A 5C6PB 4Y0GA 5HDLA 1BPVA 3QO1B 4MHHI 4HS6A 1LO4L 5JLZB 5DVLA 1YMHA 4KVNH 3BEWA 3D48R 4HUMB 5DJAB 1OP3K 4DAGH 43C9B 2MKWA 4U6HA 1NANI 4DZBB 2BNRB 1Q1JH 2P8LB 4YHYC 5EFIA 5ESAA 2WLYA 3STZB 4JDVB 1GZQA 2P8PA 3QXDB 4LSVH 4P2OA 4UOW0 4XMPL 5CZKA 2ZCLL 5T3XH 4Z7QF 5TQ0H 2N7AA 3BP4A 5GS3A 1UFUA 4O51A 1S7TB 4JG1H 3MRFB 4OGYH 5I1JH 2JB6A 3TCLB 4P3WA 2GJJA 1RUKL 2UWEB 1QLFB 4MJIB 2CRIA 1CL7L 4Z7VE 2ZG2A 2VISA 5CZXD 4YXHL 1MUJA 4QRTB 4J3WA 5KJRH 2Q20A 1FL5A 1QEWB 1AHWC 3D87B 1HKLL 4XVSH 5HHOB 5HDQL 4XCYB 5J1SC 1RPQA 1CGTA 1WCQA 2E3VA 2G9HA 5CJQH 3ZYOA 3DYPA 3BQUB 1XGYL 3SGJC 5DDHB 2DJSA 4KQ4H 2AK4D 5DQDL 4XMKL 5DWUH 4R90L 1YEIL 4XBPA 5ACLA 5IB4A 5FGBA 1F6FB 3MRDA 4AT6B 5FDYA 3ZTNL 2G2RB 4F37K 2VXVL 4UTBH 2LAAA 3PWUA 4IMLB 1ZVSB 1MCFA 3WFCH 4XVJL 4AMKL 1ADQH 1T1XA 3SY0A 2J4WL 3BH9B 3CFEA 2D2OA 4OZGA 5D6CA 5KSUA 3MROB 5HHPA 4TOYL 3LB6C 3MJ6A 3ULSB 4PPTA 5KVDL 3UPRA 5DYOB 2JELL 5IV2A 4OZHB 5F9OL 5M7QA 1MCLA 5FDWB 4CVXB 1N2RB 3QG7L 3QO1A 2LVEA 1N0XH 3HC3H 5JLZA 5AZ2H 1TJGL 5DJAA 43C9A 5TE6L 1E4XI 1FBIL 4PLKC 5E2TH 4DZBA 2BNRA 2P8LA 1E6OL 5IEKB 1FCGA 3STZA 2ZOKB 1NGPL 3E8UL 1K5NB 3KPOB 5FECB 4JDVA 5F70A 3HZYB 3QXDA 1EMTL 3CVIH 3I02B 4MMZC 1C7TA 1VB9A 3CLEH 4OTXL 2D4FA 3CU1A 3KYNB 4BFBD 4UBDD 4Y2DB 1Q72H 1I1AA 2EIEA 4NZUL 3FHAA 2ARJB 3BKML 5EU6E 4XB7A 1AKJB 5MHSD 1S7TA 4U7KA 3MRFA 1UKSA 3ULUE 4XCCH 2DOCA 2GJ6D 2MPAH 4KKAC 3TCLA 1T2XA 2ARWA 1DL7L 2UWEA 1QLFA 4MJIA 5M94B 5HI4C 4NUGH 4AIXA 2WBWB 4NYLB 1G9ML 4QRTA 4H20H 3WIFB 2HFGH 2VJXA 2YRLA 4WUUB 4YUEL 4BUGA 1QEWA 4LLVB 3CXDL 2IAMD 3ULVL 3QEQD 2F5BL 1EZVX 5HHOA 1CDUA 1XGPB 4XCYA 4I9WE 2NMSA 3P0GB 3A6CL 3F12B 2I9LB 4AQ1B 1DBAL 3BQUA 3HMXH 4JKMA 4NKIH 5E8OB 4WO4C 1AGFB 5DDHA 4KHTH 2R8SL 4Q6IC 1BQHG 1AXTH 5J13B 4WHYG 3BN3B 3M17B 1T6WA 5GJTH 3BZDA 2J8UB 3FZUD 4KK9C 5EA0L 1TJIL 5CD5C 5I1CH 3QQ9D 1X5LA 5JR1L 4AT6A 5LCVH 1OQOA 2G2RA 2VQUA 2DTML 3EDFA 1C5BH 1ZVSA 4IMLA 3VXRD 2X9YA 4C55A 4OLXL 2G75B 3DX7B 1CDCA 1JE6A 3BH9A 2XPGB 2YWYA 5MEPB 3W0WB 3MROA 4HUUB 3SOBH 2Y06L 3ULSA 3RBSA 2NY2D 5DYOA 4OZHA 1CK0H 1BX2B 3DXAB 5FDWA 4CVXA 1N2RA 1GIGH 4N1EA 2IGFL 3ZE1F 2ZKHL 2OYPA 1QFWL 2X10A 4R8WH 3V5DB 2V5RA 3ROOB 4AEIL 5JHLH 4ODVH 1NMBL 4ZDHB 1GGUA 4G9FD 3OAZH 4KV5F 2FLBT 5D1ZC 4ZUTB 3QDME 3WS6A 5IEKA 3RVXD 2ZOKA 2OXHA 1K5NA 3KXFE 3KPOA 3RGVC 3NFSL 5FECA 3HZYA 4HPOH 4ZPTB 3H42L 3I02A 4FP8H 3QT2A 4X9HA 3KYNA 3QIWC 4CVUA 4Y2DA 3VXSB 5HGHB 2KKQA 3X3GL 2ARJA 3QXAB 1AKJA 3K2UH 5HD8D 1CF8H 3AS1A 1MFNA 2OJEB 1RIVL 1DBJL 3LKNB 3MUJA 4JR9H 4NYLA 5C1MB 4G6KH 2D0HA 3WIFA 3N1GC 3SGDI 4WUUA 3CVHB 4LLVA 3ZZ1A 4I3RH 4POZC 5I30H 3WE6B 1XGPA 4RDQG 4PRIB 1IJ9A 3F12A 2I9LA 1MELA 3L3GB 5E8OA 1QLEL 1AGFA 3VWJB 5EZIL 1J11A 3NFNB 3M17A 3TA3B 2J8UA 3LQZB 4YFDB 4RWYL 1A7QL 3IJSB 3HMWL 5IVOA 2FD6L 4KTEH 1C5CH 4OF5A 5HHXL 3LCYA 1TZIB 4K7PY 3MFFB 4LRIA 5CP7B 3UTSE 3MTRA 3MBXL 7FABH 1MCOL 4HV8B 2W9LA 2G75A 3DX7A 3S34L 2XPGA 3SDDD 5MEPA 3W0WA 4HUUA 2ITCB 3OBAA 2X05A 1RU9L 4QXUL 4QRRB 2YSSB 25C8L 4GXUN 1ZGLM 5GRJL 2B0SH 3GJFH 1BX2A 4HAFA 5HJ3B 2D0GA 3DXAA 4S1QH 5E9DE 1H3GA 3RBGA 4F37F 1MWAL 3IB4A 4BM7A 3RUGB 3V5DA 4CAGA 3RAJL 4PJHB 3ROOA 1TDQA 4ZDHA 4ZUTA 3H0TA 1AIFB 2N1KA 1YEGL 4N0RA 4ZPTA 4M4RA 1A6WH 1RZKH 4MQSB 2V7HB 5DFVD 3TNMB 3VXSA 3QDJB 5HGHA 2JJTA 3ESVF 2NY7H 3QXAA 4TYUA 3V4VL 2DLFL 1CD1B 2PCPB 4P4RB 5DZLA 1OY3B 4IOIB 4CDHA 2O5ZH 2OJEA 6CGTA 3HPJB 1JPSL 3LKNA 3QJHB 1RAMA 2VL4A 1HK6A 1II4E 1J10A 4AL8H 2XN9B 3CVHA 3IAPA 1DUZB 4KAQH 3WE6A 4PRIA 1G6RL 3QWOB 1JF1B 5C0AB 3KNBB 3L3GA 2FX8H 1IGML 3UZQA 3VWJA 4XBEL 1H9VA 2BC4B 3NFNA 4HT1L 4AM0B 3TA3A 1CQKA 1DVFB 1B0GB 3C60D 3LQZA 2OS7A 1N6QL 4C83B 4LSTH 3QWRD 3IJSA 4LDLB 3KGRA 4LARL 1TZIA 1TQCC 1Z0NA 2RGSA 3JVGA 4G6ML 3MFFA 5CP7A 3I85A 4KKCD 1CZ8L 2NY0C 2XQYK 4OF7A 4HV8A 2XZCL 2IG2L 1M6OB 4IHOB 3TO4D 2ITCA 3KDMB 4GBXD 4PJBB 4QRRA 2YSSA 3GMRB 5DGRA 3ZKQD 3UZEA 5DK2B 5HJ3A 3B9EA 4WFEE 4RAHA 2ENSA 3BPLC 5F7DB 2QADD 1KB9J 1L7TH 1W2KT 4Z9KB 3RUGA 4PJHA 4WWKD 2WK2A 1EHNA 5D70H 5TE4H 1AIFA 1QFHA 4WTZA 3SDXB 4W6YB 1C16B 4U6TA 1QR4A 4LAQL 3O6FD 2X1PA 2V7HA 3P4NB 1JYNA 3TNMA 3QDJA 3TIDB 1CGSH 2DBLL 4GKNB 1MVUB 4OSUL 1CD1A 3LY6A 4AJ0A 2PCPA 4P4RA 4PV8B 3U79A 2YMXL 4IOIA 5EWIL 1I1AD 4G8GB 2NY5L 1RZ7H 3QJHA 1U2CA 4XC3H 4TTDC 4NIKB 3MRGB 1MI5B 4KZDH 4GKSB 2FX9H 5D7IB 2XN9A 1TQBB 5EUOF 1DUZA 4GG6B 4HH8A 4NGHH 2BXZA 4LSDA 4FZEL 5HDBE 5IMOB 2FBOJ 1P4LB 3QWOA 4R0LC 1JF1A 1RUAL 3DROB 3KNBA 1IM9B 5C0AA 1ZWIB 3HG1B 3P3YA 1H3PL 4JGMA 4MD4B 2CMRL 5I18L 2J2ZA 4YPGA 3V0WH 3N1QC 2BC4A 1U3JA 2R9HD 3K81A 2DQGL 1T5WB 4AM0A 3TN0C 5A2IH 5D96B 1DVFA 1B0GA 3LQAC 3W81A 4NQCE 4A2MA 4C83A 1MHEB 1G9NC 1L4IA 4JM2B 3HAEH 1B4RA 2A73B 3PP3H 1CDYA 4ETQB 3JV6B 1AE6L 5K9KB 1B4JH 1FNSL 4G6FB 1D5BB 3G5ZB 4AEHL 1M6OA 4LCWD 3VGGA 4ODSH 4IHOA 2R23B 4HXAH 3KDMA 4PJBA 4LCYB 2YD2A 1BLNB 1X3DA 1RZKC 3GMRA 1VEPA 1Z9LA 5DK2A 2IBZY 4MNQD 1QFOA 4JDTH 1D6EB 5DXWA 5F7DA 2CK0H 3MBEC 3O9WB 4N90D 1EVTC 1PG7X 5DMGC 5AG8A 1RZFH 5BJTB 3OKKB 3SDXA 2E6JA 3QEHB 4Y4FC 4YE4H 1C16A 2FATH 2DF3A 5IB2B 2NTFB 1CFBA 3P4NA 1WTGT 2XY2A 3TIDA 4I5BB 2A6KB 1S9XB 5C0BD 1OT1A 4GKNA 1MVUA 1B9ZA 1YC8A 4PV8A 5J11B 2CXKA 4G8GA 2ZUTA 1U58B 4PRPD 4WGWB 3MRGA 1MI5A 3TH3T 1XIWB 2H2SD 4X7TB 4GKSA 5D7IA 3H9SD 1KCUH 2Z31C 4GG6A 4YWGL 3KR3H 1FP5A 4DN4L 4Y5VC 5IMOA 4CKVX 3T04D 1P4LA 5E1AB 3DROA 3NZHL 1IM9A 3RNQB 1ZWIA 3HG1A 1WEJH 4MD4A 2V2TB 1FAIL 3S5LG 1KULA 1E4KC 1DQML 1LWRA 1T5WA 1CLZL 1YNKL 1JNHB 4XVUD 1MHEA 3QEGL 4UINL 4JM2A 5E4IA 3ISWA 2DIBA 4LCUB 2C3HA 5B3NA 4PREB 3ALXA 4KJWC 2A73A 4ETQA 4FQ2L 4PFEA 3JV6A 5GQBA 5FAAA 1YY9D 4JVWA 5K9KA 5IROC 4Y8DC 3T09A 1D5BA 3G5ZA 4YBLC 2AJSL 4YEFA 2V5MA 2R23A 4PJCF 2BSSB 5J0BA 4P5TD 3V6OA 1FV1B 1MLBB 4LCYA 3MLYL 1BLNA 4KTDH 2ADIB 4LRNH 3IDXH 3WHE0 3GI9H 4OB5L 3FN9A 3GBMH 4JO4L 4KROC 1DBMH 2HFTA 4J3TA 5KSBE 2OZ4H 4JFFB 1VPOL 1K4DB 1QOKA 1D6EA 3EOAB 3MOAH 2ZUSA 3O9WA 3IS0X 2X5PA 3MLTB 5BJTA 3VGEA 3QEHA 2DQHH 4UIKH 3RI5K 5IB2A 2GYSA 4TSAL 5F97E 1R5IB 5DVKA 2NTFA 3KS0H 4Y5XB 4I5BA 2A6KA 1S9XA 5EBLB 5BRZD 5HHNB 1IFHL 3U9PH 3JWOL 4OBSA 4DKAA 2CGRL 2E9JA 5FCSH 4KJYB 5DHVB 4YDIH 2ZUYA 4Y88A 4M61B 1U58A 3RY6A 4KJPD 1EA9C 1BQHB 1XIWA 4DVRH 4X7TA 1OW0C 3MSPA 4XPAH 1ZLUH 4F15B 4M5YL 4MDIB 5EORH 5D2NC 2DAVA 4X7SH 4Z18A 3O6LH 1OSPL 4HPYH 5E1AA 3RNQA 2V2TA 1WSST 2L7JA 4PJEB 3QI9C 4UQ2B 3UC0L 3RZCC 5CLTA 3EOTH 4Q9CA 3E2HC 4KZEH 3LRGA 4J7RA 2X9WA 4ZFFB 4XP5H 3ARFC 1JNHA 4U6VL 3D3VE 4W81A 4D94A 4OM0L 2IQ9L 3GMOB 4LCUA 3LKPB 4PREA 3DVFA 3O2DH 2CRZA 4PRDB 5A2KH 1GC1L 3ABZA 4HS3B 2E7MA 3DWTA 3MACH 3T0EB 4YHLL 1X4XA 1WQVT 1TMCB 2D03L 4LCCB 5FXCH 1IC4L 1KCKA 2BSSA 3K4ZA 3B4NA 1PX3A 1FV1A 1MLBA 2YD5A 2ADIA 4OFKA 2UUDK 3B9KB 3T1FB 4U3XA 3V6ZB 3AM8A 4JFFA 5GGSY 3DVGB 1K4DA 2B5IB 4EN3C 2VITB 3EOAA 1YQVH 5DMJB 1RY7B 1P6AB 3OZ9L 1Q38A 3Q5TA 3KLHD 5MEQB 4LVOC 1AQDB 3B2VH 3VMNA 2VDRL 4L8SC 2HTKC 4ALAH 3MLTA 1A3RH 3WXWH 1QRNB 2W9DL 4DKDC 5IB3B 5J89A 4PGCB 2QQQA 5K93A 4NBZB 3GZKA 3O3UN 3HZKB 1R5IA 2VSCA 2FO1A 1MHCB 4Y5XA 3WFBL 1KCSL 5D1XD 5EBLA 5HHNA 1U2HA 3ILPB 4XRCB 1U3HD 1XZ0B 1UM5H 3L9RB 3QDGD 1MPAH 3QRGL 4KJYA 5DHVA 4WFGE 3MLRL 4M61A 2AEPH 1BQHA 1DBKH 5DLML 1QBAA 2YPLB 3GMLB 3P9WB 1SYSB 4MDIA 3FO1B 4IMKC 4OBRA 2IALB 1BOYA 5KW9L 5GS0C 4L8BB 1BM3H 2R29H 1YJDH 3IDUA 3P9MB 4PJEA 4UQ2A 2EO1A 4WV1B 3VFGL 1DLHB 1MCPL 4ZFFA 1YECL 4I0PB 5SX5H 3SO3C 4Y1AD 4RFNB 3VJ6B 3Q6GH 3GMOA 3LKPA 5T3ZH 4LSPH 2AJYL 4MA7L 4PRDA 5F9WB 4DKEH 4HS3A 1WZ1H 3MGOB 3T0EA 4NNPL 2BNQD 2XQYG 4LCCA 5TE7H 4PJIB 4XNUL 3TIEB 1ND0B 2VZSA 2GY7B 1FVDB 3B9KA 3T1FA 3V6ZA 3NPZB 5FFLA 4R4FL 1QYGH 3DVGA 4Z7VF 4LQFH 2VITA 1OGAE 3BKJL 1G6VK 3MX0A 1GRWA 2KL6A 5MEQA 1AQDA 4LPYA 3R1GL 5KZCB 4DOHB 1QRNA 3BGFC 5E99H 4MJ5B 5IB3A 1HHKB 4PGCA 2NXYC 5JXEC 5CP3H 5E6IC 3HZKA 1A6VL 1QNZL 3T0VA 2EXWC 1MHCA 3TZVB 3C08L 1T1YB 1JRHH 3FB7B 4XI5D 3LSOB 4MCZB 5D5ME 2VWEE 1WBXB 4J8RB 1A6PA 3ILPA 4QGYA 4XRCA 5I6XB 4K94L 1XZ0A 3L9RA 3MNZB 2Z8SA 2W0KA 3I6LD 1MRDL 4L4VB 1WGOA 2NX5E 3RI5F 1S7RB 2HRPH 5D1QB 2YPLA 3GMLA 2D0FA 5GGVL 3ZT7A 1SYSA 4R4NC 5EC2B 1P4BL 5J9PB 3FO1A 3MA9H 1C7SA 5DHXB 2IALA 2DKSA 5I66B 2KPNA 3CPLB 4L8BA 4J3UA 3VRJB 1M7DB 1MCKA 4D9LL 4HC1L 3P9MA 5I1HH 5B39G 4WV1A 1KGCD 1FO0B 1DLHA 2W38A 4S1DD 1TETH 2X4OB 1K2DB 4QHLB 4I0PA 1JNNH 2UZYB 4FXGB 4JPWL 1WFOA 4KRPB 3VJ6A 3WDHA 2B4CL 2XTJD 5TQ2H 4QYOB 3UJTH 3O6KH 3PF2A 3MGOA 5BVPL 4O5LL 1LD9B 4ERSL 3T08A 5IGXL 4GAJL 1V7NL 1F6AB 4PJIA 1EFXB 4XZUB 4OD1L 3TIEA 5I0ZA 1ND0A 4J4PA 3QBTB 3ULUF 4NM8H 4IRZH 1FVDA 4UQ3B 3GO1L 5I8KH 4BUHA 1U8MB 3VXUE 2J8OA 3LD8C 3ARBD 3MREB 4GXVH 1BD2B 4NRZB 5DC9B 4OLUH 4ORGB 3RA7L 1GYAA 1ZLSH 5D7LD 4RGMB 5MI0B 2DQJH 5BW7C 5KSAD 3IAGC 1UZ6E 4NFCA 2E7LA 1VFMA 2VR4A 4MJ5A 1HHKA 3DX9B 1IEAB 4OZFB 2BSED 2HVJB 4FG6D 1JHKL 3DLQR 4ONGH 3TZVA 1IE5A 5DT1L 5IT2H 1T1YA 4GAYB 1RULL 3FB7A 3LSOA 4MCZA 1WBXA 3BEVB 4J8RA 4K55A 1YNLH 4CADB 5C0FB 5IWLC 1PG7W 3BKCL 4FS0A 3MNZA 4WUKL 3P0YL 3QH3B 3DGCR 3MLUH 4L4VA 2BY1A 3OKEB 1S7RA 2HYMA 5L88L 4HF5L 1VESA 5D1QA 3K80A 5EC2A 4GAGH 5J9PA 4F8QA 5I66A 2VDQH 4PJ9D 3TM6A 3CPLA 1IRAY 1VFBA 2D7NA 5CZXC 3VRJA 1M7DA 2EDWA 2F54E 1EJ6A 1FO0A 3NCFB 5JW4R 4H8WL 4X9IA 3T4AB 1UWGL 2X4OA 1K2DA 4MZ3A 3A67L 4QHLA 5B22A 1OP3H 5ISZE 5J1AB 4M7LT 4WRLA 4FXGA 3CMGA 3MLZL 2ZJSH 5IFHL 1LK2B 1NL0H 5DEFB 1WUNT 4QYOA 3RX8A 2FHFA 1LD9A 2ED9A 3OQ3B 1BZ7B 4EIZC 1F6AA 1EFXA 1OQXA 4XZUA 4QHNB 4PY7B 4UQ3A 1F4XL 4DW2H 4PLJD 5E4EB 4LFHG 5IHLB 1KCLA 2A77L 3RPIB 1YMME 4X4ME 1KTLB 3MREA 4GQ9H 1BD2A 4NRZA 1UADC 3F5WB 2J88L 1WBZB 4NHUB 4ORGA 4XC1L 1GGTA 4P2QD 3N1MC 3GSNB 4GO6B 2ILLA 4NZTL 4YDLC 3DX9A 1IEAA 4OZFA 2HN7B 2A6IB 2HVJA 5MEOB 4YHKL 1WAAE 4CRPA 5BCAA 4M7JL 4YGAB 4GAYA 3UROR 1WCBB 4JKLA 5FV1L 2ENYA 3BEVA 1AC6A 1KB5L 4CADA 2FL5B 5C0FA 1FZOB 1RFDL 1MFEL 1P4IH 4JZNB 2E8YA 3QH3A 1VEOA 4HCRH 1IAKB 3OKEA 3M8OL 5JW3L 4QXGH 4ZG1A 4S0TD 4OCXL 4DN3H 3WIHH 4F2MB 1HN1A 3HZVB 4DTGH 1LILA 4ISVB 3ZYIA 2DQFB 1M7IB 4PJAE 2EKJA 2ADGB 3IJHB 4GSDL 3IETB 3MNVB 3T4AA 4PLNC 4QRPE 5CUSL 5CLWA 3QIBD 5J1AA 1XMWA 1ZHBB 4S1SH 3FONB 3T2QA 2MTPA 2W1NA 2CKNA 1LK2A 5DEFA 2VXUH 4BKLB 2EYTB 4FQXB 1EFQA 3R4DA 3L1OH 3QUZB 3UTTB 4ZPVB 1BZ7A 4WNQB 2YA0A 3FZUC 1J86A 1EGJL 5DSCA 2MKLC 1RV6X 1EO5A 3ARGD 4QHNA 3QQ9C 4PY7A 2VDKL 2HWZH 4KHXL 1RJCA 3GSXB 1AH1A 5MENE 4DUXA 3RPIA 1OTUD 3RVUC 2HT2D 3BT2L 1KTLA 3ZTJG 5BZDB 5T3ZD 5L2KD 3F5WA 1WBZA 4NHUA 1AC0A 1LDSA 2IAND 4N8PA 3UJIH 4KDTC 2OSLB 4RZCB 1N5YL 2NY2C 3GSNA 5JHDD 4E41D 5JOPD 1MJUL 3B8SA 5F88B 2HN7A 2A6IA 2EH8H 2BMKB 3O11B 1NGYB 1DEEB 1CE6B 4XP9L 3FMGH 3SJVB 2FR4B 1GGBH 1A3LH 1RMFL 2G60H 4PGZA 4YHOH 1WCBA 3U7AA 4JHAL 4DCQB 1OL0A 2DDQH 3RVXC 3O0RL 5F21B 4MVBC 2FL5A 2XZAL 2WQRA 2QHRL 1FZOA 2WUCH 1FLRH 3MJ7B 4JZNA 1LP9B 2DQIH 4FABH 1IAKA 1HXMB 1A6UL 1NBVL 4W6XB 2BERA 1SMAA 4F2MA 5JORB 4KPHL 4NN6C 3BPOB 3HZVA 4DQOL 3QISA 4ISVA 2DQFA 1M7IA 3WO4C 2A1WH 3TFKC 1M1SA 1HE7A 4EDWL 3MODH 2ADGA 3F62A 3LOWA 3IJHA 5SWSB 2CLRB 3LS5L 3IETA 3MNVA 5D7JB 1J0ZA 2MJWA 2VLME 3VD4A 4UV7H 3FONA 1AI1H 2X2YA 4UT6L 2AI0H 1IGYB 5IVXE 4BKLA 2EYTA 4FQXA 3LHPL 3BWAB 2MQCA 1KJ3L 5SV4A 3TJEH 2PXYB 3QUZA 3UTTA 1OAQH 3MLSL 4NNYB 2VZTA 4WNQA 4ZPVA 5J4MA 4CBPA 4XPTL 4BQBA 4DZ8B 2IFFH 3GMQB 2VLRD 5L9DH 5DJXB 2MQ3A 4XNXH 5JMOC 4G7VH 4MXQD 3GSXA 4WCYH 3IGAA 4S1RL 1CLOL 3WFEH 4GKZB 2N7BA 5BZDA 4LLYA 4NQUA 3SDDC 4KGJA 4MA1C 2PW1B 3BIBX 3TCXA 2OSLA 4RZCA 5HDBF 2YRZA 3LRHA 5CEYB 3QCVL 1W8OA 3MLXL 3SGKC 3ARXA 2GY5A 4JFEB 4XAKD 5F88A 1IT9H 3CJJA 2BMKA 3O11A 1NGYA 5EZOH 1DEEA 1CE6A 1IGTB 4IRSB 4ODUB 3OGCB 3O41B 2COQA 3SJVA 2FR4A 4XWGH 4DCQA 1I3GH 4JANB 3QFJD 2IF7A 2EXYD 3MJ7A 5IESL 1LP9A 4NRYB 2LE9A 1NGQH 4HXBH 2IBBA 1GCFA 5ANME 4XHJD 5FHBL 3TV3H 1HXMA 5T3XE 1S5IH 1I3VA 1I1FB 3UO1H 2YUWA 4YBQD 4U31A 5CBAB 5DRZB 5JORA 5FGCB 3MJ9A 4P2OC 1QBLL 1G7MB 3LDBC 1KF9B 5C6TH 3MXWH 2VIRB 4P23B 1XGQB 1T66D 2J5LB 5CEZH 5FYKH 5BV7B 1AJ7H 4HJJL 4M9PA 4MQXC 4NUJB 4YDKL 4KKLC 5SWSA 2CLRA 5D7JA 1D3CA 1JBJA 3WD5L 1N3NB 4OF8A 4V1DE 1IGYA 5IP4A 3QXUA 2APBA 3BWAA 4OJFH 1JCKA 2PXYA 1N4XH 2YD8A 5JW4M 4H25B 5BO1L 5KAQF 4NNYA 3O8XB 4O9HL 3SE8H 2K3TA 3P0VH 3V52H 4DZ8A 2NW3B 3GMQA 4OV5B 2W07A 5I9QB 4G80B 5DJXA 2X1WL 3L5XH 4W4NA 5EU5B 3EOBB 3N9GL 1HCFX 4JZJB 4OD3L 3D69B 4OCYL 4RGND 1WV7T 4KKCC 5T1LB 4OZIE 2APFA 1HDMB 4DGIH 4GKZA 5IIEB 2XICA 3QDHA 5IQ7H 5FO9B 4XPFL 2Y25A 1YYLL 1D6VH 2PW1A 2YKLL 4PJ7E 4XVTL 4LF3B 1YQ2A 5CEYA 2AGJH 2RBLA 4ENED 4JFEA 3IF1B 4M7ZB 2BZDA 1IGTA 4IRSA 5CILH 4ODUA 3OGCA 5DI8B 3O41A 2BHUA 4JG1L 2ESVD 4WWKC 3DV6B 3OAYK 3QPXH 2WV3A 3LEVH 2EDKA 3GUTB 4NJAL 3EYOB 4JANA 3DI3B 3MRBB 4ZS6D 5HHVH 4ZFZB 5KJRL 5F3HB 4NRYA 3QUYD 1JTOA 5KANI 3NGBC 3CSPA 1I1FA 1R3IL 3MRNB 5CBAA 5DRZA 4J2XA 5EUKB 1G7MA 1NCWL 2HH0L 4NNXB 1EO8L 3ZO0A 1T2QH 4E9LA 3M1BB 4NO5B 3BE1L 4KQ4L 2VIRA 4P23A 4LVHC 1XGQA 2X4UB 3TBWB 5KSBF 1I1AC 2OL3H 2P44B 1MNUL 2HP4A 4NUJA 4AEEA 4MA8L 1BAFL 1LE5B 5KG9B 4UTBL 1N3NA 5GS2D 3VU2A 2AJXH 5FCUL 3MLWH 2AAVA 4NM4H 3HI6H 2EO9A 4IIQB 3RKDD 1ADQL 1T83A 4L3EE 5DRXB 5FYJD 4K7PH 3F6IA 2XZQH 4H25A 2R9HC 1JZ2A 3BQUC 3O8XA 1BZQK 5C08E 1P2CB 2HFFB 2NW3A 4OV5A 1CBVH 4G80A 2J6EL 5EU5A 3EOBA 5IMKB 3UDWA 3HC3L 4JZJA 3D69A 2BK8A 4YDJB 1ZSDB 3VMPA 1Q94B 4MD0A 5T1LA 5E2TL 1JGDB 4NN5B 1HDMA 4PJFB 5IIEA 1HCVA 5FO9A 1KJ2B 5IVNA 1JF6A 3LRSB 1JRHI 4NP4H 2HMID 3P30H 3CVIL 1EHXA 4LF3A 1JMXA 5B38G 1UXWB 4NQEB 3IF1A 3PUCA 3PV6B 4Q9QL 4N8CH 2ADJB 4RISL 3U0WL 4YGVB 2IH3B 5DI8A 2AQ3A 2HLFD 5EO0B 3DV6A 2YA2A 5E08L 4L4TD 1NAKL 4AK1A 4NUGL 3GUTA 3BRDA 2DQDL 3EYOA 4JREB 4JZOB 3MRBA 4H20L 4EUPG 4WFHD 4ZFZA 5F3HA 5HYJB 2YD3A 5I19H 3MCG1 3Q1SH 4X6CB 1AHWB 3GMMB 1HH6B 1U95B 2HKFH 2OR7A 3BZFB 3MRNA 5FUZH 3L95B 5EUKA 1JMZA 1QA9B 3BESR 4P57B 4NNXA 1MH5B 4NKIL 1FC2D 2VLJE 2ZPKL 3M1BA 4NO5A 2X4UA 3TBWA 4Y2DC 1AXTL 3R06B 4UAOB 2VN4A 3IXTB 1M7XA 3DX8B 3V7AG 5DK0B 5F7LB 4N0UE 1I9IH 1ZV5A 3L3OB 1LE5A 3CXHK 5H94B 5KG9A 43CAB 2VNCA 5LCVL 1ITBB 4PY8J 4CL7A 4IIQA 3GSUB 5DRXA 4B53A 3SOBL 3UAJD 2LV4A 4KMQA 4GRWB 4KUCF 3JWDH 1CK0L 1P2CA 2HFFA 3HLAB 4GOSA 4MA3B 1KLFA 5J13C 3QUZD 5IMKA 2R4SH 5CCKH 4MNGB 4YDJA 1ZSDA 5IW1B 1MJ8L 5JHLL 1Q94A 1F4YH 2IFGA 2V5YA 4HMCA 4ODVL 3SKJH 1JGDA 1D9KD 4PJFA 4QRQB 4Z7WE 1KJ2A 1I9RH 3LRSA 4YXLL 5EZLB 3QJFB 4X8XA 4P5TC 4G42B 4HPOL 5AZEH 1SY6H 4PGJA 4CMMB 2OK0H 1JFQH 1UXWA 3DPBA 4XP4H 2NYYD 4NQEA 3MV7D 3KPRE 1KYOK 3PV6A 3ARZA 2ADJA 2F53D 2ZUWA 2V5SA 2IH3A 1UENA 4OCWL 4YGVA 5FUCC 3K2UL 5EO0A 1CF8L 4Y5YB 5DJZB 1N59B 4G7YH 2IEPA 4JR9L 5BS0E 4JZOA 3PQYD 3TT1H 4BJLA 4ZFGL 1WF5A 5I15H 1S3KL 4RIRB 5GGQH 5HYJA 2APWA 3SHSA 5FYLD 4I3RL 5I30L 4X6CA 3GKWH 1AHWA 3GMMA 1HH6A 1U95A 3BZFA 4F9LA 4MB4A 1UYWL 1QKZH 3L95A 1QA9A 5CGMA 4P57A 4IOFD 1MH5A 1FGVH 4PJDE 2CRYA 2JJTC 3R06A 4M93B 3IXTA 3DX8A 2F5AH 4KJPC 4J6RL 3GDBA 5DK0A 3V4PH 3U0TB 3PG2A 4Y89A 3KLAB 3L3OA 4C56E 2HRLA 1YEKH 4KTEL 1C5CL 4RRPA 3MV11 5H94A 3EJZC 3MV9B 43CAA 4M48H 1MAMH 2H26B 1EX0A 5CHNB 4JJHA 4JY5H 4FFYL 2CKBH 3JXAA 7FABL 5DS8B 1MCRA 2BY3A 4QOKE 4Y4HD 3GSUA 4R26H 1EV2E 5ITBH 4LMQI 5CEZD 4EIGB 4Z0BL 4MHHG 1OAYH 4NHCH 2VDLL 3CDYA 4FQIH 5D5MF 2B0SL 2AJUL 4X7DC 1U6AH 1GGIH 4MA3A 2ZCKH 5IR1B 3HCVB 4NQXB 4MNGA 1GOFA 3TA3C 5IW1A 5JQHC 4YQXH 3PHSA 2JCCB 4QRQA 1RZ8B 4EVNB 4F57H 3JVGC 5EZLA 3QJFA 5GS1B 5C07D 2VZOA 1DN2A 4G42A 1CD9B 2NY4D 4NQDB 4CMMA 5HSFA 3ARTA 3U1SL 3D85D 4XP6H 1FH5H 4G6AD 1J8HD 4J3SA 3F7QA 3TYGL 4HLZH 4TVPD 1JHLH 4LHJB 2XA3A 4Y5YA 5DJZA 4OM1L 2VUYA 3B5HA 1N59A 4FTVB 2CDFB 1EJOL 2O5ZL 3AXLB 3CX5K 1CS6A 1I7TB 4JDZB 4APQD 4AL8L 4JFOB 4RIRA 4Z5RB 3UEZA 4IM8A 5KS9E 3ULUH 1NJ9B 3DYMA 3DRQB 4KAQL 4L4JA 2EDQA 2Q6WB 4M6OH 4MAUL 2HJFB 1TJHL 4XTRC 2E9WA 2PYEE 3KPSE 3Q6FB 1MWAB 4PRHE 3P40A 3RNKB 1IAIH 3WKMH 3ARQA 3TYFB 4RAVB 1LO0H 4QHUB 4JFDD 5IBUB 3VG0H 1XGRB 2NLJB 4P46B 5DJ8B 1KN4H 3U0TA 4NWTH 1QBMH 3KLAA 1T7ZA 3MV9A 3PL6B 2VZUA 2E7CA 2EC8A 3QNYB 1L6ZA 3R8BB 2H26A 4UT7L 5F71A 4LIQL 5CHNA 1UZ6F 4TUJB 4WFFD 1A5FH 1AFVL 1ZAGA 5DS8A 4L29B 5GZOD 3Q0HA 1UG9A 1S5HB 5AUMB 5SV3A 1BFVH 3P11L 4H26B 1XGTB 4N0CD 5GPRA 3FB5B 2CDEB 2FGZA 4LBEB 4D3CH 4I2XB 2RIKA 5IR1A 3HCVA 3KAAA 4NQXA 3QXVA 3WMSA 3RTQD 4S11A 1DVFC 5D2NE 1JGUH 1IILE 2JCCA 1RZ8A 4EVNA 1G6RB 1EHLH 3FRPA 5TE4L 2BRRL 2ZCHH 5IKCB 2P46B 1ZHKB 5GS1A 4HJGB 1KIUA 4UTAL 2ADFH 5C86A 4NQDA 5TFSL 2X1OA 2QQLH 1P5UA 1VENA 1KN2H 4X9BA 1CGSL 4Y8AA 4OCNC 1VA9A 2FDBP 2R2HB 1OAXH 1R6VA 4ODTH 3NCYS 4M62H 4FTVA 2CDFA 3AXLA 5GRYA 1RZ7L 2WIIB 2FO4B 4KZDL 1QO3B 1I7TA 4JDZA 4JFOA 4Z5RA 5F8RC 1NJ9A 2V7NB 4U2ZA 5ALBL 4FFZH 2Q6WA 4UT9L 3I50H 4LSQL 3RP1A 1JZ6A 2HJFA 2VL5B 5E8PB 3Q6FA 1MWAA 3RNKA 4KFZC 1CICD 4XX1E 4OFVA 3TYFA 4RAVA 4YAQB 4XT1C 1BQLH 4QHUA 4LLAA 2D31B 2VERN 4R96B 1XGRA 2NLJA 4P46A 5DJ8A 1QSEE 1FNEB 2LVCA 3B43A 2AEIT 3QNXB 3RDTD 3PL6A 4JPKH 5CD3B 3QNYA 1MY5A 4OFIA 2O5XL 3EFFB 4J3OC 2P5WB 5DO2D 4WI4A 4YHPB 1TQCB 2C4XA 2NXZB 4TUJA 4AIOA 1TQBC 4L29A 2NY0B 3RJDA 1S5HA 4ODSL 5AUMA 1WAAF 2CQVA 4S1DC 5LQBL 4H26A 3GMPB 1XGTA 2P5EB 3FB5A 3MV8E 3PWVB 2CDEA 2DJ4A 4LBEA 3UTPE 4WIQA 3AMKA 1HYSC 4I2XA 4JDTL 3BXNB 1M4KA 2DN7A 1J18A 1AO7B 4Q9RH 1VDGA 5D96C 2GHWB 3HE7D 3FKUS 1DJSA 1G6RA 1SVZA 4JM2C 1FSKC 1J1XL 1RZFL 4L8DB 5IKCA 2KQMA 1W0YT 1ZHKA 4YE4L 4HJGA 5F7WC 3RKPA 1Q8MA 4PJAF 1JPST 3ZSTA 4K8RD 3H3PL 3V6OC 3LAFA 4X6FB 1CR9H 4PJGB 3U48A 1CG9B 2R2HA 5CSZB 1NKOA 1T7YA 3FO0H 1EDQA 4MNHB 3A6BL 3BFOA 4NQED 5TF0A 5DC0A 4HBQA 3G6JE 5KSAC 1GPOH 1HSBB 2WIIA 1OAUH 2FO4A 4GFTB 1QO3A 3O9WC 2BOBB 1KCUL 2V7NA 3EYUH 3KR3L 4RFEB 3H3BC 4R7NB 2DB8A 2C4FT 4XNMB 2WIMA 5JXAH 2VL5A 5E8PA 1WEJL 4JCMA 4LSUH 1WIPA 2P47B 4YAQA 3QUMH 2JTDA 1P7KB 1QTYT 2D31A 2GFBB 4D9QE 1RUPH 1X7QB 2HA1A 4R96A 4K3EH 3VWKB 4W68A 1CFSB 1FNEA 5J11C 4WHTB 3QNXA 5EOTB 3C6LD 3RVVD 5CD3A 4K3JH 3BGAA 3RY6C 3EFFA 2P5WA 3GHEH 4PJ9C 5DJ2B 4YHPA 4FHBD 2BDNH 1OTTD 3SDYH 1EUUA 1O7VA 5DQ9B 4LRNL 2BY0A 4KTDL 2E7BA 2G5RA 3IDXL 3GMPA 2P5EA 5B8CB 3D39E 3PWVA 2OZ4L 2Q7YB 4LFHD 3UBXB 2DM4A 3BXNA 4YK4B 2GSIB 3MOAL 2FLRT 1AO7A 5F7KC 1CLYL 4LGPB 2VQTA 1TENA 3H9ZA 4L1DA 3NACL 1KT2B 5F7NC 4U1NB 5CGYC 4XPHL 4BA8A 2O26U 4L8DA 5HI5C 2MCG1 2CIKB 4YJZL 1F90L 4XMLL 2PR4H 5ADOL 1X4YA 4UIKL 3W5NA 4JN1H 1QQDB 3SKMB 1C5DB 4URTB 4I13B 2DM7A 3WBDA 4N5ED 4X6FA 3U9PL 4PJGA 1CG9A 5CSZA 5C0ND 4M03A 2AABL 3PWJB 4JLRB 4KJQD 1S9VB 4MNHA 3AM8C 3LEYH 1ODAA 2OX5A 2H1PH 4KI5C 4YDIL 1HSBA 4P4KD 1V7MH 2APVA 3QHFH 3VFNB 5IVXF 1CGXA 5F6HI 2BOBA 3K4DA 3IDMB 3RJQB 3TVMB 4H1LG 5EORL 3BJLA 4RFEA 2Z31B 1Q0YL 4R7NA 3O6LL 4XNMA 5J8OA 1R0AH 5HHME 4HPYL 3MZGB 1JZ7A 4L8CB 5LBSH 4OLZL 1A7BA 1SJXA 3GHBH 2MCPH 3E0GA 1QSFE 2NZ9D 3JTTB 4Y5XC 1P7KA 4LU5H 5C0CE 3EOTL 5TPWH 2VXTH 4KZEL 2JIXB 2GFBA 1JWUB 3UTQB 1NFKA 4XP5L 5EU6D 2D7QA 3T3PE 3VWKA 1CFSA 5IM7B 4Z95L 1UACH 4WHTA 5D7KE 5EOTA 1WZLA 3BRFA 2VC2H 5J3HD 3O2DL 3OAZK 5DJ2A 3SQOH 5CBEB 2QJDA 3KVQA 5EBGA 2AV1B 4F15C 4TRPL 2M1KA 4JM4H 5DQ9A 4I9WD 4PD4K 5A2LH 5HPOA 5B8CA 2B2XH 4NKDB 1J5OL 2Q7YA 4HG4J 3UBXA 1T89A 2ERJC 3GSWB 4MB5A 2GSIA 1WC7B 3DBXB 1A0QH 5SX4H 1BFTA 15C8H 1OPGL 4RMRA 3B2VL 1KT2A 4U1NA 4ALAL 2GJZB 1A3RL 3WXWL 5DUBB 2CIKA 4OCSL 2EECA 2ZZUT 4O58L 4QF1B 3T0EC 9CGTA 4N68A 3NIGE 1QQDA 4N9OB 3SKMA 4B50A 4LCCC 1C5DA 1G0XA 5I8EB 3MA7B 4XPGL 3IFNL 5EOCL 4LCIL 1HZHL 3PWJA 4JLRA 4PJ8D 5I0DA 5JPMB 1EEQA 1S9VA 3EZ8A 4ODXB 5KOMC 2B5IC 1MPAL 3EO9H 4MWFB 3VFNA 4HWNA 3IDMA 1A7NH 3TVMA 3GFUA 1I4FB 1NFDB 3QDMD 2Z31A 2I24N 3L5HA 4JRXB 5LAXB 3KXFD 3DUHA 5H35B 4L8CA 3S96B 4RGOH 4U1GB 1BM3L 1DP0A 5J56B 4ZSOE 3JTTA 2HG5B 2VH5L 3FB6B 4TQEL 2O93L 3WNPA 2JIXA 1D5ZB 3QI9B 1JWUA 3UTQA 4OZIF 2YWZA 1E4KA 4Y19E 2NNAB 2CSPA 5IM7A 1KFAH 1UCBL 4Y4KD 1LHZA 1I8MB 3DUUB 2FJGB 1UZ8B 5T3ZL 4LSPL 5CBEA 4PJ7F 4KK6C 4DKEL 3NN8B 4OZFH 3O4LB 2AV1A 5I17B 4P99A 4TSBL 3VFSB 1UWEH 5FK9B 1S78D 3ZL4L 4NKDA 4LLDB 3GSWA 1QYGL 7CGTA 4LQFL 2DJUA 4WV1C 1WC7A 3DBXA 3KPQB 3WIIL 2I27N 5ILTL 1XF2A 1IKFL 4I0PC 5E8DH 2VLKB 2GJZA 4Q7DA 5T33H 5E99L 3CSBA 3GRWH 1V3LA 1PKQE 3IXAB 5DUBA 3OHXB 1YEHL 5F9WC 4MLSA 4WI2A 2X89D 4QF1A 3VGHA 3BN9D 4JFZL 4RMVA 5I8EA 4XXCA 5KOVC 1FFNA 3GGWB 3MA7A 1BWWA 3OKNB 4J4PC 4L3CB 5JPMA 3OKLB 1URLA 3HUJB 4M5ZL 2B7DT 1MRCH 2CK2A 2ZNWA 4ODXA 1CXIA 1ZT4B 1JPFB 5E9DD 3WNKA 4F33B 2FB4L 4MWFA 1T7VA 2NY1D 1YPZE 1YUHB 35C8H 4JRYE 2BVYA 1I4FA 4BZ2H 3ORJA 1NFDA 3HNSL 1IQDB 4UOW1 3U7YL 2BJMH 2E7LC 3WN5B 4JRXA 5LAXA 1IKNA 3BP6B 5H35A 3S96A 5BVJB 1GOHA 2YC1B 1EZVY 1NC4B 3TZVC 3HE6D 5I1HL 5CAYB 1NDGB 2HG5A 3FB6A 4DGVH 5I71B 4MAYD 12E8H 1D5ZA 3QI9A 2NNAA 3TPUB 2V2WB 5E2WH 5I1KL 1RVFH 2W9EH 4NZDA 5JUEH 1DQLH 3LN5B 3OPZH 5CKAA 1I8MA 1CWVA 3DUUA 4PJ5B 2FJGA 3U7WH 1UZ8A 3O6KL 1E6JH 4YPJA 4XNQB 5D1QC 1T66C 4JHBA 4PG2C 3NN8A 3O4LA 3X11B 5I17A 4WI9A 2BRQA 2XI9A 3VFSA 4MXWL 4HGMA 5FK9A 1TCMA 1MHHB 1P5VA 1VEMA 4DUVA 4NM8L 4ODHL 4IDJL 3MOQA 4LLDA 1Q0XH 2ZUQB 4HIJB 3KPQA 5EIIB 3DGGB 4GXVL 4ZAKB 4ZMAT 4YC2B 3GI8L 3SDAD 1A1NB 4R7DB 1SQ2N 2VLKA 4HEPG 4DGYH 1CFVH 4KRPC 3IXAA 4KDVA 4RFOH 3OHXA 2AXGB 4D0BB 5C2BH 8FABB 5JA8B 5FA4B 2Y9RT 4ONGL 4X80H 4K71C 2A9MH 1DANT 1L0XA 1F42A 2DYPB 3P4MB 1QRKA 4RAUB 5E6IB 5C09B 4Y16D 3GGWA 1Z9MA 3OKNA 4L3CA 4KUZL 1KCRL 3OKLA 2GUOB 1PFCA 1YNLL 3HUJA 4QWWC 1SHMA 2VDNH 3RL2B 1ZT4A 1JPFA 3HC4H 4PJXE 3VXMB 3MLUL 4F33A 4OZ4B 1IAII 2H41A 4ENEC 1A9EB 3PIQB 4JQXA 1YUHA 4HMEA 5MI0C 4RGMC 3JV5A 4NKMB 3IU3B 1IQDA 4YNYB 1CFQB 4JO1L 4I77H 3WN5A 2VDQL 4ZUSB 3UJJL 4HIHB 3BP6A 1PLGH 4IMKA 3PWPB 5BVJA 2YC1A 5I8CB 1NC4A 5I1GH 1B0RB 4O2CB 2Y5TB 1NDGA 5JO5B 2ZNXA 1I7ZB 5HPMB 2OCFD 4WI7A 4IJ3B 4P2RE 3TPUA 4Z7WF 2YPVL 1MEXH 1WIUA 2V2WA 4LHUB 1JPTL 3LN5A 1NL0L 2BX5A 3EW3B 4PJ5A 4ZOBA 1WZKA 3CFJB 4XNQA 4R97B 1ZE3C 3X3FH 4PRBB 3X11A 1SEBB 4P59H 5IT2L 3SKNB 1EXUB 1MHHA 3LVEA 4KMLB 5CINH 5IVZB 1MCWM 3MR9B 4FQCH 4OFPA 4DW2L 3OAYH 2OBGA 2IPUG 4JQVA 1MHPH 5EIIA 1IZJA 3DGGA 4GQ9L 4ZAKA 2KUTA 1A1NA 3RIAK 1K6QH 4R7DA 4NQCD 3S35H 4F80A 1D5XB 2AXGA 4YFLI 5FYJU 4D0BA 5I8OH 1FYTB 4P2CG 4HC1A 2D7TH 4PJDF 8FABA 5FA4A 4R2GB 5JXEA 5E6IA 2DYPA 3P4MA 4RAUA 5DFTA 2M2DA 5C09A 1CCZA 2X1QA 2AW2A 2VTFA 5HXMA 4QTHB 2GUOA 2HTLD 1U8PB 5E4EC 3RL2A 4ZOCA 1ONQB 4HQQH 1FPTH 1P4IL 3SE9L 3VXMA 4JRWA 3KYKH 2OJZH 4LSRL 5D7SH 5F7UA 2LAGB 4OZ4A 4QXGL 1B6UA 3PIQA 3ARDD 3WIHL 5TGBB 4NKMA 3H7LA 3IU3A 1SEQH 4DTGL 1MF2H 2HLFC 4YNYA 4X9FA 1CFQA 4ZUSA 4NQSB 4HIHA 1RUQL 2R0WH 3PWPA 5I8CA 1B0RA 4O2CA 2Y5TA 3S4SG 5K9JH 4P9HC 5JO5A 1ACYH 5GRWA 2MFNA 2ED7A 1I7ZA 3UTZB 5HPMA 2W92A 2F8VA 1RZJH 2Q8BL 4LHUA 4UILH 5CIPB 2GQHA 4CN4A 4OZGE 2VXUL 1KC5H 1F3DH 3CFJA 4MQTB 1A7PL 1J0KA 3F65A 5IHBA 4FQPA 2AK4B 4PRBA 3IT8D 6FABH 4ELMB 3SN6N 1SEBA 4TNVK 1KB5B 2IPTL 3S37L 5I74B 3SKNA 4OQ1A 1EXUA 4PGDB 1FNFA 1WIOA 5IVZA 3MR9A 2EH7H 4QKXB 2BNRE 2YUZA 4NCDA 5GGTH 1HHHB 5F96H 3EIFA 1RURH 1L9MA 5KS9F 4P3CH 4HWBL 3UJIL 4RQQB 1D5XA 3EFDL 1P1ZB 1ZLUK 1GGYA 1FYTA 2EH8L 1NCCL 3QUZC 3FT4B 1PY9A 2UYLB 1ORQB 2UWEE 3HC0B 4MJIE 1U8HB 1GGBL 2QL1A 3HI5L 3PHOB 1KENH 2G60L 3CFIC 4NCC1 1D9KC 4XP1H 4YHOL 3S9DB 1P9MA 2EDXA 5CZVH 4QTHA 5L8JB 5CJ5A 1CLCA 1U8PA 4M3KB 5HHOE 1FLRL 1ONQA 1FNGB 5B21A 4Z8FH 2DQIL 4U33A 5GGRB 2NYYC 2XOTA 3G5VB 3O6ML 4NC1C 5TGBA 4QGTA 1TTGA 1S7SB 3ALWA 1NQBA 3OX8B 2VDML 4O4YH 1WVZA 5H37H 1ZK9A 2YN3A 4NQSA 1T1WB 1NEZG 2A1WL 3B6SB 2GJ6B 2QSCH 3CMOH 4FQ1H 3MODL 4PTUB 5DD5H 2EYSB 3GIZH 5T5NF 3W9EB 2F19H 3UTZA 1J0JA 5AWNL 2IAMB 3ARVA 4UV7L 1GAFH 3QEQB 1AI1L 2PUQT 1ZLVK 2AI0L 5CIPA 4U1LB 2B20A 4AEFA 4YHZH 2PO6D 5FO7B 4LLMB 1NCBH 3CFDB 4OZHE 5DD3H 1OAQL 2AK4A 1H15B 1SM3H 3BPOC 4K9EC 4ELMA 5FYKE 3BD3A 5JDJA 1KB5A 4YHIB 4PGDA 4QY8B 4OIBA 3FCTB 1IZKA 1NAMH 5LGHH 1ES0B 1HHHA 5IFAH 4BELD 3D9AH 3VRLE 3WFEL 1GJIA 5D7JC 4Y4HC 3QIUD 3VXRB 5F7HA 2JF1A 4YDVB 2FSEB 4ZTOH 3OG6B 2VKWA 4H1LH 3D3VD 4RQQA 5FYLL 5IG7B 2MMXA 1P1ZA 1T22B 1LO4H 1CTNA 1IT9L 1MCHA 3FT4A 2UYLA 1ORQA 3HC0A 5KVEH 1U8HA 1UVQB 3PHOA 4XWGL 4ZUVB 3RIAF 4QT5B 4WUUE 4G9FB 4X4ZA 1I3GL 1FORH 1UWXK 3MRMB 1MJ7H 1X6NA 2EDEA 1TVBB 2ZCLH 1FNGA 4WU5B 2KZ1B 5GGRA 3TV3L 1S5IL 1RZJC 3UO1L 3G5VA 3PGFL 1EGJA 2FEDD 4K23H 1S7SA 4ZYKB 3OX8A 1T6VN 1RUKH 3AS2A 1T1WA 2J8UE 3B6SA 4RA0C 5CEZL 1NBZB 2GJ6A 3VH8B 5C71A 4IRSC 4PTUA 3ZE2E 2EYSA 3RL1B 4POUB 2CJUL 5HDQH 2C3GA 3W9EA 4KUCD 4XNZB 3VA2C 4OLYH 4WENB 2IAMA 1KJ2H 3QEQA 4EOWH 1H3VA 3IDIB 3T1WA 4PUBL 1MY7A 4ZUWB 4U1LA 2JE8A 4EXKA 4WFGD 2ZG1A 3WEXB 5FO7A 4LLMA 5CKGA 2AJVH 3CFDA 1N4XL 4R90H 4KH2A 1YEIH 1H15A 3DXAE 3QUXD 3SE8L 3P0VL 4YHIA 4P23C 1NDMB 3BWUC 2P24B 4JFHE 4QY8A 3L5XL 2P8MB 4L9LB 5BV7C 2JJWA 3FCTA 3NAAH 3VD5A 3B9VA 3G6JF 4TVPL 4ZS7L 1ES0A 4AMKH 3NH7H 1OHQA 3U4EB 1H5BC 3N1FC 5IQ7L 1DZBA 3VXRA 1UQSA 2JJVA 5ALCH 4YDVA 2FSEA 4TNVF 3U30B 3MJGX 2JELH 3OR7B 3SDDB 4JJ5B 3VXSE 2NY6D 5IG7A 4FNLL 2AGJL 3RVTD 4I8DA 1T83C 1T22A 1IGIH 3GIVB 3GM0A 1TJGH 5LGJB 1G7LB 5TE6H 3KS0J 1FBIH 5CILL 2C26A 5ELIA 3O8XC 1F2XK 5A43C 3RTQC 3WLWC 5DVMA 1UVQA 4K3GA