3TT7A

Structure of clpp from bacillus subtilis in complex with dfp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
188
structure length
180
Chain Sequence
b'IPTVIAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structural insights into the conformational diversity of ClpP from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 65
structure length 180
sequence length 188
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3tt7A00
3GF7A 2W3PA 2F9IA 3R0OA 4YLHA 1HZDA 5DKPA 5INFA 3SLLA 4JVTA 1Y7OA 4B3JA 4OMRA 4JCRA 4U0GH 3WG5A 1EF9A 3R9TA 4JYLA 5DZKH 1XX4A 2QQ3A 3TV5A 4K29A 2WTBA 1RJNA 3STAA 3BPPA 3OMEA 3Q0JA 1OD4A 3R6HA 3N6RB 3DORA 4U0HA 3HRXA 4U19A 4HC8A 4MOUA 4Q1IA 3V5EA 2F6IA 3IAVA 4RYFA 3QWDA 1HNOA 2BZRA 4FB8A 3H0JA 4WCZA 3HP0A 5G1SA 3U9SB 4ZDCA 3H81A 4NEKA 3IBBA 4OG1A 2J5II 3BEZA 1XNWA 3QXZA 3T3WA 2IEXA 4RYFH 5G1QA 3FF6A 4FZWC 4I4ZA 3HLN1 3QKAA 1NZYB 1WDMA 2J5IB 3R9QA 5G1RA 3LKEA 2VSUE 4QIIA 1DCIA 1SZOA 4F47A 3NJBA 1TG6A 4MXIA 4KWBA 1FC7A 2J5SA 3H0SA 4JSBA 3VIVA 4IZCA 3GMAA 4WZ8B 4DI1A 4B3IA 5KJPA 2VSUF 1NZYA 2A7KA 4EMLA 2NP9A 2Q34A 4L6WA 1SG4A 4FNBA 3GKBA 1K32A 1Q51A 4K2NA 3KTHA 3QXIA 1WDLA 5E0SA 4G2RA 3G64A 1DUBA 3GLMA 1EF8A 4QFEA 3HINA 4JCTA 2VSUC 4WYOB 2ZL0A 3T8BA 5C90A 2FZSA 2X58A 1WZ8A 2UZFA 2J5GD 3BF0A 3TDCA 1RJMA 1ON3A 3TLFA 3PZKA 1WDKA 5E0SH 1MJ3A 4ZU2A 1FCFA 1UYSA 3U9RB 5JBWA 5C9GA 2A81A 2FBMA 2VSSE 4FZWA 1JXZA 2DEOA 1YG8A 3MT6A 1PIXA 4K3WA 2CE3A 1PJHA 3T88A 1Q52A 1YG6A 2VSSF 2ZL2A 3M6NA 3KTIA 3KTKA 3RSTA 3KTJA 4Q0GA 5CTBA 1FC6A 1X0UA 5INIA 3MOYA 3ISAA 2F9YB 3U9TB 1UIYA 1N6FA 3PEAA 3Q7HA 4JFCA 3I47A 3TRRA 4ZDBA 4MI2A 1XO6A 3RRVA 2Q2XA 2A7SA 2J5GA 1XNYA 4I52A 3KQFA 3R9SA 4KD6A 2C8TA 2VSUA 2F9YA 3Q0GA 2FW2A 4JWVA 1UYRA 5DTPA 2VX2A 4U18A 2CBYA 4HNKA 5DU4A 3V5IA 3QREA 1ON9A 3P5MA 1XNVA 4GHNA 3TVWA 4Z0MA 1N6EA 3ZWAA 3PGQA 3LAOA 4ELWA 5MGBA 3T8AA 1UYTA 1J7XA 3H02A 4L8KA 2PBPA 3PE8A 4NNQA 5JBXA 3KTGA 2HW5A 4JJTA 2F6QA 4LK5A 5DU8A 4EMMA 3ZWBA 5DUCA 4QIJA 3K50A 1FC9A 3ST9A 1VRGA 5FIFA 5KDRB 1OD2A 3GF3A 3RSIA 3TZ3A 2VSSA 4FJWD 2Q35A 3TT7A 2GTRA 3H0QA 3NJDA 4FN8A 1TYFA 3MFMA 2X24A 5KDRA 2D3TA 3QYRA 3ZWCA 5FUSA 3FDUA 3MYBA 3OT6A 4ZDFA 2DUBA 4JCSA 5INGA 3P85A 1HNUA 3SWXA 4GM2A 3QMJA 4KNPA 2PPYA 4KPKA 2ZQQA 3JU1A 4JYJA 3P2LA 4FNDA 4FN7A 3K8XA 2ZQRA 4B3HA 3HE2A 4IZBA 4RCNA 2VREA 3ZW9A 2PG8A 3Q1TA 4OLQA 5DL1A 3OC7A 3QK8A 4JOTA 4U1AA 3DJAA 3M6MA 2ZL4A 2ZL3A 3IB9A 3ZW8A 4ELSA 5CTCA 5DUFA 1EY3A 4I42A 1K39A 5DU6A 2F9IB 2EJ5A 4U0GA 1O8UA 3TT6A 1UYVA 3TVUA 1N6DA 5DZKA 4ASIA 3L3SA 4ZDEA 1W2XA 4EMPA 4ELXA 5E0NX 2J5IA 3T89A 3H0UA 4JCQA 5IKLB 4IZDA 4ZDDA 5DTWA
chains in the Genus database with same CATH superfamily
3GF7A 2W3PA 2F9IA 3R0OA 4YLHA 1HZDA 5DKPA 5INFA 3SLLA 4JVTA 1Y7OA 4B3JA 4OMRA 4JCRA 4U0GH 3WG5A 1EF9A 3R9TA 4JYLA 5DZKH 1XX4A 2QQ3A 3TV5A 4K29A 2WTBA 1RJNA 3STAA 3BPPA 3OMEA 3Q0JA 1OD4A 3R6HA 3N6RB 3DORA 4U0HA 3HRXA 4U19A 4HC8A 4MOUA 4Q1IA 3V5EA 2F6IA 3IAVA 4RYFA 3QWDA 1HNOA 2BZRA 4FB8A 3H0JA 4WCZA 3HP0A 5G1SA 3U9SB 4ZDCA 3H81A 4NEKA 3IBBA 4OG1A 2J5II 3BEZA 1XNWA 3QXZA 3T3WA 2IEXA 4RYFH 5G1QA 3FF6A 4FZWC 4I4ZA 3HLN1 3QKAA 1NZYB 1WDMA 2J5IB 3R9QA 5G1RA 3LKEA 2VSUE 4QIIA 1DCIA 1SZOA 4F47A 3NJBA 1TG6A 4HDTA 4MXIA 4KWBA 1FC7A 2J5SA 3H0SA 4JSBA 3VIVA 4IZCA 3GMAA 4WZ8B 4DI1A 4B3IA 5KJPA 2VSUF 1NZYA 2A7KA 4EMLA 2NP9A 2Q34A 4L6WA 1SG4A 4FNBA 3GKBA 1K32A 1Q51A 4K2NA 3KTHA 3QXIA 1WDLA 5E0SA 4G2RA 3G64A 1DUBA 3GLMA 1EF8A 4QFEA 3HINA 4JCTA 2VSUC 4WYOB 2ZL0A 3T8BA 5C90A 2FZSA 2X58A 1WZ8A 2UZFA 2J5GD 3BF0A 3TDCA 1RJMA 1ON3A 3TLFA 3PZKA 1WDKA 5E0SH 1MJ3A 4ZU2A 1FCFA 1UYSA 3U9RB 5JBWA 5C9GA 2A81A 2FBMA 2VSSE 4FZWA 1JXZA 2DEOA 1YG8A 3MT6A 1PIXA 4K3WA 2CE3A 1PJHA 3T88A 1Q52A 1YG6A 2VSSF 2ZL2A 3M6NA 3KTIA 3KTKA 3RSTA 3KTJA 4Q0GA 5CTBA 1FC6A 1X0UA 5INIA 3MOYA 3ISAA 4NARA 2F9YB 3U9TB 1UIYA 1N6FA 3PEAA 3Q7HA 4JFCA 3I47A 3TRRA 4ZDBA 4MI2A 1XO6A 3RRVA 2Q2XA 2A7SA 2J5GA 1XNYA 4I52A 3KQFA 3R9SA 4KD6A 2C8TA 2VSUA 2F9YA 3Q0GA 2FW2A 4JWVA 1UYRA 5DTPA 2VX2A 5HUQA 4U18A 2CBYA 2YJGA 4HNKA 5DU4A 3V5IA 3QREA 1ON9A 3P5MA 1XNVA 4GHNA 3TVWA 4Z0MA 1N6EA 3ZWAA 3PGQA 3LAOA 4ELWA 5MGBA 3T8AA 1UYTA 1J7XA 3H02A 4L8KA 2PBPA 3PE8A 4NNQA 5JBXA 3KTGA 2HW5A 4JJTA 2F6QA 4LK5A 5DU8A 4EMMA 3ZWBA 5DUCA 4QIJA 3K50A 1FC9A 3ST9A 1VRGA 5FIFA 5KDRB 1OD2A 3GF3A 3RSIA 3TZ3A 3BPTA 2VSSA 4FJWD 2Q35A 3TT7A 2GTRA 3H0QA 3NJDA 4FN8A 1TYFA 3MFMA 2X24A 5KDRA 2D3TA 3QYRA 3ZWCA 5FUSA 3FDUA 3MYBA 3OT6A 4ZDFA 2DUBA 4JCSA 5INGA 3P85A 1HNUA 3SWXA 4GM2A 3QMJA 4KNPA 2PPYA 4KPKA 2ZQQA 3JU1A 4JYJA 3P2LA 4FNDA 4FN7A 3K8XA 2ZQRA 4B3HA 3HE2A 4IZBA 4RCNA 2VREA 3ZW9A 2PG8A 3Q1TA 4OLQA 5DL1A 3OC7A 3QK8A 4JOTA 4U1AA 3DJAA 3M6MA 2ZL4A 2ZL3A 3IB9A 3ZW8A 4ELSA 5CTCA 5DUFA 1EY3A 4I42A 1K39A 5DU6A 2F9IB 2EJ5A 4U0GA 1O8UA 4J2UA 3TT6A 1UYVA 3TVUA 1N6DA 5DZKA 4ASIA 3L3SA 4ZDEA 1W2XA 4EMPA 4ELXA 5E0NX 2J5IA 3T89A 3H0UA 4JCQA 5IKLB 4IZDA 4ZDDA 5DTWA
chains in the Genus database with same CATH topology
3GF7A 2W3PA 2F9IA 3R0OA 4YLHA 1HZDA 5DKPA 5INFA 3SLLA 4JVTA 1Y7OA 4B3JA 4OMRA 4JCRA 4U0GH 3WG5A 1EF9A 3R9TA 4JYLA 5DZKH 1XX4A 2QQ3A 3TV5A 4K29A 2WTBA 1RJNA 3STAA 3BPPA 3OMEA 3Q0JA 1OD4A 3R6HA 3N6RB 3DORA 4U0HA 3HRXA 4U19A 4HC8A 4MOUA 4Q1IA 3V5EA 2F6IA 3IAVA 4RYFA 3QWDA 1HNOA 2BZRA 4FB8A 3H0JA 4WCZA 3HP0A 5G1SA 3U9SB 4ZDCA 3H81A 4NEKA 3IBBA 4OG1A 2J5II 3BEZA 1XNWA 3QXZA 3T3WA 2IEXA 4RYFH 5G1QA 3FF6A 4FZWC 4I4ZA 3HLN1 3QKAA 1NZYB 1WDMA 2J5IB 3R9QA 5G1RA 3LKEA 2VSUE 4QIIA 1DCIA 1SZOA 4F47A 3NJBA 1TG6A 4HDTA 4MXIA 4KWBA 1FC7A 2J5SA 3H0SA 4JSBA 3VIVA 4IZCA 3GMAA 4WZ8B 4DI1A 4B3IA 5KJPA 2VSUF 1NZYA 2A7KA 4EMLA 2NP9A 2Q34A 4L6WA 1SG4A 4FNBA 3GKBA 1K32A 1Q51A 4K2NA 3KTHA 3QXIA 1WDLA 5E0SA 4G2RA 3G64A 1DUBA 3GLMA 1EF8A 4QFEA 3HINA 4JCTA 2VSUC 4WYOB 2ZL0A 3T8BA 5C90A 2FZSA 2X58A 1WZ8A 2UZFA 2J5GD 3BF0A 3TDCA 1RJMA 1ON3A 3TLFA 3PZKA 1WDKA 5E0SH 1MJ3A 4ZU2A 1FCFA 1UYSA 3U9RB 5JBWA 5C9GA 2A81A 2FBMA 2VSSE 4FZWA 1JXZA 2DEOA 1YG8A 3MT6A 1PIXA 4K3WA 2CE3A 1PJHA 3T88A 1Q52A 1YG6A 2VSSF 2ZL2A 3M6NA 3KTIA 3KTKA 3RSTA 3KTJA 4Q0GA 5CTBA 1FC6A 1X0UA 5INIA 3MOYA 3ISAA 4NARA 2F9YB 3U9TB 1UIYA 1N6FA 3PEAA 3Q7HA 4JFCA 3I47A 3TRRA 4ZDBA 4MI2A 1XO6A 3RRVA 2Q2XA 2A7SA 2J5GA 1XNYA 4I52A 3KQFA 3R9SA 4KD6A 2C8TA 2VSUA 2F9YA 3Q0GA 2FW2A 4JWVA 1UYRA 5DTPA 2VX2A 5HUQA 4U18A 2CBYA 2YJGA 4HNKA 5DU4A 3V5IA 3QREA 1ON9A 3P5MA 1XNVA 4GHNA 3TVWA 4Z0MA 1N6EA 3ZWAA 3PGQA 3LAOA 4ELWA 5MGBA 3T8AA 1UYTA 1J7XA 3H02A 4L8KA 2PBPA 3PE8A 4NNQA 5JBXA 3KTGA 2HW5A 4JJTA 2F6QA 4LK5A 5DU8A 4EMMA 3ZWBA 5DUCA 4QIJA 3K50A 1FC9A 3ST9A 1VRGA 5FIFA 5KDRB 1OD2A 3GF3A 3RSIA 3TZ3A 3BPTA 2VSSA 4FJWD 2Q35A 3TT7A 2GTRA 3H0QA 3NJDA 4FN8A 1TYFA 3MFMA 2X24A 5KDRA 2D3TA 3QYRA 3ZWCA 5FUSA 3FDUA 3MYBA 3OT6A 4ZDFA 2DUBA 4JCSA 5INGA 3P85A 1HNUA 3SWXA 4GM2A 3QMJA 4KNPA 2PPYA 4KPKA 2ZQQA 3JU1A 4JYJA 3P2LA 4FNDA 4FN7A 3K8XA 2ZQRA 4B3HA 3HE2A 4IZBA 4RCNA 2VREA 3ZW9A 2PG8A 3Q1TA 4OLQA 5DL1A 3OC7A 3QK8A 4JOTA 4U1AA 3DJAA 3M6MA 2ZL4A 2ZL3A 3IB9A 3ZW8A 4ELSA 5CTCA 5DUFA 1EY3A 4I42A 1K39A 5DU6A 2F9IB 2EJ5A 4U0GA 1O8UA 4J2UA 3TT6A 1UYVA 3TVUA 1N6DA 5DZKA 4ASIA 3L3SA 4ZDEA 1W2XA 4EMPA 4ELXA 5E0NX 2J5IA 3T89A 3H0UA 4JCQA 5IKLB 4IZDA 4ZDDA 5DTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GF7 A;  2W3P A;  2F9I A;  3R0O A;  4YLH A;  1HZD A;  5DKP A;  5INF A;  3SLL A;  4JVT A;  1Y7O A;  4B3J A;  4OMR A;  4JCR A;  4U0G H;  3WG5 A;  1EF9 A;  3R9T A;  4JYL A;  5DZK H;  1XX4 A;  2QQ3 A;  3TV5 A;  4K29 A;  2WTB A;  1RJN A;  3STA A;  3BPP A;  3OME A;  3Q0J A;  1OD4 A;  3R6H A;  3N6R B;  3DOR A;  4U0H A;  3HRX A;  4U19 A;  4HC8 A;  4MOU A;  4Q1I A;  3V5E A;  2F6I A;  3IAV A;  4RYF A;  3QWD A;  1HNO A;  2BZR A;  4FB8 A;  3H0J A;  4WCZ A;  3HP0 A;  5G1S A;  3U9S B;  4ZDC A;  3H81 A;  4NEK A;  3IBB A;  4OG1 A;  2J5I I;  3BEZ A;  1XNW A;  3QXZ A;  3T3W A;  2IEX A;  4RYF H;  5G1Q A;  3FF6 A;  4FZW C;  4I4Z A;  3HLN 1;  3QKA A;  1NZY B;  1WDM A;  2J5I B;  3R9Q A;  5G1R A;  3LKE A;  2VSU E;  4QII A;  1DCI A;  1SZO A;  4F47 A;  3NJB A;  1TG6 A;  4MXI A;  4KWB A;  1FC7 A;  2J5S A;  3H0S A;  4JSB A;  3VIV A;  4IZC A;  3GMA A;  4WZ8 B;  4DI1 A;  4B3I A;  5KJP A;  2VSU F;  1NZY A;  2A7K A;  4EML A;  2NP9 A;  2Q34 A;  4L6W A;  1SG4 A;  4FNB A;  3GKB A;  1K32 A;  1Q51 A;  4K2N A;  3KTH A;  3QXI A;  1WDL A;  5E0S A;  4G2R A;  3G64 A;  1DUB A;  3GLM A;  1EF8 A;  4QFE A;  3HIN A;  4JCT A;  2VSU C;  4WYO B;  2ZL0 A;  3T8B A;  5C90 A;  2FZS A;  2X58 A;  1WZ8 A;  2UZF A;  2J5G D;  3BF0 A;  3TDC A;  1RJM A;  1ON3 A;  3TLF A;  3PZK A;  1WDK A;  5E0S H;  1MJ3 A;  4ZU2 A;  1FCF A;  1UYS A;  3U9R B;  5JBW A;  5C9G A;  2A81 A;  2FBM A;  2VSS E;  4FZW A;  1JXZ A;  2DEO A;  1YG8 A;  3MT6 A;  1PIX A;  4K3W A;  2CE3 A;  1PJH A;  3T88 A;  1Q52 A;  1YG6 A;  2VSS F;  2ZL2 A;  3M6N A;  3KTI A;  3KTK A;  3RST A;  3KTJ A;  4Q0G A;  5CTB A;  1FC6 A;  1X0U A;  5INI A;  3MOY A;  3ISA A;  2F9Y B;  3U9T B;  1UIY A;  1N6F A;  3PEA A;  3Q7H A;  4JFC A;  3I47 A;  3TRR A;  4ZDB A;  4MI2 A;  1XO6 A;  3RRV A;  2Q2X A;  2A7S A;  2J5G A;  1XNY A;  4I52 A;  3KQF A;  3R9S A;  4KD6 A;  2C8T A;  2VSU A;  2F9Y A;  3Q0G A;  2FW2 A;  4JWV A;  1UYR A;  5DTP A;  2VX2 A;  4U18 A;  2CBY A;  4HNK A;  5DU4 A;  3V5I A;  3QRE A;  1ON9 A;  3P5M A;  1XNV A;  4GHN A;  3TVW A;  4Z0M A;  1N6E A;  3ZWA A;  3PGQ A;  3LAO A;  4ELW A;  5MGB A;  3T8A A;  1UYT A;  1J7X A;  3H02 A;  4L8K A;  2PBP A;  3PE8 A;  4NNQ A;  5JBX A;  3KTG A;  2HW5 A;  4JJT A;  2F6Q A;  4LK5 A;  5DU8 A;  4EMM A;  3ZWB A;  5DUC A;  4QIJ A;  3K50 A;  1FC9 A;  3ST9 A;  1VRG A;  5FIF A;  5KDR B;  1OD2 A;  3GF3 A;  3RSI A;  3TZ3 A;  2VSS A;  4FJW D;  2Q35 A;  3TT7 A;  2GTR A;  3H0Q A;  3NJD A;  4FN8 A;  1TYF A;  3MFM A;  2X24 A;  5KDR A;  2D3T A;  3QYR A;  3ZWC A;  5FUS A;  3FDU A;  3MYB A;  3OT6 A;  4ZDF A;  2DUB A;  4JCS A;  5ING A;  3P85 A;  1HNU A;  3SWX A;  4GM2 A;  3QMJ A;  4KNP A;  2PPY A;  4KPK A;  2ZQQ A;  3JU1 A;  4JYJ A;  3P2L A;  4FND A;  4FN7 A;  3K8X A;  2ZQR A;  4B3H A;  3HE2 A;  4IZB A;  4RCN A;  2VRE A;  3ZW9 A;  2PG8 A;  3Q1T A;  4OLQ A;  5DL1 A;  3OC7 A;  3QK8 A;  4JOT A;  4U1A A;  3DJA A;  3M6M A;  2ZL4 A;  2ZL3 A;  3IB9 A;  3ZW8 A;  4ELS A;  5CTC A;  5DUF A;  1EY3 A;  4I42 A;  1K39 A;  5DU6 A;  2F9I B;  2EJ5 A;  4U0G A;  1O8U A;  3TT6 A;  1UYV A;  3TVU A;  1N6D A;  5DZK A;  4ASI A;  3L3S A;  4ZDE A;  1W2X A;  4EMP A;  4ELX A;  5E0N X;  2J5I A;  3T89 A;  3H0U A;  4JCQ A;  5IKL B;  4IZD A;  4ZDD A;  5DTW A; 
#chains in the Genus database with same CATH topology
 3GF7 A;  2W3P A;  2F9I A;  3R0O A;  4YLH A;  1HZD A;  5DKP A;  5INF A;  3SLL A;  4JVT A;  1Y7O A;  4B3J A;  4OMR A;  4JCR A;  4U0G H;  3WG5 A;  1EF9 A;  3R9T A;  4JYL A;  5DZK H;  1XX4 A;  2QQ3 A;  3TV5 A;  4K29 A;  2WTB A;  1RJN A;  3STA A;  3BPP A;  3OME A;  3Q0J A;  1OD4 A;  3R6H A;  3N6R B;  3DOR A;  4U0H A;  3HRX A;  4U19 A;  4HC8 A;  4MOU A;  4Q1I A;  3V5E A;  2F6I A;  3IAV A;  4RYF A;  3QWD A;  1HNO A;  2BZR A;  4FB8 A;  3H0J A;  4WCZ A;  3HP0 A;  5G1S A;  3U9S B;  4ZDC A;  3H81 A;  4NEK A;  3IBB A;  4OG1 A;  2J5I I;  3BEZ A;  1XNW A;  3QXZ A;  3T3W A;  2IEX A;  4RYF H;  5G1Q A;  3FF6 A;  4FZW C;  4I4Z A;  3HLN 1;  3QKA A;  1NZY B;  1WDM A;  2J5I B;  3R9Q A;  5G1R A;  3LKE A;  2VSU E;  4QII A;  1DCI A;  1SZO A;  4F47 A;  3NJB A;  1TG6 A;  4HDT A;  4MXI A;  4KWB A;  1FC7 A;  2J5S A;  3H0S A;  4JSB A;  3VIV A;  4IZC A;  3GMA A;  4WZ8 B;  4DI1 A;  4B3I A;  5KJP A;  2VSU F;  1NZY A;  2A7K A;  4EML A;  2NP9 A;  2Q34 A;  4L6W A;  1SG4 A;  4FNB A;  3GKB A;  1K32 A;  1Q51 A;  4K2N A;  3KTH A;  3QXI A;  1WDL A;  5E0S A;  4G2R A;  3G64 A;  1DUB A;  3GLM A;  1EF8 A;  4QFE A;  3HIN A;  4JCT A;  2VSU C;  4WYO B;  2ZL0 A;  3T8B A;  5C90 A;  2FZS A;  2X58 A;  1WZ8 A;  2UZF A;  2J5G D;  3BF0 A;  3TDC A;  1RJM A;  1ON3 A;  3TLF A;  3PZK A;  1WDK A;  5E0S H;  1MJ3 A;  4ZU2 A;  1FCF A;  1UYS A;  3U9R B;  5JBW A;  5C9G A;  2A81 A;  2FBM A;  2VSS E;  4FZW A;  1JXZ A;  2DEO A;  1YG8 A;  3MT6 A;  1PIX A;  4K3W A;  2CE3 A;  1PJH A;  3T88 A;  1Q52 A;  1YG6 A;  2VSS F;  2ZL2 A;  3M6N A;  3KTI A;  3KTK A;  3RST A;  3KTJ A;  4Q0G A;  5CTB A;  1FC6 A;  1X0U A;  5INI A;  3MOY A;  3ISA A;  4NAR A;  2F9Y B;  3U9T B;  1UIY A;  1N6F A;  3PEA A;  3Q7H A;  4JFC A;  3I47 A;  3TRR A;  4ZDB A;  4MI2 A;  1XO6 A;  3RRV A;  2Q2X A;  2A7S A;  2J5G A;  1XNY A;  4I52 A;  3KQF A;  3R9S A;  4KD6 A;  2C8T A;  2VSU A;  2F9Y A;  3Q0G A;  2FW2 A;  4JWV A;  1UYR A;  5DTP A;  2VX2 A;  5HUQ A;  4U18 A;  2CBY A;  2YJG A;  4HNK A;  5DU4 A;  3V5I A;  3QRE A;  1ON9 A;  3P5M A;  1XNV A;  4GHN A;  3TVW A;  4Z0M A;  1N6E A;  3ZWA A;  3PGQ A;  3LAO A;  4ELW A;  5MGB A;  3T8A A;  1UYT A;  1J7X A;  3H02 A;  4L8K A;  2PBP A;  3PE8 A;  4NNQ A;  5JBX A;  3KTG A;  2HW5 A;  4JJT A;  2F6Q A;  4LK5 A;  5DU8 A;  4EMM A;  3ZWB A;  5DUC A;  4QIJ A;  3K50 A;  1FC9 A;  3ST9 A;  1VRG A;  5FIF A;  5KDR B;  1OD2 A;  3GF3 A;  3RSI A;  3TZ3 A;  3BPT A;  2VSS A;  4FJW D;  2Q35 A;  3TT7 A;  2GTR A;  3H0Q A;  3NJD A;  4FN8 A;  1TYF A;  3MFM A;  2X24 A;  5KDR A;  2D3T A;  3QYR A;  3ZWC A;  5FUS A;  3FDU A;  3MYB A;  3OT6 A;  4ZDF A;  2DUB A;  4JCS A;  5ING A;  3P85 A;  1HNU A;  3SWX A;  4GM2 A;  3QMJ A;  4KNP A;  2PPY A;  4KPK A;  2ZQQ A;  3JU1 A;  4JYJ A;  3P2L A;  4FND A;  4FN7 A;  3K8X A;  2ZQR A;  4B3H A;  3HE2 A;  4IZB A;  4RCN A;  2VRE A;  3ZW9 A;  2PG8 A;  3Q1T A;  4OLQ A;  5DL1 A;  3OC7 A;  3QK8 A;  4JOT A;  4U1A A;  3DJA A;  3M6M A;  2ZL4 A;  2ZL3 A;  3IB9 A;  3ZW8 A;  4ELS A;  5CTC A;  5DUF A;  1EY3 A;  4I42 A;  1K39 A;  5DU6 A;  2F9I B;  2EJ5 A;  4U0G A;  1O8U A;  4J2U A;  3TT6 A;  1UYV A;  3TVU A;  1N6D A;  5DZK A;  4ASI A;  3L3S A;  4ZDE A;  1W2X A;  4EMP A;  4ELX A;  5E0N X;  2J5I A;  3T89 A;  3H0U A;  4JCQ A;  5IKL B;  4IZD A;  4ZDD A;  5DTW A; 
#chains in the Genus database with same CATH homology
 3GF7 A;  2W3P A;  2F9I A;  3R0O A;  4YLH A;  1HZD A;  5DKP A;  5INF A;  3SLL A;  4JVT A;  1Y7O A;  4B3J A;  4OMR A;  4JCR A;  4U0G H;  3WG5 A;  1EF9 A;  3R9T A;  4JYL A;  5DZK H;  1XX4 A;  2QQ3 A;  3TV5 A;  4K29 A;  2WTB A;  1RJN A;  3STA A;  3BPP A;  3OME A;  3Q0J A;  1OD4 A;  3R6H A;  3N6R B;  3DOR A;  4U0H A;  3HRX A;  4U19 A;  4HC8 A;  4MOU A;  4Q1I A;  3V5E A;  2F6I A;  3IAV A;  4RYF A;  3QWD A;  1HNO A;  2BZR A;  4FB8 A;  3H0J A;  4WCZ A;  3HP0 A;  5G1S A;  3U9S B;  4ZDC A;  3H81 A;  4NEK A;  3IBB A;  4OG1 A;  2J5I I;  3BEZ A;  1XNW A;  3QXZ A;  3T3W A;  2IEX A;  4RYF H;  5G1Q A;  3FF6 A;  4FZW C;  4I4Z A;  3HLN 1;  3QKA A;  1NZY B;  1WDM A;  2J5I B;  3R9Q A;  5G1R A;  3LKE A;  2VSU E;  4QII A;  1DCI A;  1SZO A;  4F47 A;  3NJB A;  1TG6 A;  4HDT A;  4MXI A;  4KWB A;  1FC7 A;  2J5S A;  3H0S A;  4JSB A;  3VIV A;  4IZC A;  3GMA A;  4WZ8 B;  4DI1 A;  4B3I A;  5KJP A;  2VSU F;  1NZY A;  2A7K A;  4EML A;  2NP9 A;  2Q34 A;  4L6W A;  1SG4 A;  4FNB A;  3GKB A;  1K32 A;  1Q51 A;  4K2N A;  3KTH A;  3QXI A;  1WDL A;  5E0S A;  4G2R A;  3G64 A;  1DUB A;  3GLM A;  1EF8 A;  4QFE A;  3HIN A;  4JCT A;  2VSU C;  4WYO B;  2ZL0 A;  3T8B A;  5C90 A;  2FZS A;  2X58 A;  1WZ8 A;  2UZF A;  2J5G D;  3BF0 A;  3TDC A;  1RJM A;  1ON3 A;  3TLF A;  3PZK A;  1WDK A;  5E0S H;  1MJ3 A;  4ZU2 A;  1FCF A;  1UYS A;  3U9R B;  5JBW A;  5C9G A;  2A81 A;  2FBM A;  2VSS E;  4FZW A;  1JXZ A;  2DEO A;  1YG8 A;  3MT6 A;  1PIX A;  4K3W A;  2CE3 A;  1PJH A;  3T88 A;  1Q52 A;  1YG6 A;  2VSS F;  2ZL2 A;  3M6N A;  3KTI A;  3KTK A;  3RST A;  3KTJ A;  4Q0G A;  5CTB A;  1FC6 A;  1X0U A;  5INI A;  3MOY A;  3ISA A;  4NAR A;  2F9Y B;  3U9T B;  1UIY A;  1N6F A;  3PEA A;  3Q7H A;  4JFC A;  3I47 A;  3TRR A;  4ZDB A;  4MI2 A;  1XO6 A;  3RRV A;  2Q2X A;  2A7S A;  2J5G A;  1XNY A;  4I52 A;  3KQF A;  3R9S A;  4KD6 A;  2C8T A;  2VSU A;  2F9Y A;  3Q0G A;  2FW2 A;  4JWV A;  1UYR A;  5DTP A;  2VX2 A;  5HUQ A;  4U18 A;  2CBY A;  2YJG A;  4HNK A;  5DU4 A;  3V5I A;  3QRE A;  1ON9 A;  3P5M A;  1XNV A;  4GHN A;  3TVW A;  4Z0M A;  1N6E A;  3ZWA A;  3PGQ A;  3LAO A;  4ELW A;  5MGB A;  3T8A A;  1UYT A;  1J7X A;  3H02 A;  4L8K A;  2PBP A;  3PE8 A;  4NNQ A;  5JBX A;  3KTG A;  2HW5 A;  4JJT A;  2F6Q A;  4LK5 A;  5DU8 A;  4EMM A;  3ZWB A;  5DUC A;  4QIJ A;  3K50 A;  1FC9 A;  3ST9 A;  1VRG A;  5FIF A;  5KDR B;  1OD2 A;  3GF3 A;  3RSI A;  3TZ3 A;  3BPT A;  2VSS A;  4FJW D;  2Q35 A;  3TT7 A;  2GTR A;  3H0Q A;  3NJD A;  4FN8 A;  1TYF A;  3MFM A;  2X24 A;  5KDR A;  2D3T A;  3QYR A;  3ZWC A;  5FUS A;  3FDU A;  3MYB A;  3OT6 A;  4ZDF A;  2DUB A;  4JCS A;  5ING A;  3P85 A;  1HNU A;  3SWX A;  4GM2 A;  3QMJ A;  4KNP A;  2PPY A;  4KPK A;  2ZQQ A;  3JU1 A;  4JYJ A;  3P2L A;  4FND A;  4FN7 A;  3K8X A;  2ZQR A;  4B3H A;  3HE2 A;  4IZB A;  4RCN A;  2VRE A;  3ZW9 A;  2PG8 A;  3Q1T A;  4OLQ A;  5DL1 A;  3OC7 A;  3QK8 A;  4JOT A;  4U1A A;  3DJA A;  3M6M A;  2ZL4 A;  2ZL3 A;  3IB9 A;  3ZW8 A;  4ELS A;  5CTC A;  5DUF A;  1EY3 A;  4I42 A;  1K39 A;  5DU6 A;  2F9I B;  2EJ5 A;  4U0G A;  1O8U A;  4J2U A;  3TT6 A;  1UYV A;  3TVU A;  1N6D A;  5DZK A;  4ASI A;  3L3S A;  4ZDE A;  1W2X A;  4EMP A;  4ELX A;  5E0N X;  2J5I A;  3T89 A;  3H0U A;  4JCQ A;  5IKL B;  4IZD A;  4ZDD A;  5DTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...