3TTMA

Crystal structure of spud in complex with putrescine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
341
Chain Sequence
DNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Binding Specificity Revealed by the Crystal Structures of Polyamine Receptors SpuD and SpuE from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Polyamine transport protein
total genus 122
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttmA02
3CI8A 5JEIA 2PMSA 3S9LC 3LSXA 3MBPA 4KCDA 4H5GA 5EHSA 4PFUA 4F1YA 1LBBA 4FECA 4KYDA 3GZGA 1MH4A 1LAGE 1FQBA 1XVYA 4RY1A 4U4SA 2OWSA 2XD2A 5DTBA 4DDDA 2QS4A 1MXUA 2RF1A 3PPPA 4OZ9A 2UVGA 3K0VA 2ONSA 1P99A 3VXCA 1Q1KA 3KN7A 4BLAA 4C1UA 4ZECA 2PT1A 3HSTA 1NNPA 3EHTA 4H1XA 4G8NA 4HCYA 4FORA 4OXVA 4OWDA 4G68C 3U8QA 4OTEA 1SDXA 3MP1A 3C32A 1GTKA 3IR1A 4OYVA 3T96B 3T9UA 2FNCA 1N7XA 3KGCA 1YPNA 4IO4A 4JB7A 3QYTA 4N13A 1IQ7A 3IAZA 3T9VA 1MY1A 5ISUA 3RQTA 1MXXA 2DWAA 4YKKA 3R26A 4GXAA 4IO3A 3H6TA 5DT6A 2ONKE 1IXHA 2D3IA 1B5IA 1PB8A 3EF7A 1P1OA 2REGA 4POXA 2ZYNA 3QXMA 4DLDA 4LA9A 4RA1A 2O51A 3S9EA 5H8HA 3TCGA 4ZEIA 4ZZEA 1FTOA 3SEVA 2O1LA 1MPDA 1MY2A 1UTHB 2H25A 2X7QA 4LONB 4NF4B 3S4UA 1ANFA 1R9LA 3G7WA 5H8FA 4IY5A 5AA4A 1GR2A 2X26A 3LSWA 1PBPA 2Q2AA 2VGQA 2O6AA 4PFWA 4RJZA 1SI1A 4ELPA 1IITA 1B0LA 1RKMA 1ZU0A 3H03A 3O66A 3OEKA 4ZZAA 3S2VA 1YCJA 4QSCA 1NNKA 2WKYA 4P11A 5TP9B 1XHYA 2AL4A 1LB8A 3U93A 3CRBA 4U1ZA 1B52A 1MG1A 2DE4A 4OEUA 4YKPA 4H8JA 1N76A 4GD5A 4IO5A 2ZYKA 3W15C 5TP9A 1SW5A 2F5XA 3SKPA 4R2BA 3IJOB 4PFYA 2RINA 3IB1A 1S9TA 3U94A 3SDFA 3TTRA 1MXVA 2OCUA 2PX1A 2XXRA 2DP8A 5DVFA 3HN0A 4GXSB 3SEWA 2YJPA 5HM4B 4QFLA 5B7DA 1HSLA 2I4BA 4MBPA 5LOMA 2VD3A 3B6TA 3R6UA 4G8HA 2Z23A 1B3EA 4BDLA 1EZ9A 2I3VA 4QHQA 4U4XA 3MZ1A 4YB7A 4MFIA 2Z8EA 3OEMA 1FQAA 2PYYA 5I2NB 4H8IA 1VFDA 1SD3A 4YMAA 2PVUA 1B5HA 2Q88A 4GF8A 4QFKA 5AA1A 1NNFA 2VD2A 1PBQA 3Q25A 1USYH 3MAMA 1MY0A 2KLFA 4PQJA 1VE4A 2F6PA 2ESNA 4P0GA 3TODA 4LUBA 2RC8A 2F7AA 1NKXA 1JEUA 2OBGA 2AL5A 3TUSA 1MQDA 3VLWA 4F29A 4FEBA 2F36A 2Z22A 1IXGA 1FQCA 5HPQA 1WVJA 3OO9A 3RLFE 2YPNA 1DTGA 5IAIA 2GHAA 2ZNTA 1OQGA 3MC2A 4U22A 3L6HA 3VVDA 2PBWA 1ELJA 4ISUA 3LUYA 1B3GA 2DE2A 5FHMA 4C1TA 3V89B 4OHNA 3ILUB 4KCCA 5AA2B 5L9SA 4EXLA 3TEPA 4FJPA 1KWHA 1LFHA 4ZEKA 2QL3A 2E0SA 2AYSA 5L9OA 1FW0A 1OLCA 4QFNA 5ICQA 3H6VA 4PFTA 1IXCA 3KN8A 4JDFA 3SEUA 3THIA 3MW0A 3I3VA 3KOSA 3CIJA 1OIBA 4NF6B 3PUVE 1VSOA 4O3AA 3S9NC 2UVIA 4NF5B 4H67A 1FQEA 2YLNA 3T9XB 1B0HA 3CSGA 3DP6A 3IB0A 3TQLA 1Q35A 2LAOA 4NF4A 1XVXA 3MZBA 5B70A 1N0TA 5ITOA 2DYXA 1URDA 4RXLA 2NOOA 1F9BA 3GBAA 4LQ2A 4POWA 5KZTA 5CI5A 1EU8A 4LZ5A 4ELQA 1M5FA 2XXTA 4JXIA 2O69A 3C4MA 3FJ7A 3R7XA 4NF8B 5AA3A 5I58A 2GH9A 3C31A 1XT8A 4FE8A 2O7UA 3H06B 3AXFA 3M8UA 4K3FA 4L17A 4YMBA 1UTHA 2QS3A 2Y7RA 2BJJX 1LBCA 2THIA 3CG1A 3K01A 4AB6A 4DCYA 1JVXA 3L6GA 3RNNA 1AH5A 3W9VA 4ESWA 5I59B 1MDQA 3EHUA 3I6VA 4IGTA 1QKBA 4KI0E 1PEBA 5ICTA 1JW5A 2O7IA 4Q5TA 4X1DA 4OEVA 4R9GA 5H8QA 1AIVA 3TTNA 3O97A 5CM6A 4GL8A 3K4UA 4IY6A 1R9QA 4X9TA 3ZKKA 1MXZA 4BDMA 1Z7ME 4YB6A 1LAXA 2P0SA 5CMKA 3CR9A 4RYAA 5H8NA 1MQHA 3OENA 5CRYA 1B46A 1I6QA 1PB7A 3ILTB 4Z0IA 5I2KA 4R73A 4G77A 1P1QA 1DOTA 4GOTA 2F8DA 4O3BA 2NXOA 5CMCA 4NWDA 1OMPA 1XOCA 1SQYA 4F3SA 1LSTA 4EQBA 2DWHA 3E9XA 4I9DA 1JW4A 4OMBA 4FEDA 4ZDMA 1B7UA 1FTLA 1DPPA 2W7YA 1URGA 2DVZA 3USDA 3PD8A 3G3GA 5CMMA 1FTJA 1P1WA 3IK6B 1IIWA 4KQPA 1B58A 2Y7WA 2QPQA 3IORA 3TTKA 2QSXA 3EPEA 2I58A 2HQ0A 3C9HA 1A8FA 3D4CA 4G2ZA 4NE4A 2I49A 5F1QA 3ECRA 3O6GA 3IL1B 2B3BA 3MUQA 4MLQA 2A5SA 5BWJA 1LLSA 3S9MC 4I8CA 3FIRA 3O29A 4N07A 4YB5A 3VXBA 4ZE9A 4ESXA 3K2DA 4JSOA 3K1PA 3LBSA 3MVXA 2V84A 4QRZA 1OVTA 5KCJA 1H3DA 4F2OA 1MPBA 3FVGA 5A5XB 3T9HB 4WKMA 1P1UA 3OELA 2O84X 2GFEA 2Y7PA 3TQWA 1LCFA 3ZS6A 3CFLA 2V25A 4ZEFA 3VDFA 5I57B 1M5EA 1IZ1A 4ZS9A 5JTYB 3A09A 1H43A 3EN3A 3H4ZA 1O64A 4ONYA 2REJA 4F22A 1MPCA 2QMXA 4KHZE 3TELA 4DIGA 4M4GA 1N7WA 5I56A 4XKQA 4RPOA 3IOUA 2G29A 1UIVA 3DP4A 2XXIA 5FTIA 1N3WA 2OZZA 3LSLA 2ZNSA 3H6WA 4MF3A 4OFJA 3BFTA 3VVFA 4PP0A 1AL3A 1ZBMA 1Y3QA 5H8HB 1A8EA 5HBCA 3UA8A 1N84A 3K6XA 4C0RA 4XXUA 1NFTA 1B2HA 2F7CA 2ZYMA 4OERA 4QSDA 5CBSA 2XXWA 3FJGA 1UTBA 2Q89A 3IO4A 1B7HA 3MPLA 1FCKA 4Q30B 2A5TB 1L5TA 1H45A 2QJEA 3VVEA 1NH7A 2RC7A 3SESA 1YAEA 3FZVA 2M8CA 4YKIA 3RGYA 3RTWB 3C33A 4Q8RA 3KBRA 2XX7A 2DWJA 4R6HA 4EUOA 1Y9UA 2ALUA 2VHAA 1A40A 3FVKA 4HS7A 1FTMA 1BP5A 1POY1 2OLBA 2VP1A 3CSBA 2F7BA 3MP8A 1VR5A 2Y7KA 4RK9A 3RT6B 3B6QA 3MVWA 4I1DA 3TPAA 3TFLA 4Z7EA 1XC1A 2IA4A 3FVNA 2ZXTA 3G3JA 3PGFA 2NWJA 3ONMA 2VOZA 4JWYA 2HFBA 1HSEA 1T0KA 1TWYA 1TT1A 3TKDA 4NF5A 3PUXE 4F19A 1MY3A 4LZ7A 4O3CA 1B6HA 3H7MA 1R6ZA 1B5JA 3MP6A 2XX8A 1SVXB 1QUKA 3PUYE 3RTFB 1H44A 4AQ4A 3A3UA 3OSQA 4GFRA 3IB2A 2D21A 1H76A 3OO6A 3FXUA 1HSJA 1EZOA 4BDRA 1N3XA 4THIA 3M3LA 3PPQA 3ODBA 1D9VA 3QK6A 4YAHX 4NMYA 4OFOA 2V3TA 4KPTA 4OFLA 2V3UA 3BBRA 5K2YA 3FJMA 4FATA 4IO2A 1USYE 5I59A 1DPEA 3DLNA 4F39A 4Q0CA 3MVZA 3O6IA 1BKAA 2AIXA 2I4CA 1VFEA 2DXRA 5DVIA 2RCBA 4MH5A 4DXCA 4NEDA 3TMGA 1IUDA 2HEUA 3K1NA 3Q27A 4FIMA 1PC3A 1II5A 3FATA 3KSJA 3DM0A 5FTHA 3VFJA 4G4PA 4TOZA 5I84A 4RNSA 2R9JA 4OETA 1B9JA 5TPAB 1ZTYA 4LQ5A 5KCJB 2I0BA 2HAUA 1BIYA 1JVYA 1NMUA 2UVJA 1MDP1 1FQDA 5DYHA 2NVUB 1D9YA 3OOAA 2XXYA 4ND9A 4NF6A 4OENA 2FA7A 4U23A 2OWTA 2B3FA 3N5LA 1OLAA 5M2VA 4XKRA 4H0WA 3PU5A 2ANJA 5FHOA 3V5AA 1AMFA 1B4ZA 3HV1A 3MZ9A 3HCQA 1MQGA 1RYXA 3N6UA 1O63A 4WEDA 5F7VA 1IEJA 3MVYA 4GWOA 4KD5A 2PT2A 2F34A 3CVGA 2R6GE 3M3KA 3FXRA 2XXPA 4ZEDA 4IO6A 3GXAA 4GQOA 2HXWA 3QSLA 4DCXA 5ITPA 4UACA 4F18A 1LFGA 1MXYA 3CFZA 3EHSA 3N26A 3SERA 4GVOA 2P1SA 4ELRA 2XXVA 3ZKLA 1S50A 1MM6A 2UXAA 3HHGA 3LSFB 2DOJA 3PMXA 5ELVA 3VLUA 3TAJA 1QJMA 4MLVA 3HO7A 5AA4B 4XKPA 3G3IA 1B3LA 2A5TA 2H99A 3G3KA 3HHFA 3UIFA 1ATGA 1B3HA 1B40A 3V8XB 4R74A 2HAVA 2Q9TA 4GL0A 2RCAA 4UA8A 3V83A 3TCFA 1I69A 5JK4A 1WDNA 2FYIA 1M5BA 1B4HA 1IXIA 3MWBA 3OMBA 4TLLB 5EHMA 2HZKA 1O7TA 2DXYA 2XD3A 4WXJA 1XS5A 1ZJLA 1SYIA 1OVBA 3K6WA 1MH3A 1B7ZA 4U21A 2RC9A 3F11A 1B3FA 2OK2A 4JWOA 4KFQA 1BLFA 3JZJA 1D4NA 3O28A 1US5A 2ABHA 1MRPA 1LAHE 3O9PA 3VV5A 3DP8A 4HW8A 5J1DA 2HCAA 4XKNA 1Y20A 4X1BA 3RN8A 3T66A 3PMVA 1A7LA 3SEXA 4HCWA 4KYSA 1Y4TA 4NWCA 4R75A 4F2QA 1QUJA 4R6KA 2XHDA 1LAFE 3VLVA 3TTLA 5AE4A 5CBRA 2H5YA 5H8QB 4H5FA 5H8SA 1DSNA 3QUFA 4KR5A 1B1XA 1TFDA 3LR1A 2CZLA 4QFPA 5I2KB 2RKMA 3MQ9A 1JQFA 1JW1A 4U1OA 5L8DA 2DE3A 4GIZA 3RUMA 1MY4A 2ZMBA 3IOWA 3KN3A 4H6DA 4EQ9A 3CG3A 5CC2A 2DWIA 2V3QA 1TFAA 2Y7IA 3OD7A 4F3BA 4JSDA 1B1HA 2R71A 1QULA 3QIMA 3Q26A 3UK4A 1GV8A 1SW4A 1A99A 4G68A 3U72A 3C36A 3KG2A 4E0WA 5K2XA 4M1VA 2Y84A 1LB9A 2Z8DA 3MPKA 1QUIA 2XXXA 4U2RA 1R1NA 3OO7A 4ELOA 4FAJA 3GLBA 4IO7A 4ECFA 3Q28A 4RPNA 1NL5A 2DS9A 1MQJA 3UORA 5I57A 2F35A 4NTLA 1CE2A 2F78A 2G93A 2I0CA 2V93A 3D4GA 3FV1A 3OSRA 3PPRA 1S7YA 1MS7A 3O2AA 4BDQA 5DVJA 4EDPA 3FV2A 3TDJA 3ZSFA 4ZEBA 3K1MA 4DZ1A 3QUJA 1UIUA 3IX1A 1JEVA 3M3FA 5CMBA 2QMWA 1URSA 3G3FA 3PPNA 4QF9A 1BTJA 1UQWA 2UYFA 4OVJA 5EYFA 1I6AA 2I48A 4HTGA 1LFIA 1UTBB 2QS2A 4LP2B 2H4IA 1QKAA 2X7PA 1WODA 1EH3A 1J1NA 2DVCA 3K02A 4YKJA 4YZZA 3H3GA 4LVQA 1B32A 3TYHA 3O6HA 4H65A 3C35A 2CMOA 3U1OA 3N94A 3P7IA 4XTCQ 1Y1ZA 3T22A 4R2FA 1RYOA 2ZNUA 3FGSA 1Y1MA 4NF8A 5I58B 2UVHA 1GVCA 2H98A 3PUZE 3FUZA 3WAFA 4XIGQ 4QFOA 3IOTA 1I6BA 1Y3NA 2F97A 3FD3A 3PV0E 3W9WA 1B05A 2UYEA 4JWXA 1MQIA 3DELB 3RY3A 5TPAA 3OO8A 3E3KA 4GRKA 4DE8A 3KJTA 1P1NA 4IB2A 1LCTA 4JBZA 4OESA 2GHBA 2XXUA 3H6UA 3KEIA 1N04A 1QVSA 3FXQA 5L9MA 2IEEA 3I5OA 1QW0A 1NNTA 3JYRA 4IGRA 4DXUA 2QRYA 5TU0A 3VE1B 2O68A 2E1SA 3EQ1A 5BUUA 1AOVA 1SW1A 4TLMB 5IKBA 3LC8A 3PMWA 3IOVA 4TQUQ 4EXKA 1DTZA 1SBPA 1MM7A 1SW2A 3MJNA 3SETA 5AA2A 1YTVA 3G3HA 3K6UA 4LZ8A 2DQVA 5FHNA 3N6TA 4ZE8A 2Q8JA 4AB5A 3FASA 2XX9A 1PDAA 3KFMA 1NH8A 3PUWE 3E4RA 4GLIA 4KYEA 2Z8FA 4N6PA 5DEXB 4F3PA 2H9BA 1Y4CA 4I62A 3K00A 3FVOA 2Q2CA 2XXHA 4G8MA 5DEXA 2GRVA 1LGBC 3QAXA 2F6GA 1US4A 4P0IA 1OQHA 5H8NB 2ONRA 1JNFA 1ZMGA 3BKIB 1SYHA 3K6VA 1M5DA 4R72A 4G68B 3RPWA 3TTMA 1Y3PA 3GBBA 3C34A 3KJ7A 4F3GA 3TZAA 1PB9A 4YICA 3Q29A 2D5WA 2ZYOA 3JV9A 1A54A 3T93B 4F1VA 1MXWA 4DXBA 5H8FB 3PD9A 3E13X 3PPOA 4LATA 4QSEA 2O1MA 3HPIA 4EQ7A 3IJXB 4RK2A 3RT8A 1JETA 3UN6A 1GGGA 1FQFA 4F1UA 4BDOA 3KZGA 4E0XA 3B7DA 3A3CA 3TCHA 4EF2A 4PETA 1EZPA 4BDNA 3IO6A 3WAEA 4OQOA 1M5CA 1FTKA 3CFXA 4WEPA 5AA2D 1SI0A 2DSFA 4EF1A 3UP9A 2HZLA 4R9FA 1POTA 1ZIUA 3OXNA 3U92A 2B65A 3KOTA 3UGWA 5I56B 4R6YA 4F31B 1A55A 2I3WA 2P2AA 1DMBA 5KDTA 2XXQA 4YU0A 2I6EA 3BFUA 3KSXA 4PE5B 4X48A 1D3KA 2NUVA 5A5XA 5JTYA 5KDTB 1Z7NE 1CB6A 1ZKBA 3B6WA 5I2NA 2OJTA 3SEYA 1ZLQA 1TXFA 1B51A 2QS1A
chains in the Genus database with same CATH superfamily
4OVQA 5JEIA 3MBPA 4KCDA 3LV0A 4PFUA 1Q9DA 4RY1A 1XVYA 2XD2A 1MXUA 2RF1A 4BLAA 1INPA 4ZECA 4FORA 4OTEA 3MP1A 3IR1A 4OYVA 4N81A 4N13A 3IAZA 1MY1A 3RQTA 1DK4A 2ONKE 1B5IA 3EF7A 3S9EA 1LBWA 4LONB 5AA4A 4PFWA 2O6AA 1SI1A 1LB8A 3CRBA 1B52A 1MG1A 4YKPA 4IO5A 4R2BA 3IB1A 5EQ8A 3HN0A 2YJPA 1HSLA 2V4CA 3R6UA 4QHQA 1FSAA 1B5HA 5I3SA 1LEVA 3Q25A 3MAMA 1MY0A 2F6PA 4P0GA 2F7AA 1NKXA 2AL5A 2OWZA 1MQDA 1FQCA 5HPQA 1DTGA 1OQGA 3VVDA 1ELJA 4ISUA 4OHNA 3TEPA 1KWHA 1LFHA 2QL3A 2E0SA 3H6VA 4PFTA 1IXCA 4HE1A 4JDFA 3SEUA 3MW0A 3PUVE 4H67A 1FQEA 1G0HA 2YLNA 3T9XB 3TQLA 2LAOA 2NOOA 1F9BA 2VPNA 1FPJA 3M8UA 2Y7RA 3CG1A 3RNNA 2QVUA 3EHUA 3ZKKA 1MXZA 3CR9A 4Z0IA 1PB7A 3ILTB 1SQYA 4GWWA 4EQBA 4ZDMA 1FTLA 3USDA 5CMMA 1FTJA 5EYHA 2WX9A 1B58A 2Y7WA 2QPQA 3TTKA 1FPGA 5F1QA 3D4CA 4G2ZA 2B3BA 4I8CA 1FBCA 4JSOA 1P1UA 2O84X 1FBGA 2GFEA 3ZS6A 3CFLA 1M5EA 4GBVA 1O64A 4ONYA 2QMXA 1YYZA 4XKQA 5FTIA 2G29A 2OZZA 4MF3A 4OFJA 3BFTA 1ZBMA 5H8HB 1A8EA 1NFTA 5CBSA 4OERA 2Q89A 1L5TA 4N8YA 1RDXA 1NH7A 2RC7A 2FIEA 4X04A 1NUYA 4Q8RA 2XX7A 2DWJA 1A40A 3FVKA 1FTMA 3IFAA 3MP8A 2F7BA 4RK9A 3MVWA 4QXDA 3TPAA 1XC1A 3FVNA 2ZXTA 3G3JA 3ONMA 2VOZA 1HSEA 1TWYA 1LBZA 1B6HA 1R6ZA 1QUKA 3RPLB 3RTFB 3OSQA 3IB2A 5IZZA 1H76A 3M3LA 4NMYA 4OFOA 4KPTA 5K2YA 3BBRA 4FATA 1DBZA 4F39A 1BKAA 4LN5A 2RCBA 1PC3A 5I84A 4RNSA 4QBAA 4LQ5A 4OENA 2XXYA 4ND9A 3PU5A 3HV1A 1B4ZA 3MZ9A 3HCQA 4WEDA 3MVYA 4KD5A 2QVVA 3CVGA 3M3KA 4DCXA 2HXWA 4UACA 1LFGA 3E78A 4ELRA 2DOJA 1QJMA 5AA4B 3G3KA 1B40A 3MSTA 2Q9TA 3V83A 2RCAA 1B4HA 4TLLB 1OVBA 1B7ZA 2XWIA 2RC9A 3O9PA 3BIHA 1KZ8A 1LAHE 4HW8A 4X1BA 4KYSA 2XHDA 3TTLA 5CBRA 4H5FA 1FJ6A 5H8SA 2CZLA 5L8DA 3MQ9A 4H6DA 3CG3A 4OVRA 2Y7IA 4JSDA 1B1HA 2R71A 3Q26A 2WBDA 3UK4A 3FBPA 2WBBA 3KG2A 5IZ3A 4E0WA 2Y84A 2Z8DA 1NV7A 4IO7A 4RPNA 1NUXA 3UORA 5I57A 2F35A 1FPDA 2G93A 2V93A 3ZSFA 4ZEBA 3K1MA 1UIUA 1FRPA 1UQWA 2FHYA 4XF5A 1LFIA 2QS2A 3H3GA 2B4MA 4H65A 3C35A 4R2FA 1RYOA 2ZNUA 3FGSA 2UVHA 2H98A 3PUZE 3FUZA 3WAFA 2F97A 1B05A 4MAGA 3KJTA 2XXUA 3KEIA 1QVSA 3FXQA 1QW0A 1NNTA 3VE1B 2O68A 5LDZA 4TLMB 5IKBA 3LC8A 1SBPA 1NV3A 3MJNA 3SETA 5FHNA 3N6TA 2XX9A 1PDAA 1XI6A 4I62A 1Y4CA 1LGBC 1US4A 4P0IA 3RPWA 1Y3PA 3GBBA 3KJ7A 2D5WA 2PFYA 1NV4A 4N15A 1JETA 3B7DA 3A3CA 4G61A 4PETA 3IO6A 3WAEA 1FPKA 2VPOA 5AA2D 4PAIA 2DSFA 3LUZA 3UGWA 3KOTA 4R6YA 1KA1A 4MJOA 2I6EA 3KSXA 4O94A 4GX4A 5I2NA 2OJTA 3S9LC 2Y5KA 4KYDA 1MH4A 1FQBA 3PPPA 2ONSA 4C1UA 2PT1A 3HSTA 4H1XA 3MYUA 4OXVA 1GTKA 3T96B 1N7XA 4JB7A 3T9VA 2DWAA 4YKKA 4IO3A 1FPEA 3H6TA 5LTCA 1IXHA 1PB8A 2REGA 4POXA 4DLDA 2ZYNA 4RA1A 3TCGA 4ZEIA 1MY2A 1UTHB 3G7WA 1GR2A 2X26A 1KA0A 1PBPA 4ELPA 4ZZAA 3S2VA 3HFUA 1NNKA 2WKYA 4U1ZA 4H8JA 4GD5A 2ZYKA 5TP9A 2RINA 3U94A 3TTRA 1MXVA 2OCUA 2PX1A 2XXRA 4N17A 5B7DA 5LOMA 3B6TA 2Z23A 1EZ9A 4U4XA 3MZ1A 2Z8EA 3OEMA 4YMAA 4QFKA 5AA1A 5IZ3B 2VD2A 1PBQA 1USYH 2KLFA 3T0JA 4LUBA 2OBGA 1FPIA 3VLWA 3CHGA 4F29A 1IXGA 3RLFE 2YPNA 4O7MA 4DI4B 5IAIA 2MKZA 3MC2A 2PBWA 2R8TA 1B3GA 2DE2A 2HXRA 3PTYA 5AA2B 5L9SA 1FW0A 3D1RA 3KN8A 3THIA 4O3AA 3S9NC 1B0HA 3IB0A 1Q35A 3MZBA 3RYDA 1N0TA 4OVPA 5ITOA 3GBAA 5CI5A 1M5FA 2XXTA 3FJ7A 3C4MA 4NF8B 5I58A 2GH9A 3AXFA 2THIA 5I59B 1JVXA 3W9VA 1JP4A 1MDQA 3I6VA 4UABA 4KI0E 1JW5A 2O7IA 1FPFA 4OEVA 4R9GA 5H8QA 3TTNA 4GL8A 1Z7ME 2FIXA 5CMKA 5H8NA 4RYAA 5I57B 1I6QA 4G77A 4HE2A 4GOTA 4O3BA 4NWDA 1LSTA 2DWHA 3E9XA 5EYGA 1B7UA 1DPPA 2W7YA 2DVZA 1YXIA 3PD8A 1P1WA 3IK6B 1IIWA 3IORA 2QSXA 4PCDA 2HQ0A 1A8FA 4NE4A 3O6GA 5BWJA 1YZ0A 4ZE9A 3K2DA 4QRZA 1OVTA 5KCJA 1H3DA 5A5XB 1MPBA 4ZEFA 2V25A 3VDFA 3A09A 1AWBA 2REJA 4M4GA 1FTAA 4P47A 1UIVA 1N3WA 3LSLA 3H6WA 1AL3A 5HBCA 3UA8A 3K6XA 4PF8A 4MIJA 2XXWA 3V8XB 3VVEA 1FCKA 2A5TB 1YAEA 3FZVA 2M8CA 4YKIA 3C33A 5EQAA 4NX1A 1Y9UA 2ALUA 2OLBA 3CSBA 1VR5A 3B6QA 2NWJA 2HFBA 3TKDA 1K9ZA 1B5JA 2XX8A 2Q74A 4PFBA 1QGXA 4GFRA 2D21A 4N4UA 1N3XA 2V3TA 1AIVA 3FJMA 4Q0CA 3O6IA 2AIXA 2I4CA 5DVIA 1VFEA 4MH5A 1IUDA 3Q27A 1II5A 3VFJA 4G4PA 4OETA 1ZTYA 2I0BA 2HAUA 1NMUA 2NVUB 2L5VA 3OOAA 2FA7A 3N5LA 4XKRA 5FHOA 1MQGA 1O63A 4X8RA 2PT2A 2F34A 3FXRA 4IO6A 3EHSA 4GVOA 2XXVA 3LSFB 5ELVA 3VLUA 2XWVA 4XKPA 2A5TA 4R74A 4MNCA 4GWZA 4UA8A 3TCFA 1I69A 2FYIA 1IXIA 3MWBA 5EHMA 2HZKA 1O7TA 2XD3A 5J16A 4U21A 1D4NA 1US5A 3NOHA 1Y20A 3RN8A 3T66A 3PMVA 4F2QA 1Y4TA 1IMCA 2H5YA 3QUFA 4QFPA 2RKMA 1JQFA 2DE3A 2ZMBA 3IOWA 1GV8A 3C36A 5K2XA 1LB9A 3MPKA 2XXXA 3OO7A 3GLBA 1CE2A 3FV1A 2I0CA 1S7YA 4BDQA 4PTKA 5DVJA 3QUJA 5CMBA 3G3FA 4QF9A 5EYFA 1I6AA 2I48A 4HTGA 4LP2B 1QKAA 2X7PA 4YKJA 1J1NA 2QFLA 3U1OA 3T22A 4NF8A 3U65A 5I58B 4QFOA 2UYEA 3E3KA 4MNPA 1LCTA 2GHBA 1FBHA 2IEEA 4IGRA 3EQ1A 1SW1A 3IOVA 1DTZA 1MM7A 1SW2A 5AA2A 3K6UA 5IGAA 4ZE8A 2Q8JA 3KFMA 5DEXB 2CEXA 3K00A 2Q2CA 4P56A 4PFRA 4OA4A 2ONRA 4P8BA 1ZMGA 1SYHA 4R72A 3TTMA 4F3GA 4YICA 3JV9A 1MXWA 1IMDA 2O1MA 3IJXB 3RT8A 4F1UA 2Y5LA 4BDNA 5FBPA 4OVSA 3CFXA 1SI0A 4R9FA 1POTA 1ZIUA 3U92A 1A55A 2P2AA 5KDTA 4YU0A 3BFUA 1CB6A 3B6WA 1TXFA 2PMSA 3LSXA 5EHSA 1NV1A 4F1YA 4I3YA 3TQWA 1LAGE 2OWSA 5DTBA 2QS4A 4OZ9A 2JJKA 2HPGA 2UVGA 2P3NA 3K0VA 1P99A 1Q1KA 3KN7A 4G8NA 1NUWA 1SDXA 3T9UA 1IQ7A 4GWUA 2D3IA 1P1OA 4LA9A 2O51A 1FTOA 2O1LA 1FBEA 2H25A 2X7QA 1ANFA 1R9LA 5H8FA 4IY5A 3LSWA 4RJZA 1B0LA 2Q8MA 3H03A 4P11A 2DE4A 4IR8A 3W15C 1SW5A 3QMFA 3SKPA 4NHBA 5T3JA 2DP8A 5DVFA 5HM4B 4QFLA 4MBPA 2VD3A 4BDLA 4MFIA 1FQAA 2PYYA 5I2NB 4H8IA 2Q88A 4YB7A 1VE4A 1FBFA 2RC8A 5IM2A 1JEUA 2Z22A 1WVJA 3OO9A 1D9QA 2ZNTA 4NG7A 3L6HA 5FHMA 3ILUB 5EQ9A 4EXLA 5L9OA 1OLCA 3I3VA 3KOSA 3CIJA 4N8GA 1IMAA 4NF6B 1VSOA 2UVIA 4NF5B 3CSGA 3DP6A 4NF4A 5B70A 1CNQA 1URDA 4RXLA 4OANA 1EU8A 4ELQA 4JXIA 5AA3A 3C31A 1XT8A 4FE8A 1VDWA 2QS3A 4JVDA 2BJJX 1LBCA 4I3EA 4DCYA 4Q5TA 4PF6A 3K4UA 4X9TA 4HE0A 1MQHA 3OENA 5I2KA 2F8DA 2NXOA 1OMPA 4I9DA 1K9YA 3EPEA 2CZIA 3C9HA 4MNIA 3T1BA 3S9MC 3TUSA 1LLSA 4N07A 3O29A 4YB5A 4ESXA 3K1PA 3LBSA 3MVXA 3FVGA 4WKMA 1SPIA 3OELA 2Y7PA 2XWOA 1IZ1A 4ZS9A 5JTYB 3EN3A 4F22A 1MPCA 4KHZE 1N7WA 5I56A 4RPOA 2XXIA 4MEVA 2ZNSA 4PP0A 1Y3QA 5ESYA 2FVZA 4C0RA 4XXUA 4QSDA 4Q30B 3FJGA 1UTBA 3IO4A 1H45A 5A5LA 3RGYA 4GX6A 3KBRA 4EUOA 2KQZA 4I1DA 4Z7EA 5I7IA 4JWYA 4GWSA 3PUXE 1MY3A 4LZ7A 4O3CA 3RPLA 4JVIA 3H7MA 3MP6A 3A3UA 3SZPA 1EZOA 4THIA 3PPQA 3ODBA 1D9VA 3QK6A 4YAHX 4OFLA 5I59A 1USYE 3DLNA 3MVZA 4DXCA 2WEFA 3TMGA 2HEUA 4FIMA 4AQ4A 3KSJA 3DM0A 2R9JA 1B9JA 5TPAB 1JVYA 1IMFA 2UVJA 1MDP1 1FQDA 1D9YA 4GWXA 2OWTA 2B3FA 5M2VA 4KXPA 4H0WA 3V5AA 1AMFA 4NF0A 4GX3A 1RYXA 5F7VA 1IEJA 2R6GE 4ZEDA 3GXAA 3QSLA 4F18A 3CFZA 3B50A 3SERA 2P1SA 3ZKLA 2UXAA 3PMXA 3TAJA 3HO7A 2WYKA 3G3IA 1B3LA 2H99A 3UIFA 2CZKA 1ATGA 5ET5A 1B3HA 2HAVA 4GL0A 1M5BA 3OMBA 1NUZA 1XS5A 1ZJLA 2ZZVA 3K6WA 1MH3A 2OK2A 4MCOA 1BLFA 3O28A 3DP8A 5J1DA 4PBHA 1A7LA 1LBYA 4NWCA 4R75A 4R6KA 1LAFE 3VLVA 5AE4A 1DSNA 2ZZWA 1B1XA 1TFDA 3LR1A 1JW1A 3RUMA 4EQ9A 1NV6A 5CC2A 1RDZA 3OD7A 4PC9A 2KR0A 4DI3D 1SW4A 4G68A 3U72A 4GBWA 4M1VA 4NN3A 4ELOA 4ECFA 3Q28A 1NL5A 2DS9A 1MQJA 4NTLA 2F78A 3PPRA 1MS7A 3O2AA 2GQ1A 4EDPA 3FV2A 4DZ1A 3IX1A 3M3FA 1JEVA 4YZZA 1EH3A 2DVCA 1B32A 4NQ8A 2CMOA 3N94A 3P7IA 4XTCQ 1Y1MA 4XIGQ 1Y3NA 3FD3A 3PV0E 3W9WA 4JWXA 1MQIA 3RY3A 4GRKA 4DE8A 1P1NA 4IB2A 4JBZA 2WYPA 3KBZA 3H6UA 5F24A 1N04A 2XA5A 3JYRA 1LBXA 2QRYA 5TU0A 5BUUA 4N91A 4NGUA 2DQVA 4AB5A 3FASA 4GLIA 1AOVA 1NH8A 4KYEA 3E4RA 2H9BA 4G8MA 2XXHA 1EYJA 1NI9A 2GRVA 3QAXA 2F6GA 5H8NB 3K6VA 4GWYA 3C34A 3TZAA 1PB9A 3Q29A 5EQ7A 2FBPA 3T93B 2PFZA 4DXBA 5H8FB 4EQ7A 3HPIA 4RK2A 3UN6A 1GGGA 1FQFA 4FBPA 5ET7A 2P3VA 1M5CA 1FTKA 4EF1A 4MMPA 3ROJA 2B65A 5I56B 2I3WA 1FJ9A 5ET6A 1Z7NE 1ZKBA 4MX6A 4HXVA 1B51A 3CI8A 1NV2A 4H5GA 1LBBA 4FECA 3TODA 3GZGA 4U4SA 4DDDA 3B8BA 3VXCA 1NNPA 3EHTA 4OWDA 4HCYA 4G68C 3U8QA 3C32A 2FNCA 3KGCA 1YPNA 4IO4A 3QYTA 5ISUA 1MXXA 3R26A 4GXAA 5DT6A 3KC1A 3QXMA 5H8HA 4ZZEA 3SEVA 1MPDA 4NF4B 3A29A 3S4UA 4AS4A 2Q2AA 2VGQA 1IITA 1ZU0A 1RKMA 3O66A 3OEKA 1YCJA 4QSCA 5TP9B 1XHYA 2AL4A 3U93A 4OEUA 1N76A 1BK4A 3KC0A 2F5XA 3IJOB 4PFYA 1S9TA 3SDFA 4GXSB 3SEWA 2I4BA 4G8HA 5IZ1A 1B3EA 2I3VA 4AS5A 1VFDA 1SD3A 2PVUA 4GF8A 1NNFA 4OVTA 4PQJA 2ESNA 4P3LA 2F3DA 2F36A 4FEBA 2PCRA 2GHAA 4U22A 3LUYA 4C1TA 3V89B 4KCCA 4FJPA 4JVCA 4ZEKA 2AYSA 4QFNA 5ICQA 1OIBA 2B4LA 1XVXA 2DYXA 2QVRA 4LQ2A 4POWA 5KZTA 4LZ5A 3R7XA 2O69A 2O7UA 3H06B 4K3FA 4L17A 4YMBA 1UTHA 1RDYA 4AB6A 3K01A 3L6GA 4ESWA 1AH5A 1FBPA 5ICTA 4IGTA 1QKBA 1PEBA 4X1DA 3O97A 5CM6A 4IY6A 1R9QA 1EYKA 5I5PA 4BDMA 4YB6A 1LAXA 2P0SA 5DW8A 3ISPA 1B46A 5CRYA 4R73A 1P1QA 1DOTA 1FPBA 2DDKA 5CMCA 4PGNA 1XOCA 4F3SA 3IFCA 1JW4A 4OMBA 4FEDA 4PGPA 1URGA 3G3GA 4PDHA 4KQPA 4NAPA 2I58A 2I49A 3ECRA 3IL1B 3MUQA 4MLQA 2A5SA 2OX3A 3FIRA 3VXBA 2V84A 4F2OA 3T9HB 4XEQA 1LCFA 1H43A 3H4ZA 3TELA 4PAFA 1FPLA 4DIGA 3IOUA 3DP4A 1NV5A 3VVFA 4PBQA 1N84A 3GYYA 1B2HA 2F7CA 2ZYMA 2XWKA 3MPLA 1B7HA 2F3BA 2QJEA 3SESA 1DCUA 3RTWB 4XFEA 4R6HA 2VHAA 4HS7A 1POY1 1BP5A 2VP1A 2Y7KA 3RT6B 3TFLA 2IA4A 3PGFA 4P1LA 1T0KA 2CEYA 1TT1A 4NF5A 4F19A 2HHMA 1SVXB 3PUYE 1H44A 4PAKA 3OO6A 3FXUA 1HSJA 4BDRA 2XXKA 4N6KA 2V3UA 4IO2A 1DPEA 2DXRA 4NEDA 3K1NA 4MHFA 3FATA 5FTHA 4TOZA 5KCJB 5DYHA 1BIYA 4U23A 4NF6A 1OLAA 2ANJA 3N6UA 1NV0A 4GWOA 4H45A 2XXPA 4O7IA 4GQOA 5ITPA 5ET8A 1MXYA 3N26A 1IMBA 1S50A 1MM6A 3HHGA 4MLVA 3HHFA 2ZZXA 4PE3A 5JK4A 1WDNA 4P1EA 2DXYA 4N6DA 4WXJA 1SYIA 1FBDA 2VT5A 2CZHA 3F11A 1B3FA 4JWOA 4KFQA 3JZJA 3VV5A 2ABHA 1MRPA 4PDDA 2HCAA 4XKNA 3SEXA 4HCWA 4PFIA 1QUJA 5H8QB 4KR5A 5I2KB 4U1OA 4GIZA 1MY4A 3KN3A 2DWIA 2V3QA 1TFAA 4F3BA 1QULA 3QIMA 2BJIA 1A99A 1QUIA 4U2RA 1R1NA 4FAJA 3D4GA 3OSRA 3TDJA 2QMWA 1URSA 3PPNA 1BTJA 2UYFA 4OVJA 4P9KA 3E79A 1UTBB 2H4IA 1WODA 3K02A 4LVQA 3TYHA 3O6HA 1Y1ZA 3BIGA 1GVCA 4H46A 3IOTA 1I6BA 3DELB 5TPAA 3OO8A 4OESA 1LBVA 5L9MA 3I5OA 4DXUA 2E1SA 3EKIA 3PMWA 4EXKA 4TQUQ 1EYIA 1YTVA 3G3HA 4LZ8A 3PUWE 2Z8FA 4N6PA 4F3PA 3FVOA 5DEXA 1OQHA 1JNFA 3BKIB 1M5DA 4G68B 1G0IA 3FXBA 2ZYOA 1A54A 4F1VA 3PD9A 3E13X 3PPOA 4LATA 4QSEA 4BDOA 3KZGA 4E0XA 3TCHA 4EF2A 1IMEA 1EZPA 4OQOA 4WEPA 4I40A 3UP9A 2HZLA 3OXNA 4F31B 4O8MA 1DMBA 2XXQA 4PE5B 4X48A 1D3KA 2NUVA 5A5XA 5JTYA 5KDTB 3SEYA 1ZLQA 2QS1A
chains in the Genus database with same CATH topology
3CI8A 5JEIA 2PMSA 3S9LC 3LSXA 3MBPA 4KCDA 4H5GA 5EHSA 4PFUA 4F1YA 1LBBA 4FECA 4KYDA 3GZGA 1MH4A 1LAGE 1FQBA 1XVYA 4RY1A 4U4SA 2OWSA 2XD2A 5DTBA 4DDDA 2QS4A 1MXUA 2RF1A 3PPPA 4OZ9A 2UVGA 3K0VA 2ONSA 1P99A 3VXCA 1Q1KA 3KN7A 4BLAA 4C1UA 4ZECA 2PT1A 3HSTA 1NNPA 3EHTA 4H1XA 4G8NA 4HCYA 4FORA 4OXVA 4OWDA 4G68C 3U8QA 4OTEA 1SDXA 3MP1A 3C32A 1GTKA 3IR1A 4OYVA 3T96B 3T9UA 2FNCA 1N7XA 3KGCA 1YPNA 4IO4A 4JB7A 3QYTA 4N13A 1IQ7A 3IAZA 3T9VA 1MY1A 5ISUA 3RQTA 1MXXA 2DWAA 4YKKA 3R26A 4GXAA 4IO3A 3H6TA 5DT6A 2ONKE 1IXHA 2D3IA 1B5IA 1PB8A 3EF7A 1P1OA 2REGA 4POXA 2ZYNA 3QXMA 4DLDA 4LA9A 4RA1A 2O51A 3S9EA 5H8HA 3TCGA 4ZEIA 4ZZEA 1FTOA 3SEVA 2O1LA 1MPDA 1MY2A 1UTHB 2H25A 2X7QA 4LONB 4NF4B 3S4UA 1ANFA 1R9LA 3G7WA 5H8FA 4IY5A 5AA4A 1GR2A 2X26A 3LSWA 1PBPA 2Q2AA 2VGQA 2O6AA 4PFWA 4RJZA 1SI1A 4ELPA 1IITA 1B0LA 1RKMA 1ZU0A 3H03A 3O66A 3OEKA 4ZZAA 3S2VA 1YCJA 4QSCA 1NNKA 2WKYA 4P11A 5TP9B 1XHYA 2AL4A 1LB8A 3U93A 3CRBA 4U1ZA 1B52A 1MG1A 2DE4A 4OEUA 4YKPA 4H8JA 1N76A 4GD5A 4IO5A 2ZYKA 3W15C 5TP9A 1SW5A 2F5XA 3SKPA 4R2BA 3IJOB 4PFYA 2RINA 3IB1A 1S9TA 3U94A 3SDFA 3TTRA 1MXVA 2OCUA 2PX1A 2XXRA 2DP8A 5DVFA 3HN0A 4GXSB 3SEWA 2YJPA 5HM4B 4QFLA 5B7DA 1HSLA 2I4BA 4MBPA 5LOMA 2VD3A 3B6TA 3R6UA 4G8HA 2Z23A 1B3EA 4BDLA 1EZ9A 2I3VA 4QHQA 4U4XA 3MZ1A 4YB7A 4MFIA 2Z8EA 3OEMA 1FQAA 2PYYA 5I2NB 4H8IA 1VFDA 1SD3A 4YMAA 2PVUA 1B5HA 2Q88A 4GF8A 4QFKA 5AA1A 1NNFA 2VD2A 1PBQA 3Q25A 1USYH 3MAMA 1MY0A 2KLFA 4PQJA 1VE4A 2F6PA 2ESNA 4P0GA 3TODA 4LUBA 2RC8A 2F7AA 1NKXA 1JEUA 2OBGA 2AL5A 3TUSA 1MQDA 3VLWA 4F29A 4FEBA 2F36A 2Z22A 1IXGA 1FQCA 5HPQA 1WVJA 3OO9A 3RLFE 2YPNA 1DTGA 5IAIA 2GHAA 2ZNTA 1OQGA 3MC2A 4U22A 3L6HA 3VVDA 2PBWA 1ELJA 4ISUA 3LUYA 1B3GA 2DE2A 5FHMA 4C1TA 3V89B 4OHNA 3ILUB 4KCCA 5AA2B 5L9SA 4EXLA 3TEPA 4FJPA 1KWHA 1LFHA 4ZEKA 2QL3A 2E0SA 2AYSA 5L9OA 1FW0A 1OLCA 4QFNA 5ICQA 3H6VA 4PFTA 1IXCA 3KN8A 4JDFA 3SEUA 3THIA 3MW0A 3I3VA 3KOSA 3CIJA 1OIBA 4NF6B 3PUVE 1VSOA 4O3AA 3S9NC 2UVIA 4NF5B 4H67A 1FQEA 2YLNA 3T9XB 1B0HA 3CSGA 3DP6A 3IB0A 3TQLA 1Q35A 2LAOA 4NF4A 1XVXA 3MZBA 5B70A 1N0TA 5ITOA 2DYXA 1URDA 4RXLA 2NOOA 1F9BA 3GBAA 4LQ2A 4POWA 5KZTA 5CI5A 1EU8A 4LZ5A 4ELQA 1M5FA 2XXTA 4JXIA 2O69A 3C4MA 3FJ7A 3R7XA 4NF8B 5AA3A 5I58A 2GH9A 3C31A 1XT8A 4FE8A 2O7UA 3H06B 3AXFA 3M8UA 4K3FA 4L17A 4YMBA 1UTHA 2QS3A 2Y7RA 2BJJX 1LBCA 2THIA 3CG1A 3K01A 4AB6A 4DCYA 1JVXA 3L6GA 3RNNA 1AH5A 3W9VA 4ESWA 5I59B 1MDQA 3EHUA 3I6VA 4IGTA 1QKBA 4KI0E 1PEBA 5ICTA 1JW5A 2O7IA 4Q5TA 4X1DA 4OEVA 4R9GA 5H8QA 1AIVA 3TTNA 3O97A 5CM6A 4GL8A 3K4UA 4IY6A 1R9QA 4X9TA 3ZKKA 1MXZA 4BDMA 1Z7ME 4YB6A 1LAXA 2P0SA 5CMKA 3CR9A 4RYAA 5H8NA 1MQHA 3OENA 5CRYA 1B46A 1I6QA 1PB7A 3ILTB 4Z0IA 5I2KA 4R73A 4G77A 1P1QA 1DOTA 4GOTA 2F8DA 4O3BA 2NXOA 5CMCA 4NWDA 1OMPA 1XOCA 1SQYA 4F3SA 1LSTA 4EQBA 2DWHA 3E9XA 4I9DA 1JW4A 4OMBA 4FEDA 4ZDMA 1B7UA 1FTLA 1DPPA 2W7YA 1URGA 2DVZA 3USDA 3PD8A 3G3GA 5CMMA 1FTJA 1P1WA 3IK6B 1IIWA 4KQPA 1B58A 2Y7WA 2QPQA 3IORA 3TTKA 2QSXA 3EPEA 2I58A 2HQ0A 3C9HA 1A8FA 3D4CA 4G2ZA 4NE4A 2I49A 5F1QA 3ECRA 3O6GA 3IL1B 2B3BA 3MUQA 4MLQA 2A5SA 5BWJA 1LLSA 3S9MC 4I8CA 3FIRA 3O29A 4N07A 4YB5A 3VXBA 4ZE9A 4ESXA 3K2DA 4JSOA 3K1PA 3LBSA 3MVXA 2V84A 4QRZA 1OVTA 5KCJA 1H3DA 4F2OA 1MPBA 3FVGA 5A5XB 3T9HB 4WKMA 1P1UA 3OELA 2O84X 2GFEA 2Y7PA 3TQWA 1LCFA 3ZS6A 3CFLA 2V25A 4ZEFA 3VDFA 5I57B 1M5EA 1IZ1A 4ZS9A 5JTYB 3A09A 1H43A 3EN3A 3H4ZA 1O64A 4ONYA 2REJA 4F22A 1MPCA 2QMXA 4KHZE 3TELA 4DIGA 4M4GA 1N7WA 5I56A 4XKQA 4RPOA 3IOUA 2G29A 1UIVA 3DP4A 2XXIA 5FTIA 1N3WA 2OZZA 3LSLA 2ZNSA 3H6WA 4MF3A 4OFJA 3BFTA 3VVFA 4PP0A 1AL3A 1ZBMA 1Y3QA 5H8HB 1A8EA 5HBCA 3UA8A 1N84A 3K6XA 4C0RA 4XXUA 1NFTA 1B2HA 2F7CA 2ZYMA 4OERA 4QSDA 5CBSA 2XXWA 3FJGA 1UTBA 2Q89A 3IO4A 1B7HA 3MPLA 1FCKA 4Q30B 2A5TB 1L5TA 1H45A 2QJEA 3VVEA 1NH7A 2RC7A 3SESA 1YAEA 3FZVA 2M8CA 4YKIA 3RGYA 3RTWB 3C33A 4Q8RA 3KBRA 2XX7A 2DWJA 4R6HA 4EUOA 1Y9UA 2ALUA 2VHAA 1A40A 3FVKA 4HS7A 1FTMA 1BP5A 1POY1 2OLBA 2VP1A 3CSBA 2F7BA 3MP8A 1VR5A 2Y7KA 4RK9A 3RT6B 3B6QA 3MVWA 4I1DA 3TPAA 3TFLA 4Z7EA 1XC1A 2IA4A 3FVNA 2ZXTA 3G3JA 3PGFA 2NWJA 3ONMA 2VOZA 4JWYA 2HFBA 1HSEA 1T0KA 1TWYA 1TT1A 3TKDA 4NF5A 3PUXE 4F19A 1MY3A 4LZ7A 4O3CA 1B6HA 3H7MA 1R6ZA 1B5JA 3MP6A 2XX8A 1SVXB 1QUKA 3PUYE 3RTFB 1H44A 4AQ4A 3A3UA 3OSQA 4GFRA 3IB2A 2D21A 1H76A 3OO6A 3FXUA 1HSJA 1EZOA 4BDRA 1N3XA 4THIA 3M3LA 3PPQA 3ODBA 1D9VA 3QK6A 4YAHX 4NMYA 4OFOA 2V3TA 4KPTA 4OFLA 2V3UA 3BBRA 5K2YA 3FJMA 4FATA 4IO2A 1USYE 5I59A 1DPEA 3DLNA 4F39A 4Q0CA 3MVZA 3O6IA 1BKAA 2AIXA 2I4CA 1VFEA 2DXRA 5DVIA 2RCBA 4MH5A 4DXCA 4NEDA 3TMGA 1IUDA 2HEUA 3K1NA 3Q27A 4FIMA 1PC3A 1II5A 3FATA 3KSJA 3DM0A 5FTHA 3VFJA 4G4PA 4TOZA 5I84A 4RNSA 2R9JA 4OETA 1B9JA 5TPAB 1ZTYA 4LQ5A 5KCJB 2I0BA 2HAUA 1BIYA 1JVYA 1NMUA 2UVJA 1MDP1 1FQDA 5DYHA 2NVUB 1D9YA 3OOAA 2XXYA 4ND9A 4NF6A 4OENA 2FA7A 4U23A 2OWTA 2B3FA 3N5LA 1OLAA 5M2VA 4XKRA 4H0WA 3PU5A 2ANJA 5FHOA 3V5AA 1AMFA 1B4ZA 3HV1A 3MZ9A 3HCQA 1MQGA 1RYXA 3N6UA 1O63A 4WEDA 5F7VA 1IEJA 3MVYA 4GWOA 4KD5A 2PT2A 2F34A 3CVGA 2R6GE 3M3KA 3FXRA 2XXPA 4ZEDA 4IO6A 3GXAA 4GQOA 2HXWA 3QSLA 4DCXA 5ITPA 4UACA 4F18A 1LFGA 1MXYA 3CFZA 3EHSA 3N26A 3SERA 4GVOA 2P1SA 4ELRA 2XXVA 3ZKLA 1S50A 1MM6A 2UXAA 3HHGA 3LSFB 2DOJA 3PMXA 5ELVA 3VLUA 3TAJA 1QJMA 4MLVA 3HO7A 5AA4B 4XKPA 3G3IA 1B3LA 2A5TA 2H99A 3G3KA 3HHFA 3UIFA 1ATGA 1B3HA 1B40A 3V8XB 4R74A 2HAVA 2Q9TA 4GL0A 2RCAA 4UA8A 3V83A 3TCFA 1I69A 5JK4A 1WDNA 2FYIA 1M5BA 1B4HA 1IXIA 3MWBA 3OMBA 4TLLB 5EHMA 2HZKA 1O7TA 2DXYA 2XD3A 4WXJA 1XS5A 1ZJLA 1SYIA 1OVBA 3K6WA 1MH3A 1B7ZA 4U21A 2RC9A 3F11A 1B3FA 2OK2A 4JWOA 4KFQA 1BLFA 3JZJA 1D4NA 3O28A 1US5A 2ABHA 1MRPA 1LAHE 3O9PA 3VV5A 3DP8A 4HW8A 5J1DA 2HCAA 4XKNA 1Y20A 4X1BA 3RN8A 3T66A 3PMVA 1A7LA 3SEXA 4HCWA 4KYSA 1Y4TA 4NWCA 4R75A 4F2QA 1QUJA 4R6KA 2XHDA 1LAFE 3VLVA 3TTLA 5AE4A 5CBRA 2H5YA 5H8QB 4H5FA 5H8SA 1DSNA 3QUFA 4KR5A 1B1XA 1TFDA 3LR1A 2CZLA 4QFPA 5I2KB 2RKMA 3MQ9A 1JQFA 1JW1A 4U1OA 5L8DA 2DE3A 4GIZA 3RUMA 1MY4A 2ZMBA 3IOWA 3KN3A 4H6DA 4EQ9A 3CG3A 5CC2A 2DWIA 2V3QA 1TFAA 2Y7IA 3OD7A 4F3BA 4JSDA 1B1HA 2R71A 1QULA 3QIMA 3Q26A 3UK4A 1GV8A 1SW4A 1A99A 4G68A 3U72A 3C36A 3KG2A 4E0WA 5K2XA 4M1VA 2Y84A 1LB9A 2Z8DA 3MPKA 1QUIA 2XXXA 4U2RA 1R1NA 3OO7A 4ELOA 4FAJA 3GLBA 4IO7A 4ECFA 3Q28A 4RPNA 1NL5A 2DS9A 1MQJA 3UORA 5I57A 2F35A 4NTLA 1CE2A 2F78A 2G93A 2I0CA 2V93A 3D4GA 3FV1A 3OSRA 3PPRA 1S7YA 1MS7A 3O2AA 4BDQA 5DVJA 4EDPA 3FV2A 3TDJA 3ZSFA 4ZEBA 3K1MA 4DZ1A 3QUJA 1UIUA 3IX1A 1JEVA 3M3FA 5CMBA 2QMWA 1URSA 3G3FA 3PPNA 4QF9A 1BTJA 1UQWA 2UYFA 4OVJA 5EYFA 1I6AA 2I48A 4HTGA 1LFIA 1UTBB 2QS2A 4LP2B 2H4IA 1QKAA 2X7PA 1WODA 1EH3A 1J1NA 2DVCA 3K02A 4YKJA 4YZZA 3H3GA 4LVQA 1B32A 3TYHA 3O6HA 4H65A 3C35A 2CMOA 3U1OA 3N94A 3P7IA 4XTCQ 1Y1ZA 3T22A 4R2FA 1RYOA 2ZNUA 3FGSA 1Y1MA 4NF8A 5I58B 2UVHA 1GVCA 2H98A 3PUZE 3FUZA 3WAFA 4XIGQ 4QFOA 3IOTA 1I6BA 1Y3NA 2F97A 3FD3A 3PV0E 3W9WA 1B05A 2UYEA 4JWXA 1MQIA 3DELB 3RY3A 5TPAA 3OO8A 3E3KA 4GRKA 4DE8A 3KJTA 1P1NA 4IB2A 1LCTA 4JBZA 4OESA 2GHBA 2XXUA 3H6UA 3KEIA 1N04A 1QVSA 3FXQA 5L9MA 2IEEA 3I5OA 1QW0A 1NNTA 3JYRA 4IGRA 4DXUA 2QRYA 5TU0A 3VE1B 2O68A 2E1SA 3EQ1A 5BUUA 1AOVA 1SW1A 4TLMB 5IKBA 3LC8A 3PMWA 3IOVA 4TQUQ 4EXKA 1DTZA 1SBPA 1MM7A 1SW2A 3MJNA 3SETA 5AA2A 1YTVA 3G3HA 3K6UA 4LZ8A 2DQVA 5FHNA 3N6TA 4ZE8A 2Q8JA 4AB5A 3FASA 2XX9A 1PDAA 3KFMA 1NH8A 3PUWE 3E4RA 4GLIA 4KYEA 2Z8FA 4N6PA 5DEXB 4F3PA 2H9BA 1Y4CA 4I62A 3K00A 3FVOA 2Q2CA 2XXHA 4G8MA 5DEXA 2GRVA 1LGBC 3QAXA 2F6GA 1US4A 4P0IA 1OQHA 5H8NB 2ONRA 1JNFA 1ZMGA 3BKIB 1SYHA 3K6VA 1M5DA 4R72A 4G68B 3RPWA 3TTMA 1Y3PA 3GBBA 3C34A 3KJ7A 4F3GA 3TZAA 1PB9A 4YICA 3Q29A 2D5WA 2ZYOA 3JV9A 1A54A 3T93B 4F1VA 1MXWA 4DXBA 5H8FB 3PD9A 3E13X 3PPOA 4LATA 4QSEA 2O1MA 3HPIA 4EQ7A 3IJXB 4RK2A 3RT8A 1JETA 3UN6A 1GGGA 1FQFA 4F1UA 4BDOA 3KZGA 4E0XA 3B7DA 3A3CA 3TCHA 4EF2A 4PETA 1EZPA 4BDNA 3IO6A 3WAEA 4OQOA 1M5CA 1FTKA 3CFXA 4WEPA 5AA2D 1SI0A 2DSFA 4EF1A 3UP9A 2HZLA 4R9FA 1POTA 1ZIUA 3OXNA 3U92A 2B65A 3KOTA 3UGWA 5I56B 4R6YA 4F31B 1A55A 2I3WA 2P2AA 1DMBA 5KDTA 2XXQA 4YU0A 2I6EA 3BFUA 3KSXA 4PE5B 4X48A 1D3KA 2NUVA 5A5XA 5JTYA 5KDTB 1Z7NE 1CB6A 1ZKBA 3B6WA 5I2NA 2OJTA 3SEYA 1ZLQA 1TXFA 1B51A 2QS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CI8 A;  5JEI A;  2PMS A;  3S9L C;  3LSX A;  3MBP A;  4KCD A;  4H5G A;  5EHS A;  4PFU A;  4F1Y A;  1LBB A;  4FEC A;  4KYD A;  3GZG A;  1MH4 A;  1LAG E;  1FQB A;  1XVY A;  4RY1 A;  4U4S A;  2OWS A;  2XD2 A;  5DTB A;  4DDD A;  2QS4 A;  1MXU A;  2RF1 A;  3PPP A;  4OZ9 A;  2UVG A;  3K0V A;  2ONS A;  1P99 A;  3VXC A;  1Q1K A;  3KN7 A;  4BLA A;  4C1U A;  4ZEC A;  2PT1 A;  3HST A;  1NNP A;  3EHT A;  4H1X A;  4G8N A;  4HCY A;  4FOR A;  4OXV A;  4OWD A;  4G68 C;  3U8Q A;  4OTE A;  1SDX A;  3MP1 A;  3C32 A;  1GTK A;  3IR1 A;  4OYV A;  3T96 B;  3T9U A;  2FNC A;  1N7X A;  3KGC A;  1YPN A;  4IO4 A;  4JB7 A;  3QYT A;  4N13 A;  1IQ7 A;  3IAZ A;  3T9V A;  1MY1 A;  5ISU A;  3RQT A;  1MXX A;  2DWA A;  4YKK A;  3R26 A;  4GXA A;  4IO3 A;  3H6T A;  5DT6 A;  2ONK E;  1IXH A;  2D3I A;  1B5I A;  1PB8 A;  3EF7 A;  1P1O A;  2REG A;  4POX A;  2ZYN A;  3QXM A;  4DLD A;  4LA9 A;  4RA1 A;  2O51 A;  3S9E A;  5H8H A;  3TCG A;  4ZEI A;  4ZZE A;  1FTO A;  3SEV A;  2O1L A;  1MPD A;  1MY2 A;  1UTH B;  2H25 A;  2X7Q A;  4LON B;  4NF4 B;  3S4U A;  1ANF A;  1R9L A;  3G7W A;  5H8F A;  4IY5 A;  5AA4 A;  1GR2 A;  2X26 A;  3LSW A;  1PBP A;  2Q2A A;  2VGQ A;  2O6A A;  4PFW A;  4RJZ A;  1SI1 A;  4ELP A;  1IIT A;  1B0L A;  1RKM A;  1ZU0 A;  3H03 A;  3O66 A;  3OEK A;  4ZZA A;  3S2V A;  1YCJ A;  4QSC A;  1NNK A;  2WKY A;  4P11 A;  5TP9 B;  1XHY A;  2AL4 A;  1LB8 A;  3U93 A;  3CRB A;  4U1Z A;  1B52 A;  1MG1 A;  2DE4 A;  4OEU A;  4YKP A;  4H8J A;  1N76 A;  4GD5 A;  4IO5 A;  2ZYK A;  3W15 C;  5TP9 A;  1SW5 A;  2F5X A;  3SKP A;  4R2B A;  3IJO B;  4PFY A;  2RIN A;  3IB1 A;  1S9T A;  3U94 A;  3SDF A;  3TTR A;  1MXV A;  2OCU A;  2PX1 A;  2XXR A;  2DP8 A;  5DVF A;  3HN0 A;  4GXS B;  3SEW A;  2YJP A;  5HM4 B;  4QFL A;  5B7D A;  1HSL A;  2I4B A;  4MBP A;  5LOM A;  2VD3 A;  3B6T A;  3R6U A;  4G8H A;  2Z23 A;  1B3E A;  4BDL A;  1EZ9 A;  2I3V A;  4QHQ A;  4U4X A;  3MZ1 A;  4YB7 A;  4MFI A;  2Z8E A;  3OEM A;  1FQA A;  2PYY A;  5I2N B;  4H8I A;  1VFD A;  1SD3 A;  4YMA A;  2PVU A;  1B5H A;  2Q88 A;  4GF8 A;  4QFK A;  5AA1 A;  1NNF A;  2VD2 A;  1PBQ A;  3Q25 A;  1USY H;  3MAM A;  1MY0 A;  2KLF A;  4PQJ A;  1VE4 A;  2F6P A;  2ESN A;  4P0G A;  3TOD A;  4LUB A;  2RC8 A;  2F7A A;  1NKX A;  1JEU A;  2OBG A;  2AL5 A;  3TUS A;  1MQD A;  3VLW A;  4F29 A;  4FEB A;  2F36 A;  2Z22 A;  1IXG A;  1FQC A;  5HPQ A;  1WVJ A;  3OO9 A;  3RLF E;  2YPN A;  1DTG A;  5IAI A;  2GHA A;  2ZNT A;  1OQG A;  3MC2 A;  4U22 A;  3L6H A;  3VVD A;  2PBW A;  1ELJ A;  4ISU A;  3LUY A;  1B3G A;  2DE2 A;  5FHM A;  4C1T A;  3V89 B;  4OHN A;  3ILU B;  4KCC A;  5AA2 B;  5L9S A;  4EXL A;  3TEP A;  4FJP A;  1KWH A;  1LFH A;  4ZEK A;  2QL3 A;  2E0S A;  2AYS A;  5L9O A;  1FW0 A;  1OLC A;  4QFN A;  5ICQ A;  3H6V A;  4PFT A;  1IXC A;  3KN8 A;  4JDF A;  3SEU A;  3THI A;  3MW0 A;  3I3V A;  3KOS A;  3CIJ A;  1OIB A;  4NF6 B;  3PUV E;  1VSO A;  4O3A A;  3S9N C;  2UVI A;  4NF5 B;  4H67 A;  1FQE A;  2YLN A;  3T9X B;  1B0H A;  3CSG A;  3DP6 A;  3IB0 A;  3TQL A;  1Q35 A;  2LAO A;  4NF4 A;  1XVX A;  3MZB A;  5B70 A;  1N0T A;  5ITO A;  2DYX A;  1URD A;  4RXL A;  2NOO A;  1F9B A;  3GBA A;  4LQ2 A;  4POW A;  5KZT A;  5CI5 A;  1EU8 A;  4LZ5 A;  4ELQ A;  1M5F A;  2XXT A;  4JXI A;  2O69 A;  3C4M A;  3FJ7 A;  3R7X A;  4NF8 B;  5AA3 A;  5I58 A;  2GH9 A;  3C31 A;  1XT8 A;  4FE8 A;  2O7U A;  3H06 B;  3AXF A;  3M8U A;  4K3F A;  4L17 A;  4YMB A;  1UTH A;  2QS3 A;  2Y7R A;  2BJJ X;  1LBC A;  2THI A;  3CG1 A;  3K01 A;  4AB6 A;  4DCY A;  1JVX A;  3L6G A;  3RNN A;  1AH5 A;  3W9V A;  4ESW A;  5I59 B;  1MDQ A;  3EHU A;  3I6V A;  4IGT A;  1QKB A;  4KI0 E;  1PEB A;  5ICT A;  1JW5 A;  2O7I A;  4Q5T A;  4X1D A;  4OEV A;  4R9G A;  5H8Q A;  1AIV A;  3TTN A;  3O97 A;  5CM6 A;  4GL8 A;  3K4U A;  4IY6 A;  1R9Q A;  4X9T A;  3ZKK A;  1MXZ A;  4BDM A;  1Z7M E;  4YB6 A;  1LAX A;  2P0S A;  5CMK A;  3CR9 A;  4RYA A;  5H8N A;  1MQH A;  3OEN A;  5CRY A;  1B46 A;  1I6Q A;  1PB7 A;  3ILT B;  4Z0I A;  5I2K A;  4R73 A;  4G77 A;  1P1Q A;  1DOT A;  4GOT A;  2F8D A;  4O3B A;  2NXO A;  5CMC A;  4NWD A;  1OMP A;  1XOC A;  1SQY A;  4F3S A;  1LST A;  4EQB A;  2DWH A;  3E9X A;  4I9D A;  1JW4 A;  4OMB A;  4FED A;  4ZDM A;  1B7U A;  1FTL A;  1DPP A;  2W7Y A;  1URG A;  2DVZ A;  3USD A;  3PD8 A;  3G3G A;  5CMM A;  1FTJ A;  1P1W A;  3IK6 B;  1IIW A;  4KQP A;  1B58 A;  2Y7W A;  2QPQ A;  3IOR A;  3TTK A;  2QSX A;  3EPE A;  2I58 A;  2HQ0 A;  3C9H A;  1A8F A;  3D4C A;  4G2Z A;  4NE4 A;  2I49 A;  5F1Q A;  3ECR A;  3O6G A;  3IL1 B;  2B3B A;  3MUQ A;  4MLQ A;  2A5S A;  5BWJ A;  1LLS A;  3S9M C;  4I8C A;  3FIR A;  3O29 A;  4N07 A;  4YB5 A;  3VXB A;  4ZE9 A;  4ESX A;  3K2D A;  4JSO A;  3K1P A;  3LBS A;  3MVX A;  2V84 A;  4QRZ A;  1OVT A;  5KCJ A;  1H3D A;  4F2O A;  1MPB A;  3FVG A;  5A5X B;  3T9H B;  4WKM A;  1P1U A;  3OEL A;  2O84 X;  2GFE A;  2Y7P A;  3TQW A;  1LCF A;  3ZS6 A;  3CFL A;  2V25 A;  4ZEF A;  3VDF A;  5I57 B;  1M5E A;  1IZ1 A;  4ZS9 A;  5JTY B;  3A09 A;  1H43 A;  3EN3 A;  3H4Z A;  1O64 A;  4ONY A;  2REJ A;  4F22 A;  1MPC A;  2QMX A;  4KHZ E;  3TEL A;  4DIG A;  4M4G A;  1N7W A;  5I56 A;  4XKQ A;  4RPO A;  3IOU A;  2G29 A;  1UIV A;  3DP4 A;  2XXI A;  5FTI A;  1N3W A;  2OZZ A;  3LSL A;  2ZNS A;  3H6W A;  4MF3 A;  4OFJ A;  3BFT A;  3VVF A;  4PP0 A;  1AL3 A;  1ZBM A;  1Y3Q A;  5H8H B;  1A8E A;  5HBC A;  3UA8 A;  1N84 A;  3K6X A;  4C0R A;  4XXU A;  1NFT A;  1B2H A;  2F7C A;  2ZYM A;  4OER A;  4QSD A;  5CBS A;  2XXW A;  3FJG A;  1UTB A;  2Q89 A;  3IO4 A;  1B7H A;  3MPL A;  1FCK A;  4Q30 B;  2A5T B;  1L5T A;  1H45 A;  2QJE A;  3VVE A;  1NH7 A;  2RC7 A;  3SES A;  1YAE A;  3FZV A;  2M8C A;  4YKI A;  3RGY A;  3RTW B;  3C33 A;  4Q8R A;  3KBR A;  2XX7 A;  2DWJ A;  4R6H A;  4EUO A;  1Y9U A;  2ALU A;  2VHA A;  1A40 A;  3FVK A;  4HS7 A;  1FTM A;  1BP5 A;  1POY 1;  2OLB A;  2VP1 A;  3CSB A;  2F7B A;  3MP8 A;  1VR5 A;  2Y7K A;  4RK9 A;  3RT6 B;  3B6Q A;  3MVW A;  4I1D A;  3TPA A;  3TFL A;  4Z7E A;  1XC1 A;  2IA4 A;  3FVN A;  2ZXT A;  3G3J A;  3PGF A;  2NWJ A;  3ONM A;  2VOZ A;  4JWY A;  2HFB A;  1HSE A;  1T0K A;  1TWY A;  1TT1 A;  3TKD A;  4NF5 A;  3PUX E;  4F19 A;  1MY3 A;  4LZ7 A;  4O3C A;  1B6H A;  3H7M A;  1R6Z A;  1B5J A;  3MP6 A;  2XX8 A;  1SVX B;  1QUK A;  3PUY E;  3RTF B;  1H44 A;  4AQ4 A;  3A3U A;  3OSQ A;  4GFR A;  3IB2 A;  2D21 A;  1H76 A;  3OO6 A;  3FXU A;  1HSJ A;  1EZO A;  4BDR A;  1N3X A;  4THI A;  3M3L A;  3PPQ A;  3ODB A;  1D9V A;  3QK6 A;  4YAH X;  4NMY A;  4OFO A;  2V3T A;  4KPT A;  4OFL A;  2V3U A;  3BBR A;  5K2Y A;  3FJM A;  4FAT A;  4IO2 A;  1USY E;  5I59 A;  1DPE A;  3DLN A;  4F39 A;  4Q0C A;  3MVZ A;  3O6I A;  1BKA A;  2AIX A;  2I4C A;  1VFE A;  2DXR A;  5DVI A;  2RCB A;  4MH5 A;  4DXC A;  4NED A;  3TMG A;  1IUD A;  2HEU A;  3K1N A;  3Q27 A;  4FIM A;  1PC3 A;  1II5 A;  3FAT A;  3KSJ A;  3DM0 A;  5FTH A;  3VFJ A;  4G4P A;  4TOZ A;  5I84 A;  4RNS A;  2R9J A;  4OET A;  1B9J A;  5TPA B;  1ZTY A;  4LQ5 A;  5KCJ B;  2I0B A;  2HAU A;  1BIY A;  1JVY A;  1NMU A;  2UVJ A;  1MDP 1;  1FQD A;  5DYH A;  2NVU B;  1D9Y A;  3OOA A;  2XXY A;  4ND9 A;  4NF6 A;  4OEN A;  2FA7 A;  4U23 A;  2OWT A;  2B3F A;  3N5L A;  1OLA A;  5M2V A;  4XKR A;  4H0W A;  3PU5 A;  2ANJ A;  5FHO A;  3V5A A;  1AMF A;  1B4Z A;  3HV1 A;  3MZ9 A;  3HCQ A;  1MQG A;  1RYX A;  3N6U A;  1O63 A;  4WED A;  5F7V A;  1IEJ A;  3MVY A;  4GWO A;  4KD5 A;  2PT2 A;  2F34 A;  3CVG A;  2R6G E;  3M3K A;  3FXR A;  2XXP A;  4ZED A;  4IO6 A;  3GXA A;  4GQO A;  2HXW A;  3QSL A;  4DCX A;  5ITP A;  4UAC A;  4F18 A;  1LFG A;  1MXY A;  3CFZ A;  3EHS A;  3N26 A;  3SER A;  4GVO A;  2P1S A;  4ELR A;  2XXV A;  3ZKL A;  1S50 A;  1MM6 A;  2UXA A;  3HHG A;  3LSF B;  2DOJ A;  3PMX A;  5ELV A;  3VLU A;  3TAJ A;  1QJM A;  4MLV A;  3HO7 A;  5AA4 B;  4XKP A;  3G3I A;  1B3L A;  2A5T A;  2H99 A;  3G3K A;  3HHF A;  3UIF A;  1ATG A;  1B3H A;  1B40 A;  3V8X B;  4R74 A;  2HAV A;  2Q9T A;  4GL0 A;  2RCA A;  4UA8 A;  3V83 A;  3TCF A;  1I69 A;  5JK4 A;  1WDN A;  2FYI A;  1M5B A;  1B4H A;  1IXI A;  3MWB A;  3OMB A;  4TLL B;  5EHM A;  2HZK A;  1O7T A;  2DXY A;  2XD3 A;  4WXJ A;  1XS5 A;  1ZJL A;  1SYI A;  1OVB A;  3K6W A;  1MH3 A;  1B7Z A;  4U21 A;  2RC9 A;  3F11 A;  1B3F A;  2OK2 A;  4JWO A;  4KFQ A;  1BLF A;  3JZJ A;  1D4N A;  3O28 A;  1US5 A;  2ABH A;  1MRP A;  1LAH E;  3O9P A;  3VV5 A;  3DP8 A;  4HW8 A;  5J1D A;  2HCA A;  4XKN A;  1Y20 A;  4X1B A;  3RN8 A;  3T66 A;  3PMV A;  1A7L A;  3SEX A;  4HCW A;  4KYS A;  1Y4T A;  4NWC A;  4R75 A;  4F2Q A;  1QUJ A;  4R6K A;  2XHD A;  1LAF E;  3VLV A;  3TTL A;  5AE4 A;  5CBR A;  2H5Y A;  5H8Q B;  4H5F A;  5H8S A;  1DSN A;  3QUF A;  4KR5 A;  1B1X A;  1TFD A;  3LR1 A;  2CZL A;  4QFP A;  5I2K B;  2RKM A;  3MQ9 A;  1JQF A;  1JW1 A;  4U1O A;  5L8D A;  2DE3 A;  4GIZ A;  3RUM A;  1MY4 A;  2ZMB A;  3IOW A;  3KN3 A;  4H6D A;  4EQ9 A;  3CG3 A;  5CC2 A;  2DWI A;  2V3Q A;  1TFA A;  2Y7I A;  3OD7 A;  4F3B A;  4JSD A;  1B1H A;  2R71 A;  1QUL A;  3QIM A;  3Q26 A;  3UK4 A;  1GV8 A;  1SW4 A;  1A99 A;  4G68 A;  3U72 A;  3C36 A;  3KG2 A;  4E0W A;  5K2X A;  4M1V A;  2Y84 A;  1LB9 A;  2Z8D A;  3MPK A;  1QUI A;  2XXX A;  4U2R A;  1R1N A;  3OO7 A;  4ELO A;  4FAJ A;  3GLB A;  4IO7 A;  4ECF A;  3Q28 A;  4RPN A;  1NL5 A;  2DS9 A;  1MQJ A;  3UOR A;  5I57 A;  2F35 A;  4NTL A;  1CE2 A;  2F78 A;  2G93 A;  2I0C A;  2V93 A;  3D4G A;  3FV1 A;  3OSR A;  3PPR A;  1S7Y A;  1MS7 A;  3O2A A;  4BDQ A;  5DVJ A;  4EDP A;  3FV2 A;  3TDJ A;  3ZSF A;  4ZEB A;  3K1M A;  4DZ1 A;  3QUJ A;  1UIU A;  3IX1 A;  1JEV A;  3M3F A;  5CMB A;  2QMW A;  1URS A;  3G3F A;  3PPN A;  4QF9 A;  1BTJ A;  1UQW A;  2UYF A;  4OVJ A;  5EYF A;  1I6A A;  2I48 A;  4HTG A;  1LFI A;  1UTB B;  2QS2 A;  4LP2 B;  2H4I A;  1QKA A;  2X7P A;  1WOD A;  1EH3 A;  1J1N A;  2DVC A;  3K02 A;  4YKJ A;  4YZZ A;  3H3G A;  4LVQ A;  1B32 A;  3TYH A;  3O6H A;  4H65 A;  3C35 A;  2CMO A;  3U1O A;  3N94 A;  3P7I A;  4XTC Q;  1Y1Z A;  3T22 A;  4R2F A;  1RYO A;  2ZNU A;  3FGS A;  1Y1M A;  4NF8 A;  5I58 B;  2UVH A;  1GVC A;  2H98 A;  3PUZ E;  3FUZ A;  3WAF A;  4XIG Q;  4QFO A;  3IOT A;  1I6B A;  1Y3N A;  2F97 A;  3FD3 A;  3PV0 E;  3W9W A;  1B05 A;  2UYE A;  4JWX A;  1MQI A;  3DEL B;  3RY3 A;  5TPA A;  3OO8 A;  3E3K A;  4GRK A;  4DE8 A;  3KJT A;  1P1N A;  4IB2 A;  1LCT A;  4JBZ A;  4OES A;  2GHB A;  2XXU A;  3H6U A;  3KEI A;  1N04 A;  1QVS A;  3FXQ A;  5L9M A;  2IEE A;  3I5O A;  1QW0 A;  1NNT A;  3JYR A;  4IGR A;  4DXU A;  2QRY A;  5TU0 A;  3VE1 B;  2O68 A;  2E1S A;  3EQ1 A;  5BUU A;  1AOV A;  1SW1 A;  4TLM B;  5IKB A;  3LC8 A;  3PMW A;  3IOV A;  4TQU Q;  4EXK A;  1DTZ A;  1SBP A;  1MM7 A;  1SW2 A;  3MJN A;  3SET A;  5AA2 A;  1YTV A;  3G3H A;  3K6U A;  4LZ8 A;  2DQV A;  5FHN A;  3N6T A;  4ZE8 A;  2Q8J A;  4AB5 A;  3FAS A;  2XX9 A;  1PDA A;  3KFM A;  1NH8 A;  3PUW E;  3E4R A;  4GLI A;  4KYE A;  2Z8F A;  4N6P A;  5DEX B;  4F3P A;  2H9B A;  1Y4C A;  4I62 A;  3K00 A;  3FVO A;  2Q2C A;  2XXH A;  4G8M A;  5DEX A;  2GRV A;  1LGB C;  3QAX A;  2F6G A;  1US4 A;  4P0I A;  1OQH A;  5H8N B;  2ONR A;  1JNF A;  1ZMG A;  3BKI B;  1SYH A;  3K6V A;  1M5D A;  4R72 A;  4G68 B;  3RPW A;  3TTM A;  1Y3P A;  3GBB A;  3C34 A;  3KJ7 A;  4F3G A;  3TZA A;  1PB9 A;  4YIC A;  3Q29 A;  2D5W A;  2ZYO A;  3JV9 A;  1A54 A;  3T93 B;  4F1V A;  1MXW A;  4DXB A;  5H8F B;  3PD9 A;  3E13 X;  3PPO A;  4LAT A;  4QSE A;  2O1M A;  3HPI A;  4EQ7 A;  3IJX B;  4RK2 A;  3RT8 A;  1JET A;  3UN6 A;  1GGG A;  1FQF A;  4F1U A;  4BDO A;  3KZG A;  4E0X A;  3B7D A;  3A3C A;  3TCH A;  4EF2 A;  4PET A;  1EZP A;  4BDN A;  3IO6 A;  3WAE A;  4OQO A;  1M5C A;  1FTK A;  3CFX A;  4WEP A;  5AA2 D;  1SI0 A;  2DSF A;  4EF1 A;  3UP9 A;  2HZL A;  4R9F A;  1POT A;  1ZIU A;  3OXN A;  3U92 A;  2B65 A;  3KOT A;  3UGW A;  5I56 B;  4R6Y A;  4F31 B;  1A55 A;  2I3W A;  2P2A A;  1DMB A;  5KDT A;  2XXQ A;  4YU0 A;  2I6E A;  3BFU A;  3KSX A;  4PE5 B;  4X48 A;  1D3K A;  2NUV A;  5A5X A;  5JTY A;  5KDT B;  1Z7N E;  1CB6 A;  1ZKB A;  3B6W A;  5I2N A;  2OJT A;  3SEY A;  1ZLQ A;  1TXF A;  1B51 A;  2QS1 A; 
#chains in the Genus database with same CATH topology
 4OVQ A;  5JEI A;  3MBP A;  4KCD A;  3LV0 A;  4PFU A;  1Q9D A;  4RY1 A;  1XVY A;  2XD2 A;  1MXU A;  2RF1 A;  4BLA A;  1INP A;  4ZEC A;  4FOR A;  4OTE A;  3MP1 A;  3IR1 A;  4OYV A;  4N81 A;  4N13 A;  3IAZ A;  1MY1 A;  3RQT A;  1DK4 A;  2ONK E;  1B5I A;  3EF7 A;  3S9E A;  1LBW A;  4LON B;  5AA4 A;  4PFW A;  2O6A A;  1SI1 A;  1LB8 A;  3CRB A;  1B52 A;  1MG1 A;  4YKP A;  4IO5 A;  4R2B A;  3IB1 A;  5EQ8 A;  3HN0 A;  2YJP A;  1HSL A;  2V4C A;  3R6U A;  4QHQ A;  1FSA A;  1B5H A;  5I3S A;  1LEV A;  3Q25 A;  3MAM A;  1MY0 A;  2F6P A;  4P0G A;  2F7A A;  1NKX A;  2AL5 A;  2OWZ A;  1MQD A;  1FQC A;  5HPQ A;  1DTG A;  1OQG A;  3VVD A;  1ELJ A;  4ISU A;  4OHN A;  3TEP A;  1KWH A;  1LFH A;  2QL3 A;  2E0S A;  3H6V A;  4PFT A;  1IXC A;  4HE1 A;  4JDF A;  3SEU A;  3MW0 A;  3PUV E;  4H67 A;  1FQE A;  1G0H A;  2YLN A;  3T9X B;  3TQL A;  2LAO A;  2NOO A;  1F9B A;  2VPN A;  1FPJ A;  3M8U A;  2Y7R A;  3CG1 A;  3RNN A;  2QVU A;  3EHU A;  3ZKK A;  1MXZ A;  3CR9 A;  4Z0I A;  1PB7 A;  3ILT B;  1SQY A;  4GWW A;  4EQB A;  4ZDM A;  1FTL A;  3USD A;  5CMM A;  1FTJ A;  5EYH A;  2WX9 A;  1B58 A;  2Y7W A;  2QPQ A;  3TTK A;  1FPG A;  5F1Q A;  3D4C A;  4G2Z A;  2B3B A;  4I8C A;  1FBC A;  4JSO A;  1P1U A;  2O84 X;  1FBG A;  2GFE A;  3ZS6 A;  3CFL A;  1M5E A;  4GBV A;  1O64 A;  4ONY A;  2QMX A;  1YYZ A;  4XKQ A;  5FTI A;  2G29 A;  2OZZ A;  4MF3 A;  4OFJ A;  3BFT A;  1ZBM A;  5H8H B;  1A8E A;  1NFT A;  5CBS A;  4OER A;  2Q89 A;  1L5T A;  4N8Y A;  1RDX A;  1NH7 A;  2RC7 A;  2FIE A;  4X04 A;  1NUY A;  4Q8R A;  2XX7 A;  2DWJ A;  1A40 A;  3FVK A;  1FTM A;  3IFA A;  3MP8 A;  2F7B A;  4RK9 A;  3MVW A;  4QXD A;  3TPA A;  1XC1 A;  3FVN A;  2ZXT A;  3G3J A;  3ONM A;  2VOZ A;  1HSE A;  1TWY A;  1LBZ A;  1B6H A;  1R6Z A;  1QUK A;  3RPL B;  3RTF B;  3OSQ A;  3IB2 A;  5IZZ A;  1H76 A;  3M3L A;  4NMY A;  4OFO A;  4KPT A;  5K2Y A;  3BBR A;  4FAT A;  1DBZ A;  4F39 A;  1BKA A;  4LN5 A;  2RCB A;  1PC3 A;  5I84 A;  4RNS A;  4QBA A;  4LQ5 A;  4OEN A;  2XXY A;  4ND9 A;  3PU5 A;  3HV1 A;  1B4Z A;  3MZ9 A;  3HCQ A;  4WED A;  3MVY A;  4KD5 A;  2QVV A;  3CVG A;  3M3K A;  4DCX A;  2HXW A;  4UAC A;  1LFG A;  3E78 A;  4ELR A;  2DOJ A;  1QJM A;  5AA4 B;  3G3K A;  1B40 A;  3MST A;  2Q9T A;  3V83 A;  2RCA A;  1B4H A;  4TLL B;  1OVB A;  1B7Z A;  2XWI A;  2RC9 A;  3O9P A;  3BIH A;  1KZ8 A;  1LAH E;  4HW8 A;  4X1B A;  4KYS A;  2XHD A;  3TTL A;  5CBR A;  4H5F A;  1FJ6 A;  5H8S A;  2CZL A;  5L8D A;  3MQ9 A;  4H6D A;  3CG3 A;  4OVR A;  2Y7I A;  4JSD A;  1B1H A;  2R71 A;  3Q26 A;  2WBD A;  3UK4 A;  3FBP A;  2WBB A;  3KG2 A;  5IZ3 A;  4E0W A;  2Y84 A;  2Z8D A;  1NV7 A;  4IO7 A;  4RPN A;  1NUX A;  3UOR A;  5I57 A;  2F35 A;  1FPD A;  2G93 A;  2V93 A;  3ZSF A;  4ZEB A;  3K1M A;  1UIU A;  1FRP A;  1UQW A;  2FHY A;  4XF5 A;  1LFI A;  2QS2 A;  3H3G A;  2B4M A;  4H65 A;  3C35 A;  4R2F A;  1RYO A;  2ZNU A;  3FGS A;  2UVH A;  2H98 A;  3PUZ E;  3FUZ A;  3WAF A;  2F97 A;  1B05 A;  4MAG A;  3KJT A;  2XXU A;  3KEI A;  1QVS A;  3FXQ A;  1QW0 A;  1NNT A;  3VE1 B;  2O68 A;  5LDZ A;  4TLM B;  5IKB A;  3LC8 A;  1SBP A;  1NV3 A;  3MJN A;  3SET A;  5FHN A;  3N6T A;  2XX9 A;  1PDA A;  1XI6 A;  4I62 A;  1Y4C A;  1LGB C;  1US4 A;  4P0I A;  3RPW A;  1Y3P A;  3GBB A;  3KJ7 A;  2D5W A;  2PFY A;  1NV4 A;  4N15 A;  1JET A;  3B7D A;  3A3C A;  4G61 A;  4PET A;  3IO6 A;  3WAE A;  1FPK A;  2VPO A;  5AA2 D;  4PAI A;  2DSF A;  3LUZ A;  3UGW A;  3KOT A;  4R6Y A;  1KA1 A;  4MJO A;  2I6E A;  3KSX A;  4O94 A;  4GX4 A;  5I2N A;  2OJT A;  3S9L C;  2Y5K A;  4KYD A;  1MH4 A;  1FQB A;  3PPP A;  2ONS A;  4C1U A;  2PT1 A;  3HST A;  4H1X A;  3MYU A;  4OXV A;  1GTK A;  3T96 B;  1N7X A;  4JB7 A;  3T9V A;  2DWA A;  4YKK A;  4IO3 A;  1FPE A;  3H6T A;  5LTC A;  1IXH A;  1PB8 A;  2REG A;  4POX A;  4DLD A;  2ZYN A;  4RA1 A;  3TCG A;  4ZEI A;  1MY2 A;  1UTH B;  3G7W A;  1GR2 A;  2X26 A;  1KA0 A;  1PBP A;  4ELP A;  4ZZA A;  3S2V A;  3HFU A;  1NNK A;  2WKY A;  4U1Z A;  4H8J A;  4GD5 A;  2ZYK A;  5TP9 A;  2RIN A;  3U94 A;  3TTR A;  1MXV A;  2OCU A;  2PX1 A;  2XXR A;  4N17 A;  5B7D A;  5LOM A;  3B6T A;  2Z23 A;  1EZ9 A;  4U4X A;  3MZ1 A;  2Z8E A;  3OEM A;  4YMA A;  4QFK A;  5AA1 A;  5IZ3 B;  2VD2 A;  1PBQ A;  1USY H;  2KLF A;  3T0J A;  4LUB A;  2OBG A;  1FPI A;  3VLW A;  3CHG A;  4F29 A;  1IXG A;  3RLF E;  2YPN A;  4O7M A;  4DI4 B;  5IAI A;  2MKZ A;  3MC2 A;  2PBW A;  2R8T A;  1B3G A;  2DE2 A;  2HXR A;  3PTY A;  5AA2 B;  5L9S A;  1FW0 A;  3D1R A;  3KN8 A;  3THI A;  4O3A A;  3S9N C;  1B0H A;  3IB0 A;  1Q35 A;  3MZB A;  3RYD A;  1N0T A;  4OVP A;  5ITO A;  3GBA A;  5CI5 A;  1M5F A;  2XXT A;  3FJ7 A;  3C4M A;  4NF8 B;  5I58 A;  2GH9 A;  3AXF A;  2THI A;  5I59 B;  1JVX A;  3W9V A;  1JP4 A;  1MDQ A;  3I6V A;  4UAB A;  4KI0 E;  1JW5 A;  2O7I A;  1FPF A;  4OEV A;  4R9G A;  5H8Q A;  3TTN A;  4GL8 A;  1Z7M E;  2FIX A;  5CMK A;  5H8N A;  4RYA A;  5I57 B;  1I6Q A;  4G77 A;  4HE2 A;  4GOT A;  4O3B A;  4NWD A;  1LST A;  2DWH A;  3E9X A;  5EYG A;  1B7U A;  1DPP A;  2W7Y A;  2DVZ A;  1YXI A;  3PD8 A;  1P1W A;  3IK6 B;  1IIW A;  3IOR A;  2QSX A;  4PCD A;  2HQ0 A;  1A8F A;  4NE4 A;  3O6G A;  5BWJ A;  1YZ0 A;  4ZE9 A;  3K2D A;  4QRZ A;  1OVT A;  5KCJ A;  1H3D A;  5A5X B;  1MPB A;  4ZEF A;  2V25 A;  3VDF A;  3A09 A;  1AWB A;  2REJ A;  4M4G A;  1FTA A;  4P47 A;  1UIV A;  1N3W A;  3LSL A;  3H6W A;  1AL3 A;  5HBC A;  3UA8 A;  3K6X A;  4PF8 A;  4MIJ A;  2XXW A;  3V8X B;  3VVE A;  1FCK A;  2A5T B;  1YAE A;  3FZV A;  2M8C A;  4YKI A;  3C33 A;  5EQA A;  4NX1 A;  1Y9U A;  2ALU A;  2OLB A;  3CSB A;  1VR5 A;  3B6Q A;  2NWJ A;  2HFB A;  3TKD A;  1K9Z A;  1B5J A;  2XX8 A;  2Q74 A;  4PFB A;  1QGX A;  4GFR A;  2D21 A;  4N4U A;  1N3X A;  2V3T A;  1AIV A;  3FJM A;  4Q0C A;  3O6I A;  2AIX A;  2I4C A;  5DVI A;  1VFE A;  4MH5 A;  1IUD A;  3Q27 A;  1II5 A;  3VFJ A;  4G4P A;  4OET A;  1ZTY A;  2I0B A;  2HAU A;  1NMU A;  2NVU B;  2L5V A;  3OOA A;  2FA7 A;  3N5L A;  4XKR A;  5FHO A;  1MQG A;  1O63 A;  4X8R A;  2PT2 A;  2F34 A;  3FXR A;  4IO6 A;  3EHS A;  4GVO A;  2XXV A;  3LSF B;  5ELV A;  3VLU A;  2XWV A;  4XKP A;  2A5T A;  4R74 A;  4MNC A;  4GWZ A;  4UA8 A;  3TCF A;  1I69 A;  2FYI A;  1IXI A;  3MWB A;  5EHM A;  2HZK A;  1O7T A;  2XD3 A;  5J16 A;  4U21 A;  1D4N A;  1US5 A;  3NOH A;  1Y20 A;  3RN8 A;  3T66 A;  3PMV A;  4F2Q A;  1Y4T A;  1IMC A;  2H5Y A;  3QUF A;  4QFP A;  2RKM A;  1JQF A;  2DE3 A;  2ZMB A;  3IOW A;  1GV8 A;  3C36 A;  5K2X A;  1LB9 A;  3MPK A;  2XXX A;  3OO7 A;  3GLB A;  1CE2 A;  3FV1 A;  2I0C A;  1S7Y A;  4BDQ A;  4PTK A;  5DVJ A;  3QUJ A;  5CMB A;  3G3F A;  4QF9 A;  5EYF A;  1I6A A;  2I48 A;  4HTG A;  4LP2 B;  1QKA A;  2X7P A;  4YKJ A;  1J1N A;  2QFL A;  3U1O A;  3T22 A;  4NF8 A;  3U65 A;  5I58 B;  4QFO A;  2UYE A;  3E3K A;  4MNP A;  1LCT A;  2GHB A;  1FBH A;  2IEE A;  4IGR A;  3EQ1 A;  1SW1 A;  3IOV A;  1DTZ A;  1MM7 A;  1SW2 A;  5AA2 A;  3K6U A;  5IGA A;  4ZE8 A;  2Q8J A;  3KFM A;  5DEX B;  2CEX A;  3K00 A;  2Q2C A;  4P56 A;  4PFR A;  4OA4 A;  2ONR A;  4P8B A;  1ZMG A;  1SYH A;  4R72 A;  3TTM A;  4F3G A;  4YIC A;  3JV9 A;  1MXW A;  1IMD A;  2O1M A;  3IJX B;  3RT8 A;  4F1U A;  2Y5L A;  4BDN A;  5FBP A;  4OVS A;  3CFX A;  1SI0 A;  4R9F A;  1POT A;  1ZIU A;  3U92 A;  1A55 A;  2P2A A;  5KDT A;  4YU0 A;  3BFU A;  1CB6 A;  3B6W A;  1TXF A;  2PMS A;  3LSX A;  5EHS A;  1NV1 A;  4F1Y A;  4I3Y A;  3TQW A;  1LAG E;  2OWS A;  5DTB A;  2QS4 A;  4OZ9 A;  2JJK A;  2HPG A;  2UVG A;  2P3N A;  3K0V A;  1P99 A;  1Q1K A;  3KN7 A;  4G8N A;  1NUW A;  1SDX A;  3T9U A;  1IQ7 A;  4GWU A;  2D3I A;  1P1O A;  4LA9 A;  2O51 A;  1FTO A;  2O1L A;  1FBE A;  2H25 A;  2X7Q A;  1ANF A;  1R9L A;  5H8F A;  4IY5 A;  3LSW A;  4RJZ A;  1B0L A;  2Q8M A;  3H03 A;  4P11 A;  2DE4 A;  4IR8 A;  3W15 C;  1SW5 A;  3QMF A;  3SKP A;  4NHB A;  5T3J A;  2DP8 A;  5DVF A;  5HM4 B;  4QFL A;  4MBP A;  2VD3 A;  4BDL A;  4MFI A;  1FQA A;  2PYY A;  5I2N B;  4H8I A;  2Q88 A;  4YB7 A;  1VE4 A;  1FBF A;  2RC8 A;  5IM2 A;  1JEU A;  2Z22 A;  1WVJ A;  3OO9 A;  1D9Q A;  2ZNT A;  4NG7 A;  3L6H A;  5FHM A;  3ILU B;  5EQ9 A;  4EXL A;  5L9O A;  1OLC A;  3I3V A;  3KOS A;  3CIJ A;  4N8G A;  1IMA A;  4NF6 B;  1VSO A;  2UVI A;  4NF5 B;  3CSG A;  3DP6 A;  4NF4 A;  5B70 A;  1CNQ A;  1URD A;  4RXL A;  4OAN A;  1EU8 A;  4ELQ A;  4JXI A;  5AA3 A;  3C31 A;  1XT8 A;  4FE8 A;  1VDW A;  2QS3 A;  4JVD A;  2BJJ X;  1LBC A;  4I3E A;  4DCY A;  4Q5T A;  4PF6 A;  3K4U A;  4X9T A;  4HE0 A;  1MQH A;  3OEN A;  5I2K A;  2F8D A;  2NXO A;  1OMP A;  4I9D A;  1K9Y A;  3EPE A;  2CZI A;  3C9H A;  4MNI A;  3T1B A;  3S9M C;  3TUS A;  1LLS A;  4N07 A;  3O29 A;  4YB5 A;  4ESX A;  3K1P A;  3LBS A;  3MVX A;  3FVG A;  4WKM A;  1SPI A;  3OEL A;  2Y7P A;  2XWO A;  1IZ1 A;  4ZS9 A;  5JTY B;  3EN3 A;  4F22 A;  1MPC A;  4KHZ E;  1N7W A;  5I56 A;  4RPO A;  2XXI A;  4MEV A;  2ZNS A;  4PP0 A;  1Y3Q A;  5ESY A;  2FVZ A;  4C0R A;  4XXU A;  4QSD A;  4Q30 B;  3FJG A;  1UTB A;  3IO4 A;  1H45 A;  5A5L A;  3RGY A;  4GX6 A;  3KBR A;  4EUO A;  2KQZ A;  4I1D A;  4Z7E A;  5I7I A;  4JWY A;  4GWS A;  3PUX E;  1MY3 A;  4LZ7 A;  4O3C A;  3RPL A;  4JVI A;  3H7M A;  3MP6 A;  3A3U A;  3SZP A;  1EZO A;  4THI A;  3PPQ A;  3ODB A;  1D9V A;  3QK6 A;  4YAH X;  4OFL A;  5I59 A;  1USY E;  3DLN A;  3MVZ A;  4DXC A;  2WEF A;  3TMG A;  2HEU A;  4FIM A;  4AQ4 A;  3KSJ A;  3DM0 A;  2R9J A;  1B9J A;  5TPA B;  1JVY A;  1IMF A;  2UVJ A;  1MDP 1;  1FQD A;  1D9Y A;  4GWX A;  2OWT A;  2B3F A;  5M2V A;  4KXP A;  4H0W A;  3V5A A;  1AMF A;  4NF0 A;  4GX3 A;  1RYX A;  5F7V A;  1IEJ A;  2R6G E;  4ZED A;  3GXA A;  3QSL A;  4F18 A;  3CFZ A;  3B50 A;  3SER A;  2P1S A;  3ZKL A;  2UXA A;  3PMX A;  3TAJ A;  3HO7 A;  2WYK A;  3G3I A;  1B3L A;  2H99 A;  3UIF A;  2CZK A;  1ATG A;  5ET5 A;  1B3H A;  2HAV A;  4GL0 A;  1M5B A;  3OMB A;  1NUZ A;  1XS5 A;  1ZJL A;  2ZZV A;  3K6W A;  1MH3 A;  2OK2 A;  4MCO A;  1BLF A;  3O28 A;  3DP8 A;  5J1D A;  4PBH A;  1A7L A;  1LBY A;  4NWC A;  4R75 A;  4R6K A;  1LAF E;  3VLV A;  5AE4 A;  1DSN A;  2ZZW A;  1B1X A;  1TFD A;  3LR1 A;  1JW1 A;  3RUM A;  4EQ9 A;  1NV6 A;  5CC2 A;  1RDZ A;  3OD7 A;  4PC9 A;  2KR0 A;  4DI3 D;  1SW4 A;  4G68 A;  3U72 A;  4GBW A;  4M1V A;  4NN3 A;  4ELO A;  4ECF A;  3Q28 A;  1NL5 A;  2DS9 A;  1MQJ A;  4NTL A;  2F78 A;  3PPR A;  1MS7 A;  3O2A A;  2GQ1 A;  4EDP A;  3FV2 A;  4DZ1 A;  3IX1 A;  3M3F A;  1JEV A;  4YZZ A;  1EH3 A;  2DVC A;  1B32 A;  4NQ8 A;  2CMO A;  3N94 A;  3P7I A;  4XTC Q;  1Y1M A;  4XIG Q;  1Y3N A;  3FD3 A;  3PV0 E;  3W9W A;  4JWX A;  1MQI A;  3RY3 A;  4GRK A;  4DE8 A;  1P1N A;  4IB2 A;  4JBZ A;  2WYP A;  3KBZ A;  3H6U A;  5F24 A;  1N04 A;  2XA5 A;  3JYR A;  1LBX A;  2QRY A;  5TU0 A;  5BUU A;  4N91 A;  4NGU A;  2DQV A;  4AB5 A;  3FAS A;  4GLI A;  1AOV A;  1NH8 A;  4KYE A;  3E4R A;  2H9B A;  4G8M A;  2XXH A;  1EYJ A;  1NI9 A;  2GRV A;  3QAX A;  2F6G A;  5H8N B;  3K6V A;  4GWY A;  3C34 A;  3TZA A;  1PB9 A;  3Q29 A;  5EQ7 A;  2FBP A;  3T93 B;  2PFZ A;  4DXB A;  5H8F B;  4EQ7 A;  3HPI A;  4RK2 A;  3UN6 A;  1GGG A;  1FQF A;  4FBP A;  5ET7 A;  2P3V A;  1M5C A;  1FTK A;  4EF1 A;  4MMP A;  3ROJ A;  2B65 A;  5I56 B;  2I3W A;  1FJ9 A;  5ET6 A;  1Z7N E;  1ZKB A;  4MX6 A;  4HXV A;  1B51 A;  3CI8 A;  1NV2 A;  4H5G A;  1LBB A;  4FEC A;  3TOD A;  3GZG A;  4U4S A;  4DDD A;  3B8B A;  3VXC A;  1NNP A;  3EHT A;  4OWD A;  4HCY A;  4G68 C;  3U8Q A;  3C32 A;  2FNC A;  3KGC A;  1YPN A;  4IO4 A;  3QYT A;  5ISU A;  1MXX A;  3R26 A;  4GXA A;  5DT6 A;  3KC1 A;  3QXM A;  5H8H A;  4ZZE A;  3SEV A;  1MPD A;  4NF4 B;  3A29 A;  3S4U A;  4AS4 A;  2Q2A A;  2VGQ A;  1IIT A;  1ZU0 A;  1RKM A;  3O66 A;  3OEK A;  1YCJ A;  4QSC A;  5TP9 B;  1XHY A;  2AL4 A;  3U93 A;  4OEU A;  1N76 A;  1BK4 A;  3KC0 A;  2F5X A;  3IJO B;  4PFY A;  1S9T A;  3SDF A;  4GXS B;  3SEW A;  2I4B A;  4G8H A;  5IZ1 A;  1B3E A;  2I3V A;  4AS5 A;  1VFD A;  1SD3 A;  2PVU A;  4GF8 A;  1NNF A;  4OVT A;  4PQJ A;  2ESN A;  4P3L A;  2F3D A;  2F36 A;  4FEB A;  2PCR A;  2GHA A;  4U22 A;  3LUY A;  4C1T A;  3V89 B;  4KCC A;  4FJP A;  4JVC A;  4ZEK A;  2AYS A;  4QFN A;  5ICQ A;  1OIB A;  2B4L A;  1XVX A;  2DYX A;  2QVR A;  4LQ2 A;  4POW A;  5KZT A;  4LZ5 A;  3R7X A;  2O69 A;  2O7U A;  3H06 B;  4K3F A;  4L17 A;  4YMB A;  1UTH A;  1RDY A;  4AB6 A;  3K01 A;  3L6G A;  4ESW A;  1AH5 A;  1FBP A;  5ICT A;  4IGT A;  1QKB A;  1PEB A;  4X1D A;  3O97 A;  5CM6 A;  4IY6 A;  1R9Q A;  1EYK A;  5I5P A;  4BDM A;  4YB6 A;  1LAX A;  2P0S A;  5DW8 A;  3ISP A;  1B46 A;  5CRY A;  4R73 A;  1P1Q A;  1DOT A;  1FPB A;  2DDK A;  5CMC A;  4PGN A;  1XOC A;  4F3S A;  3IFC A;  1JW4 A;  4OMB A;  4FED A;  4PGP A;  1URG A;  3G3G A;  4PDH A;  4KQP A;  4NAP A;  2I58 A;  2I49 A;  3ECR A;  3IL1 B;  3MUQ A;  4MLQ A;  2A5S A;  2OX3 A;  3FIR A;  3VXB A;  2V84 A;  4F2O A;  3T9H B;  4XEQ A;  1LCF A;  1H43 A;  3H4Z A;  3TEL A;  4PAF A;  1FPL A;  4DIG A;  3IOU A;  3DP4 A;  1NV5 A;  3VVF A;  4PBQ A;  1N84 A;  3GYY A;  1B2H A;  2F7C A;  2ZYM A;  2XWK A;  3MPL A;  1B7H A;  2F3B A;  2QJE A;  3SES A;  1DCU A;  3RTW B;  4XFE A;  4R6H A;  2VHA A;  4HS7 A;  1POY 1;  1BP5 A;  2VP1 A;  2Y7K A;  3RT6 B;  3TFL A;  2IA4 A;  3PGF A;  4P1L A;  1T0K A;  2CEY A;  1TT1 A;  4NF5 A;  4F19 A;  2HHM A;  1SVX B;  3PUY E;  1H44 A;  4PAK A;  3OO6 A;  3FXU A;  1HSJ A;  4BDR A;  2XXK A;  4N6K A;  2V3U A;  4IO2 A;  1DPE A;  2DXR A;  4NED A;  3K1N A;  4MHF A;  3FAT A;  5FTH A;  4TOZ A;  5KCJ B;  5DYH A;  1BIY A;  4U23 A;  4NF6 A;  1OLA A;  2ANJ A;  3N6U A;  1NV0 A;  4GWO A;  4H45 A;  2XXP A;  4O7I A;  4GQO A;  5ITP A;  5ET8 A;  1MXY A;  3N26 A;  1IMB A;  1S50 A;  1MM6 A;  3HHG A;  4MLV A;  3HHF A;  2ZZX A;  4PE3 A;  5JK4 A;  1WDN A;  4P1E A;  2DXY A;  4N6D A;  4WXJ A;  1SYI A;  1FBD A;  2VT5 A;  2CZH A;  3F11 A;  1B3F A;  4JWO A;  4KFQ A;  3JZJ A;  3VV5 A;  2ABH A;  1MRP A;  4PDD A;  2HCA A;  4XKN A;  3SEX A;  4HCW A;  4PFI A;  1QUJ A;  5H8Q B;  4KR5 A;  5I2K B;  4U1O A;  4GIZ A;  1MY4 A;  3KN3 A;  2DWI A;  2V3Q A;  1TFA A;  4F3B A;  1QUL A;  3QIM A;  2BJI A;  1A99 A;  1QUI A;  4U2R A;  1R1N A;  4FAJ A;  3D4G A;  3OSR A;  3TDJ A;  2QMW A;  1URS A;  3PPN A;  1BTJ A;  2UYF A;  4OVJ A;  4P9K A;  3E79 A;  1UTB B;  2H4I A;  1WOD A;  3K02 A;  4LVQ A;  3TYH A;  3O6H A;  1Y1Z A;  3BIG A;  1GVC A;  4H46 A;  3IOT A;  1I6B A;  3DEL B;  5TPA A;  3OO8 A;  4OES A;  1LBV A;  5L9M A;  3I5O A;  4DXU A;  2E1S A;  3EKI A;  3PMW A;  4EXK A;  4TQU Q;  1EYI A;  1YTV A;  3G3H A;  4LZ8 A;  3PUW E;  2Z8F A;  4N6P A;  4F3P A;  3FVO A;  5DEX A;  1OQH A;  1JNF A;  3BKI B;  1M5D A;  4G68 B;  1G0I A;  3FXB A;  2ZYO A;  1A54 A;  4F1V A;  3PD9 A;  3E13 X;  3PPO A;  4LAT A;  4QSE A;  4BDO A;  3KZG A;  4E0X A;  3TCH A;  4EF2 A;  1IME A;  1EZP A;  4OQO A;  4WEP A;  4I40 A;  3UP9 A;  2HZL A;  3OXN A;  4F31 B;  4O8M A;  1DMB A;  2XXQ A;  4PE5 B;  4X48 A;  1D3K A;  2NUV A;  5A5X A;  5JTY A;  5KDT B;  3SEY A;  1ZLQ A;  2QS1 A; 
#chains in the Genus database with same CATH homology
 3CI8 A;  5JEI A;  2PMS A;  3S9L C;  3LSX A;  3MBP A;  4KCD A;  4H5G A;  5EHS A;  4PFU A;  4F1Y A;  1LBB A;  4FEC A;  4KYD A;  3GZG A;  1MH4 A;  1LAG E;  1FQB A;  1XVY A;  4RY1 A;  4U4S A;  2OWS A;  2XD2 A;  5DTB A;  4DDD A;  2QS4 A;  1MXU A;  2RF1 A;  3PPP A;  4OZ9 A;  2UVG A;  3K0V A;  2ONS A;  1P99 A;  3VXC A;  1Q1K A;  3KN7 A;  4BLA A;  4C1U A;  4ZEC A;  2PT1 A;  3HST A;  1NNP A;  3EHT A;  4H1X A;  4G8N A;  4HCY A;  4FOR A;  4OXV A;  4OWD A;  4G68 C;  3U8Q A;  4OTE A;  1SDX A;  3MP1 A;  3C32 A;  1GTK A;  3IR1 A;  4OYV A;  3T96 B;  3T9U A;  2FNC A;  1N7X A;  3KGC A;  1YPN A;  4IO4 A;  4JB7 A;  3QYT A;  4N13 A;  1IQ7 A;  3IAZ A;  3T9V A;  1MY1 A;  5ISU A;  3RQT A;  1MXX A;  2DWA A;  4YKK A;  3R26 A;  4GXA A;  4IO3 A;  3H6T A;  5DT6 A;  2ONK E;  1IXH A;  2D3I A;  1B5I A;  1PB8 A;  3EF7 A;  1P1O A;  2REG A;  4POX A;  2ZYN A;  3QXM A;  4DLD A;  4LA9 A;  4RA1 A;  2O51 A;  3S9E A;  5H8H A;  3TCG A;  4ZEI A;  4ZZE A;  1FTO A;  3SEV A;  2O1L A;  1MPD A;  1MY2 A;  1UTH B;  2H25 A;  2X7Q A;  4LON B;  4NF4 B;  3S4U A;  1ANF A;  1R9L A;  3G7W A;  5H8F A;  4IY5 A;  5AA4 A;  1GR2 A;  2X26 A;  3LSW A;  1PBP A;  2Q2A A;  2VGQ A;  2O6A A;  4PFW A;  4RJZ A;  1SI1 A;  4ELP A;  1IIT A;  1B0L A;  1RKM A;  1ZU0 A;  3H03 A;  3O66 A;  3OEK A;  4ZZA A;  3S2V A;  1YCJ A;  4QSC A;  1NNK A;  2WKY A;  4P11 A;  5TP9 B;  1XHY A;  2AL4 A;  1LB8 A;  3U93 A;  3CRB A;  4U1Z A;  1B52 A;  1MG1 A;  2DE4 A;  4OEU A;  4YKP A;  4H8J A;  1N76 A;  4GD5 A;  4IO5 A;  2ZYK A;  3W15 C;  5TP9 A;  1SW5 A;  2F5X A;  3SKP A;  4R2B A;  3IJO B;  4PFY A;  2RIN A;  3IB1 A;  1S9T A;  3U94 A;  3SDF A;  3TTR A;  1MXV A;  2OCU A;  2PX1 A;  2XXR A;  2DP8 A;  5DVF A;  3HN0 A;  4GXS B;  3SEW A;  2YJP A;  5HM4 B;  4QFL A;  5B7D A;  1HSL A;  2I4B A;  4MBP A;  5LOM A;  2VD3 A;  3B6T A;  3R6U A;  4G8H A;  2Z23 A;  1B3E A;  4BDL A;  1EZ9 A;  2I3V A;  4QHQ A;  4U4X A;  3MZ1 A;  4YB7 A;  4MFI A;  2Z8E A;  3OEM A;  1FQA A;  2PYY A;  5I2N B;  4H8I A;  1VFD A;  1SD3 A;  4YMA A;  2PVU A;  1B5H A;  2Q88 A;  4GF8 A;  4QFK A;  5AA1 A;  1NNF A;  2VD2 A;  1PBQ A;  3Q25 A;  1USY H;  3MAM A;  1MY0 A;  2KLF A;  4PQJ A;  1VE4 A;  2F6P A;  2ESN A;  4P0G A;  3TOD A;  4LUB A;  2RC8 A;  2F7A A;  1NKX A;  1JEU A;  2OBG A;  2AL5 A;  3TUS A;  1MQD A;  3VLW A;  4F29 A;  4FEB A;  2F36 A;  2Z22 A;  1IXG A;  1FQC A;  5HPQ A;  1WVJ A;  3OO9 A;  3RLF E;  2YPN A;  1DTG A;  5IAI A;  2GHA A;  2ZNT A;  1OQG A;  3MC2 A;  4U22 A;  3L6H A;  3VVD A;  2PBW A;  1ELJ A;  4ISU A;  3LUY A;  1B3G A;  2DE2 A;  5FHM A;  4C1T A;  3V89 B;  4OHN A;  3ILU B;  4KCC A;  5AA2 B;  5L9S A;  4EXL A;  3TEP A;  4FJP A;  1KWH A;  1LFH A;  4ZEK A;  2QL3 A;  2E0S A;  2AYS A;  5L9O A;  1FW0 A;  1OLC A;  4QFN A;  5ICQ A;  3H6V A;  4PFT A;  1IXC A;  3KN8 A;  4JDF A;  3SEU A;  3THI A;  3MW0 A;  3I3V A;  3KOS A;  3CIJ A;  1OIB A;  4NF6 B;  3PUV E;  1VSO A;  4O3A A;  3S9N C;  2UVI A;  4NF5 B;  4H67 A;  1FQE A;  2YLN A;  3T9X B;  1B0H A;  3CSG A;  3DP6 A;  3IB0 A;  3TQL A;  1Q35 A;  2LAO A;  4NF4 A;  1XVX A;  3MZB A;  5B70 A;  1N0T A;  5ITO A;  2DYX A;  1URD A;  4RXL A;  2NOO A;  1F9B A;  3GBA A;  4LQ2 A;  4POW A;  5KZT A;  5CI5 A;  1EU8 A;  4LZ5 A;  4ELQ A;  1M5F A;  2XXT A;  4JXI A;  2O69 A;  3C4M A;  3FJ7 A;  3R7X A;  4NF8 B;  5AA3 A;  5I58 A;  2GH9 A;  3C31 A;  1XT8 A;  4FE8 A;  2O7U A;  3H06 B;  3AXF A;  3M8U A;  4K3F A;  4L17 A;  4YMB A;  1UTH A;  2QS3 A;  2Y7R A;  2BJJ X;  1LBC A;  2THI A;  3CG1 A;  3K01 A;  4AB6 A;  4DCY A;  1JVX A;  3L6G A;  3RNN A;  1AH5 A;  3W9V A;  4ESW A;  5I59 B;  1MDQ A;  3EHU A;  3I6V A;  4IGT A;  1QKB A;  4KI0 E;  1PEB A;  5ICT A;  1JW5 A;  2O7I A;  4Q5T A;  4X1D A;  4OEV A;  4R9G A;  5H8Q A;  1AIV A;  3TTN A;  3O97 A;  5CM6 A;  4GL8 A;  3K4U A;  4IY6 A;  1R9Q A;  4X9T A;  3ZKK A;  1MXZ A;  4BDM A;  1Z7M E;  4YB6 A;  1LAX A;  2P0S A;  5CMK A;  3CR9 A;  4RYA A;  5H8N A;  1MQH A;  3OEN A;  5CRY A;  1B46 A;  1I6Q A;  1PB7 A;  3ILT B;  4Z0I A;  5I2K A;  4R73 A;  4G77 A;  1P1Q A;  1DOT A;  4GOT A;  2F8D A;  4O3B A;  2NXO A;  5CMC A;  4NWD A;  1OMP A;  1XOC A;  1SQY A;  4F3S A;  1LST A;  4EQB A;  2DWH A;  3E9X A;  4I9D A;  1JW4 A;  4OMB A;  4FED A;  4ZDM A;  1B7U A;  1FTL A;  1DPP A;  2W7Y A;  1URG A;  2DVZ A;  3USD A;  3PD8 A;  3G3G A;  5CMM A;  1FTJ A;  1P1W A;  3IK6 B;  1IIW A;  4KQP A;  1B58 A;  2Y7W A;  2QPQ A;  3IOR A;  3TTK A;  2QSX A;  3EPE A;  2I58 A;  2HQ0 A;  3C9H A;  1A8F A;  3D4C A;  4G2Z A;  4NE4 A;  2I49 A;  5F1Q A;  3ECR A;  3O6G A;  3IL1 B;  2B3B A;  3MUQ A;  4MLQ A;  2A5S A;  5BWJ A;  1LLS A;  3S9M C;  4I8C A;  3FIR A;  3O29 A;  4N07 A;  4YB5 A;  3VXB A;  4ZE9 A;  4ESX A;  3K2D A;  4JSO A;  3K1P A;  3LBS A;  3MVX A;  2V84 A;  4QRZ A;  1OVT A;  5KCJ A;  1H3D A;  4F2O A;  1MPB A;  3FVG A;  5A5X B;  3T9H B;  4WKM A;  1P1U A;  3OEL A;  2O84 X;  2GFE A;  2Y7P A;  3TQW A;  1LCF A;  3ZS6 A;  3CFL A;  2V25 A;  4ZEF A;  3VDF A;  5I57 B;  1M5E A;  1IZ1 A;  4ZS9 A;  5JTY B;  3A09 A;  1H43 A;  3EN3 A;  3H4Z A;  1O64 A;  4ONY A;  2REJ A;  4F22 A;  1MPC A;  2QMX A;  4KHZ E;  3TEL A;  4DIG A;  4M4G A;  1N7W A;  5I56 A;  4XKQ A;  4RPO A;  3IOU A;  2G29 A;  1UIV A;  3DP4 A;  2XXI A;  5FTI A;  1N3W A;  2OZZ A;  3LSL A;  2ZNS A;  3H6W A;  4MF3 A;  4OFJ A;  3BFT A;  3VVF A;  4PP0 A;  1AL3 A;  1ZBM A;  1Y3Q A;  5H8H B;  1A8E A;  5HBC A;  3UA8 A;  1N84 A;  3K6X A;  4C0R A;  4XXU A;  1NFT A;  1B2H A;  2F7C A;  2ZYM A;  4OER A;  4QSD A;  5CBS A;  2XXW A;  3FJG A;  1UTB A;  2Q89 A;  3IO4 A;  1B7H A;  3MPL A;  1FCK A;  4Q30 B;  2A5T B;  1L5T A;  1H45 A;  2QJE A;  3VVE A;  1NH7 A;  2RC7 A;  3SES A;  1YAE A;  3FZV A;  2M8C A;  4YKI A;  3RGY A;  3RTW B;  3C33 A;  4Q8R A;  3KBR A;  2XX7 A;  2DWJ A;  4R6H A;  4EUO A;  1Y9U A;  2ALU A;  2VHA A;  1A40 A;  3FVK A;  4HS7 A;  1FTM A;  1BP5 A;  1POY 1;  2OLB A;  2VP1 A;  3CSB A;  2F7B A;  3MP8 A;  1VR5 A;  2Y7K A;  4RK9 A;  3RT6 B;  3B6Q A;  3MVW A;  4I1D A;  3TPA A;  3TFL A;  4Z7E A;  1XC1 A;  2IA4 A;  3FVN A;  2ZXT A;  3G3J A;  3PGF A;  2NWJ A;  3ONM A;  2VOZ A;  4JWY A;  2HFB A;  1HSE A;  1T0K A;  1TWY A;  1TT1 A;  3TKD A;  4NF5 A;  3PUX E;  4F19 A;  1MY3 A;  4LZ7 A;  4O3C A;  1B6H A;  3H7M A;  1R6Z A;  1B5J A;  3MP6 A;  2XX8 A;  1SVX B;  1QUK A;  3PUY E;  3RTF B;  1H44 A;  4AQ4 A;  3A3U A;  3OSQ A;  4GFR A;  3IB2 A;  2D21 A;  1H76 A;  3OO6 A;  3FXU A;  1HSJ A;  1EZO A;  4BDR A;  1N3X A;  4THI A;  3M3L A;  3PPQ A;  3ODB A;  1D9V A;  3QK6 A;  4YAH X;  4NMY A;  4OFO A;  2V3T A;  4KPT A;  4OFL A;  2V3U A;  3BBR A;  5K2Y A;  3FJM A;  4FAT A;  4IO2 A;  1USY E;  5I59 A;  1DPE A;  3DLN A;  4F39 A;  4Q0C A;  3MVZ A;  3O6I A;  1BKA A;  2AIX A;  2I4C A;  1VFE A;  2DXR A;  5DVI A;  2RCB A;  4MH5 A;  4DXC A;  4NED A;  3TMG A;  1IUD A;  2HEU A;  3K1N A;  3Q27 A;  4FIM A;  1PC3 A;  1II5 A;  3FAT A;  3KSJ A;  3DM0 A;  5FTH A;  3VFJ A;  4G4P A;  4TOZ A;  5I84 A;  4RNS A;  2R9J A;  4OET A;  1B9J A;  5TPA B;  1ZTY A;  4LQ5 A;  5KCJ B;  2I0B A;  2HAU A;  1BIY A;  1JVY A;  1NMU A;  2UVJ A;  1MDP 1;  1FQD A;  5DYH A;  2NVU B;  1D9Y A;  3OOA A;  2XXY A;  4ND9 A;  4NF6 A;  4OEN A;  2FA7 A;  4U23 A;  2OWT A;  2B3F A;  3N5L A;  1OLA A;  5M2V A;  4XKR A;  4H0W A;  3PU5 A;  2ANJ A;  5FHO A;  3V5A A;  1AMF A;  1B4Z A;  3HV1 A;  3MZ9 A;  3HCQ A;  1MQG A;  1RYX A;  3N6U A;  1O63 A;  4WED A;  5F7V A;  1IEJ A;  3MVY A;  4GWO A;  4KD5 A;  2PT2 A;  2F34 A;  3CVG A;  2R6G E;  3M3K A;  3FXR A;  2XXP A;  4ZED A;  4IO6 A;  3GXA A;  4GQO A;  2HXW A;  3QSL A;  4DCX A;  5ITP A;  4UAC A;  4F18 A;  1LFG A;  1MXY A;  3CFZ A;  3EHS A;  3N26 A;  3SER A;  4GVO A;  2P1S A;  4ELR A;  2XXV A;  3ZKL A;  1S50 A;  1MM6 A;  2UXA A;  3HHG A;  3LSF B;  2DOJ A;  3PMX A;  5ELV A;  3VLU A;  3TAJ A;  1QJM A;  4MLV A;  3HO7 A;  5AA4 B;  4XKP A;  3G3I A;  1B3L A;  2A5T A;  2H99 A;  3G3K A;  3HHF A;  3UIF A;  1ATG A;  1B3H A;  1B40 A;  3V8X B;  4R74 A;  2HAV A;  2Q9T A;  4GL0 A;  2RCA A;  4UA8 A;  3V83 A;  3TCF A;  1I69 A;  5JK4 A;  1WDN A;  2FYI A;  1M5B A;  1B4H A;  1IXI A;  3MWB A;  3OMB A;  4TLL B;  5EHM A;  2HZK A;  1O7T A;  2DXY A;  2XD3 A;  4WXJ A;  1XS5 A;  1ZJL A;  1SYI A;  1OVB A;  3K6W A;  1MH3 A;  1B7Z A;  4U21 A;  2RC9 A;  3F11 A;  1B3F A;  2OK2 A;  4JWO A;  4KFQ A;  1BLF A;  3JZJ A;  1D4N A;  3O28 A;  1US5 A;  2ABH A;  1MRP A;  1LAH E;  3O9P A;  3VV5 A;  3DP8 A;  4HW8 A;  5J1D A;  2HCA A;  4XKN A;  1Y20 A;  4X1B A;  3RN8 A;  3T66 A;  3PMV A;  1A7L A;  3SEX A;  4HCW A;  4KYS A;  1Y4T A;  4NWC A;  4R75 A;  4F2Q A;  1QUJ A;  4R6K A;  2XHD A;  1LAF E;  3VLV A;  3TTL A;  5AE4 A;  5CBR A;  2H5Y A;  5H8Q B;  4H5F A;  5H8S A;  1DSN A;  3QUF A;  4KR5 A;  1B1X A;  1TFD A;  3LR1 A;  2CZL A;  4QFP A;  5I2K B;  2RKM A;  3MQ9 A;  1JQF A;  1JW1 A;  4U1O A;  5L8D A;  2DE3 A;  4GIZ A;  3RUM A;  1MY4 A;  2ZMB A;  3IOW A;  3KN3 A;  4H6D A;  4EQ9 A;  3CG3 A;  5CC2 A;  2DWI A;  2V3Q A;  1TFA A;  2Y7I A;  3OD7 A;  4F3B A;  4JSD A;  1B1H A;  2R71 A;  1QUL A;  3QIM A;  3Q26 A;  3UK4 A;  1GV8 A;  1SW4 A;  1A99 A;  4G68 A;  3U72 A;  3C36 A;  3KG2 A;  4E0W A;  5K2X A;  4M1V A;  2Y84 A;  1LB9 A;  2Z8D A;  3MPK A;  1QUI A;  2XXX A;  4U2R A;  1R1N A;  3OO7 A;  4ELO A;  4FAJ A;  3GLB A;  4IO7 A;  4ECF A;  3Q28 A;  4RPN A;  1NL5 A;  2DS9 A;  1MQJ A;  3UOR A;  5I57 A;  2F35 A;  4NTL A;  1CE2 A;  2F78 A;  2G93 A;  2I0C A;  2V93 A;  3D4G A;  3FV1 A;  3OSR A;  3PPR A;  1S7Y A;  1MS7 A;  3O2A A;  4BDQ A;  5DVJ A;  4EDP A;  3FV2 A;  3TDJ A;  3ZSF A;  4ZEB A;  3K1M A;  4DZ1 A;  3QUJ A;  1UIU A;  3IX1 A;  1JEV A;  3M3F A;  5CMB A;  2QMW A;  1URS A;  3G3F A;  3PPN A;  4QF9 A;  1BTJ A;  1UQW A;  2UYF A;  4OVJ A;  5EYF A;  1I6A A;  2I48 A;  4HTG A;  1LFI A;  1UTB B;  2QS2 A;  4LP2 B;  2H4I A;  1QKA A;  2X7P A;  1WOD A;  1EH3 A;  1J1N A;  2DVC A;  3K02 A;  4YKJ A;  4YZZ A;  3H3G A;  4LVQ A;  1B32 A;  3TYH A;  3O6H A;  4H65 A;  3C35 A;  2CMO A;  3U1O A;  3N94 A;  3P7I A;  4XTC Q;  1Y1Z A;  3T22 A;  4R2F A;  1RYO A;  2ZNU A;  3FGS A;  1Y1M A;  4NF8 A;  5I58 B;  2UVH A;  1GVC A;  2H98 A;  3PUZ E;  3FUZ A;  3WAF A;  4XIG Q;  4QFO A;  3IOT A;  1I6B A;  1Y3N A;  2F97 A;  3FD3 A;  3PV0 E;  3W9W A;  1B05 A;  2UYE A;  4JWX A;  1MQI A;  3DEL B;  3RY3 A;  5TPA A;  3OO8 A;  3E3K A;  4GRK A;  4DE8 A;  3KJT A;  1P1N A;  4IB2 A;  1LCT A;  4JBZ A;  4OES A;  2GHB A;  2XXU A;  3H6U A;  3KEI A;  1N04 A;  1QVS A;  3FXQ A;  5L9M A;  2IEE A;  3I5O A;  1QW0 A;  1NNT A;  3JYR A;  4IGR A;  4DXU A;  2QRY A;  5TU0 A;  3VE1 B;  2O68 A;  2E1S A;  3EQ1 A;  5BUU A;  1AOV A;  1SW1 A;  4TLM B;  5IKB A;  3LC8 A;  3PMW A;  3IOV A;  4TQU Q;  4EXK A;  1DTZ A;  1SBP A;  1MM7 A;  1SW2 A;  3MJN A;  3SET A;  5AA2 A;  1YTV A;  3G3H A;  3K6U A;  4LZ8 A;  2DQV A;  5FHN A;  3N6T A;  4ZE8 A;  2Q8J A;  4AB5 A;  3FAS A;  2XX9 A;  1PDA A;  3KFM A;  1NH8 A;  3PUW E;  3E4R A;  4GLI A;  4KYE A;  2Z8F A;  4N6P A;  5DEX B;  4F3P A;  2H9B A;  1Y4C A;  4I62 A;  3K00 A;  3FVO A;  2Q2C A;  2XXH A;  4G8M A;  5DEX A;  2GRV A;  1LGB C;  3QAX A;  2F6G A;  1US4 A;  4P0I A;  1OQH A;  5H8N B;  2ONR A;  1JNF A;  1ZMG A;  3BKI B;  1SYH A;  3K6V A;  1M5D A;  4R72 A;  4G68 B;  3RPW A;  3TTM A;  1Y3P A;  3GBB A;  3C34 A;  3KJ7 A;  4F3G A;  3TZA A;  1PB9 A;  4YIC A;  3Q29 A;  2D5W A;  2ZYO A;  3JV9 A;  1A54 A;  3T93 B;  4F1V A;  1MXW A;  4DXB A;  5H8F B;  3PD9 A;  3E13 X;  3PPO A;  4LAT A;  4QSE A;  2O1M A;  3HPI A;  4EQ7 A;  3IJX B;  4RK2 A;  3RT8 A;  1JET A;  3UN6 A;  1GGG A;  1FQF A;  4F1U A;  4BDO A;  3KZG A;  4E0X A;  3B7D A;  3A3C A;  3TCH A;  4EF2 A;  4PET A;  1EZP A;  4BDN A;  3IO6 A;  3WAE A;  4OQO A;  1M5C A;  1FTK A;  3CFX A;  4WEP A;  5AA2 D;  1SI0 A;  2DSF A;  4EF1 A;  3UP9 A;  2HZL A;  4R9F A;  1POT A;  1ZIU A;  3OXN A;  3U92 A;  2B65 A;  3KOT A;  3UGW A;  5I56 B;  4R6Y A;  4F31 B;  1A55 A;  2I3W A;  2P2A A;  1DMB A;  5KDT A;  2XXQ A;  4YU0 A;  2I6E A;  3BFU A;  3KSX A;  4PE5 B;  4X48 A;  1D3K A;  2NUV A;  5A5X A;  5JTY A;  5KDT B;  1Z7N E;  1CB6 A;  1ZKB A;  3B6W A;  5I2N A;  2OJT A;  3SEY A;  1ZLQ A;  1TXF A;  1B51 A;  2QS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...