3TT6A

Structure of clpp from bacillus subtilis in compressed state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
173
structure length
162
Chain Sequence
IYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the conformational diversity of ClpP from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 58
structure length 162
sequence length 173
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3tt6A00
3TZ3A 2ZQQA 4FZWC 4OLQA 5DTWA 2J5IB 4ELWA 3PEAA 2VSSF 3GF3A 3H0UA 4WYOB 2PPYA 3BPPA 4Q1IA 2VSUA 5INGA 3HE2A 4ZDBA 4LK5A 4FZWA 1SG4A 2EJ5A 3GF7A 3T88A 2J5IA 1WDKA 3QREA 2X24A 2UZFA 2F9YB 3T89A 4U18A 4JWVA 4JCQA 1PIXA 4HNKA 3TDCA 3TVUA 1FC7A 3PZKA 5FUSA 3LKEA 1RJMA 4OG1A 1XO6A 4DI1A 1XX4A 5DUFA 1YG8A 3RSIA 2J5SA 4OMRA 4FN8A 2ZL4A 1UYSA 2NP9A 3FF6A 1UYRA 2BZRA 2A81A 4JYJA 2J5GA 1HNUA 3GMAA 4ELSA 3U9RB 3N6RB 3ZWCA 3H81A 2VSUE 4IZBA 4FNDA 1UYTA 2VSSE 3TRRA 2QQ3A 5KDRA 4Q0GA 4JOTA 2VSUF 4FB8A 2Q2XA 1O8UA 3KTKA 3HINA 1EF8A 3NJBA 4F47A 3LAOA 1RJNA 1TYFA 3QXZA 3MOYA 4FJWD 3T8BA 5DKPA 3P85A 4WZ8B 3QK8A 2VREA 3Q1TA 1K39A 3Q0GA 4HC8A 2A7KA 2F9IA 1W2XA 3QWDA 1EY3A 1SZOA 3TT6A 3TV5A 3R9SA 2W3PA 3PE8A 3MT6A 3KQFA 3JU1A 5FIFA 1HNOA 2ZL3A 1N6FA 1JXZA 3ZW8A 4Z0MA 3IAVA 1XNWA 2F6QA 3DJAA 3HP0A 4L8KA 1N6EA 1N6DA 1PJHA 4JYLA 2F9IB 2ZL0A 4U0GA 2ZL2A 5DZKH 4EMMA 1TG6A 3K8XA 4JFCA 4L6WA 4EMPA 3TVWA 1K32A 4ZDFA 3SLLA 4K2NA 1WDLA 2VSSA 3KTHA 3BEZA 3QKAA 3SWXA 4G2RA 4JVTA 5DL1A 3M6MA 4U0GH 4JSBA 5G1QA 1DCIA 4ZDDA 3K50A 3TLFA 2PBPA 1UYVA 5E0SA 1X0UA 3STAA 5INIA 5DZKA 1VRGA 2ZQRA 3H0QA 3ST9A 2Q35A 2FZSA 4JCSA 3FDUA 3NJDA 3H02A 3ZWAA 1ON3A 4KD6A 5DTPA 3KTJA 5MGBA 2DEOA 2F9YA 3KTIA 1NZYB 4ZDEA 4JCRA 4NNQA 4IZDA 4WCZA 5DU4A 4IZCA 1J7XA 3G64A 4JCTA 5C9GA 4NEKA 3MYBA 3QXIA 4MI2A 1FC6A 3I47A 1OD4A 3T3WA 1DUBA 1Q51A 3HRXA 3HLN1 3T8AA 2FBMA 3U9SB 3V5IA 1FC9A 3OT6A 4B3HA 3P5MA 2DUBA 3BF0A 4GHNA 5CTBA 1ON9A 3H0SA 3ZW9A 4FNBA 3DORA 4K29A 2HW5A 3Q0JA 1MJ3A 4I42A 4ZU2A 5G1RA 3QYRA 2C8TA 4FN7A 3R0OA 4KWBA 4MOUA 3H0JA 4RCNA 2GTRA 3MFMA 3WG5A 1Q52A 4QIIA 3QMJA 4U0HA 4QIJA 5G1SA 2D3TA 1UIYA 1EF9A 4RYFA 5JBWA 3VIVA 2CBYA 4I4ZA 3R6HA 4B3IA 1OD2A 5INFA 1WDMA 2A7SA 4QFEA 4ZDCA 1Y7OA 1NZYA 5DU8A 3OC7A 4EMLA 3IB9A 4JJTA 4KPKA 2PG8A 5IKLB 4K3WA 3OMEA 3ISAA 3PGQA 1HZDA 5JBXA 5KJPA 5C90A 4GM2A 4RYFH 4I52A 3V5EA 3P2LA 2WTBA 3M6NA 3R9TA 5CTCA 4ASIA 5DU6A 2J5GD 2J5II 3TT7A 1FCFA 2IEXA 3U9TB 3IBBA 5KDRB 5DUCA 3KTGA 3GKBA 4U19A 3RRVA 4YLHA 1XNVA 2CE3A 3Q7HA 3R9QA 2VX2A 5E0NX 4U1AA 4B3JA 4ELXA 4KNPA 3L3SA 1WZ8A 4MXIA 2FW2A 5E0SH 2X58A 1YG6A 1XNYA 2Q34A 2F6IA 3GLMA 2VSUC 3ZWBA 3RSTA
chains in the Genus database with same CATH superfamily
3TZ3A 2ZQQA 4FZWC 4OLQA 5DTWA 2J5IB 4ELWA 3PEAA 2VSSF 3GF3A 3H0UA 4WYOB 2PPYA 3BPPA 4Q1IA 2VSUA 5INGA 3HE2A 4ZDBA 4LK5A 4FZWA 1SG4A 2EJ5A 3GF7A 3T88A 2J5IA 1WDKA 3QREA 2X24A 2UZFA 2F9YB 3T89A 4NARA 4U18A 4JWVA 4JCQA 1PIXA 4HNKA 3TDCA 3TVUA 1FC7A 3PZKA 5FUSA 3LKEA 1RJMA 4OG1A 1XO6A 4DI1A 1XX4A 5DUFA 1YG8A 3RSIA 2J5SA 4OMRA 4FN8A 2ZL4A 1UYSA 2NP9A 3FF6A 4HDTA 1UYRA 2BZRA 2A81A 4JYJA 2J5GA 1HNUA 3GMAA 4ELSA 3U9RB 3N6RB 3ZWCA 3H81A 2VSUE 4IZBA 4FNDA 1UYTA 2VSSE 3TRRA 2QQ3A 5KDRA 4Q0GA 4JOTA 2VSUF 4FB8A 2Q2XA 1O8UA 3KTKA 3HINA 1EF8A 3NJBA 4F47A 3LAOA 1RJNA 1TYFA 3QXZA 3MOYA 4FJWD 3T8BA 5DKPA 3P85A 4WZ8B 3QK8A 2VREA 3Q1TA 1K39A 3Q0GA 4HC8A 2A7KA 2F9IA 1W2XA 3QWDA 1EY3A 1SZOA 3TT6A 3TV5A 3R9SA 2W3PA 3PE8A 3MT6A 3KQFA 3JU1A 5FIFA 1HNOA 2ZL3A 1N6FA 1JXZA 3ZW8A 4Z0MA 3IAVA 1XNWA 2F6QA 3DJAA 3HP0A 4L8KA 1N6EA 1N6DA 1PJHA 4JYLA 2F9IB 2ZL0A 4U0GA 2ZL2A 5DZKH 4EMMA 1TG6A 3BPTA 3K8XA 4JFCA 2YJGA 4L6WA 4EMPA 3TVWA 1K32A 4J2UA 4ZDFA 3SLLA 4K2NA 1WDLA 2VSSA 3KTHA 3BEZA 3QKAA 3SWXA 4G2RA 4JVTA 5DL1A 3M6MA 4U0GH 4JSBA 5G1QA 1DCIA 4ZDDA 3K50A 3TLFA 2PBPA 1UYVA 5E0SA 1X0UA 3STAA 5INIA 5DZKA 1VRGA 2ZQRA 3H0QA 3ST9A 2Q35A 2FZSA 4JCSA 3FDUA 3NJDA 3H02A 3ZWAA 1ON3A 4KD6A 5DTPA 3KTJA 5MGBA 2DEOA 2F9YA 3KTIA 1NZYB 4ZDEA 4JCRA 4NNQA 4IZDA 4WCZA 5DU4A 4IZCA 1J7XA 3G64A 4JCTA 5C9GA 4NEKA 3MYBA 3QXIA 4MI2A 1FC6A 3I47A 1OD4A 3T3WA 1DUBA 1Q51A 3HRXA 3HLN1 3T8AA 2FBMA 3U9SB 3V5IA 1FC9A 3OT6A 4B3HA 3P5MA 2DUBA 3BF0A 4GHNA 5CTBA 1ON9A 3H0SA 3ZW9A 4FNBA 3DORA 4K29A 2HW5A 3Q0JA 1MJ3A 4I42A 4ZU2A 5G1RA 3QYRA 2C8TA 4FN7A 3R0OA 4KWBA 4MOUA 3H0JA 4RCNA 2GTRA 3MFMA 3WG5A 1Q52A 4QIIA 3QMJA 4U0HA 4QIJA 5G1SA 2D3TA 1UIYA 1EF9A 4RYFA 5JBWA 3VIVA 2CBYA 4I4ZA 3R6HA 4B3IA 1OD2A 5INFA 1WDMA 2A7SA 4QFEA 4ZDCA 1Y7OA 1NZYA 5DU8A 3OC7A 4EMLA 3IB9A 4JJTA 4KPKA 2PG8A 5IKLB 4K3WA 3OMEA 3ISAA 3PGQA 1HZDA 5JBXA 5KJPA 5C90A 4GM2A 4RYFH 4I52A 3V5EA 3P2LA 2WTBA 3M6NA 3R9TA 5CTCA 4ASIA 5DU6A 2J5GD 2J5II 3TT7A 1FCFA 2IEXA 3U9TB 3IBBA 5KDRB 5DUCA 3KTGA 5HUQA 3GKBA 4U19A 3RRVA 4YLHA 1XNVA 2CE3A 3Q7HA 3R9QA 2VX2A 5E0NX 4U1AA 4B3JA 4ELXA 4KNPA 3L3SA 1WZ8A 4MXIA 2FW2A 5E0SH 2X58A 1YG6A 1XNYA 2Q34A 2F6IA 3GLMA 2VSUC 3ZWBA 3RSTA
chains in the Genus database with same CATH topology
3TZ3A 2ZQQA 4FZWC 4OLQA 5DTWA 2J5IB 4ELWA 3PEAA 2VSSF 3GF3A 3H0UA 4WYOB 2PPYA 3BPPA 4Q1IA 2VSUA 5INGA 3HE2A 4ZDBA 4LK5A 4FZWA 1SG4A 2EJ5A 3GF7A 3T88A 2J5IA 1WDKA 3QREA 2X24A 2UZFA 2F9YB 3T89A 4NARA 4U18A 4JWVA 4JCQA 1PIXA 4HNKA 3TDCA 3TVUA 1FC7A 3PZKA 5FUSA 3LKEA 1RJMA 4OG1A 1XO6A 4DI1A 1XX4A 5DUFA 1YG8A 3RSIA 2J5SA 4OMRA 4FN8A 2ZL4A 1UYSA 2NP9A 3FF6A 4HDTA 1UYRA 2BZRA 2A81A 4JYJA 2J5GA 1HNUA 3GMAA 4ELSA 3U9RB 3N6RB 3ZWCA 3H81A 2VSUE 4IZBA 4FNDA 1UYTA 2VSSE 3TRRA 2QQ3A 5KDRA 4Q0GA 4JOTA 2VSUF 4FB8A 2Q2XA 1O8UA 3KTKA 3HINA 1EF8A 3NJBA 4F47A 3LAOA 1RJNA 1TYFA 3QXZA 3MOYA 4FJWD 3T8BA 5DKPA 3P85A 4WZ8B 3QK8A 2VREA 3Q1TA 1K39A 3Q0GA 4HC8A 2A7KA 2F9IA 1W2XA 3QWDA 1EY3A 1SZOA 3TT6A 3TV5A 3R9SA 2W3PA 3PE8A 3MT6A 3KQFA 3JU1A 5FIFA 1HNOA 2ZL3A 1N6FA 1JXZA 3ZW8A 4Z0MA 3IAVA 1XNWA 2F6QA 3DJAA 3HP0A 4L8KA 1N6EA 1N6DA 1PJHA 4JYLA 2F9IB 2ZL0A 4U0GA 2ZL2A 5DZKH 4EMMA 1TG6A 3BPTA 3K8XA 4JFCA 2YJGA 4L6WA 4EMPA 3TVWA 1K32A 4J2UA 4ZDFA 3SLLA 4K2NA 1WDLA 2VSSA 3KTHA 3BEZA 3QKAA 3SWXA 4G2RA 4JVTA 5DL1A 3M6MA 4U0GH 4JSBA 5G1QA 1DCIA 4ZDDA 3K50A 3TLFA 2PBPA 1UYVA 5E0SA 1X0UA 3STAA 5INIA 5DZKA 1VRGA 2ZQRA 3H0QA 3ST9A 2Q35A 2FZSA 4JCSA 3FDUA 3NJDA 3H02A 3ZWAA 1ON3A 4KD6A 5DTPA 3KTJA 5MGBA 2DEOA 2F9YA 3KTIA 1NZYB 4ZDEA 4JCRA 4NNQA 4IZDA 4WCZA 5DU4A 4IZCA 1J7XA 3G64A 4JCTA 5C9GA 4NEKA 3MYBA 3QXIA 4MI2A 1FC6A 3I47A 1OD4A 3T3WA 1DUBA 1Q51A 3HRXA 3HLN1 3T8AA 2FBMA 3U9SB 3V5IA 1FC9A 3OT6A 4B3HA 3P5MA 2DUBA 3BF0A 4GHNA 5CTBA 1ON9A 3H0SA 3ZW9A 4FNBA 3DORA 4K29A 2HW5A 3Q0JA 1MJ3A 4I42A 4ZU2A 5G1RA 3QYRA 2C8TA 4FN7A 3R0OA 4KWBA 4MOUA 3H0JA 4RCNA 2GTRA 3MFMA 3WG5A 1Q52A 4QIIA 3QMJA 4U0HA 4QIJA 5G1SA 2D3TA 1UIYA 1EF9A 4RYFA 5JBWA 3VIVA 2CBYA 4I4ZA 3R6HA 4B3IA 1OD2A 5INFA 1WDMA 2A7SA 4QFEA 4ZDCA 1Y7OA 1NZYA 5DU8A 3OC7A 4EMLA 3IB9A 4JJTA 4KPKA 2PG8A 5IKLB 4K3WA 3OMEA 3ISAA 3PGQA 1HZDA 5JBXA 5KJPA 5C90A 4GM2A 4RYFH 4I52A 3V5EA 3P2LA 2WTBA 3M6NA 3R9TA 5CTCA 4ASIA 5DU6A 2J5GD 2J5II 3TT7A 1FCFA 2IEXA 3U9TB 3IBBA 5KDRB 5DUCA 3KTGA 5HUQA 3GKBA 4U19A 3RRVA 4YLHA 1XNVA 2CE3A 3Q7HA 3R9QA 2VX2A 5E0NX 4U1AA 4B3JA 4ELXA 4KNPA 3L3SA 1WZ8A 4MXIA 2FW2A 5E0SH 2X58A 1YG6A 1XNYA 2Q34A 2F6IA 3GLMA 2VSUC 3ZWBA 3RSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZ3 A;  2ZQQ A;  4FZW C;  4OLQ A;  5DTW A;  2J5I B;  4ELW A;  3PEA A;  2VSS F;  3GF3 A;  3H0U A;  4WYO B;  2PPY A;  3BPP A;  4Q1I A;  2VSU A;  5ING A;  3HE2 A;  4ZDB A;  4LK5 A;  4FZW A;  1SG4 A;  2EJ5 A;  3GF7 A;  3T88 A;  2J5I A;  1WDK A;  3QRE A;  2X24 A;  2UZF A;  2F9Y B;  3T89 A;  4U18 A;  4JWV A;  4JCQ A;  1PIX A;  4HNK A;  3TDC A;  3TVU A;  1FC7 A;  3PZK A;  5FUS A;  3LKE A;  1RJM A;  4OG1 A;  1XO6 A;  4DI1 A;  1XX4 A;  5DUF A;  1YG8 A;  3RSI A;  2J5S A;  4OMR A;  4FN8 A;  2ZL4 A;  1UYS A;  2NP9 A;  3FF6 A;  1UYR A;  2BZR A;  2A81 A;  4JYJ A;  2J5G A;  1HNU A;  3GMA A;  4ELS A;  3U9R B;  3N6R B;  3ZWC A;  3H81 A;  2VSU E;  4IZB A;  4FND A;  1UYT A;  2VSS E;  3TRR A;  2QQ3 A;  5KDR A;  4Q0G A;  4JOT A;  2VSU F;  4FB8 A;  2Q2X A;  1O8U A;  3KTK A;  3HIN A;  1EF8 A;  3NJB A;  4F47 A;  3LAO A;  1RJN A;  1TYF A;  3QXZ A;  3MOY A;  4FJW D;  3T8B A;  5DKP A;  3P85 A;  4WZ8 B;  3QK8 A;  2VRE A;  3Q1T A;  1K39 A;  3Q0G A;  4HC8 A;  2A7K A;  2F9I A;  1W2X A;  3QWD A;  1EY3 A;  1SZO A;  3TT6 A;  3TV5 A;  3R9S A;  2W3P A;  3PE8 A;  3MT6 A;  3KQF A;  3JU1 A;  5FIF A;  1HNO A;  2ZL3 A;  1N6F A;  1JXZ A;  3ZW8 A;  4Z0M A;  3IAV A;  1XNW A;  2F6Q A;  3DJA A;  3HP0 A;  4L8K A;  1N6E A;  1N6D A;  1PJH A;  4JYL A;  2F9I B;  2ZL0 A;  4U0G A;  2ZL2 A;  5DZK H;  4EMM A;  1TG6 A;  3K8X A;  4JFC A;  4L6W A;  4EMP A;  3TVW A;  1K32 A;  4ZDF A;  3SLL A;  4K2N A;  1WDL A;  2VSS A;  3KTH A;  3BEZ A;  3QKA A;  3SWX A;  4G2R A;  4JVT A;  5DL1 A;  3M6M A;  4U0G H;  4JSB A;  5G1Q A;  1DCI A;  4ZDD A;  3K50 A;  3TLF A;  2PBP A;  1UYV A;  5E0S A;  1X0U A;  3STA A;  5INI A;  5DZK A;  1VRG A;  2ZQR A;  3H0Q A;  3ST9 A;  2Q35 A;  2FZS A;  4JCS A;  3FDU A;  3NJD A;  3H02 A;  3ZWA A;  1ON3 A;  4KD6 A;  5DTP A;  3KTJ A;  5MGB A;  2DEO A;  2F9Y A;  3KTI A;  1NZY B;  4ZDE A;  4JCR A;  4NNQ A;  4IZD A;  4WCZ A;  5DU4 A;  4IZC A;  1J7X A;  3G64 A;  4JCT A;  5C9G A;  4NEK A;  3MYB A;  3QXI A;  4MI2 A;  1FC6 A;  3I47 A;  1OD4 A;  3T3W A;  1DUB A;  1Q51 A;  3HRX A;  3HLN 1;  3T8A A;  2FBM A;  3U9S B;  3V5I A;  1FC9 A;  3OT6 A;  4B3H A;  3P5M A;  2DUB A;  3BF0 A;  4GHN A;  5CTB A;  1ON9 A;  3H0S A;  3ZW9 A;  4FNB A;  3DOR A;  4K29 A;  2HW5 A;  3Q0J A;  1MJ3 A;  4I42 A;  4ZU2 A;  5G1R A;  3QYR A;  2C8T A;  4FN7 A;  3R0O A;  4KWB A;  4MOU A;  3H0J A;  4RCN A;  2GTR A;  3MFM A;  3WG5 A;  1Q52 A;  4QII A;  3QMJ A;  4U0H A;  4QIJ A;  5G1S A;  2D3T A;  1UIY A;  1EF9 A;  4RYF A;  5JBW A;  3VIV A;  2CBY A;  4I4Z A;  3R6H A;  4B3I A;  1OD2 A;  5INF A;  1WDM A;  2A7S A;  4QFE A;  4ZDC A;  1Y7O A;  1NZY A;  5DU8 A;  3OC7 A;  4EML A;  3IB9 A;  4JJT A;  4KPK A;  2PG8 A;  5IKL B;  4K3W A;  3OME A;  3ISA A;  3PGQ A;  1HZD A;  5JBX A;  5KJP A;  5C90 A;  4GM2 A;  4RYF H;  4I52 A;  3V5E A;  3P2L A;  2WTB A;  3M6N A;  3R9T A;  5CTC A;  4ASI A;  5DU6 A;  2J5G D;  2J5I I;  3TT7 A;  1FCF A;  2IEX A;  3U9T B;  3IBB A;  5KDR B;  5DUC A;  3KTG A;  3GKB A;  4U19 A;  3RRV A;  4YLH A;  1XNV A;  2CE3 A;  3Q7H A;  3R9Q A;  2VX2 A;  5E0N X;  4U1A A;  4B3J A;  4ELX A;  4KNP A;  3L3S A;  1WZ8 A;  4MXI A;  2FW2 A;  5E0S H;  2X58 A;  1YG6 A;  1XNY A;  2Q34 A;  2F6I A;  3GLM A;  2VSU C;  3ZWB A;  3RST A; 
#chains in the Genus database with same CATH topology
 3TZ3 A;  2ZQQ A;  4FZW C;  4OLQ A;  5DTW A;  2J5I B;  4ELW A;  3PEA A;  2VSS F;  3GF3 A;  3H0U A;  4WYO B;  2PPY A;  3BPP A;  4Q1I A;  2VSU A;  5ING A;  3HE2 A;  4ZDB A;  4LK5 A;  4FZW A;  1SG4 A;  2EJ5 A;  3GF7 A;  3T88 A;  2J5I A;  1WDK A;  3QRE A;  2X24 A;  2UZF A;  2F9Y B;  3T89 A;  4NAR A;  4U18 A;  4JWV A;  4JCQ A;  1PIX A;  4HNK A;  3TDC A;  3TVU A;  1FC7 A;  3PZK A;  5FUS A;  3LKE A;  1RJM A;  4OG1 A;  1XO6 A;  4DI1 A;  1XX4 A;  5DUF A;  1YG8 A;  3RSI A;  2J5S A;  4OMR A;  4FN8 A;  2ZL4 A;  1UYS A;  2NP9 A;  3FF6 A;  4HDT A;  1UYR A;  2BZR A;  2A81 A;  4JYJ A;  2J5G A;  1HNU A;  3GMA A;  4ELS A;  3U9R B;  3N6R B;  3ZWC A;  3H81 A;  2VSU E;  4IZB A;  4FND A;  1UYT A;  2VSS E;  3TRR A;  2QQ3 A;  5KDR A;  4Q0G A;  4JOT A;  2VSU F;  4FB8 A;  2Q2X A;  1O8U A;  3KTK A;  3HIN A;  1EF8 A;  3NJB A;  4F47 A;  3LAO A;  1RJN A;  1TYF A;  3QXZ A;  3MOY A;  4FJW D;  3T8B A;  5DKP A;  3P85 A;  4WZ8 B;  3QK8 A;  2VRE A;  3Q1T A;  1K39 A;  3Q0G A;  4HC8 A;  2A7K A;  2F9I A;  1W2X A;  3QWD A;  1EY3 A;  1SZO A;  3TT6 A;  3TV5 A;  3R9S A;  2W3P A;  3PE8 A;  3MT6 A;  3KQF A;  3JU1 A;  5FIF A;  1HNO A;  2ZL3 A;  1N6F A;  1JXZ A;  3ZW8 A;  4Z0M A;  3IAV A;  1XNW A;  2F6Q A;  3DJA A;  3HP0 A;  4L8K A;  1N6E A;  1N6D A;  1PJH A;  4JYL A;  2F9I B;  2ZL0 A;  4U0G A;  2ZL2 A;  5DZK H;  4EMM A;  1TG6 A;  3BPT A;  3K8X A;  4JFC A;  2YJG A;  4L6W A;  4EMP A;  3TVW A;  1K32 A;  4J2U A;  4ZDF A;  3SLL A;  4K2N A;  1WDL A;  2VSS A;  3KTH A;  3BEZ A;  3QKA A;  3SWX A;  4G2R A;  4JVT A;  5DL1 A;  3M6M A;  4U0G H;  4JSB A;  5G1Q A;  1DCI A;  4ZDD A;  3K50 A;  3TLF A;  2PBP A;  1UYV A;  5E0S A;  1X0U A;  3STA A;  5INI A;  5DZK A;  1VRG A;  2ZQR A;  3H0Q A;  3ST9 A;  2Q35 A;  2FZS A;  4JCS A;  3FDU A;  3NJD A;  3H02 A;  3ZWA A;  1ON3 A;  4KD6 A;  5DTP A;  3KTJ A;  5MGB A;  2DEO A;  2F9Y A;  3KTI A;  1NZY B;  4ZDE A;  4JCR A;  4NNQ A;  4IZD A;  4WCZ A;  5DU4 A;  4IZC A;  1J7X A;  3G64 A;  4JCT A;  5C9G A;  4NEK A;  3MYB A;  3QXI A;  4MI2 A;  1FC6 A;  3I47 A;  1OD4 A;  3T3W A;  1DUB A;  1Q51 A;  3HRX A;  3HLN 1;  3T8A A;  2FBM A;  3U9S B;  3V5I A;  1FC9 A;  3OT6 A;  4B3H A;  3P5M A;  2DUB A;  3BF0 A;  4GHN A;  5CTB A;  1ON9 A;  3H0S A;  3ZW9 A;  4FNB A;  3DOR A;  4K29 A;  2HW5 A;  3Q0J A;  1MJ3 A;  4I42 A;  4ZU2 A;  5G1R A;  3QYR A;  2C8T A;  4FN7 A;  3R0O A;  4KWB A;  4MOU A;  3H0J A;  4RCN A;  2GTR A;  3MFM A;  3WG5 A;  1Q52 A;  4QII A;  3QMJ A;  4U0H A;  4QIJ A;  5G1S A;  2D3T A;  1UIY A;  1EF9 A;  4RYF A;  5JBW A;  3VIV A;  2CBY A;  4I4Z A;  3R6H A;  4B3I A;  1OD2 A;  5INF A;  1WDM A;  2A7S A;  4QFE A;  4ZDC A;  1Y7O A;  1NZY A;  5DU8 A;  3OC7 A;  4EML A;  3IB9 A;  4JJT A;  4KPK A;  2PG8 A;  5IKL B;  4K3W A;  3OME A;  3ISA A;  3PGQ A;  1HZD A;  5JBX A;  5KJP A;  5C90 A;  4GM2 A;  4RYF H;  4I52 A;  3V5E A;  3P2L A;  2WTB A;  3M6N A;  3R9T A;  5CTC A;  4ASI A;  5DU6 A;  2J5G D;  2J5I I;  3TT7 A;  1FCF A;  2IEX A;  3U9T B;  3IBB A;  5KDR B;  5DUC A;  3KTG A;  5HUQ A;  3GKB A;  4U19 A;  3RRV A;  4YLH A;  1XNV A;  2CE3 A;  3Q7H A;  3R9Q A;  2VX2 A;  5E0N X;  4U1A A;  4B3J A;  4ELX A;  4KNP A;  3L3S A;  1WZ8 A;  4MXI A;  2FW2 A;  5E0S H;  2X58 A;  1YG6 A;  1XNY A;  2Q34 A;  2F6I A;  3GLM A;  2VSU C;  3ZWB A;  3RST A; 
#chains in the Genus database with same CATH homology
 3TZ3 A;  2ZQQ A;  4FZW C;  4OLQ A;  5DTW A;  2J5I B;  4ELW A;  3PEA A;  2VSS F;  3GF3 A;  3H0U A;  4WYO B;  2PPY A;  3BPP A;  4Q1I A;  2VSU A;  5ING A;  3HE2 A;  4ZDB A;  4LK5 A;  4FZW A;  1SG4 A;  2EJ5 A;  3GF7 A;  3T88 A;  2J5I A;  1WDK A;  3QRE A;  2X24 A;  2UZF A;  2F9Y B;  3T89 A;  4NAR A;  4U18 A;  4JWV A;  4JCQ A;  1PIX A;  4HNK A;  3TDC A;  3TVU A;  1FC7 A;  3PZK A;  5FUS A;  3LKE A;  1RJM A;  4OG1 A;  1XO6 A;  4DI1 A;  1XX4 A;  5DUF A;  1YG8 A;  3RSI A;  2J5S A;  4OMR A;  4FN8 A;  2ZL4 A;  1UYS A;  2NP9 A;  3FF6 A;  4HDT A;  1UYR A;  2BZR A;  2A81 A;  4JYJ A;  2J5G A;  1HNU A;  3GMA A;  4ELS A;  3U9R B;  3N6R B;  3ZWC A;  3H81 A;  2VSU E;  4IZB A;  4FND A;  1UYT A;  2VSS E;  3TRR A;  2QQ3 A;  5KDR A;  4Q0G A;  4JOT A;  2VSU F;  4FB8 A;  2Q2X A;  1O8U A;  3KTK A;  3HIN A;  1EF8 A;  3NJB A;  4F47 A;  3LAO A;  1RJN A;  1TYF A;  3QXZ A;  3MOY A;  4FJW D;  3T8B A;  5DKP A;  3P85 A;  4WZ8 B;  3QK8 A;  2VRE A;  3Q1T A;  1K39 A;  3Q0G A;  4HC8 A;  2A7K A;  2F9I A;  1W2X A;  3QWD A;  1EY3 A;  1SZO A;  3TT6 A;  3TV5 A;  3R9S A;  2W3P A;  3PE8 A;  3MT6 A;  3KQF A;  3JU1 A;  5FIF A;  1HNO A;  2ZL3 A;  1N6F A;  1JXZ A;  3ZW8 A;  4Z0M A;  3IAV A;  1XNW A;  2F6Q A;  3DJA A;  3HP0 A;  4L8K A;  1N6E A;  1N6D A;  1PJH A;  4JYL A;  2F9I B;  2ZL0 A;  4U0G A;  2ZL2 A;  5DZK H;  4EMM A;  1TG6 A;  3BPT A;  3K8X A;  4JFC A;  2YJG A;  4L6W A;  4EMP A;  3TVW A;  1K32 A;  4J2U A;  4ZDF A;  3SLL A;  4K2N A;  1WDL A;  2VSS A;  3KTH A;  3BEZ A;  3QKA A;  3SWX A;  4G2R A;  4JVT A;  5DL1 A;  3M6M A;  4U0G H;  4JSB A;  5G1Q A;  1DCI A;  4ZDD A;  3K50 A;  3TLF A;  2PBP A;  1UYV A;  5E0S A;  1X0U A;  3STA A;  5INI A;  5DZK A;  1VRG A;  2ZQR A;  3H0Q A;  3ST9 A;  2Q35 A;  2FZS A;  4JCS A;  3FDU A;  3NJD A;  3H02 A;  3ZWA A;  1ON3 A;  4KD6 A;  5DTP A;  3KTJ A;  5MGB A;  2DEO A;  2F9Y A;  3KTI A;  1NZY B;  4ZDE A;  4JCR A;  4NNQ A;  4IZD A;  4WCZ A;  5DU4 A;  4IZC A;  1J7X A;  3G64 A;  4JCT A;  5C9G A;  4NEK A;  3MYB A;  3QXI A;  4MI2 A;  1FC6 A;  3I47 A;  1OD4 A;  3T3W A;  1DUB A;  1Q51 A;  3HRX A;  3HLN 1;  3T8A A;  2FBM A;  3U9S B;  3V5I A;  1FC9 A;  3OT6 A;  4B3H A;  3P5M A;  2DUB A;  3BF0 A;  4GHN A;  5CTB A;  1ON9 A;  3H0S A;  3ZW9 A;  4FNB A;  3DOR A;  4K29 A;  2HW5 A;  3Q0J A;  1MJ3 A;  4I42 A;  4ZU2 A;  5G1R A;  3QYR A;  2C8T A;  4FN7 A;  3R0O A;  4KWB A;  4MOU A;  3H0J A;  4RCN A;  2GTR A;  3MFM A;  3WG5 A;  1Q52 A;  4QII A;  3QMJ A;  4U0H A;  4QIJ A;  5G1S A;  2D3T A;  1UIY A;  1EF9 A;  4RYF A;  5JBW A;  3VIV A;  2CBY A;  4I4Z A;  3R6H A;  4B3I A;  1OD2 A;  5INF A;  1WDM A;  2A7S A;  4QFE A;  4ZDC A;  1Y7O A;  1NZY A;  5DU8 A;  3OC7 A;  4EML A;  3IB9 A;  4JJT A;  4KPK A;  2PG8 A;  5IKL B;  4K3W A;  3OME A;  3ISA A;  3PGQ A;  1HZD A;  5JBX A;  5KJP A;  5C90 A;  4GM2 A;  4RYF H;  4I52 A;  3V5E A;  3P2L A;  2WTB A;  3M6N A;  3R9T A;  5CTC A;  4ASI A;  5DU6 A;  2J5G D;  2J5I I;  3TT7 A;  1FCF A;  2IEX A;  3U9T B;  3IBB A;  5KDR B;  5DUC A;  3KTG A;  5HUQ A;  3GKB A;  4U19 A;  3RRV A;  4YLH A;  1XNV A;  2CE3 A;  3Q7H A;  3R9Q A;  2VX2 A;  5E0N X;  4U1A A;  4B3J A;  4ELX A;  4KNP A;  3L3S A;  1WZ8 A;  4MXI A;  2FW2 A;  5E0S H;  2X58 A;  1YG6 A;  1XNY A;  2Q34 A;  2F6I A;  3GLM A;  2VSU C;  3ZWB A;  3RST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...