3TT4A

Human mmp8 in complex with l-glutamate motif inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
GNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil collagenase
publication title Simple pseudo-dipeptides with a P2' glutamate: a novel inhibitor family of matrix metalloproteases and other metzincins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3tt4A00
3I7IA 3WV3A 2W0DA 4GQLA 3DPEA 4IN9A 2X7MA 1QJJA 1IAEA 4IJOA 2O3EA 4JA1A 1QUAA 4J4MA 3V96B 1XFVA 3F18A 1GO7P 2FV9A 2DDYA 4FXYP 1R1HA 1UTZA 2AIGP 3OHLA 1YQYA 3AIGA 1USNA 4PKSA 456CA 2Z2DA 2A8HA 4JIJA 4WF6A 1GKDA 1XURA 2XS3A 3K7LA 3HY7A 4L63A 1MMPA 2OY4A 1CK7A 4L6TA 1ZXCA 1BSWA 3F17A 3Q2HA 1MMRA 4QKZA 1ASTA 2L0RA 3B8ZA 4DPEA 3RTTA 3O2XA 1Y8JA 3KEKA 2Y6CA 1O0QA 1G49A 1BM6A 1HY7A 2JIHA 1S4BP 5I12A 3L0VA 1Y93A 2K9CA 1HTDA 2ERPA 2YIGA 1XFYA 2X3AA 3TT4A 2RJQA 1IAGA 1G4KA 1J7NA 3LQBA 2JSDA 1HFCA 3RTSA 1B3DA 4PKTA 3ZXHA 1QIAA 4DF9A 2OZRA 3LGPA 3TS4A 5CXAA 1XUCA 1AKLA 4FVLA 1KUHA 1CQRA 2W12A 2D1NA 1ZS0A 4AUOA 2W13A 4FXQA 1JH1A 1G9KA 4GF1A 4WK7A 3F1AA 2J0TA 3LJGA 2POJA 4H82A 3WV2A 1GKCA 3I7GA 3P24A 3LUMA 2MZIA 5BOYA 2RJPA 1MMQA 3F19A 1WNIA 1XUDA 1GO8P 4GWMA 1I76A 4H49A 4WZVA 4H84A 1L6JA 5D1TA 1PWWA 5D7WA 5LABA 3USNA 1OM8A 3EDGA 1Q3AA 4JQGA 1BKCA 3KMEA 3E8RA 4WKIA 1PWVA 3EDHA 4GR3A 3KHIA 3LMCA 1JAPA 1D8MA 1PWPA 3LK8A 1FM1A 3ZUKA 3Q2GA 1JANA 2WOAA 2W14A 1Y0VA 5CZMA 3P1VA 4ILWD 2PJTA 1PWQA 1CAQA 1C7KA 3KWVC 3N2UA 1OS9A 2K2GA 3HYGA 1HFSA 2E2DA 3LE9A 5BOTA 3HDBA 2KRJA 4FU4A 1YCMA 1OM7A 1JK3A 1SLMA 1K7QA 3AYKA 1QICA 3ZVSA 4HX3A 1OS2A 4XM6A 5L7FA 4PKWA 4ZR5A 3HB2P 5D2BA 2JT5A 1K7IA 2XS4A 2EROA 1EAKA 1KUKA 5CUHA 1FBLA 1KBCA 1XFXA 4GWNA 1ZVXA 4H3XA 1BKCI 1RM8A 4XCTA 3AYUA 5BPAA 5B5PA 1XFUA 3TVCA 1FLSA 2OVZA 3HBVP 3CKIA 2QPJA 2MZEA 4XBHA 1XFWA 1KUIA 1ATLA 1YOUA 4GR8A 966CA 1K7GA 3ELMA 1GXDA 1MMBA 3F15A 3EHXA 1OMJA 2DW1A 1EB6A 1UMSA 4DV8A 2ERQA 1ROSA 4EFSA 5D1UA 1I1IP 2I47A 4H1QA 1ZXVA 4AYKA 1C3IA 3B92A 2MLRA 2SRTA 1D5JA 3DL1A 1R55A 3N2VA 4AIGA 4Q1LA 1QJIA 4DD8A 1KUFA 3EDZA 2JNPA 1ZTQA 4I03A 3OHOA 3LILA 1BIWA 4AXQA 3KEJA 4PKVA 3LUNA 1IADA 1BQOA 1D8FA 1JJ9A 3NX7A 1CXVA 4WKEA 1JAOA 4XM8A 1R54A 4CTHA 2X3BA 1A86A 1IAAA 3HDAP 2OI0A 1BUVM 2OXZA 2Y6DA 1ND1A 4G0DA 1HOVA 5I0LA 3VI1A 3F16A 1MNCA 2X3CA 4GUYA 3U1RA 4GR0A 4R3VA 4XM7A 4HMAA 1KUGA 3EHYA 5I2ZA 830CA 3EDIA 3TSKA 4PKQA 3DSLA 1UMTA 2OVXA 1SU3A 5I4OA 4JP4A 3G5CA 4PKRA 1CIZA 1SLNA 1UEAA 1SATA 1O0TA 1GE5A 4JPAA 2AYKA 1JAQA 2O36A 2MLSA 1PWUA 1D7XA 1Z3JA 1ZP5A 3G42A 2OW1A 2OW2A 4A3WA 1IACA 1KAPP 3LJTA 2W15A 1DMTA 4IUWA 3LEAA 3LQ0A 4H30A 2WO9A 3KECA 3O64A 3UVCA 3HBUP 1H71P 1YP1A 4G9LA 2OXWA 1JIWP 2V4BA 3LIRA 3SHIA 1CGLA 4H2EA 1C8TA 1I73A 3KMCA 4I35A 2HU6A 1SRPA 1A85A 2DW0A 5D3CA 1UTTA 2FV5A 5L79A 1R1IA 3VTGA 3LIKA 2OY2A 1BKCE 2CLTA 2WO8A 2E3XA 2OW9A 3B2ZA 2MZHA 3EWJA 3GBOA 4A7BA 1QIBA 2OW0A 2USNA 1BUDA 1CGEA 3DNGA 1IABA 1G05A 3DWBA 2TCLA 1DTHA 1R1JA 5D1SA 3K7NA 5JMYA 1XFZA 2YB9A 1G12A 1GE7A 3MA2A 3DPFA 3HY9A 1HV5A 2JT6A 2OXUA 1JIZA 1AF0A 1EUBA 2D1OA 4L19A 1OM6A 3LKAA 4H76A 2DW2A 1BZSA 1CGFA 5H8XA 3LJZA 1JKYA 5I3MA 1OO9A 2DDFA 3BA0A 3WV1A 2N8RA 5B5OA 1GE6A 3KRYA 3L0TA 1RMZA 2CKIA 1SMPA 4PKUA 1BQQM 5I43A 1AYKA 2J83A 4ON1A 1B8YA
chains in the Genus database with same CATH superfamily
3I7IA 3WV3A 2W0DA 4GQLA 3DPEA 4IN9A 2X7MA 1QJJA 1IAEA 4IJOA 2O3EA 4JA1A 1QUAA 4J4MA 3V96B 1XFVA 3F18A 1GO7P 2FV9A 2DDYA 4FXYP 1R1HA 1UTZA 2AIGP 3OHLA 1YQYA 3AIGA 1USNA 4PKSA 456CA 2Z2DA 2A8HA 4JIJA 4WF6A 1GKDA 1XURA 2XS3A 3K7LA 3HY7A 4L63A 1MMPA 2OY4A 1CK7A 4L6TA 1OZ9A 1ZXCA 1BSWA 3F17A 3Q2HA 1MMRA 4QKZA 1ASTA 2L0RA 3B8ZA 4DPEA 3RTTA 3O2XA 1Y8JA 3KEKA 2Y6CA 1O0QA 1G49A 1BM6A 1HY7A 1TVIA 2JIHA 1S4BP 5I12A 4L7AA 3L0VA 1Y93A 2K9CA 1HTDA 2ERPA 2YIGA 1XFYA 2X3AA 3TT4A 2RJQA 1IAGA 1G4KA 1J7NA 3LQBA 2JSDA 1HFCA 3RTSA 1B3DA 4PKTA 3ZXHA 1QIAA 4DF9A 2OZRA 3LGPA 2YUFA 3TS4A 5CXAA 1XUCA 1AKLA 4FVLA 1KUHA 1CQRA 2W12A 2D1NA 1ZS0A 4AUOA 2W13A 4FXQA 1JH1A 1G9KA 4GF1A 4WK7A 3F1AA 2J0TA 3LJGA 2POJA 4H82A 3WV2A 1GKCA 3I7GA 3P24A 3LUMA 2MZIA 5BOYA 2RJPA 1MMQA 3F19A 1WNIA 1XUDA 1GO8P 4GWMA 1I76A 4H49A 4WZVA 4H84A 1L6JA 5D1TA 1PWWA 5D7WA 5LABA 3USNA 1OM8A 3EDGA 1Q3AA 4JQGA 1BKCA 3KMEA 3E8RA 4WKIA 1PWVA 3EDHA 4GR3A 3KHIA 3LMCA 1JAPA 1D8MA 1PWPA 3LK8A 1FM1A 1XM5A 3ZUKA 3Q2GA 1JANA 2WOAA 2W14A 1Y0VA 5CZMA 3P1VA 4ILWD 2PJTA 1PWQA 1CAQA 1C7KA 3KWVC 3N2UA 1OS9A 2K2GA 3HYGA 1HFSA 2E2DA 3LE9A 5BOTA 3HDBA 2KRJA 4FU4A 1YCMA 1OM7A 1JK3A 1SLMA 1K7QA 3AYKA 1QICA 3ZVSA 4HX3A 1OS2A 4XM6A 5L7FA 4PKWA 4ZR5A 3HB2P 5D2BA 2JT5A 1K7IA 2XS4A 2EROA 1EAKA 1KUKA 3DTKA 5CUHA 1FBLA 1KBCA 1XFXA 4GWNA 1ZVXA 4H3XA 1BKCI 1RM8A 4XCTA 3AYUA 5BPAA 5B5PA 1XFUA 3TVCA 1FLSA 2OVZA 3HBVP 3CKIA 2QPJA 2MZEA 4XBHA 1XFWA 1KUIA 1XAXA 1ATLA 1YOUA 4GR8A 966CA 1K7GA 3ELMA 1GXDA 1MMBA 3F15A 3EHXA 1OMJA 2DW1A 1EB6A 1UMSA 4DV8A 2ERQA 1ROSA 4EFSA 5D1UA 1I1IP 2I47A 4H1QA 1ZXVA 4AYKA 1C3IA 3B92A 2MLRA 2SRTA 1D5JA 3DL1A 1R55A 3N2VA 4AIGA 4Q1LA 1QJIA 4DD8A 1KUFA 3EDZA 2JNPA 1ZTQA 4I03A 3OHOA 3LILA 1BIWA 4AXQA 3KEJA 4PKVA 3LUNA 1IADA 1BQOA 1D8FA 1JJ9A 3NX7A 1CXVA 4WKEA 1JAOA 4XM8A 1R54A 4CTHA 2X3BA 1A86A 1IAAA 3HDAP 2OI0A 1BUVM 2OXZA 2Y6DA 1ND1A 4G0DA 1HOVA 5I0LA 3VI1A 3F16A 1MNCA 2X3CA 4GUYA 3U1RA 4GR0A 4R3VA 4XM7A 4HMAA 1KUGA 3EHYA 5I2ZA 830CA 3EDIA 3TSKA 4PKQA 3DSLA 1UMTA 2OVXA 1SU3A 5I4OA 4JP4A 3G5CA 4PKRA 1CIZA 1SLNA 1UEAA 1SATA 1O0TA 1GE5A 4JPAA 2AYKA 1JAQA 2O36A 3DTEA 2MLSA 1PWUA 1D7XA 1Z3JA 1ZP5A 3G42A 2OW1A 2OW2A 4A3WA 1IACA 1KAPP 2W15A 3LJTA 1DMTA 4IUWA 3LEAA 3LQ0A 4H30A 2WO9A 3KECA 3O64A 3UVCA 3HBUP 1H71P 1YP1A 4G9LA 2OXWA 1JIWP 2V4BA 3LIRA 3SHIA 1CGLA 4H2EA 1C8TA 1I73A 3KMCA 4I35A 2HU6A 1SRPA 1A85A 2DW0A 5D3CA 1UTTA 2FV5A 5L79A 1R1IA 3VTGA 3LIKA 2OY2A 1BKCE 2CLTA 2WO8A 2E3XA 3DTIA 2OW9A 3B2ZA 2MZHA 3EWJA 3GBOA 4A7BA 1QIBA 2OW0A 2USNA 1BUDA 1CGEA 3DNGA 1IABA 1G05A 3DWBA 2TCLA 1DTHA 1R1JA 5D1SA 3K7NA 5JMYA 1XFZA 2YB9A 1G12A 1GE7A 3MA2A 3DPFA 3HY9A 1HV5A 2JT6A 2OXUA 1JIZA 1AF0A 1EUBA 2D1OA 4L19A 1OM6A 3LKAA 4H76A 2DW2A 1BZSA 1CGFA 5H8XA 3LJZA 1JKYA 5I3MA 1OO9A 2DDFA 3BA0A 3WV1A 2N8RA 5B5OA 1GE6A 3KRYA 3L0TA 1RMZA 2CKIA 1SMPA 4PKUA 1BQQM 5I43A 1AYKA 2J83A 4ON1A 1B8YA
chains in the Genus database with same CATH topology
3I7IA 3WV3A 2W0DA 4GQLA 3DPEA 4IN9A 2X7MA 1QJJA 1IAEA 4IJOA 2O3EA 4JA1A 1QUAA 4J4MA 3V96B 1XFVA 3F18A 1GO7P 2FV9A 2DDYA 4FXYP 1R1HA 1UTZA 2AIGP 3OHLA 1YQYA 3AIGA 1USNA 4PKSA 456CA 2Z2DA 2A8HA 4JIJA 4WF6A 1GKDA 1XURA 2XS3A 3K7LA 3HY7A 4L63A 1MMPA 2OY4A 1CK7A 4L6TA 1ZXCA 1BSWA 3F17A 3Q2HA 1MMRA 4QKZA 1ASTA 2L0RA 3B8ZA 4DPEA 3RTTA 3O2XA 1Y8JA 3KEKA 2Y6CA 1O0QA 1G49A 1BM6A 1HY7A 2JIHA 1S4BP 5I12A 4L7AA 3L0VA 1Y93A 2K9CA 1HTDA 2ERPA 2YIGA 1XFYA 2X3AA 3TT4A 2RJQA 1IAGA 1G4KA 1J7NA 3LQBA 2JSDA 1HFCA 3RTSA 1B3DA 4PKTA 3ZXHA 1QIAA 4DF9A 2OZRA 3LGPA 2YUFA 3TS4A 5CXAA 1XUCA 1AKLA 4FVLA 1KUHA 1CQRA 2W12A 2D1NA 1ZS0A 4AUOA 2W13A 4FXQA 1JH1A 1G9KA 4GF1A 4WK7A 3F1AA 2J0TA 3LJGA 2POJA 4H82A 3WV2A 1GKCA 3I7GA 3P24A 3LUMA 2MZIA 5BOYA 2RJPA 1MMQA 3F19A 1WNIA 1XUDA 1GO8P 4GWMA 1I76A 4H49A 4WZVA 4H84A 1L6JA 5D1TA 1PWWA 5D7WA 5LABA 3USNA 1OM8A 3EDGA 1Q3AA 4JQGA 1BKCA 3KMEA 3E8RA 4WKIA 1PWVA 3EDHA 4GR3A 3KHIA 3LMCA 1JAPA 1D8MA 1PWPA 3LK8A 1FM1A 3ZUKA 3Q2GA 1JANA 2WOAA 2W14A 1Y0VA 5CZMA 3P1VA 4ILWD 2PJTA 1PWQA 1CAQA 1C7KA 3KWVC 3N2UA 1OS9A 2K2GA 3HYGA 1HFSA 2E2DA 3LE9A 5BOTA 3HDBA 2KRJA 4FU4A 1YCMA 1OM7A 1JK3A 1SLMA 1K7QA 3AYKA 1QICA 3ZVSA 4HX3A 1OS2A 4XM6A 5L7FA 4PKWA 4ZR5A 3HB2P 5D2BA 2JT5A 1K7IA 2XS4A 2EROA 1EAKA 1KUKA 3DTKA 5CUHA 1FBLA 1KBCA 1XFXA 4GWNA 1ZVXA 4H3XA 1BKCI 1RM8A 4XCTA 3AYUA 5BPAA 5B5PA 1XFUA 3TVCA 1FLSA 2OVZA 3HBVP 3CKIA 2QPJA 2MZEA 4XBHA 1XFWA 1KUIA 1ATLA 1YOUA 4GR8A 966CA 1K7GA 3ELMA 1GXDA 1MMBA 3F15A 3EHXA 1OMJA 2DW1A 1EB6A 1UMSA 4DV8A 2ERQA 1ROSA 4EFSA 5D1UA 1I1IP 2I47A 4H1QA 1ZXVA 4AYKA 1C3IA 3B92A 2MLRA 2SRTA 1D5JA 3DL1A 1R55A 3N2VA 4AIGA 4Q1LA 1QJIA 4DD8A 1KUFA 3EDZA 2JNPA 1ZTQA 4I03A 3OHOA 3LILA 1BIWA 4AXQA 3KEJA 4PKVA 3LUNA 1IADA 1BQOA 1D8FA 1JJ9A 3NX7A 1CXVA 4WKEA 1JAOA 4XM8A 1R54A 4CTHA 2X3BA 1A86A 1IAAA 3HDAP 2OI0A 1BUVM 2OXZA 2Y6DA 1ND1A 4G0DA 1HOVA 5I0LA 3VI1A 3F16A 1MNCA 2X3CA 4GUYA 3U1RA 4GR0A 4R3VA 4XM7A 4HMAA 1KUGA 3EHYA 5I2ZA 830CA 3EDIA 3TSKA 4PKQA 3DSLA 1UMTA 2OVXA 1SU3A 5I4OA 4JP4A 3G5CA 4PKRA 1CIZA 1SLNA 1UEAA 1SATA 1O0TA 1GE5A 4JPAA 2AYKA 1JAQA 2O36A 3DTEA 2MLSA 1PWUA 1D7XA 1Z3JA 1ZP5A 3G42A 2OW1A 2OW2A 4A3WA 1IACA 1KAPP 2W15A 3LJTA 1DMTA 4IUWA 3LEAA 3LQ0A 4H30A 2WO9A 3KECA 3O64A 3UVCA 3HBUP 1H71P 1YP1A 4G9LA 2OXWA 1JIWP 2V4BA 3LIRA 3SHIA 1CGLA 4H2EA 1C8TA 1I73A 3KMCA 4I35A 2HU6A 1SRPA 1A85A 2DW0A 5D3CA 1UTTA 2FV5A 5L79A 1R1IA 3VTGA 3LIKA 2OY2A 1BKCE 2CLTA 2WO8A 2E3XA 3DTIA 2OW9A 3B2ZA 2MZHA 3EWJA 3GBOA 4A7BA 1QIBA 2OW0A 2USNA 1BUDA 1CGEA 3DNGA 1IABA 1G05A 3DWBA 2TCLA 1DTHA 1R1JA 5D1SA 3K7NA 5JMYA 1XFZA 2YB9A 1G12A 1GE7A 3MA2A 3DPFA 3HY9A 1HV5A 2JT6A 2OXUA 1JIZA 1AF0A 1EUBA 2D1OA 4L19A 1OM6A 3LKAA 4H76A 2DW2A 1BZSA 1CGFA 5H8XA 3LJZA 1JKYA 5I3MA 1OO9A 2DDFA 3BA0A 3WV1A 2N8RA 5B5OA 1GE6A 3KRYA 3L0TA 1RMZA 2CKIA 1SMPA 4PKUA 1BQQM 5I43A 1AYKA 2J83A 4ON1A 1B8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7I A;  3WV3 A;  2W0D A;  4GQL A;  3DPE A;  4IN9 A;  2X7M A;  1QJJ A;  1IAE A;  4IJO A;  2O3E A;  4JA1 A;  1QUA A;  4J4M A;  3V96 B;  1XFV A;  3F18 A;  1GO7 P;  2FV9 A;  2DDY A;  4FXY P;  1R1H A;  1UTZ A;  2AIG P;  3OHL A;  1YQY A;  3AIG A;  1USN A;  4PKS A;  456C A;  2Z2D A;  2A8H A;  4JIJ A;  4WF6 A;  1GKD A;  1XUR A;  2XS3 A;  3K7L A;  3HY7 A;  4L63 A;  1MMP A;  2OY4 A;  1CK7 A;  4L6T A;  1ZXC A;  1BSW A;  3F17 A;  3Q2H A;  1MMR A;  4QKZ A;  1AST A;  2L0R A;  3B8Z A;  4DPE A;  3RTT A;  3O2X A;  1Y8J A;  3KEK A;  2Y6C A;  1O0Q A;  1G49 A;  1BM6 A;  1HY7 A;  2JIH A;  1S4B P;  5I12 A;  3L0V A;  1Y93 A;  2K9C A;  1HTD A;  2ERP A;  2YIG A;  1XFY A;  2X3A A;  3TT4 A;  2RJQ A;  1IAG A;  1G4K A;  1J7N A;  3LQB A;  2JSD A;  1HFC A;  3RTS A;  1B3D A;  4PKT A;  3ZXH A;  1QIA A;  4DF9 A;  2OZR A;  3LGP A;  3TS4 A;  5CXA A;  1XUC A;  1AKL A;  4FVL A;  1KUH A;  1CQR A;  2W12 A;  2D1N A;  1ZS0 A;  4AUO A;  2W13 A;  4FXQ A;  1JH1 A;  1G9K A;  4GF1 A;  4WK7 A;  3F1A A;  2J0T A;  3LJG A;  2POJ A;  4H82 A;  3WV2 A;  1GKC A;  3I7G A;  3P24 A;  3LUM A;  2MZI A;  5BOY A;  2RJP A;  1MMQ A;  3F19 A;  1WNI A;  1XUD A;  1GO8 P;  4GWM A;  1I76 A;  4H49 A;  4WZV A;  4H84 A;  1L6J A;  5D1T A;  1PWW A;  5D7W A;  5LAB A;  3USN A;  1OM8 A;  3EDG A;  1Q3A A;  4JQG A;  1BKC A;  3KME A;  3E8R A;  4WKI A;  1PWV A;  3EDH A;  4GR3 A;  3KHI A;  3LMC A;  1JAP A;  1D8M A;  1PWP A;  3LK8 A;  1FM1 A;  3ZUK A;  3Q2G A;  1JAN A;  2WOA A;  2W14 A;  1Y0V A;  5CZM A;  3P1V A;  4ILW D;  2PJT A;  1PWQ A;  1CAQ A;  1C7K A;  3KWV C;  3N2U A;  1OS9 A;  2K2G A;  3HYG A;  1HFS A;  2E2D A;  3LE9 A;  5BOT A;  3HDB A;  2KRJ A;  4FU4 A;  1YCM A;  1OM7 A;  1JK3 A;  1SLM A;  1K7Q A;  3AYK A;  1QIC A;  3ZVS A;  4HX3 A;  1OS2 A;  4XM6 A;  5L7F A;  4PKW A;  4ZR5 A;  3HB2 P;  5D2B A;  2JT5 A;  1K7I A;  2XS4 A;  2ERO A;  1EAK A;  1KUK A;  5CUH A;  1FBL A;  1KBC A;  1XFX A;  4GWN A;  1ZVX A;  4H3X A;  1BKC I;  1RM8 A;  4XCT A;  3AYU A;  5BPA A;  5B5P A;  1XFU A;  3TVC A;  1FLS A;  2OVZ A;  3HBV P;  3CKI A;  2QPJ A;  2MZE A;  4XBH A;  1XFW A;  1KUI A;  1ATL A;  1YOU A;  4GR8 A;  966C A;  1K7G A;  3ELM A;  1GXD A;  1MMB A;  3F15 A;  3EHX A;  1OMJ A;  2DW1 A;  1EB6 A;  1UMS A;  4DV8 A;  2ERQ A;  1ROS A;  4EFS A;  5D1U A;  1I1I P;  2I47 A;  4H1Q A;  1ZXV A;  4AYK A;  1C3I A;  3B92 A;  2MLR A;  2SRT A;  1D5J A;  3DL1 A;  1R55 A;  3N2V A;  4AIG A;  4Q1L A;  1QJI A;  4DD8 A;  1KUF A;  3EDZ A;  2JNP A;  1ZTQ A;  4I03 A;  3OHO A;  3LIL A;  1BIW A;  4AXQ A;  3KEJ A;  4PKV A;  3LUN A;  1IAD A;  1BQO A;  1D8F A;  1JJ9 A;  3NX7 A;  1CXV A;  4WKE A;  1JAO A;  4XM8 A;  1R54 A;  4CTH A;  2X3B A;  1A86 A;  1IAA A;  3HDA P;  2OI0 A;  1BUV M;  2OXZ A;  2Y6D A;  1ND1 A;  4G0D A;  1HOV A;  5I0L A;  3VI1 A;  3F16 A;  1MNC A;  2X3C A;  4GUY A;  3U1R A;  4GR0 A;  4R3V A;  4XM7 A;  4HMA A;  1KUG A;  3EHY A;  5I2Z A;  830C A;  3EDI A;  3TSK A;  4PKQ A;  3DSL A;  1UMT A;  2OVX A;  1SU3 A;  5I4O A;  4JP4 A;  3G5C A;  4PKR A;  1CIZ A;  1SLN A;  1UEA A;  1SAT A;  1O0T A;  1GE5 A;  4JPA A;  2AYK A;  1JAQ A;  2O36 A;  2MLS A;  1PWU A;  1D7X A;  1Z3J A;  1ZP5 A;  3G42 A;  2OW1 A;  2OW2 A;  4A3W A;  1IAC A;  1KAP P;  3LJT A;  2W15 A;  1DMT A;  4IUW A;  3LEA A;  3LQ0 A;  4H30 A;  2WO9 A;  3KEC A;  3O64 A;  3UVC A;  3HBU P;  1H71 P;  1YP1 A;  4G9L A;  2OXW A;  1JIW P;  2V4B A;  3LIR A;  3SHI A;  1CGL A;  4H2E A;  1C8T A;  1I73 A;  3KMC A;  4I35 A;  2HU6 A;  1SRP A;  1A85 A;  2DW0 A;  5D3C A;  1UTT A;  2FV5 A;  5L79 A;  1R1I A;  3VTG A;  3LIK A;  2OY2 A;  1BKC E;  2CLT A;  2WO8 A;  2E3X A;  2OW9 A;  3B2Z A;  2MZH A;  3EWJ A;  3GBO A;  4A7B A;  1QIB A;  2OW0 A;  2USN A;  1BUD A;  1CGE A;  3DNG A;  1IAB A;  1G05 A;  3DWB A;  2TCL A;  1DTH A;  1R1J A;  5D1S A;  3K7N A;  5JMY A;  1XFZ A;  2YB9 A;  1G12 A;  1GE7 A;  3MA2 A;  3DPF A;  3HY9 A;  1HV5 A;  2JT6 A;  2OXU A;  1JIZ A;  1AF0 A;  1EUB A;  2D1O A;  4L19 A;  1OM6 A;  3LKA A;  4H76 A;  2DW2 A;  1BZS A;  1CGF A;  5H8X A;  3LJZ A;  1JKY A;  5I3M A;  1OO9 A;  2DDF A;  3BA0 A;  3WV1 A;  2N8R A;  5B5O A;  1GE6 A;  3KRY A;  3L0T A;  1RMZ A;  2CKI A;  1SMP A;  4PKU A;  1BQQ M;  5I43 A;  1AYK A;  2J83 A;  4ON1 A;  1B8Y A; 
#chains in the Genus database with same CATH topology
 3I7I A;  3WV3 A;  2W0D A;  4GQL A;  3DPE A;  4IN9 A;  2X7M A;  1QJJ A;  1IAE A;  4IJO A;  2O3E A;  4JA1 A;  1QUA A;  4J4M A;  3V96 B;  1XFV A;  3F18 A;  1GO7 P;  2FV9 A;  2DDY A;  4FXY P;  1R1H A;  1UTZ A;  2AIG P;  3OHL A;  1YQY A;  3AIG A;  1USN A;  4PKS A;  456C A;  2Z2D A;  2A8H A;  4JIJ A;  4WF6 A;  1GKD A;  1XUR A;  2XS3 A;  3K7L A;  3HY7 A;  4L63 A;  1MMP A;  2OY4 A;  1CK7 A;  4L6T A;  1OZ9 A;  1ZXC A;  1BSW A;  3F17 A;  3Q2H A;  1MMR A;  4QKZ A;  1AST A;  2L0R A;  3B8Z A;  4DPE A;  3RTT A;  3O2X A;  1Y8J A;  3KEK A;  2Y6C A;  1O0Q A;  1G49 A;  1BM6 A;  1HY7 A;  1TVI A;  2JIH A;  1S4B P;  5I12 A;  4L7A A;  3L0V A;  1Y93 A;  2K9C A;  1HTD A;  2ERP A;  2YIG A;  1XFY A;  2X3A A;  3TT4 A;  2RJQ A;  1IAG A;  1G4K A;  1J7N A;  3LQB A;  2JSD A;  1HFC A;  3RTS A;  1B3D A;  4PKT A;  3ZXH A;  1QIA A;  4DF9 A;  2OZR A;  3LGP A;  2YUF A;  3TS4 A;  5CXA A;  1XUC A;  1AKL A;  4FVL A;  1KUH A;  1CQR A;  2W12 A;  2D1N A;  1ZS0 A;  4AUO A;  2W13 A;  4FXQ A;  1JH1 A;  1G9K A;  4GF1 A;  4WK7 A;  3F1A A;  2J0T A;  3LJG A;  2POJ A;  4H82 A;  3WV2 A;  1GKC A;  3I7G A;  3P24 A;  3LUM A;  2MZI A;  5BOY A;  2RJP A;  1MMQ A;  3F19 A;  1WNI A;  1XUD A;  1GO8 P;  4GWM A;  1I76 A;  4H49 A;  4WZV A;  4H84 A;  1L6J A;  5D1T A;  1PWW A;  5D7W A;  5LAB A;  3USN A;  1OM8 A;  3EDG A;  1Q3A A;  4JQG A;  1BKC A;  3KME A;  3E8R A;  4WKI A;  1PWV A;  3EDH A;  4GR3 A;  3KHI A;  3LMC A;  1JAP A;  1D8M A;  1PWP A;  3LK8 A;  1FM1 A;  1XM5 A;  3ZUK A;  3Q2G A;  1JAN A;  2WOA A;  2W14 A;  1Y0V A;  5CZM A;  3P1V A;  4ILW D;  2PJT A;  1PWQ A;  1CAQ A;  1C7K A;  3KWV C;  3N2U A;  1OS9 A;  2K2G A;  3HYG A;  1HFS A;  2E2D A;  3LE9 A;  5BOT A;  3HDB A;  2KRJ A;  4FU4 A;  1YCM A;  1OM7 A;  1JK3 A;  1SLM A;  1K7Q A;  3AYK A;  1QIC A;  3ZVS A;  4HX3 A;  1OS2 A;  4XM6 A;  5L7F A;  4PKW A;  4ZR5 A;  3HB2 P;  5D2B A;  2JT5 A;  1K7I A;  2XS4 A;  2ERO A;  1EAK A;  1KUK A;  3DTK A;  5CUH A;  1FBL A;  1KBC A;  1XFX A;  4GWN A;  1ZVX A;  4H3X A;  1BKC I;  1RM8 A;  4XCT A;  3AYU A;  5BPA A;  5B5P A;  1XFU A;  3TVC A;  1FLS A;  2OVZ A;  3HBV P;  3CKI A;  2QPJ A;  2MZE A;  4XBH A;  1XFW A;  1KUI A;  1XAX A;  1ATL A;  1YOU A;  4GR8 A;  966C A;  1K7G A;  3ELM A;  1GXD A;  1MMB A;  3F15 A;  3EHX A;  1OMJ A;  2DW1 A;  1EB6 A;  1UMS A;  4DV8 A;  2ERQ A;  1ROS A;  4EFS A;  5D1U A;  1I1I P;  2I47 A;  4H1Q A;  1ZXV A;  4AYK A;  1C3I A;  3B92 A;  2MLR A;  2SRT A;  1D5J A;  3DL1 A;  1R55 A;  3N2V A;  4AIG A;  4Q1L A;  1QJI A;  4DD8 A;  1KUF A;  3EDZ A;  2JNP A;  1ZTQ A;  4I03 A;  3OHO A;  3LIL A;  1BIW A;  4AXQ A;  3KEJ A;  4PKV A;  3LUN A;  1IAD A;  1BQO A;  1D8F A;  1JJ9 A;  3NX7 A;  1CXV A;  4WKE A;  1JAO A;  4XM8 A;  1R54 A;  4CTH A;  2X3B A;  1A86 A;  1IAA A;  3HDA P;  2OI0 A;  1BUV M;  2OXZ A;  2Y6D A;  1ND1 A;  4G0D A;  1HOV A;  5I0L A;  3VI1 A;  3F16 A;  1MNC A;  2X3C A;  4GUY A;  3U1R A;  4GR0 A;  4R3V A;  4XM7 A;  4HMA A;  1KUG A;  3EHY A;  5I2Z A;  830C A;  3EDI A;  3TSK A;  4PKQ A;  3DSL A;  1UMT A;  2OVX A;  1SU3 A;  5I4O A;  4JP4 A;  3G5C A;  4PKR A;  1CIZ A;  1SLN A;  1UEA A;  1SAT A;  1O0T A;  1GE5 A;  4JPA A;  2AYK A;  1JAQ A;  2O36 A;  3DTE A;  2MLS A;  1PWU A;  1D7X A;  1Z3J A;  1ZP5 A;  3G42 A;  2OW1 A;  2OW2 A;  4A3W A;  1IAC A;  1KAP P;  2W15 A;  3LJT A;  1DMT A;  4IUW A;  3LEA A;  3LQ0 A;  4H30 A;  2WO9 A;  3KEC A;  3O64 A;  3UVC A;  3HBU P;  1H71 P;  1YP1 A;  4G9L A;  2OXW A;  1JIW P;  2V4B A;  3LIR A;  3SHI A;  1CGL A;  4H2E A;  1C8T A;  1I73 A;  3KMC A;  4I35 A;  2HU6 A;  1SRP A;  1A85 A;  2DW0 A;  5D3C A;  1UTT A;  2FV5 A;  5L79 A;  1R1I A;  3VTG A;  3LIK A;  2OY2 A;  1BKC E;  2CLT A;  2WO8 A;  2E3X A;  3DTI A;  2OW9 A;  3B2Z A;  2MZH A;  3EWJ A;  3GBO A;  4A7B A;  1QIB A;  2OW0 A;  2USN A;  1BUD A;  1CGE A;  3DNG A;  1IAB A;  1G05 A;  3DWB A;  2TCL A;  1DTH A;  1R1J A;  5D1S A;  3K7N A;  5JMY A;  1XFZ A;  2YB9 A;  1G12 A;  1GE7 A;  3MA2 A;  3DPF A;  3HY9 A;  1HV5 A;  2JT6 A;  2OXU A;  1JIZ A;  1AF0 A;  1EUB A;  2D1O A;  4L19 A;  1OM6 A;  3LKA A;  4H76 A;  2DW2 A;  1BZS A;  1CGF A;  5H8X A;  3LJZ A;  1JKY A;  5I3M A;  1OO9 A;  2DDF A;  3BA0 A;  3WV1 A;  2N8R A;  5B5O A;  1GE6 A;  3KRY A;  3L0T A;  1RMZ A;  2CKI A;  1SMP A;  4PKU A;  1BQQ M;  5I43 A;  1AYK A;  2J83 A;  4ON1 A;  1B8Y A; 
#chains in the Genus database with same CATH homology
 3I7I A;  3WV3 A;  2W0D A;  4GQL A;  3DPE A;  4IN9 A;  2X7M A;  1QJJ A;  1IAE A;  4IJO A;  2O3E A;  4JA1 A;  1QUA A;  4J4M A;  3V96 B;  1XFV A;  3F18 A;  1GO7 P;  2FV9 A;  2DDY A;  4FXY P;  1R1H A;  1UTZ A;  2AIG P;  3OHL A;  1YQY A;  3AIG A;  1USN A;  4PKS A;  456C A;  2Z2D A;  2A8H A;  4JIJ A;  4WF6 A;  1GKD A;  1XUR A;  2XS3 A;  3K7L A;  3HY7 A;  4L63 A;  1MMP A;  2OY4 A;  1CK7 A;  4L6T A;  1ZXC A;  1BSW A;  3F17 A;  3Q2H A;  1MMR A;  4QKZ A;  1AST A;  2L0R A;  3B8Z A;  4DPE A;  3RTT A;  3O2X A;  1Y8J A;  3KEK A;  2Y6C A;  1O0Q A;  1G49 A;  1BM6 A;  1HY7 A;  2JIH A;  1S4B P;  5I12 A;  4L7A A;  3L0V A;  1Y93 A;  2K9C A;  1HTD A;  2ERP A;  2YIG A;  1XFY A;  2X3A A;  3TT4 A;  2RJQ A;  1IAG A;  1G4K A;  1J7N A;  3LQB A;  2JSD A;  1HFC A;  3RTS A;  1B3D A;  4PKT A;  3ZXH A;  1QIA A;  4DF9 A;  2OZR A;  3LGP A;  2YUF A;  3TS4 A;  5CXA A;  1XUC A;  1AKL A;  4FVL A;  1KUH A;  1CQR A;  2W12 A;  2D1N A;  1ZS0 A;  4AUO A;  2W13 A;  4FXQ A;  1JH1 A;  1G9K A;  4GF1 A;  4WK7 A;  3F1A A;  2J0T A;  3LJG A;  2POJ A;  4H82 A;  3WV2 A;  1GKC A;  3I7G A;  3P24 A;  3LUM A;  2MZI A;  5BOY A;  2RJP A;  1MMQ A;  3F19 A;  1WNI A;  1XUD A;  1GO8 P;  4GWM A;  1I76 A;  4H49 A;  4WZV A;  4H84 A;  1L6J A;  5D1T A;  1PWW A;  5D7W A;  5LAB A;  3USN A;  1OM8 A;  3EDG A;  1Q3A A;  4JQG A;  1BKC A;  3KME A;  3E8R A;  4WKI A;  1PWV A;  3EDH A;  4GR3 A;  3KHI A;  3LMC A;  1JAP A;  1D8M A;  1PWP A;  3LK8 A;  1FM1 A;  3ZUK A;  3Q2G A;  1JAN A;  2WOA A;  2W14 A;  1Y0V A;  5CZM A;  3P1V A;  4ILW D;  2PJT A;  1PWQ A;  1CAQ A;  1C7K A;  3KWV C;  3N2U A;  1OS9 A;  2K2G A;  3HYG A;  1HFS A;  2E2D A;  3LE9 A;  5BOT A;  3HDB A;  2KRJ A;  4FU4 A;  1YCM A;  1OM7 A;  1JK3 A;  1SLM A;  1K7Q A;  3AYK A;  1QIC A;  3ZVS A;  4HX3 A;  1OS2 A;  4XM6 A;  5L7F A;  4PKW A;  4ZR5 A;  3HB2 P;  5D2B A;  2JT5 A;  1K7I A;  2XS4 A;  2ERO A;  1EAK A;  1KUK A;  3DTK A;  5CUH A;  1FBL A;  1KBC A;  1XFX A;  4GWN A;  1ZVX A;  4H3X A;  1BKC I;  1RM8 A;  4XCT A;  3AYU A;  5BPA A;  5B5P A;  1XFU A;  3TVC A;  1FLS A;  2OVZ A;  3HBV P;  3CKI A;  2QPJ A;  2MZE A;  4XBH A;  1XFW A;  1KUI A;  1ATL A;  1YOU A;  4GR8 A;  966C A;  1K7G A;  3ELM A;  1GXD A;  1MMB A;  3F15 A;  3EHX A;  1OMJ A;  2DW1 A;  1EB6 A;  1UMS A;  4DV8 A;  2ERQ A;  1ROS A;  4EFS A;  5D1U A;  1I1I P;  2I47 A;  4H1Q A;  1ZXV A;  4AYK A;  1C3I A;  3B92 A;  2MLR A;  2SRT A;  1D5J A;  3DL1 A;  1R55 A;  3N2V A;  4AIG A;  4Q1L A;  1QJI A;  4DD8 A;  1KUF A;  3EDZ A;  2JNP A;  1ZTQ A;  4I03 A;  3OHO A;  3LIL A;  1BIW A;  4AXQ A;  3KEJ A;  4PKV A;  3LUN A;  1IAD A;  1BQO A;  1D8F A;  1JJ9 A;  3NX7 A;  1CXV A;  4WKE A;  1JAO A;  4XM8 A;  1R54 A;  4CTH A;  2X3B A;  1A86 A;  1IAA A;  3HDA P;  2OI0 A;  1BUV M;  2OXZ A;  2Y6D A;  1ND1 A;  4G0D A;  1HOV A;  5I0L A;  3VI1 A;  3F16 A;  1MNC A;  2X3C A;  4GUY A;  3U1R A;  4GR0 A;  4R3V A;  4XM7 A;  4HMA A;  1KUG A;  3EHY A;  5I2Z A;  830C A;  3EDI A;  3TSK A;  4PKQ A;  3DSL A;  1UMT A;  2OVX A;  1SU3 A;  5I4O A;  4JP4 A;  3G5C A;  4PKR A;  1CIZ A;  1SLN A;  1UEA A;  1SAT A;  1O0T A;  1GE5 A;  4JPA A;  2AYK A;  1JAQ A;  2O36 A;  3DTE A;  2MLS A;  1PWU A;  1D7X A;  1Z3J A;  1ZP5 A;  3G42 A;  2OW1 A;  2OW2 A;  4A3W A;  1IAC A;  1KAP P;  2W15 A;  3LJT A;  1DMT A;  4IUW A;  3LEA A;  3LQ0 A;  4H30 A;  2WO9 A;  3KEC A;  3O64 A;  3UVC A;  3HBU P;  1H71 P;  1YP1 A;  4G9L A;  2OXW A;  1JIW P;  2V4B A;  3LIR A;  3SHI A;  1CGL A;  4H2E A;  1C8T A;  1I73 A;  3KMC A;  4I35 A;  2HU6 A;  1SRP A;  1A85 A;  2DW0 A;  5D3C A;  1UTT A;  2FV5 A;  5L79 A;  1R1I A;  3VTG A;  3LIK A;  2OY2 A;  1BKC E;  2CLT A;  2WO8 A;  2E3X A;  3DTI A;  2OW9 A;  3B2Z A;  2MZH A;  3EWJ A;  3GBO A;  4A7B A;  1QIB A;  2OW0 A;  2USN A;  1BUD A;  1CGE A;  3DNG A;  1IAB A;  1G05 A;  3DWB A;  2TCL A;  1DTH A;  1R1J A;  5D1S A;  3K7N A;  5JMY A;  1XFZ A;  2YB9 A;  1G12 A;  1GE7 A;  3MA2 A;  3DPF A;  3HY9 A;  1HV5 A;  2JT6 A;  2OXU A;  1JIZ A;  1AF0 A;  1EUB A;  2D1O A;  4L19 A;  1OM6 A;  3LKA A;  4H76 A;  2DW2 A;  1BZS A;  1CGF A;  5H8X A;  3LJZ A;  1JKY A;  5I3M A;  1OO9 A;  2DDF A;  3BA0 A;  3WV1 A;  2N8R A;  5B5O A;  1GE6 A;  3KRY A;  3L0T A;  1RMZ A;  2CKI A;  1SMP A;  4PKU A;  1BQQ M;  5I43 A;  1AYK A;  2J83 A;  4ON1 A;  1B8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...