3TTMA

Crystal structure of spud in complex with putrescine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
341
Chain Sequence
b'DNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyamine transport protein
publication title Structural Basis of Substrate Binding Specificity Revealed by the Crystal Structures of Polyamine Receptors SpuD and SpuE from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 122
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttmA02
4ZEFA 3O2AA 3RUMA 3UN6A 1ZJLA 1HSLA 2I49A 5TPAA 3H6UA 2QRYA 3T93B 2ZMBA 4U2RA 1LB9A 4U4XA 4DCYA 5JTYB 4OFJA 2VOZA 4OEVA 4F3SA 1Y1ZA 1Y1MA 1FQEA 5B70A 4PFUA 3JYRA 5I58B 1GVCA 2XHDA 3UIFA 1XS5A 3OO6A 2O7UA 5I84A 4NE4A 4OWDA 3TAJA 4JDFA 3IOVA 3EHSA 1B3GA 2GFEA 1M5FA 4U22A 4O3CA 5EHSA 4JSOA 2O1LA 2NWJA 4KQPA 4QHQA 1UTBB 1YAEA 4LATA 4LA9A 3OSQA 1ATGA 3KGCA 3L6GA 2XXPA 4X48A 1XHYA 5AA2B 1AMFA 2DP8A 3MBPA 3MVZA 4GWOA 1PBPA 1AIVA 3PV0E 3IX1A 3PPQA 1A54A 2F36A 5DT6A 4NF8B 2PT2A 1Q35A 4DIGA 3I5OA 4FORA 4RXLA 3T9HB 4PFTA 1D4NA 2I3VA 2P0SA 5ELVA 3PUXE 4R72A 5DVJA 1WODA 2Y7RA 2DYXA 2ZNSA 1MXXA 3EHUA 1B3HA 5CM6A 3CSGA 3PGFA 3D4GA 2NOOA 1IXCA 4QFLA 2I0BA 4HCWA 1SDXA 2Q8JA 5H8SA 1I6QA 3PUZE 1DTZA 2I0CA 4I1DA 1D9VA 3H03A 4PFYA 1OLCA 3HPIA 4ZE8A 3TCHA 4M1VA 1EZOA 4DE8A 2W7YA 1P1QA 1ZTYA 4RPNA 3RTWB 4XKPA 1JVXA 1CB6A 2I48A 3H7MA 3N26A 1IZ1A 3A3UA 3FV1A 5DTBA 5BWJA 1FTLA 3PU5A 2ALUA 1MG1A 1MPBA 5DYHA 3CR9A 5I57B 2VD2A 2DQVA 5CMMA 2VGQA 2I3WA 2OJTA 1SQYA 3MZ9A 2E1SA 1ANFA 1NNTA 1Y20A 1FQAA 5H8QA 4ZECA 5AA4B 1ZKBA 3CI8A 1IEJA 2DSFA 4U4SA 1QUKA 4PQJA 4DXUA 3G3IA 1JW5A 4KCDA 1FTJA 3LUYA 2Q9TA 1BTJA 3U92A 4GIZA 1JW4A 1SI1A 3I6VA 4AB5A 1MDP1 2CZLA 1B2HA 2ZXTA 2ZNTA 4C1UA 3PD9A 4G77A 4NF6B 3OOAA 4Z0IA 1S9TA 1A7LA 4EF2A 4BDOA 4XKQA 4UA8A 4X9TA 3SEWA 1R6ZA 1VFEA 5A5XA 3QUJA 2RF1A 1M5DA 3E13X 1R9QA 5L9OA 3RGYA 4ISUA 1P1OA 3PPPA 2OLBA 1MPCA 3M3KA 3TDJA 2HEUA 4LUBA 1GTKA 4IY6A 2F7CA 4I8CA 3C36A 3U1OA 3K6VA 4H0WA 1OLAA 3ILUB 1BKAA 2H4IA 1B3EA 1Y3PA 3RT8A 4HTGA 3TCGA 4H6DA 1SW2A 3FJGA 4KCCA 5TPAB 3U72A 4ZDMA 1XT8A 4RA1A 1HSEA 1MY3A 3T9XB 4YMAA 3OD7A 5CMCA 1VE4A 4GVOA 4NWCA 3QAXA 3HSTA 5EYFA 1ELJA 5CMBA 1IXIA 2XD2A 3H4ZA 3EF7A 4ELPA 1B5JA 1FQDA 4QFOA 2LAOA 4PFWA 2H5YA 1B5HA 1M5BA 1GV8A 5HBCA 3SESA 5AA1A 2V93A 5CBSA 3CFLA 2H25A 3TPAA 3FXRA 1PBQA 4KD5A 2Y7WA 4NEDA 5KCJA 3FD3A 3IB0A 4FJPA 2HFBA 4P0IA 2O6AA 1USYH 1B58A 2F5XA 3MPLA 2PYYA 1B7HA 3L6HA 3IOUA 3IJOB 4R6KA 2A5TA 3JZJA 2XX9A 3TTLA 3BKIB 4YB5A 2XXRA 3H06B 1MH3A 4IO5A 3KN3A 1RYOA 3RTFB 4ONYA 3ILTB 2Q2CA 3E3KA 2Z8EA 5F1QA 3IB1A 3S2VA 3MAMA 2QL3A 1MDQA 1WVJA 1B5IA 3FXQA 3C34A 4DXBA 1MY1A 4XXUA 3G3HA 2HZKA 2X7PA 1LSTA 3CFZA 2M8CA 4OZ9A 3H3GA 2OK2A 2R71A 5L8DA 5H8HB 4QFKA 3TTNA 2XXYA 3V5AA 3MPKA 3MWBA 3KJ7A 2Q88A 1MY4A 2OCUA 3FV2A 3KFMA 3LSLA 1H76A 4QSDA 4H8JA 1Y3QA 4FE8A 1H3DA 2AL5A 2P2AA 4MBPA 3OMBA 4YMBA 4RJZA 1LAGE 3MC2A 1RKMA 2F6GA 2O68A 3DP4A 2XD3A 4POXA 4E0XA 4U23A 3PMWA 5TU0A 1MQHA 3FVGA 4P0GA 1QVSA 1YTVA 1Z7ME 2R6GE 1A55A 4ZS9A 3LSFB 1P1WA 5L9MA 3N94A 3OSRA 4U21A 1JVYA 4KI0E 1OVBA 1Y4CA 2DWAA 4LQ5A 4F2OA 4H67A 2F8DA 2Z8DA 3VDFA 3TZAA 4F19A 4UACA 2PBWA 3S9NC 5H8QB 1FTMA 2FA7A 4EF1A 3N6TA 3VXCA 3LSWA 3QIMA 2XXIA 2ZNUA 3UK4A 2Y7PA 3RY3A 3RNNA 3KBRA 3SEXA 5FHOA 4EQ7A 3K6UA 1FW0A 4G68A 3C35A 4LZ7A 3DLNA 4R73A 4ESWA 4LVQA 1LCTA 3UORA 3FUZA 3R6UA 4R9FA 3I3VA 1L5TA 3Q27A 4RK9A 4GQOA 4ZZAA 3GBAA 4ZEKA 2QJEA 5A5XB 1ZBMA 1P1UA 1MM7A 1USYE 1S7YA 3IJXB 3U8QA 5CBRA 4NMYA 4AQ4A 2I4BA 5HM4B 2ONRA 5FHMA 1B7ZA 2HAVA 3O66A 4H1XA 1POY1 5FHNA 3O28A 2HZLA 5AE4A 2RC8A 1DPEA 4G68C 1ZU0A 4TQUQ 3R26A 4OYVA 3KZGA 5H8HA 4U1ZA 3PUYE 3FGSA 3O29A 1B05A 4KYSA 2FYIA 3W15C 1LLSA 1UTHA 1B9JA 3VVEA 5I59A 5H8NA 2ONSA 1FQBA 3QYTA 4EUOA 1I6BA 1EH3A 3C9HA 1FTOA 4XKNA 4DZ1A 5KDTB 1MXWA 2Y84A 1H44A 3TQLA 1NMUA 1VR5A 2B3BA 2Q2AA 4TLLB 1MY0A 3N5LA 4JXIA 4Q0CA 3MVXA 4OERA 1SI0A 3T22A 1SBPA 1Z7NE 1ZMGA 3IL1B 4ELRA 5KCJB 1KWHA 2I4CA 1B6HA 4R6HA 3O6IA 5DVIA 1B3FA 2DVZA 4BLAA 4PE5B 3MUQA 1SYIA 4OHNA 1PEBA 2A5TB 2VHAA 3FASA 4N6PA 4HCYA 1FQCA 1TT1A 4ZEDA 3LC8A 2HAUA 1LAHE 5ICQA 4GF8A 2V25A 1SYHA 5I56A 4MLVA 4LZ5A 3H6TA 3PPOA 2Y7KA 3PMXA 4PETA 4R75A 5JEIA 2DE2A 3V8XB 3V83A 1NH8A 2CMOA 3VXBA 5JK4A 4GOTA 1II5A 4YKJA 1F9BA 3BBRA 3BFUA 5KZTA 4L17A 1LB8A 1B0LA 3VLWA 2ANJA 3SEVA 1BIYA 4MLQA 3SEUA 4QF9A 4NF5A 3RQTA 3TCFA 3THIA 1MPDA 2QS3A 4OTEA 3OEMA 3FVNA 2PX1A 2O7IA 2OWTA 1POTA 1NNFA 4GL8A 2F7AA 1FTKA 3VLVA 3W9VA 2NXOA 1NNKA 3SEYA 5FTHA 3Q28A 2XXHA 2F78A 4YKPA 2QMXA 2XXXA 3GLBA 2V3QA 1IXGA 3FIRA 3IK6B 1LBCA 4R74A 1EZ9A 3O6GA 4EDPA 4OFOA 4QFNA 3T9UA 1OVTA 3USDA 4OQOA 2V84A 4H5GA 4YKIA 1OQGA 2RC7A 4IGTA 2NVUB 3KN7A 1P1NA 3QXMA 3OENA 3U94A 3PUWE 2XXUA 4F22A 5IKBA 5ITOA 2X26A 3Q25A 5KDTA 1Q1KA 1ZIUA 3PPRA 4XTCQ 4GXAA 3RT6B 3OO9A 3EHTA 3EN3A 2UVJA 3EPEA 2Z22A 1H45A 3DELB 1TWYA 3B7DA 5IAIA 4G4PA 4H5FA 3CRBA 1TXFA 3C31A 1URSA 3IO4A 2DVCA 5DEXA 3UGWA 3O97A 3Q26A 3TODA 1JEUA 1MH4A 5TP9A 1NH7A 4LP2B 4G68B 1I6AA 4IO6A 4F39A 1N7WA 3IORA 4OESA 4R6YA 3WAFA 3ZKKA 2YLNA 3OXNA 4Z7EA 2PVUA 4XIGQ 3V89B 4FAJA 2ZYOA 1PB8A 2A5SA 2XXTA 1B32A 1IQ7A 5CC2A 1AL3A 3K4UA 1AH5A 3IAZA 2QS2A 2F6PA 2UVIA 2XXVA 4YICA 4HS7A 2F35A 2Y7IA 2O1MA 3O6HA 1LFGA 3FJMA 4JWOA 3R7XA 2YPNA 3VLUA 2ZYNA 1QULA 3AXFA 2NUVA 2REGA 1Y4TA 3K0VA 4O3BA 4F31B 2REJA 3M3LA 4NF4A 4F1UA 1EU8A 4ELQA 5F7VA 2HXWA 4KR5A 3UP9A 3VFJA 3MW0A 4KHZE 1B51A 2AIXA 2DXYA 1D3KA 1GR2A 3FJ7A 4EXKA 4JWYA 4H8IA 1MM6A 2O84X 4LQ2A 1UTHB 4F3GA 1JQFA 3G3GA 4EQBA 5I59B 1DTGA 5H8NB 5H8FA 3ZKLA 3CG3A 2GHBA 3KSJA 1IXHA 1B1HA 2DXRA 4R9GA 4JBZA 3MVWA 2ONKE 2GRVA 2AL4A 1N04A 1NNPA 3MP6A 1HSJA 4H65A 4OFLA 3GZGA 4IGRA 2VP1A 5J1DA 4M4GA 3U93A 3TTKA 3DP6A 1EZPA 1SW5A 1OMPA 1MRPA 2HCAA 4F1YA 2DE4A 3VE1B 2XX7A 2UYFA 3OEKA 5I2NA 1N7XA 2I58A 3KOTA 3A3CA 3SERA 4F29A 3S9MC 3MJNA 4IO3A 1JEVA 1MXYA 2G29A 2DWHA 2B65A 3CVGA 1A99A 5I56B 2V3TA 1B46A 4X1DA 1SVXB 1JETA 2R9JA 5BUUA 4ND9A 3TELA 5L9SA 3ODBA 4DXCA 3K1MA 3TFLA 4R2BA 2I6EA 4OXVA 1SD3A 1O64A 5I2KA 2DWJA 4GXSB 3T96B 4OVJA 4R2FA 3VVDA 2RCBA 3RLFE 4P11A 2F97A 1DSNA 1US5A 2QMWA 3PD8A 4G8NA 3OO8A 3M3FA 3SETA 1P99A 4QFPA 4BDQA 3EQ1A 1B4ZA 2DWIA 4K3FA 4GRKA 4NF5B 4FEBA 3VV5A 4ZZEA 1A8FA 3KOSA 3O9PA 2THIA 2QSXA 3UA8A 3KG2A 3CIJA 3B6WA 4LONB 2OWSA 2RC9A 1MXUA 5HPQA 3P7IA 5M2VA 1BP5A 3HO7A 2GHAA 4YKKA 3S9LC 3TUSA 4KPTA 3HHFA 4Q5TA 3PPNA 1MXZA 4F2QA 3KN8A 1N0TA 4LZ8A 4RY1A 1QJMA 3FZVA 1URGA 3CSBA 4IO2A 3S9EA 4GD5A 2UYEA 3OO7A 4JWXA 1GGGA 2UVHA 4X1BA 3T9VA 4NTLA 1LFHA 4OETA 2RCAA 4MH5A 3CFXA 1OQHA 1MQIA 3TKDA 4HW8A 3IOWA 4I9DA 5ITPA 2UXAA 4GFRA 2DOJA 2D21A 2DS9A 4N13A 3Q29A 4OENA 4EXLA 2BJJX 4O3AA 3WAEA 4GL0A 1NL5A 3QSLA 4N07A 2X7QA 3RPWA 1VFDA 2H9BA 2GH9A 1PDAA 5CRYA 2F34A 1FQFA 3QK6A 3QUFA 1PC3A 3KSXA 1IUDA 4RNSA 1XVYA 5DEXB 4OMBA 4E0WA 1NKXA 2XXWA 2Z8FA 4IB2A 1AOVA 1N3XA 1B40A 5TP9B 1A8EA 2FNCA 2AYSA 2F7BA 1B4HA 4Q8RA 2XX8A 2XXQA 2O51A 2PMSA 3N6UA 1US4A 4FECA 3C32A 5JTYA 3FVKA 3HN0A 1R9LA 4G2ZA 1B1XA 3MVYA 3BFTA 5DVFA 1S50A 1R1NA 3T66A 5I58A 2OBGA 1YPNA 2QS4A 3K1NA 3TQWA 1Y9UA 3W9WA 3FATA 4THIA 1M5CA 4RK2A 1B3LA 2O69A 1B7UA 1J1NA 1QKAA 1T0KA 3G3JA 4YAHX 5EHMA 3KJTA 3FXUA 1XVXA 3K2DA 4QSEA 2ZYMA 4NF4B 4JB7A 1IITA 1NFTA 3OELA 2D5WA 3MP8A 2H98A 3H6WA 1MS7A 1XOCA 4BDLA 1QUIA 3GXAA 1UTBA 1JW1A 2HQ0A 4ESXA 3MQ9A 4C1TA 1FCKA 4C0RA 3C33A 4ZEIA 4F1VA 5AA2A 4QSCA 1YCJA 1TFDA 3H6VA 1N3WA 5FTIA 5H8FB 1MQJA 2G93A 1LGBC 4NF8A 3ZS6A 3MP1A 2QS1A 2H99A 1ZLQA 3CG1A 3M8UA 3C4MA 1LAXA 1MY2A 4JSDA 4WEDA 4GLIA 3E4RA 3K6XA 4IO7A 5K2YA 3TTRA 4XKRA 3SDFA 5AA3A 3S4UA 1PB9A 1LFIA 4F3PA 4WXJA 4BDNA 2WKYA 4YB6A 1N84A 4PP0A 4OEUA 3G3FA 1Y3NA 4WKMA 3RN8A 5I2NB 4ZEBA 3IOTA 5CI5A 4YZZA 1MQGA 3K01A 3JV9A 4DCXA 1D9YA 3B6TA 3MZBA 4ZE9A 3G3KA 4TLMB 3DP8A 4NWDA 5I2KB 3F11A 4QRZA 4KFQA 1TFAA 1UQWA 3IO6A 3HHGA 3PMVA 3VVFA 3IB2A 3LR1A 3B6QA 4KYDA 2P1SA 3D4CA 1DMBA 1JNFA 3G7WA 2UVGA 2ZYKA 4MF3A 1URDA 4RYAA 1DPPA 3ONMA 5B7DA 5LOMA 4IO4A 4U1OA 5I57A 4WEPA 4AB6A 1H43A 4Q30B 4RPOA 1MXVA 3TEPA 1LAFE 2DE3A 5ICTA 5CMKA 2YJPA 2OZZA 5AA4A 3A09A 4DLDA 3KEIA 2ESNA 4BDRA 3HV1A 1SW4A 4F18A 3SKPA 2RINA 1UIUA 1QW0A 2PT1A 3K6WA 4DDDA 3E9XA 4FIMA 5ISUA 3TYHA 4FATA 2Q89A 4F3BA 1UIVA 1A40A 2RKMA 3HCQA 1O63A 1O7TA 1VSOA 3LSXA 1M5EA 5AA2D 4IY5A 3GBBA 2VD3A 4TOZA 2Z23A 1XC1A 4EQ9A 4G8HA 4NF6A 4KYEA 2KLFA 4YU0A 1QKBA 1N76A 5K2XA 2D3IA 2IEEA 3K02A 4YB7A 4ECFA 2QPQA 1MQDA 4MFIA 1I69A 3ECRA 3K00A 1QUJA 3PUVE 1WDNA 3LBSA 2E0SA 1IIWA 4I62A 1DOTA 1RYXA 3FVOA 2IA4A 3ZSFA 3TMGA 3K1PA 1CE2A 4FEDA 1OIBA 3MZ1A 4POWA 1B52A 4BDMA 4ELOA 3DM0A 3TTMA 2V3UA 4G8MA 1PB7A 1BLFA 1LBBA 1B0HA 2ABHA 1LCFA 2B3FA 1SW1A 3IR1A
chains in the Genus database with same CATH superfamily
4ZEFA 3O2AA 1YYZA 3RUMA 4I40A 3UN6A 4PAKA 1ZJLA 5F24A 1HSLA 2I49A 1EYIA 2XWIA 4AS4A 5TPAA 3H6UA 2QRYA 5I3SA 3T93B 2ZMBA 1RDYA 4U2RA 1LB9A 4P9KA 4U4XA 4DCYA 5JTYB 4OFJA 2VOZA 4OEVA 4F3SA 1Y1ZA 1Y1MA 1FQEA 5EYHA 5LTCA 5B70A 4IR8A 4PFUA 3JYRA 4GX4A 4PAIA 5I58B 1GVCA 1RDXA 2XHDA 3UIFA 2B4LA 1XS5A 3OO6A 2O7UA 5I84A 4NE4A 1KZ8A 4OWDA 3TAJA 4JDFA 3IOVA 3EHSA 1B3GA 2GFEA 1M5FA 3IFAA 4U22A 4O3CA 1G0IA 5EHSA 4JSOA 4GWUA 4N6DA 2O1LA 2NWJA 4KQPA 3KC1A 4QHQA 1UTBB 1YAEA 4LATA 4LA9A 3OSQA 1ATGA 4HE2A 3KGCA 3L6GA 2XXPA 4X48A 1XHYA 5AA2B 1AMFA 2DP8A 3MBPA 3MVZA 4GWOA 1PBPA 1AIVA 3PV0E 3IX1A 3PPQA 1A54A 2F36A 4GWYA 5DT6A 4NF8B 2PT2A 1Q35A 4DIGA 2ZZVA 3I5OA 4FORA 3RPLA 2FBPA 2WBDA 4RXLA 2MKZA 3T9HB 4PFTA 1D4NA 2I3VA 2P0SA 5ELVA 3PUXE 4R72A 5DVJA 1WODA 1AWBA 2PFZA 2Y7RA 2DYXA 2ZNSA 5ET5A 1MXXA 1EYKA 3EHUA 2QFLA 1B3HA 5CM6A 3CSGA 3PGFA 3D4GA 4H45A 2NOOA 1IXCA 2XWOA 2FVZA 4QFLA 4PCDA 5EYGA 2I0BA 3CHGA 4HCWA 1SDXA 2Q8JA 5H8SA 1I6QA 3PUZE 1DTZA 2I0CA 4I1DA 1D9VA 3H03A 1FSAA 4QXDA 4PFYA 1OLCA 3HPIA 5I7IA 4ZE8A 3TCHA 3U65A 4M1VA 1EZOA 4DE8A 4UABA 2W7YA 1P1QA 1ZTYA 4RPNA 4N8GA 3RTWB 4XKPA 1JVXA 1CB6A 3GYYA 2I48A 3H7MA 3N26A 1IZ1A 3A3UA 3FV1A 5DTBA 2QVRA 5BWJA 1FTLA 4MX6A 3PU5A 2ALUA 1MG1A 1MPBA 5DYHA 3CR9A 5I57B 2VD2A 2DQVA 4GWZA 5CMMA 2VGQA 2I3WA 5FBPA 2OJTA 4O94A 1SQYA 3MZ9A 2E1SA 1ANFA 1NNTA 1Y20A 4MMPA 1FQAA 5H8QA 4ZECA 1IMDA 1XI6A 5AA4B 1ZKBA 1FPFA 1FRPA 3CI8A 1IEJA 1EYJA 2DSFA 4U4SA 1QUKA 1INPA 4PQJA 2ZZWA 4DXUA 3G3IA 1JW5A 2VT5A 4KCDA 1FTJA 3LUYA 4NGUA 2Q9TA 1BTJA 3U92A 4GIZA 1JW4A 1SI1A 3I6VA 4AB5A 1MDP1 2CZLA 1B2HA 2ZXTA 2ZNTA 4C1UA 3PD9A 4G77A 4NF6B 3OOAA 4Z0IA 1S9TA 1A7LA 4EF2A 4BDOA 4XEQA 4XKQA 4UA8A 2Y5LA 4X9TA 3SEWA 1R6ZA 1VFEA 1NUXA 5A5XA 3QUJA 2RF1A 1M5DA 3E13X 1R9QA 5L9OA 3RGYA 4ISUA 2Q8MA 1P1OA 2ZZXA 3PPPA 2OLBA 4XF5A 4PF6A 4N17A 1MPCA 3M3KA 3TDJA 2HEUA 4LUBA 1GTKA 4IY6A 4X04A 1BK4A 2F7CA 4I8CA 3C36A 2KR0A 3U1OA 2KQZA 3K6VA 4H0WA 1OLAA 3ILUB 1BKAA 2H4IA 1IMFA 1B3EA 1Y3PA 3RT8A 4HTGA 3TCGA 2OWZA 4H6DA 1SW2A 3FJGA 4KCCA 5TPAB 3U72A 4ZDMA 1XT8A 4RA1A 1HSEA 3T1BA 1MY3A 4PDDA 3T9XB 4YMAA 3OD7A 5CMCA 1VE4A 4GVOA 4NWCA 3QAXA 3HSTA 5EYFA 4GX6A 1ELJA 5CMBA 1IXIA 2F3BA 2XD2A 4PF8A 3H4ZA 2CZHA 1FBGA 3EF7A 4ELPA 1B5JA 1FQDA 4QFOA 2LAOA 4PFWA 2H5YA 1B5HA 1M5BA 1GV8A 1NI9A 1FPEA 5HBCA 3SESA 5AA1A 2V93A 5CBSA 3CFLA 2H25A 3TPAA 3FXRA 1PBQA 4KD5A 2Y7WA 4JVCA 4NEDA 5KCJA 3FD3A 3IB0A 4FJPA 2HFBA 4P0IA 2QVVA 5DW8A 2O6AA 1USYH 1IMCA 1LEVA 1B58A 2F5XA 3MPLA 4JVDA 2PYYA 1B7HA 3L6HA 3IOUA 3IJOB 4R6KA 2A5TA 3JZJA 2XX9A 1LBWA 3TTLA 3BKIB 4YB5A 2XXRA 3H06B 1MH3A 4IO5A 3KN3A 1RYOA 3RTFB 4ONYA 1KA1A 3ILTB 2Q2CA 3E3KA 2Z8EA 5F1QA 3IB1A 3RPLB 3S2VA 3MAMA 2QL3A 1MDQA 1WVJA 1B5IA 3FXQA 3C34A 1JP4A 1NV7A 4MAGA 4MNCA 4DXBA 1MY1A 4XXUA 3G3HA 3QMFA 2HZKA 2X7PA 1LSTA 3CFZA 2M8CA 4OZ9A 3H3GA 2OK2A 2R71A 5L8DA 1NV4A 5H8HB 4QFKA 3TTNA 2XXYA 3V5AA 4MHFA 3MPKA 3MWBA 3KJ7A 2Q88A 1MY4A 2OCUA 3FV2A 3KFMA 1NUWA 3LSLA 1H76A 4QSDA 4H8JA 1Y3QA 1FPKA 4FE8A 1H3DA 2AL5A 4N91A 1SPIA 2P2AA 4MBPA 3OMBA 4YMBA 4RJZA 1LAGE 3MC2A 1RKMA 2F6GA 2O68A 1FPIA 3DP4A 2XD3A 4POXA 4E0XA 4U23A 3PMWA 5TU0A 1MQHA 3FVGA 4P0GA 1QVSA 1YTVA 3HFUA 1Z7ME 2R6GE 1A55A 4ZS9A 1DK4A 3LSFB 1P1WA 2CEYA 3D1RA 5L9MA 4P56A 3N94A 3OSRA 4U21A 5IZZA 1JVYA 4KI0E 1OVBA 1Y4CA 2DWAA 4LQ5A 4F2OA 4H67A 2F8DA 2Z8DA 3VDFA 3TZAA 1D9QA 4F19A 4UACA 2PBWA 3S9NC 5H8QB 1FTMA 1YXIA 2FA7A 4EF1A 2Y5KA 3N6TA 3VXCA 3LSWA 3QIMA 2XXIA 2ZNUA 3UK4A 2Y7PA 4O7MA 3RY3A 1NV5A 1FTAA 4PC9A 3RNNA 3KBRA 3SEXA 5FHOA 4EQ7A 3K6UA 1FW0A 4G68A 3C35A 4LZ7A 3ROJA 3DLNA 2WEFA 4R73A 2GQ1A 4ESWA 4PE3A 5EQAA 4LVQA 1LCTA 3UORA 3FUZA 4R9FA 3R6UA 2V4CA 3I3VA 1L5TA 2WBBA 3Q27A 4RK9A 4GQOA 4ZZAA 4MCOA 3GBAA 4ZEKA 4QBAA 2WYPA 2QJEA 5A5XB 1ZBMA 5LDZA 1P1UA 1MM7A 1USYE 1S7YA 3IJXB 3U8QA 5CBRA 4NMYA 4AQ4A 2I4BA 5HM4B 2ONRA 5FHMA 1B7ZA 2HAVA 3O66A 4PAFA 4H1XA 1POY1 5FHNA 3O28A 2HZLA 3EKIA 5AE4A 4N81A 2RC8A 1DPEA 4G68C 1ZU0A 4TQUQ 2CZIA 3R26A 4GWWA 5IGAA 4OYVA 3KZGA 5H8HA 2L5VA 4U1ZA 3PUYE 3FGSA 3O29A 1B05A 4KYSA 3ISPA 2FYIA 4NX1A 3W15C 1LLSA 4AS5A 1UTHA 1B9JA 3VVEA 5I59A 5H8NA 2ONSA 1FQBA 3QYTA 4EUOA 1I6BA 1EH3A 3C9HA 1FTOA 4XKNA 4DZ1A 5KDTB 1MXWA 4JVIA 2Y84A 4PGPA 1H44A 3TQLA 1NMUA 1VR5A 2B3BA 2Q2AA 4TLLB 1MY0A 2FIXA 3N5LA 4JXIA 4Q0CA 3MVXA 4OERA 1KA0A 1SI0A 3T22A 1SBPA 1Z7NE 1ZMGA 3IL1B 4ELRA 5KCJB 1KWHA 2I4CA 1B6HA 4R6HA 3O6IA 5DVIA 1B3FA 2DVZA 4BLAA 4PE5B 3MUQA 1SYIA 4O7IA 4OHNA 1PEBA 4N15A 4N6PA 2A5TB 2VHAA 3FASA 4HCYA 2HXRA 4I3EA 1FQCA 1K9ZA 1TT1A 4ZEDA 3LC8A 2HAUA 1LAHE 5ICQA 1NUYA 4GF8A 2V25A 1SYHA 5I56A 4MLVA 1IMAA 4LZ5A 3H6TA 1FBHA 3PPOA 2Y7KA 3PMXA 4PETA 4R75A 5JEIA 2DE2A 4NG7A 3V8XB 3V83A 1NH8A 2CMOA 4OANA 3VXBA 5JK4A 4GOTA 1II5A 4YKJA 5IZ3A 1F9BA 3BBRA 3BFUA 5KZTA 4L17A 1LB8A 1B0LA 3VLWA 2ANJA 4LN5A 3SEVA 1BIYA 4MLQA 3SEUA 4QF9A 1CNQA 4NF5A 3RQTA 3TCFA 3THIA 1MPDA 2QS3A 2WYKA 4OTEA 3OEMA 3FVNA 2PX1A 4PTKA 2O7IA 2OWTA 1POTA 1NNFA 1K9YA 4GL8A 2F7AA 1FTKA 3VLVA 3W9VA 2NXOA 1NNKA 3SEYA 5FTHA 3Q28A 2XXHA 2F78A 4YKPA 2QMXA 2XXXA 3GLBA 4MJOA 2V3QA 1IXGA 3FIRA 3IK6B 1LBCA 4R74A 1EZ9A 2FIEA 3O6GA 4EDPA 4OFOA 4QFNA 3T9UA 1OVTA 2WX9A 3USDA 1LBVA 4OQOA 2V84A 1FPGA 4H5GA 4YKIA 1OQGA 2RC7A 4IGTA 2NVUB 3KN7A 1P1NA 3QXMA 3OENA 3U94A 2XA5A 3PUWE 2XXUA 4F22A 5IKBA 5ITOA 2X26A 3Q25A 1FPBA 5KDTA 1Q1KA 1ZIUA 3PPRA 4XTCQ 4PDHA 4GXAA 3RT6B 3OO9A 3EHTA 3EN3A 2UVJA 4P1EA 3EPEA 2Z22A 1H45A 3DELB 1TWYA 3B7DA 5IAIA 4G4PA 4H5FA 3CRBA 1TXFA 3C31A 1URSA 2VPNA 3IO4A 5ESYA 2DVCA 5DEXA 3UGWA 3O97A 3Q26A 5ET7A 3TODA 1JEUA 1NV3A 5A5LA 1FPLA 4G61A 1MH4A 5TP9A 1NH7A 4PGNA 4LP2B 4G68B 4XFEA 1I6AA 4IO6A 4F39A 3B50A 1N7WA 3IORA 3PTYA 4OESA 4R6YA 1FBEA 3WAFA 3ZKKA 2YLNA 3OXNA 4Z7EA 5EQ9A 2PVUA 1NV2A 4XIGQ 3V89B 4FAJA 2ZYOA 1PB8A 2A5SA 2XXTA 1B32A 1IQ7A 5CC2A 1AL3A 3K4UA 1AH5A 3IAZA 2QS2A 2F6PA 2CEXA 2UVIA 2XXVA 4YICA 4HS7A 1NUZA 2F35A 4NAPA 2Y7IA 2VPOA 2O1MA 3O6HA 1LFGA 3FJMA 4JWOA 3R7XA 2YPNA 3VLUA 2ZYNA 1NV6A 1QULA 3AXFA 2NUVA 2REGA 1Y4TA 3K0VA 1FPJA 4O3BA 4F31B 2REJA 3M3LA 4NF4A 4F1UA 1EU8A 4ELQA 4HXVA 5F7VA 2HXWA 4KR5A 3UP9A 3VFJA 3MW0A 4KHZE 1B51A 2AIXA 4PBHA 2DXYA 1D3KA 4OVPA 1GR2A 3FJ7A 4EXKA 4JWYA 4H8IA 1MM6A 2O84X 4LQ2A 1UTHB 4F3GA 1JQFA 3G3GA 4EQBA 4PFIA 5I59B 1DTGA 5H8NB 5H8FA 3ZKLA 3CG3A 5IM2A 2GHBA 3KSJA 1IXHA 1B1HA 2DXRA 4R9GA 4JBZA 3MVWA 1DCUA 2ONKE 2GRVA 2AL4A 1N04A 1NNPA 3MP6A 1HSJA 4H65A 4OFLA 3GZGA 4IGRA 4MEVA 2VP1A 3MYUA 1RDZA 5J1DA 4M4GA 3U93A 1VDWA 3DP6A 3TTKA 1EZPA 4I3YA 1SW5A 1OMPA 1MRPA 2HCAA 5IZ1A 4F1YA 2DE4A 3RYDA 3VE1B 2XX7A 2UYFA 3OEKA 5I2NA 1N7XA 2I58A 3KOTA 3A3CA 3SERA 4F29A 3S9MC 3MJNA 4IO3A 1JEVA 1MXYA 2G29A 2DWHA 2B65A 3CVGA 3KBZA 1A99A 5I56B 2V3TA 1B46A 4X1DA 1SVXB 4GX3A 1JETA 2R9JA 5BUUA 4FBPA 4ND9A 3TELA 5L9SA 3ODBA 4DXCA 3K1MA 3TFLA 4R2BA 2I6EA 4OXVA 1SD3A 1O64A 5I2KA 2DWJA 4GXSB 3T96B 4OVJA 5IZ3B 4R2FA 3VVDA 2RCBA 3RLFE 3B8BA 2F97A 4P11A 4KXPA 1DSNA 1US5A 2QMWA 3PD8A 4G8NA 4OA4A 3OO8A 3M3FA 3SETA 1P99A 1Q9DA 4QFPA 4BDQA 3EQ1A 4OVTA 1B4ZA 2DWIA 4K3FA 4GRKA 4NF5B 4FEBA 3VV5A 3NOHA 3SZPA 4ZZEA 1A8FA 3KOSA 3O9PA 2XWVA 2THIA 2QSXA 1FPDA 3KC0A 3T0JA 4NQ8A 1G0HA 3UA8A 4MNIA 3KG2A 3CIJA 3B6WA 4LONB 4OVSA 2OWSA 2RC9A 1MXUA 5HPQA 1QGXA 3P7IA 5M2VA 4NN3A 4P47A 1BP5A 3HO7A 2GHAA 2XXKA 4YKKA 3S9LC 3TUSA 4KPTA 3HHFA 4Q5TA 3PPNA 1MXZA 4GBWA 4F2QA 3KN8A 1N0TA 4LZ8A 3LUZA 4RY1A 1QJMA 3FZVA 1URGA 3CSBA 4IO2A 3S9EA 4GD5A 2UYEA 3OO7A 2P3VA 4JWXA 1GGGA 2UVHA 5T3JA 4OVRA 2PCRA 4X1BA 4NHBA 3A29A 3T9VA 4NTLA 1LFHA 4OETA 2JJKA 2RCAA 4MH5A 3CFXA 4OVQA 1YZ0A 1OQHA 1MQIA 3TKDA 4HW8A 3IOWA 3LV0A 4I9DA 5ITPA 2UXAA 4GFRA 2DOJA 2D21A 2DS9A 4N13A 3Q29A 4OENA 4EXLA 2BJJX 4O3AA 3WAEA 4GL0A 1NL5A 3QSLA 4DI3D 4N07A 3E78A 2X7QA 3RPWA 1VFDA 2H9BA 4NF0A 2GH9A 1PDAA 5CRYA 2F34A 5I5PA 1FQFA 3QK6A 3QUFA 1PC3A 2BJIA 2R8TA 3KSXA 1IUDA 4RNSA 1XVYA 4N6KA 5DEXB 4OMBA 4E0WA 1NKXA 2XXWA 3BIHA 2Z8FA 4IB2A 1AOVA 1N3XA 1B40A 5TP9B 1A8EA 2FNCA 2AYSA 5ET8A 2F7BA 1B4HA 4Q8RA 2XX8A 2XXQA 2O51A 2PMSA 1FBPA 3N6UA 1US4A 2OX3A 4FECA 3C32A 5JTYA 3FVKA 1FJ9A 3FBPA 3HN0A 1R9LA 1NV0A 4G2ZA 1B1XA 5EQ8A 3MVYA 2XWKA 3BFTA 5DVFA 1S50A 1R1NA 2F3DA 3T66A 5I58A 2OBGA 1YPNA 2QS4A 3K1NA 3TQWA 1Y9UA 3W9WA 3FATA 4THIA 1M5CA 4RK2A 1B3LA 2O69A 1B7UA 1LBXA 1J1NA 1QKAA 1T0KA 4MNPA 3G3JA 4YAHX 5EHMA 3KJTA 2B4MA 3FXUA 4QSEA 1XVXA 3K2DA 1FBDA 2ZYMA 3IFCA 4NF4B 4JB7A 1IITA 1NFTA 4DI4B 3FXBA 4N8YA 3OELA 2D5WA 3MP8A 2H98A 3H6WA 1MS7A 1XOCA 4BDLA 1QUIA 3GXAA 1UTBA 4X8RA 1JW1A 2HQ0A 4ESXA 3MQ9A 4C1TA 1FCKA 4C0RA 3C33A 4ZEIA 4F1VA 5AA2A 4QSCA 2Q74A 1YCJA 1TFDA 3H6VA 2CZKA 1NV1A 1N3WA 5FTIA 5H8FB 1MQJA 2G93A 1LGBC 4NF8A 3ZS6A 3MP1A 2QS1A 2H99A 1ZLQA 3CG1A 3M8UA 3C4MA 5J16A 1LAXA 1MY2A 4JSDA 4WEDA 4GLIA 3E4RA 3K6XA 4IO7A 5K2YA 3TTRA 4XKRA 3SDFA 5AA3A 3S4UA 1PB9A 1LFIA 4F3PA 4WXJA 4BDNA 2WKYA 4YB6A 1N84A 4PP0A 4HE1A 4OEUA 3G3FA 1Y3NA 4WKMA 3RN8A 5I2NB 1DBZA 4ZEBA 3IOTA 5CI5A 4YZZA 1MQGA 3K01A 2DDKA 3JV9A 4DCXA 1D9YA 3B6TA 3MZBA 4ZE9A 3G3KA 4TLMB 3DP8A 4NWDA 5I2KB 3F11A 4QRZA 4P8BA 4O8MA 4KFQA 1TFAA 1UQWA 3IO6A 3HHGA 3PMVA 3VVFA 4HE0A 4GWSA 3IB2A 3LR1A 4PBQA 3B6QA 2FHYA 4H46A 4KYDA 2P1SA 3D4CA 1DMBA 1JNFA 4N4UA 3G7WA 2UVGA 2ZYKA 4MF3A 1URDA 4PFRA 4RYAA 1DPPA 3ONMA 4PFBA 4GBVA 5B7DA 5LOMA 1LBYA 1FBCA 4IO4A 4U1OA 5I57A 4WEPA 4AB6A 1H43A 4Q30B 4P3LA 4RPOA 3MSTA 1MXVA 3TEPA 1LAFE 2DE3A 5ICTA 5CMKA 1IMBA 1FBFA 3E79A 2YJPA 2OZZA 5AA4A 3A09A 4DLDA 3KEIA 2ESNA 2PFYA 4BDRA 3HV1A 1SW4A 4F18A 3SKPA 2RINA 1UIUA 1QW0A 2PT1A 4GWXA 3K6WA 4DDDA 3E9XA 4FIMA 5ISUA 3TYHA 4FATA 2Q89A 2QVUA 4F3BA 1UIVA 2P3NA 1A40A 2RKMA 3HCQA 1O63A 1O7TA 1VSOA 3LSXA 1M5EA 5AA2D 4IY5A 3GBBA 2VD3A 4TOZA 1FJ6A 1XC1A 2Z23A 4EQ9A 5EQ7A 4G8HA 4NF6A 4KYEA 2KLFA 4YU0A 1QKBA 1N76A 5K2XA 2D3IA 2IEEA 3K02A 4YB7A 4ECFA 2QPQA 1LBZA 1MQDA 1IMEA 5ET6A 4MFIA 1I69A 3ECRA 3K00A 1QUJA 3PUVE 1WDNA 3LBSA 2E0SA 1IIWA 4I62A 1DOTA 1RYXA 2HPGA 3FVOA 2IA4A 3ZSFA 3TMGA 3K1PA 2HHMA 1CE2A 4FEDA 1OIBA 3MZ1A 4POWA 4MIJA 1B52A 4BDMA 4ELOA 3DM0A 3TTMA 2V3UA 4G8MA 1PB7A 4P1LA 1BLFA 1LBBA 1B0HA 2ABHA 1LCFA 2B3FA 1SW1A 3IR1A 3BIGA
chains in the Genus database with same CATH topology
4ZEFA 3O2AA 3RUMA 3UN6A 1ZJLA 1HSLA 2I49A 5TPAA 3H6UA 2QRYA 3T93B 2ZMBA 4U2RA 1LB9A 4U4XA 4DCYA 5JTYB 4OFJA 2VOZA 4OEVA 4F3SA 1Y1ZA 1Y1MA 1FQEA 5B70A 4PFUA 3JYRA 5I58B 1GVCA 2XHDA 3UIFA 1XS5A 3OO6A 2O7UA 5I84A 4NE4A 4OWDA 3TAJA 4JDFA 3IOVA 3EHSA 1B3GA 2GFEA 1M5FA 4U22A 4O3CA 5EHSA 4JSOA 2O1LA 2NWJA 4KQPA 4QHQA 1UTBB 1YAEA 4LATA 4LA9A 3OSQA 1ATGA 3KGCA 3L6GA 2XXPA 4X48A 1XHYA 5AA2B 1AMFA 2DP8A 3MBPA 3MVZA 4GWOA 1PBPA 1AIVA 3PV0E 3IX1A 3PPQA 1A54A 2F36A 5DT6A 4NF8B 2PT2A 1Q35A 4DIGA 3I5OA 4FORA 4RXLA 3T9HB 4PFTA 1D4NA 2I3VA 2P0SA 5ELVA 3PUXE 4R72A 5DVJA 1WODA 2Y7RA 2DYXA 2ZNSA 1MXXA 3EHUA 1B3HA 5CM6A 3CSGA 3PGFA 3D4GA 2NOOA 1IXCA 4QFLA 2I0BA 4HCWA 1SDXA 2Q8JA 5H8SA 1I6QA 3PUZE 1DTZA 2I0CA 4I1DA 1D9VA 3H03A 4PFYA 1OLCA 3HPIA 4ZE8A 3TCHA 4M1VA 1EZOA 4DE8A 2W7YA 1P1QA 1ZTYA 4RPNA 3RTWB 4XKPA 1JVXA 1CB6A 2I48A 3H7MA 3N26A 1IZ1A 3A3UA 3FV1A 5DTBA 5BWJA 1FTLA 3PU5A 2ALUA 1MG1A 1MPBA 5DYHA 3CR9A 5I57B 2VD2A 2DQVA 5CMMA 2VGQA 2I3WA 2OJTA 1SQYA 3MZ9A 2E1SA 1ANFA 1NNTA 1Y20A 1FQAA 5H8QA 4ZECA 5AA4B 1ZKBA 3CI8A 1IEJA 2DSFA 4U4SA 1QUKA 4PQJA 4DXUA 3G3IA 1JW5A 4KCDA 1FTJA 3LUYA 2Q9TA 1BTJA 3U92A 4GIZA 1JW4A 1SI1A 3I6VA 4AB5A 1MDP1 2CZLA 1B2HA 2ZXTA 2ZNTA 4C1UA 3PD9A 4G77A 4NF6B 3OOAA 4Z0IA 1S9TA 1A7LA 4EF2A 4BDOA 4XKQA 4UA8A 4X9TA 3SEWA 1R6ZA 1VFEA 5A5XA 3QUJA 2RF1A 1M5DA 3E13X 1R9QA 5L9OA 3RGYA 4ISUA 1P1OA 3PPPA 2OLBA 1MPCA 3M3KA 3TDJA 2HEUA 4LUBA 1GTKA 4IY6A 2F7CA 4I8CA 3C36A 3U1OA 3K6VA 4H0WA 1OLAA 3ILUB 1BKAA 2H4IA 1B3EA 1Y3PA 3RT8A 4HTGA 3TCGA 4H6DA 1SW2A 3FJGA 4KCCA 5TPAB 3U72A 4ZDMA 1XT8A 4RA1A 1HSEA 1MY3A 3T9XB 4YMAA 3OD7A 5CMCA 1VE4A 4GVOA 4NWCA 3QAXA 3HSTA 5EYFA 1ELJA 5CMBA 1IXIA 2XD2A 3H4ZA 3EF7A 4ELPA 1B5JA 1FQDA 4QFOA 2LAOA 4PFWA 2H5YA 1B5HA 1M5BA 1GV8A 5HBCA 3SESA 5AA1A 2V93A 5CBSA 3CFLA 2H25A 3TPAA 3FXRA 1PBQA 4KD5A 2Y7WA 4NEDA 5KCJA 3FD3A 3IB0A 4FJPA 2HFBA 4P0IA 2O6AA 1USYH 1B58A 2F5XA 3MPLA 2PYYA 1B7HA 3L6HA 3IOUA 3IJOB 4R6KA 2A5TA 3JZJA 2XX9A 3TTLA 3BKIB 4YB5A 2XXRA 3H06B 1MH3A 4IO5A 3KN3A 1RYOA 3RTFB 4ONYA 3ILTB 2Q2CA 3E3KA 2Z8EA 5F1QA 3IB1A 3S2VA 3MAMA 2QL3A 1MDQA 1WVJA 1B5IA 3FXQA 3C34A 4DXBA 1MY1A 4XXUA 3G3HA 2HZKA 2X7PA 1LSTA 3CFZA 2M8CA 4OZ9A 3H3GA 2OK2A 2R71A 5L8DA 5H8HB 4QFKA 3TTNA 2XXYA 3V5AA 3MPKA 3MWBA 3KJ7A 2Q88A 1MY4A 2OCUA 3FV2A 3KFMA 3LSLA 1H76A 4QSDA 4H8JA 1Y3QA 4FE8A 1H3DA 2AL5A 2P2AA 4MBPA 3OMBA 4YMBA 4RJZA 1LAGE 3MC2A 1RKMA 2F6GA 2O68A 3DP4A 2XD3A 4POXA 4E0XA 4U23A 3PMWA 5TU0A 1MQHA 3FVGA 4P0GA 1QVSA 1YTVA 1Z7ME 2R6GE 1A55A 4ZS9A 3LSFB 1P1WA 5L9MA 3N94A 3OSRA 4U21A 1JVYA 4KI0E 1OVBA 1Y4CA 2DWAA 4LQ5A 4F2OA 4H67A 2F8DA 2Z8DA 3VDFA 3TZAA 4F19A 4UACA 2PBWA 3S9NC 5H8QB 1FTMA 2FA7A 4EF1A 3N6TA 3VXCA 3LSWA 3QIMA 2XXIA 2ZNUA 3UK4A 2Y7PA 3RY3A 3RNNA 3KBRA 3SEXA 5FHOA 4EQ7A 3K6UA 1FW0A 4G68A 3C35A 4LZ7A 3DLNA 4R73A 4ESWA 4LVQA 1LCTA 3UORA 3FUZA 3R6UA 4R9FA 3I3VA 1L5TA 3Q27A 4RK9A 4GQOA 4ZZAA 3GBAA 4ZEKA 2QJEA 5A5XB 1ZBMA 1P1UA 1MM7A 1USYE 1S7YA 3IJXB 3U8QA 5CBRA 4NMYA 4AQ4A 2I4BA 5HM4B 2ONRA 5FHMA 1B7ZA 2HAVA 3O66A 4H1XA 1POY1 5FHNA 3O28A 2HZLA 5AE4A 2RC8A 1DPEA 4G68C 1ZU0A 4TQUQ 3R26A 4OYVA 3KZGA 5H8HA 4U1ZA 3PUYE 3FGSA 3O29A 1B05A 4KYSA 2FYIA 3W15C 1LLSA 1UTHA 1B9JA 3VVEA 5I59A 5H8NA 2ONSA 1FQBA 3QYTA 4EUOA 1I6BA 1EH3A 3C9HA 1FTOA 4XKNA 4DZ1A 5KDTB 1MXWA 2Y84A 1H44A 3TQLA 1NMUA 1VR5A 2B3BA 2Q2AA 4TLLB 1MY0A 3N5LA 4JXIA 4Q0CA 3MVXA 4OERA 1SI0A 3T22A 1SBPA 1Z7NE 1ZMGA 3IL1B 4ELRA 5KCJB 1KWHA 2I4CA 1B6HA 4R6HA 3O6IA 5DVIA 1B3FA 2DVZA 4BLAA 4PE5B 3MUQA 1SYIA 4OHNA 1PEBA 2A5TB 2VHAA 3FASA 4N6PA 4HCYA 1FQCA 1TT1A 4ZEDA 3LC8A 2HAUA 1LAHE 5ICQA 4GF8A 2V25A 1SYHA 5I56A 4MLVA 4LZ5A 3H6TA 3PPOA 2Y7KA 3PMXA 4PETA 4R75A 5JEIA 2DE2A 3V8XB 3V83A 1NH8A 2CMOA 3VXBA 5JK4A 4GOTA 1II5A 4YKJA 1F9BA 3BBRA 3BFUA 5KZTA 4L17A 1LB8A 1B0LA 3VLWA 2ANJA 3SEVA 1BIYA 4MLQA 3SEUA 4QF9A 4NF5A 3RQTA 3TCFA 3THIA 1MPDA 2QS3A 4OTEA 3OEMA 3FVNA 2PX1A 2O7IA 2OWTA 1POTA 1NNFA 4GL8A 2F7AA 1FTKA 3VLVA 3W9VA 2NXOA 1NNKA 3SEYA 5FTHA 3Q28A 2XXHA 2F78A 4YKPA 2QMXA 2XXXA 3GLBA 2V3QA 1IXGA 3FIRA 3IK6B 1LBCA 4R74A 1EZ9A 3O6GA 4EDPA 4OFOA 4QFNA 3T9UA 1OVTA 3USDA 4OQOA 2V84A 4H5GA 4YKIA 1OQGA 2RC7A 4IGTA 2NVUB 3KN7A 1P1NA 3QXMA 3OENA 3U94A 3PUWE 2XXUA 4F22A 5IKBA 5ITOA 2X26A 3Q25A 5KDTA 1Q1KA 1ZIUA 3PPRA 4XTCQ 4GXAA 3RT6B 3OO9A 3EHTA 3EN3A 2UVJA 3EPEA 2Z22A 1H45A 3DELB 1TWYA 3B7DA 5IAIA 4G4PA 4H5FA 3CRBA 1TXFA 3C31A 1URSA 3IO4A 2DVCA 5DEXA 3UGWA 3O97A 3Q26A 3TODA 1JEUA 1MH4A 5TP9A 1NH7A 4LP2B 4G68B 1I6AA 4IO6A 4F39A 1N7WA 3IORA 4OESA 4R6YA 3WAFA 3ZKKA 2YLNA 3OXNA 4Z7EA 2PVUA 4XIGQ 3V89B 4FAJA 2ZYOA 1PB8A 2A5SA 2XXTA 1B32A 1IQ7A 5CC2A 1AL3A 3K4UA 1AH5A 3IAZA 2QS2A 2F6PA 2UVIA 2XXVA 4YICA 4HS7A 2F35A 2Y7IA 2O1MA 3O6HA 1LFGA 3FJMA 4JWOA 3R7XA 2YPNA 3VLUA 2ZYNA 1QULA 3AXFA 2NUVA 2REGA 1Y4TA 3K0VA 4O3BA 4F31B 2REJA 3M3LA 4NF4A 4F1UA 1EU8A 4ELQA 5F7VA 2HXWA 4KR5A 3UP9A 3VFJA 3MW0A 4KHZE 1B51A 2AIXA 2DXYA 1D3KA 1GR2A 3FJ7A 4EXKA 4JWYA 4H8IA 1MM6A 2O84X 4LQ2A 1UTHB 4F3GA 1JQFA 3G3GA 4EQBA 5I59B 1DTGA 5H8NB 5H8FA 3ZKLA 3CG3A 2GHBA 3KSJA 1IXHA 1B1HA 2DXRA 4R9GA 4JBZA 3MVWA 2ONKE 2GRVA 2AL4A 1N04A 1NNPA 3MP6A 1HSJA 4H65A 4OFLA 3GZGA 4IGRA 2VP1A 5J1DA 4M4GA 3U93A 3TTKA 3DP6A 1EZPA 1SW5A 1OMPA 1MRPA 2HCAA 4F1YA 2DE4A 3VE1B 2XX7A 2UYFA 3OEKA 5I2NA 1N7XA 2I58A 3KOTA 3A3CA 3SERA 4F29A 3S9MC 3MJNA 4IO3A 1JEVA 1MXYA 2G29A 2DWHA 2B65A 3CVGA 1A99A 5I56B 2V3TA 1B46A 4X1DA 1SVXB 1JETA 2R9JA 5BUUA 4ND9A 3TELA 5L9SA 3ODBA 4DXCA 3K1MA 3TFLA 4R2BA 2I6EA 4OXVA 1SD3A 1O64A 5I2KA 2DWJA 4GXSB 3T96B 4OVJA 4R2FA 3VVDA 2RCBA 3RLFE 4P11A 2F97A 1DSNA 1US5A 2QMWA 3PD8A 4G8NA 3OO8A 3M3FA 3SETA 1P99A 4QFPA 4BDQA 3EQ1A 1B4ZA 2DWIA 4K3FA 4GRKA 4NF5B 4FEBA 3VV5A 4ZZEA 1A8FA 3KOSA 3O9PA 2THIA 2QSXA 3UA8A 3KG2A 3CIJA 3B6WA 4LONB 2OWSA 2RC9A 1MXUA 5HPQA 3P7IA 5M2VA 1BP5A 3HO7A 2GHAA 4YKKA 3S9LC 3TUSA 4KPTA 3HHFA 4Q5TA 3PPNA 1MXZA 4F2QA 3KN8A 1N0TA 4LZ8A 4RY1A 1QJMA 3FZVA 1URGA 3CSBA 4IO2A 3S9EA 4GD5A 2UYEA 3OO7A 4JWXA 1GGGA 2UVHA 4X1BA 3T9VA 4NTLA 1LFHA 4OETA 2RCAA 4MH5A 3CFXA 1OQHA 1MQIA 3TKDA 4HW8A 3IOWA 4I9DA 5ITPA 2UXAA 4GFRA 2DOJA 2D21A 2DS9A 4N13A 3Q29A 4OENA 4EXLA 2BJJX 4O3AA 3WAEA 4GL0A 1NL5A 3QSLA 4N07A 2X7QA 3RPWA 1VFDA 2H9BA 2GH9A 1PDAA 5CRYA 2F34A 1FQFA 3QK6A 3QUFA 1PC3A 3KSXA 1IUDA 4RNSA 1XVYA 5DEXB 4OMBA 4E0WA 1NKXA 2XXWA 2Z8FA 4IB2A 1AOVA 1N3XA 1B40A 5TP9B 1A8EA 2FNCA 2AYSA 2F7BA 1B4HA 4Q8RA 2XX8A 2XXQA 2O51A 2PMSA 3N6UA 1US4A 4FECA 3C32A 5JTYA 3FVKA 3HN0A 1R9LA 4G2ZA 1B1XA 3MVYA 3BFTA 5DVFA 1S50A 1R1NA 3T66A 5I58A 2OBGA 1YPNA 2QS4A 3K1NA 3TQWA 1Y9UA 3W9WA 3FATA 4THIA 1M5CA 4RK2A 1B3LA 2O69A 1B7UA 1J1NA 1QKAA 1T0KA 3G3JA 4YAHX 5EHMA 3KJTA 3FXUA 1XVXA 3K2DA 4QSEA 2ZYMA 4NF4B 4JB7A 1IITA 1NFTA 3OELA 2D5WA 3MP8A 2H98A 3H6WA 1MS7A 1XOCA 4BDLA 1QUIA 3GXAA 1UTBA 1JW1A 2HQ0A 4ESXA 3MQ9A 4C1TA 1FCKA 4C0RA 3C33A 4ZEIA 4F1VA 5AA2A 4QSCA 1YCJA 1TFDA 3H6VA 1N3WA 5FTIA 5H8FB 1MQJA 2G93A 1LGBC 4NF8A 3ZS6A 3MP1A 2QS1A 2H99A 1ZLQA 3CG1A 3M8UA 3C4MA 1LAXA 1MY2A 4JSDA 4WEDA 4GLIA 3E4RA 3K6XA 4IO7A 5K2YA 3TTRA 4XKRA 3SDFA 5AA3A 3S4UA 1PB9A 1LFIA 4F3PA 4WXJA 4BDNA 2WKYA 4YB6A 1N84A 4PP0A 4OEUA 3G3FA 1Y3NA 4WKMA 3RN8A 5I2NB 4ZEBA 3IOTA 5CI5A 4YZZA 1MQGA 3K01A 3JV9A 4DCXA 1D9YA 3B6TA 3MZBA 4ZE9A 3G3KA 4TLMB 3DP8A 4NWDA 5I2KB 3F11A 4QRZA 4KFQA 1TFAA 1UQWA 3IO6A 3HHGA 3PMVA 3VVFA 3IB2A 3LR1A 3B6QA 4KYDA 2P1SA 3D4CA 1DMBA 1JNFA 3G7WA 2UVGA 2ZYKA 4MF3A 1URDA 4RYAA 1DPPA 3ONMA 5B7DA 5LOMA 4IO4A 4U1OA 5I57A 4WEPA 4AB6A 1H43A 4Q30B 4RPOA 1MXVA 3TEPA 1LAFE 2DE3A 5ICTA 5CMKA 2YJPA 2OZZA 5AA4A 3A09A 4DLDA 3KEIA 2ESNA 4BDRA 3HV1A 1SW4A 4F18A 3SKPA 2RINA 1UIUA 1QW0A 2PT1A 3K6WA 4DDDA 3E9XA 4FIMA 5ISUA 3TYHA 4FATA 2Q89A 4F3BA 1UIVA 1A40A 2RKMA 3HCQA 1O63A 1O7TA 1VSOA 3LSXA 1M5EA 5AA2D 4IY5A 3GBBA 2VD3A 4TOZA 2Z23A 1XC1A 4EQ9A 4G8HA 4NF6A 4KYEA 2KLFA 4YU0A 1QKBA 1N76A 5K2XA 2D3IA 2IEEA 3K02A 4YB7A 4ECFA 2QPQA 1MQDA 4MFIA 1I69A 3ECRA 3K00A 1QUJA 3PUVE 1WDNA 3LBSA 2E0SA 1IIWA 4I62A 1DOTA 1RYXA 3FVOA 2IA4A 3ZSFA 3TMGA 3K1PA 1CE2A 4FEDA 1OIBA 3MZ1A 4POWA 1B52A 4BDMA 4ELOA 3DM0A 3TTMA 2V3UA 4G8MA 1PB7A 1BLFA 1LBBA 1B0HA 2ABHA 1LCFA 2B3FA 1SW1A 3IR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZEF A;  3O2A A;  3RUM A;  3UN6 A;  1ZJL A;  1HSL A;  2I49 A;  5TPA A;  3H6U A;  2QRY A;  3T93 B;  2ZMB A;  4U2R A;  1LB9 A;  4U4X A;  4DCY A;  5JTY B;  4OFJ A;  2VOZ A;  4OEV A;  4F3S A;  1Y1Z A;  1Y1M A;  1FQE A;  5B70 A;  4PFU A;  3JYR A;  5I58 B;  1GVC A;  2XHD A;  3UIF A;  1XS5 A;  3OO6 A;  2O7U A;  5I84 A;  4NE4 A;  4OWD A;  3TAJ A;  4JDF A;  3IOV A;  3EHS A;  1B3G A;  2GFE A;  1M5F A;  4U22 A;  4O3C A;  5EHS A;  4JSO A;  2O1L A;  2NWJ A;  4KQP A;  4QHQ A;  1UTB B;  1YAE A;  4LAT A;  4LA9 A;  3OSQ A;  1ATG A;  3KGC A;  3L6G A;  2XXP A;  4X48 A;  1XHY A;  5AA2 B;  1AMF A;  2DP8 A;  3MBP A;  3MVZ A;  4GWO A;  1PBP A;  1AIV A;  3PV0 E;  3IX1 A;  3PPQ A;  1A54 A;  2F36 A;  5DT6 A;  4NF8 B;  2PT2 A;  1Q35 A;  4DIG A;  3I5O A;  4FOR A;  4RXL A;  3T9H B;  4PFT A;  1D4N A;  2I3V A;  2P0S A;  5ELV A;  3PUX E;  4R72 A;  5DVJ A;  1WOD A;  2Y7R A;  2DYX A;  2ZNS A;  1MXX A;  3EHU A;  1B3H A;  5CM6 A;  3CSG A;  3PGF A;  3D4G A;  2NOO A;  1IXC A;  4QFL A;  2I0B A;  4HCW A;  1SDX A;  2Q8J A;  5H8S A;  1I6Q A;  3PUZ E;  1DTZ A;  2I0C A;  4I1D A;  1D9V A;  3H03 A;  4PFY A;  1OLC A;  3HPI A;  4ZE8 A;  3TCH A;  4M1V A;  1EZO A;  4DE8 A;  2W7Y A;  1P1Q A;  1ZTY A;  4RPN A;  3RTW B;  4XKP A;  1JVX A;  1CB6 A;  2I48 A;  3H7M A;  3N26 A;  1IZ1 A;  3A3U A;  3FV1 A;  5DTB A;  5BWJ A;  1FTL A;  3PU5 A;  2ALU A;  1MG1 A;  1MPB A;  5DYH A;  3CR9 A;  5I57 B;  2VD2 A;  2DQV A;  5CMM A;  2VGQ A;  2I3W A;  2OJT A;  1SQY A;  3MZ9 A;  2E1S A;  1ANF A;  1NNT A;  1Y20 A;  1FQA A;  5H8Q A;  4ZEC A;  5AA4 B;  1ZKB A;  3CI8 A;  1IEJ A;  2DSF A;  4U4S A;  1QUK A;  4PQJ A;  4DXU A;  3G3I A;  1JW5 A;  4KCD A;  1FTJ A;  3LUY A;  2Q9T A;  1BTJ A;  3U92 A;  4GIZ A;  1JW4 A;  1SI1 A;  3I6V A;  4AB5 A;  1MDP 1;  2CZL A;  1B2H A;  2ZXT A;  2ZNT A;  4C1U A;  3PD9 A;  4G77 A;  4NF6 B;  3OOA A;  4Z0I A;  1S9T A;  1A7L A;  4EF2 A;  4BDO A;  4XKQ A;  4UA8 A;  4X9T A;  3SEW A;  1R6Z A;  1VFE A;  5A5X A;  3QUJ A;  2RF1 A;  1M5D A;  3E13 X;  1R9Q A;  5L9O A;  3RGY A;  4ISU A;  1P1O A;  3PPP A;  2OLB A;  1MPC A;  3M3K A;  3TDJ A;  2HEU A;  4LUB A;  1GTK A;  4IY6 A;  2F7C A;  4I8C A;  3C36 A;  3U1O A;  3K6V A;  4H0W A;  1OLA A;  3ILU B;  1BKA A;  2H4I A;  1B3E A;  1Y3P A;  3RT8 A;  4HTG A;  3TCG A;  4H6D A;  1SW2 A;  3FJG A;  4KCC A;  5TPA B;  3U72 A;  4ZDM A;  1XT8 A;  4RA1 A;  1HSE A;  1MY3 A;  3T9X B;  4YMA A;  3OD7 A;  5CMC A;  1VE4 A;  4GVO A;  4NWC A;  3QAX A;  3HST A;  5EYF A;  1ELJ A;  5CMB A;  1IXI A;  2XD2 A;  3H4Z A;  3EF7 A;  4ELP A;  1B5J A;  1FQD A;  4QFO A;  2LAO A;  4PFW A;  2H5Y A;  1B5H A;  1M5B A;  1GV8 A;  5HBC A;  3SES A;  5AA1 A;  2V93 A;  5CBS A;  3CFL A;  2H25 A;  3TPA A;  3FXR A;  1PBQ A;  4KD5 A;  2Y7W A;  4NED A;  5KCJ A;  3FD3 A;  3IB0 A;  4FJP A;  2HFB A;  4P0I A;  2O6A A;  1USY H;  1B58 A;  2F5X A;  3MPL A;  2PYY A;  1B7H A;  3L6H A;  3IOU A;  3IJO B;  4R6K A;  2A5T A;  3JZJ A;  2XX9 A;  3TTL A;  3BKI B;  4YB5 A;  2XXR A;  3H06 B;  1MH3 A;  4IO5 A;  3KN3 A;  1RYO A;  3RTF B;  4ONY A;  3ILT B;  2Q2C A;  3E3K A;  2Z8E A;  5F1Q A;  3IB1 A;  3S2V A;  3MAM A;  2QL3 A;  1MDQ A;  1WVJ A;  1B5I A;  3FXQ A;  3C34 A;  4DXB A;  1MY1 A;  4XXU A;  3G3H A;  2HZK A;  2X7P A;  1LST A;  3CFZ A;  2M8C A;  4OZ9 A;  3H3G A;  2OK2 A;  2R71 A;  5L8D A;  5H8H B;  4QFK A;  3TTN A;  2XXY A;  3V5A A;  3MPK A;  3MWB A;  3KJ7 A;  2Q88 A;  1MY4 A;  2OCU A;  3FV2 A;  3KFM A;  3LSL A;  1H76 A;  4QSD A;  4H8J A;  1Y3Q A;  4FE8 A;  1H3D A;  2AL5 A;  2P2A A;  4MBP A;  3OMB A;  4YMB A;  4RJZ A;  1LAG E;  3MC2 A;  1RKM A;  2F6G A;  2O68 A;  3DP4 A;  2XD3 A;  4POX A;  4E0X A;  4U23 A;  3PMW A;  5TU0 A;  1MQH A;  3FVG A;  4P0G A;  1QVS A;  1YTV A;  1Z7M E;  2R6G E;  1A55 A;  4ZS9 A;  3LSF B;  1P1W A;  5L9M A;  3N94 A;  3OSR A;  4U21 A;  1JVY A;  4KI0 E;  1OVB A;  1Y4C A;  2DWA A;  4LQ5 A;  4F2O A;  4H67 A;  2F8D A;  2Z8D A;  3VDF A;  3TZA A;  4F19 A;  4UAC A;  2PBW A;  3S9N C;  5H8Q B;  1FTM A;  2FA7 A;  4EF1 A;  3N6T A;  3VXC A;  3LSW A;  3QIM A;  2XXI A;  2ZNU A;  3UK4 A;  2Y7P A;  3RY3 A;  3RNN A;  3KBR A;  3SEX A;  5FHO A;  4EQ7 A;  3K6U A;  1FW0 A;  4G68 A;  3C35 A;  4LZ7 A;  3DLN A;  4R73 A;  4ESW A;  4LVQ A;  1LCT A;  3UOR A;  3FUZ A;  3R6U A;  4R9F A;  3I3V A;  1L5T A;  3Q27 A;  4RK9 A;  4GQO A;  4ZZA A;  3GBA A;  4ZEK A;  2QJE A;  5A5X B;  1ZBM A;  1P1U A;  1MM7 A;  1USY E;  1S7Y A;  3IJX B;  3U8Q A;  5CBR A;  4NMY A;  4AQ4 A;  2I4B A;  5HM4 B;  2ONR A;  5FHM A;  1B7Z A;  2HAV A;  3O66 A;  4H1X A;  1POY 1;  5FHN A;  3O28 A;  2HZL A;  5AE4 A;  2RC8 A;  1DPE A;  4G68 C;  1ZU0 A;  4TQU Q;  3R26 A;  4OYV A;  3KZG A;  5H8H A;  4U1Z A;  3PUY E;  3FGS A;  3O29 A;  1B05 A;  4KYS A;  2FYI A;  3W15 C;  1LLS A;  1UTH A;  1B9J A;  3VVE A;  5I59 A;  5H8N A;  2ONS A;  1FQB A;  3QYT A;  4EUO A;  1I6B A;  1EH3 A;  3C9H A;  1FTO A;  4XKN A;  4DZ1 A;  5KDT B;  1MXW A;  2Y84 A;  1H44 A;  3TQL A;  1NMU A;  1VR5 A;  2B3B A;  2Q2A A;  4TLL B;  1MY0 A;  3N5L A;  4JXI A;  4Q0C A;  3MVX A;  4OER A;  1SI0 A;  3T22 A;  1SBP A;  1Z7N E;  1ZMG A;  3IL1 B;  4ELR A;  5KCJ B;  1KWH A;  2I4C A;  1B6H A;  4R6H A;  3O6I A;  5DVI A;  1B3F A;  2DVZ A;  4BLA A;  4PE5 B;  3MUQ A;  1SYI A;  4OHN A;  1PEB A;  2A5T B;  2VHA A;  3FAS A;  4N6P A;  4HCY A;  1FQC A;  1TT1 A;  4ZED A;  3LC8 A;  2HAU A;  1LAH E;  5ICQ A;  4GF8 A;  2V25 A;  1SYH A;  5I56 A;  4MLV A;  4LZ5 A;  3H6T A;  3PPO A;  2Y7K A;  3PMX A;  4PET A;  4R75 A;  5JEI A;  2DE2 A;  3V8X B;  3V83 A;  1NH8 A;  2CMO A;  3VXB A;  5JK4 A;  4GOT A;  1II5 A;  4YKJ A;  1F9B A;  3BBR A;  3BFU A;  5KZT A;  4L17 A;  1LB8 A;  1B0L A;  3VLW A;  2ANJ A;  3SEV A;  1BIY A;  4MLQ A;  3SEU A;  4QF9 A;  4NF5 A;  3RQT A;  3TCF A;  3THI A;  1MPD A;  2QS3 A;  4OTE A;  3OEM A;  3FVN A;  2PX1 A;  2O7I A;  2OWT A;  1POT A;  1NNF A;  4GL8 A;  2F7A A;  1FTK A;  3VLV A;  3W9V A;  2NXO A;  1NNK A;  3SEY A;  5FTH A;  3Q28 A;  2XXH A;  2F78 A;  4YKP A;  2QMX A;  2XXX A;  3GLB A;  2V3Q A;  1IXG A;  3FIR A;  3IK6 B;  1LBC A;  4R74 A;  1EZ9 A;  3O6G A;  4EDP A;  4OFO A;  4QFN A;  3T9U A;  1OVT A;  3USD A;  4OQO A;  2V84 A;  4H5G A;  4YKI A;  1OQG A;  2RC7 A;  4IGT A;  2NVU B;  3KN7 A;  1P1N A;  3QXM A;  3OEN A;  3U94 A;  3PUW E;  2XXU A;  4F22 A;  5IKB A;  5ITO A;  2X26 A;  3Q25 A;  5KDT A;  1Q1K A;  1ZIU A;  3PPR A;  4XTC Q;  4GXA A;  3RT6 B;  3OO9 A;  3EHT A;  3EN3 A;  2UVJ A;  3EPE A;  2Z22 A;  1H45 A;  3DEL B;  1TWY A;  3B7D A;  5IAI A;  4G4P A;  4H5F A;  3CRB A;  1TXF A;  3C31 A;  1URS A;  3IO4 A;  2DVC A;  5DEX A;  3UGW A;  3O97 A;  3Q26 A;  3TOD A;  1JEU A;  1MH4 A;  5TP9 A;  1NH7 A;  4LP2 B;  4G68 B;  1I6A A;  4IO6 A;  4F39 A;  1N7W A;  3IOR A;  4OES A;  4R6Y A;  3WAF A;  3ZKK A;  2YLN A;  3OXN A;  4Z7E A;  2PVU A;  4XIG Q;  3V89 B;  4FAJ A;  2ZYO A;  1PB8 A;  2A5S A;  2XXT A;  1B32 A;  1IQ7 A;  5CC2 A;  1AL3 A;  3K4U A;  1AH5 A;  3IAZ A;  2QS2 A;  2F6P A;  2UVI A;  2XXV A;  4YIC A;  4HS7 A;  2F35 A;  2Y7I A;  2O1M A;  3O6H A;  1LFG A;  3FJM A;  4JWO A;  3R7X A;  2YPN A;  3VLU A;  2ZYN A;  1QUL A;  3AXF A;  2NUV A;  2REG A;  1Y4T A;  3K0V A;  4O3B A;  4F31 B;  2REJ A;  3M3L A;  4NF4 A;  4F1U A;  1EU8 A;  4ELQ A;  5F7V A;  2HXW A;  4KR5 A;  3UP9 A;  3VFJ A;  3MW0 A;  4KHZ E;  1B51 A;  2AIX A;  2DXY A;  1D3K A;  1GR2 A;  3FJ7 A;  4EXK A;  4JWY A;  4H8I A;  1MM6 A;  2O84 X;  4LQ2 A;  1UTH B;  4F3G A;  1JQF A;  3G3G A;  4EQB A;  5I59 B;  1DTG A;  5H8N B;  5H8F A;  3ZKL A;  3CG3 A;  2GHB A;  3KSJ A;  1IXH A;  1B1H A;  2DXR A;  4R9G A;  4JBZ A;  3MVW A;  2ONK E;  2GRV A;  2AL4 A;  1N04 A;  1NNP A;  3MP6 A;  1HSJ A;  4H65 A;  4OFL A;  3GZG A;  4IGR A;  2VP1 A;  5J1D A;  4M4G A;  3U93 A;  3TTK A;  3DP6 A;  1EZP A;  1SW5 A;  1OMP A;  1MRP A;  2HCA A;  4F1Y A;  2DE4 A;  3VE1 B;  2XX7 A;  2UYF A;  3OEK A;  5I2N A;  1N7X A;  2I58 A;  3KOT A;  3A3C A;  3SER A;  4F29 A;  3S9M C;  3MJN A;  4IO3 A;  1JEV A;  1MXY A;  2G29 A;  2DWH A;  2B65 A;  3CVG A;  1A99 A;  5I56 B;  2V3T A;  1B46 A;  4X1D A;  1SVX B;  1JET A;  2R9J A;  5BUU A;  4ND9 A;  3TEL A;  5L9S A;  3ODB A;  4DXC A;  3K1M A;  3TFL A;  4R2B A;  2I6E A;  4OXV A;  1SD3 A;  1O64 A;  5I2K A;  2DWJ A;  4GXS B;  3T96 B;  4OVJ A;  4R2F A;  3VVD A;  2RCB A;  3RLF E;  4P11 A;  2F97 A;  1DSN A;  1US5 A;  2QMW A;  3PD8 A;  4G8N A;  3OO8 A;  3M3F A;  3SET A;  1P99 A;  4QFP A;  4BDQ A;  3EQ1 A;  1B4Z A;  2DWI A;  4K3F A;  4GRK A;  4NF5 B;  4FEB A;  3VV5 A;  4ZZE A;  1A8F A;  3KOS A;  3O9P A;  2THI A;  2QSX A;  3UA8 A;  3KG2 A;  3CIJ A;  3B6W A;  4LON B;  2OWS A;  2RC9 A;  1MXU A;  5HPQ A;  3P7I A;  5M2V A;  1BP5 A;  3HO7 A;  2GHA A;  4YKK A;  3S9L C;  3TUS A;  4KPT A;  3HHF A;  4Q5T A;  3PPN A;  1MXZ A;  4F2Q A;  3KN8 A;  1N0T A;  4LZ8 A;  4RY1 A;  1QJM A;  3FZV A;  1URG A;  3CSB A;  4IO2 A;  3S9E A;  4GD5 A;  2UYE A;  3OO7 A;  4JWX A;  1GGG A;  2UVH A;  4X1B A;  3T9V A;  4NTL A;  1LFH A;  4OET A;  2RCA A;  4MH5 A;  3CFX A;  1OQH A;  1MQI A;  3TKD A;  4HW8 A;  3IOW A;  4I9D A;  5ITP A;  2UXA A;  4GFR A;  2DOJ A;  2D21 A;  2DS9 A;  4N13 A;  3Q29 A;  4OEN A;  4EXL A;  2BJJ X;  4O3A A;  3WAE A;  4GL0 A;  1NL5 A;  3QSL A;  4N07 A;  2X7Q A;  3RPW A;  1VFD A;  2H9B A;  2GH9 A;  1PDA A;  5CRY A;  2F34 A;  1FQF A;  3QK6 A;  3QUF A;  1PC3 A;  3KSX A;  1IUD A;  4RNS A;  1XVY A;  5DEX B;  4OMB A;  4E0W A;  1NKX A;  2XXW A;  2Z8F A;  4IB2 A;  1AOV A;  1N3X A;  1B40 A;  5TP9 B;  1A8E A;  2FNC A;  2AYS A;  2F7B A;  1B4H A;  4Q8R A;  2XX8 A;  2XXQ A;  2O51 A;  2PMS A;  3N6U A;  1US4 A;  4FEC A;  3C32 A;  5JTY A;  3FVK A;  3HN0 A;  1R9L A;  4G2Z A;  1B1X A;  3MVY A;  3BFT A;  5DVF A;  1S50 A;  1R1N A;  3T66 A;  5I58 A;  2OBG A;  1YPN A;  2QS4 A;  3K1N A;  3TQW A;  1Y9U A;  3W9W A;  3FAT A;  4THI A;  1M5C A;  4RK2 A;  1B3L A;  2O69 A;  1B7U A;  1J1N A;  1QKA A;  1T0K A;  3G3J A;  4YAH X;  5EHM A;  3KJT A;  3FXU A;  1XVX A;  3K2D A;  4QSE A;  2ZYM A;  4NF4 B;  4JB7 A;  1IIT A;  1NFT A;  3OEL A;  2D5W A;  3MP8 A;  2H98 A;  3H6W A;  1MS7 A;  1XOC A;  4BDL A;  1QUI A;  3GXA A;  1UTB A;  1JW1 A;  2HQ0 A;  4ESX A;  3MQ9 A;  4C1T A;  1FCK A;  4C0R A;  3C33 A;  4ZEI A;  4F1V A;  5AA2 A;  4QSC A;  1YCJ A;  1TFD A;  3H6V A;  1N3W A;  5FTI A;  5H8F B;  1MQJ A;  2G93 A;  1LGB C;  4NF8 A;  3ZS6 A;  3MP1 A;  2QS1 A;  2H99 A;  1ZLQ A;  3CG1 A;  3M8U A;  3C4M A;  1LAX A;  1MY2 A;  4JSD A;  4WED A;  4GLI A;  3E4R A;  3K6X A;  4IO7 A;  5K2Y A;  3TTR A;  4XKR A;  3SDF A;  5AA3 A;  3S4U A;  1PB9 A;  1LFI A;  4F3P A;  4WXJ A;  4BDN A;  2WKY A;  4YB6 A;  1N84 A;  4PP0 A;  4OEU A;  3G3F A;  1Y3N A;  4WKM A;  3RN8 A;  5I2N B;  4ZEB A;  3IOT A;  5CI5 A;  4YZZ A;  1MQG A;  3K01 A;  3JV9 A;  4DCX A;  1D9Y A;  3B6T A;  3MZB A;  4ZE9 A;  3G3K A;  4TLM B;  3DP8 A;  4NWD A;  5I2K B;  3F11 A;  4QRZ A;  4KFQ A;  1TFA A;  1UQW A;  3IO6 A;  3HHG A;  3PMV A;  3VVF A;  3IB2 A;  3LR1 A;  3B6Q A;  4KYD A;  2P1S A;  3D4C A;  1DMB A;  1JNF A;  3G7W A;  2UVG A;  2ZYK A;  4MF3 A;  1URD A;  4RYA A;  1DPP A;  3ONM A;  5B7D A;  5LOM A;  4IO4 A;  4U1O A;  5I57 A;  4WEP A;  4AB6 A;  1H43 A;  4Q30 B;  4RPO A;  1MXV A;  3TEP A;  1LAF E;  2DE3 A;  5ICT A;  5CMK A;  2YJP A;  2OZZ A;  5AA4 A;  3A09 A;  4DLD A;  3KEI A;  2ESN A;  4BDR A;  3HV1 A;  1SW4 A;  4F18 A;  3SKP A;  2RIN A;  1UIU A;  1QW0 A;  2PT1 A;  3K6W A;  4DDD A;  3E9X A;  4FIM A;  5ISU A;  3TYH A;  4FAT A;  2Q89 A;  4F3B A;  1UIV A;  1A40 A;  2RKM A;  3HCQ A;  1O63 A;  1O7T A;  1VSO A;  3LSX A;  1M5E A;  5AA2 D;  4IY5 A;  3GBB A;  2VD3 A;  4TOZ A;  2Z23 A;  1XC1 A;  4EQ9 A;  4G8H A;  4NF6 A;  4KYE A;  2KLF A;  4YU0 A;  1QKB A;  1N76 A;  5K2X A;  2D3I A;  2IEE A;  3K02 A;  4YB7 A;  4ECF A;  2QPQ A;  1MQD A;  4MFI A;  1I69 A;  3ECR A;  3K00 A;  1QUJ A;  3PUV E;  1WDN A;  3LBS A;  2E0S A;  1IIW A;  4I62 A;  1DOT A;  1RYX A;  3FVO A;  2IA4 A;  3ZSF A;  3TMG A;  3K1P A;  1CE2 A;  4FED A;  1OIB A;  3MZ1 A;  4POW A;  1B52 A;  4BDM A;  4ELO A;  3DM0 A;  3TTM A;  2V3U A;  4G8M A;  1PB7 A;  1BLF A;  1LBB A;  1B0H A;  2ABH A;  1LCF A;  2B3F A;  1SW1 A;  3IR1 A; 
#chains in the Genus database with same CATH topology
 4ZEF A;  3O2A A;  1YYZ A;  3RUM A;  4I40 A;  3UN6 A;  4PAK A;  1ZJL A;  5F24 A;  1HSL A;  2I49 A;  1EYI A;  2XWI A;  4AS4 A;  5TPA A;  3H6U A;  2QRY A;  5I3S A;  3T93 B;  2ZMB A;  1RDY A;  4U2R A;  1LB9 A;  4P9K A;  4U4X A;  4DCY A;  5JTY B;  4OFJ A;  2VOZ A;  4OEV A;  4F3S A;  1Y1Z A;  1Y1M A;  1FQE A;  5EYH A;  5LTC A;  5B70 A;  4IR8 A;  4PFU A;  3JYR A;  4GX4 A;  4PAI A;  5I58 B;  1GVC A;  1RDX A;  2XHD A;  3UIF A;  2B4L A;  1XS5 A;  3OO6 A;  2O7U A;  5I84 A;  4NE4 A;  1KZ8 A;  4OWD A;  3TAJ A;  4JDF A;  3IOV A;  3EHS A;  1B3G A;  2GFE A;  1M5F A;  3IFA A;  4U22 A;  4O3C A;  1G0I A;  5EHS A;  4JSO A;  4GWU A;  4N6D A;  2O1L A;  2NWJ A;  4KQP A;  3KC1 A;  4QHQ A;  1UTB B;  1YAE A;  4LAT A;  4LA9 A;  3OSQ A;  1ATG A;  4HE2 A;  3KGC A;  3L6G A;  2XXP A;  4X48 A;  1XHY A;  5AA2 B;  1AMF A;  2DP8 A;  3MBP A;  3MVZ A;  4GWO A;  1PBP A;  1AIV A;  3PV0 E;  3IX1 A;  3PPQ A;  1A54 A;  2F36 A;  4GWY A;  5DT6 A;  4NF8 B;  2PT2 A;  1Q35 A;  4DIG A;  2ZZV A;  3I5O A;  4FOR A;  3RPL A;  2FBP A;  2WBD A;  4RXL A;  2MKZ A;  3T9H B;  4PFT A;  1D4N A;  2I3V A;  2P0S A;  5ELV A;  3PUX E;  4R72 A;  5DVJ A;  1WOD A;  1AWB A;  2PFZ A;  2Y7R A;  2DYX A;  2ZNS A;  5ET5 A;  1MXX A;  1EYK A;  3EHU A;  2QFL A;  1B3H A;  5CM6 A;  3CSG A;  3PGF A;  3D4G A;  4H45 A;  2NOO A;  1IXC A;  2XWO A;  2FVZ A;  4QFL A;  4PCD A;  5EYG A;  2I0B A;  3CHG A;  4HCW A;  1SDX A;  2Q8J A;  5H8S A;  1I6Q A;  3PUZ E;  1DTZ A;  2I0C A;  4I1D A;  1D9V A;  3H03 A;  1FSA A;  4QXD A;  4PFY A;  1OLC A;  3HPI A;  5I7I A;  4ZE8 A;  3TCH A;  3U65 A;  4M1V A;  1EZO A;  4DE8 A;  4UAB A;  2W7Y A;  1P1Q A;  1ZTY A;  4RPN A;  4N8G A;  3RTW B;  4XKP A;  1JVX A;  1CB6 A;  3GYY A;  2I48 A;  3H7M A;  3N26 A;  1IZ1 A;  3A3U A;  3FV1 A;  5DTB A;  2QVR A;  5BWJ A;  1FTL A;  4MX6 A;  3PU5 A;  2ALU A;  1MG1 A;  1MPB A;  5DYH A;  3CR9 A;  5I57 B;  2VD2 A;  2DQV A;  4GWZ A;  5CMM A;  2VGQ A;  2I3W A;  5FBP A;  2OJT A;  4O94 A;  1SQY A;  3MZ9 A;  2E1S A;  1ANF A;  1NNT A;  1Y20 A;  4MMP A;  1FQA A;  5H8Q A;  4ZEC A;  1IMD A;  1XI6 A;  5AA4 B;  1ZKB A;  1FPF A;  1FRP A;  3CI8 A;  1IEJ A;  1EYJ A;  2DSF A;  4U4S A;  1QUK A;  1INP A;  4PQJ A;  2ZZW A;  4DXU A;  3G3I A;  1JW5 A;  2VT5 A;  4KCD A;  1FTJ A;  3LUY A;  4NGU A;  2Q9T A;  1BTJ A;  3U92 A;  4GIZ A;  1JW4 A;  1SI1 A;  3I6V A;  4AB5 A;  1MDP 1;  2CZL A;  1B2H A;  2ZXT A;  2ZNT A;  4C1U A;  3PD9 A;  4G77 A;  4NF6 B;  3OOA A;  4Z0I A;  1S9T A;  1A7L A;  4EF2 A;  4BDO A;  4XEQ A;  4XKQ A;  4UA8 A;  2Y5L A;  4X9T A;  3SEW A;  1R6Z A;  1VFE A;  1NUX A;  5A5X A;  3QUJ A;  2RF1 A;  1M5D A;  3E13 X;  1R9Q A;  5L9O A;  3RGY A;  4ISU A;  2Q8M A;  1P1O A;  2ZZX A;  3PPP A;  2OLB A;  4XF5 A;  4PF6 A;  4N17 A;  1MPC A;  3M3K A;  3TDJ A;  2HEU A;  4LUB A;  1GTK A;  4IY6 A;  4X04 A;  1BK4 A;  2F7C A;  4I8C A;  3C36 A;  2KR0 A;  3U1O A;  2KQZ A;  3K6V A;  4H0W A;  1OLA A;  3ILU B;  1BKA A;  2H4I A;  1IMF A;  1B3E A;  1Y3P A;  3RT8 A;  4HTG A;  3TCG A;  2OWZ A;  4H6D A;  1SW2 A;  3FJG A;  4KCC A;  5TPA B;  3U72 A;  4ZDM A;  1XT8 A;  4RA1 A;  1HSE A;  3T1B A;  1MY3 A;  4PDD A;  3T9X B;  4YMA A;  3OD7 A;  5CMC A;  1VE4 A;  4GVO A;  4NWC A;  3QAX A;  3HST A;  5EYF A;  4GX6 A;  1ELJ A;  5CMB A;  1IXI A;  2F3B A;  2XD2 A;  4PF8 A;  3H4Z A;  2CZH A;  1FBG A;  3EF7 A;  4ELP A;  1B5J A;  1FQD A;  4QFO A;  2LAO A;  4PFW A;  2H5Y A;  1B5H A;  1M5B A;  1GV8 A;  1NI9 A;  1FPE A;  5HBC A;  3SES A;  5AA1 A;  2V93 A;  5CBS A;  3CFL A;  2H25 A;  3TPA A;  3FXR A;  1PBQ A;  4KD5 A;  2Y7W A;  4JVC A;  4NED A;  5KCJ A;  3FD3 A;  3IB0 A;  4FJP A;  2HFB A;  4P0I A;  2QVV A;  5DW8 A;  2O6A A;  1USY H;  1IMC A;  1LEV A;  1B58 A;  2F5X A;  3MPL A;  4JVD A;  2PYY A;  1B7H A;  3L6H A;  3IOU A;  3IJO B;  4R6K A;  2A5T A;  3JZJ A;  2XX9 A;  1LBW A;  3TTL A;  3BKI B;  4YB5 A;  2XXR A;  3H06 B;  1MH3 A;  4IO5 A;  3KN3 A;  1RYO A;  3RTF B;  4ONY A;  1KA1 A;  3ILT B;  2Q2C A;  3E3K A;  2Z8E A;  5F1Q A;  3IB1 A;  3RPL B;  3S2V A;  3MAM A;  2QL3 A;  1MDQ A;  1WVJ A;  1B5I A;  3FXQ A;  3C34 A;  1JP4 A;  1NV7 A;  4MAG A;  4MNC A;  4DXB A;  1MY1 A;  4XXU A;  3G3H A;  3QMF A;  2HZK A;  2X7P A;  1LST A;  3CFZ A;  2M8C A;  4OZ9 A;  3H3G A;  2OK2 A;  2R71 A;  5L8D A;  1NV4 A;  5H8H B;  4QFK A;  3TTN A;  2XXY A;  3V5A A;  4MHF A;  3MPK A;  3MWB A;  3KJ7 A;  2Q88 A;  1MY4 A;  2OCU A;  3FV2 A;  3KFM A;  1NUW A;  3LSL A;  1H76 A;  4QSD A;  4H8J A;  1Y3Q A;  1FPK A;  4FE8 A;  1H3D A;  2AL5 A;  4N91 A;  1SPI A;  2P2A A;  4MBP A;  3OMB A;  4YMB A;  4RJZ A;  1LAG E;  3MC2 A;  1RKM A;  2F6G A;  2O68 A;  1FPI A;  3DP4 A;  2XD3 A;  4POX A;  4E0X A;  4U23 A;  3PMW A;  5TU0 A;  1MQH A;  3FVG A;  4P0G A;  1QVS A;  1YTV A;  3HFU A;  1Z7M E;  2R6G E;  1A55 A;  4ZS9 A;  1DK4 A;  3LSF B;  1P1W A;  2CEY A;  3D1R A;  5L9M A;  4P56 A;  3N94 A;  3OSR A;  4U21 A;  5IZZ A;  1JVY A;  4KI0 E;  1OVB A;  1Y4C A;  2DWA A;  4LQ5 A;  4F2O A;  4H67 A;  2F8D A;  2Z8D A;  3VDF A;  3TZA A;  1D9Q A;  4F19 A;  4UAC A;  2PBW A;  3S9N C;  5H8Q B;  1FTM A;  1YXI A;  2FA7 A;  4EF1 A;  2Y5K A;  3N6T A;  3VXC A;  3LSW A;  3QIM A;  2XXI A;  2ZNU A;  3UK4 A;  2Y7P A;  4O7M A;  3RY3 A;  1NV5 A;  1FTA A;  4PC9 A;  3RNN A;  3KBR A;  3SEX A;  5FHO A;  4EQ7 A;  3K6U A;  1FW0 A;  4G68 A;  3C35 A;  4LZ7 A;  3ROJ A;  3DLN A;  2WEF A;  4R73 A;  2GQ1 A;  4ESW A;  4PE3 A;  5EQA A;  4LVQ A;  1LCT A;  3UOR A;  3FUZ A;  4R9F A;  3R6U A;  2V4C A;  3I3V A;  1L5T A;  2WBB A;  3Q27 A;  4RK9 A;  4GQO A;  4ZZA A;  4MCO A;  3GBA A;  4ZEK A;  4QBA A;  2WYP A;  2QJE A;  5A5X B;  1ZBM A;  5LDZ A;  1P1U A;  1MM7 A;  1USY E;  1S7Y A;  3IJX B;  3U8Q A;  5CBR A;  4NMY A;  4AQ4 A;  2I4B A;  5HM4 B;  2ONR A;  5FHM A;  1B7Z A;  2HAV A;  3O66 A;  4PAF A;  4H1X A;  1POY 1;  5FHN A;  3O28 A;  2HZL A;  3EKI A;  5AE4 A;  4N81 A;  2RC8 A;  1DPE A;  4G68 C;  1ZU0 A;  4TQU Q;  2CZI A;  3R26 A;  4GWW A;  5IGA A;  4OYV A;  3KZG A;  5H8H A;  2L5V A;  4U1Z A;  3PUY E;  3FGS A;  3O29 A;  1B05 A;  4KYS A;  3ISP A;  2FYI A;  4NX1 A;  3W15 C;  1LLS A;  4AS5 A;  1UTH A;  1B9J A;  3VVE A;  5I59 A;  5H8N A;  2ONS A;  1FQB A;  3QYT A;  4EUO A;  1I6B A;  1EH3 A;  3C9H A;  1FTO A;  4XKN A;  4DZ1 A;  5KDT B;  1MXW A;  4JVI A;  2Y84 A;  4PGP A;  1H44 A;  3TQL A;  1NMU A;  1VR5 A;  2B3B A;  2Q2A A;  4TLL B;  1MY0 A;  2FIX A;  3N5L A;  4JXI A;  4Q0C A;  3MVX A;  4OER A;  1KA0 A;  1SI0 A;  3T22 A;  1SBP A;  1Z7N E;  1ZMG A;  3IL1 B;  4ELR A;  5KCJ B;  1KWH A;  2I4C A;  1B6H A;  4R6H A;  3O6I A;  5DVI A;  1B3F A;  2DVZ A;  4BLA A;  4PE5 B;  3MUQ A;  1SYI A;  4O7I A;  4OHN A;  1PEB A;  4N15 A;  4N6P A;  2A5T B;  2VHA A;  3FAS A;  4HCY A;  2HXR A;  4I3E A;  1FQC A;  1K9Z A;  1TT1 A;  4ZED A;  3LC8 A;  2HAU A;  1LAH E;  5ICQ A;  1NUY A;  4GF8 A;  2V25 A;  1SYH A;  5I56 A;  4MLV A;  1IMA A;  4LZ5 A;  3H6T A;  1FBH A;  3PPO A;  2Y7K A;  3PMX A;  4PET A;  4R75 A;  5JEI A;  2DE2 A;  4NG7 A;  3V8X B;  3V83 A;  1NH8 A;  2CMO A;  4OAN A;  3VXB A;  5JK4 A;  4GOT A;  1II5 A;  4YKJ A;  5IZ3 A;  1F9B A;  3BBR A;  3BFU A;  5KZT A;  4L17 A;  1LB8 A;  1B0L A;  3VLW A;  2ANJ A;  4LN5 A;  3SEV A;  1BIY A;  4MLQ A;  3SEU A;  4QF9 A;  1CNQ A;  4NF5 A;  3RQT A;  3TCF A;  3THI A;  1MPD A;  2QS3 A;  2WYK A;  4OTE A;  3OEM A;  3FVN A;  2PX1 A;  4PTK A;  2O7I A;  2OWT A;  1POT A;  1NNF A;  1K9Y A;  4GL8 A;  2F7A A;  1FTK A;  3VLV A;  3W9V A;  2NXO A;  1NNK A;  3SEY A;  5FTH A;  3Q28 A;  2XXH A;  2F78 A;  4YKP A;  2QMX A;  2XXX A;  3GLB A;  4MJO A;  2V3Q A;  1IXG A;  3FIR A;  3IK6 B;  1LBC A;  4R74 A;  1EZ9 A;  2FIE A;  3O6G A;  4EDP A;  4OFO A;  4QFN A;  3T9U A;  1OVT A;  2WX9 A;  3USD A;  1LBV A;  4OQO A;  2V84 A;  1FPG A;  4H5G A;  4YKI A;  1OQG A;  2RC7 A;  4IGT A;  2NVU B;  3KN7 A;  1P1N A;  3QXM A;  3OEN A;  3U94 A;  2XA5 A;  3PUW E;  2XXU A;  4F22 A;  5IKB A;  5ITO A;  2X26 A;  3Q25 A;  1FPB A;  5KDT A;  1Q1K A;  1ZIU A;  3PPR A;  4XTC Q;  4PDH A;  4GXA A;  3RT6 B;  3OO9 A;  3EHT A;  3EN3 A;  2UVJ A;  4P1E A;  3EPE A;  2Z22 A;  1H45 A;  3DEL B;  1TWY A;  3B7D A;  5IAI A;  4G4P A;  4H5F A;  3CRB A;  1TXF A;  3C31 A;  1URS A;  2VPN A;  3IO4 A;  5ESY A;  2DVC A;  5DEX A;  3UGW A;  3O97 A;  3Q26 A;  5ET7 A;  3TOD A;  1JEU A;  1NV3 A;  5A5L A;  1FPL A;  4G61 A;  1MH4 A;  5TP9 A;  1NH7 A;  4PGN A;  4LP2 B;  4G68 B;  4XFE A;  1I6A A;  4IO6 A;  4F39 A;  3B50 A;  1N7W A;  3IOR A;  3PTY A;  4OES A;  4R6Y A;  1FBE A;  3WAF A;  3ZKK A;  2YLN A;  3OXN A;  4Z7E A;  5EQ9 A;  2PVU A;  1NV2 A;  4XIG Q;  3V89 B;  4FAJ A;  2ZYO A;  1PB8 A;  2A5S A;  2XXT A;  1B32 A;  1IQ7 A;  5CC2 A;  1AL3 A;  3K4U A;  1AH5 A;  3IAZ A;  2QS2 A;  2F6P A;  2CEX A;  2UVI A;  2XXV A;  4YIC A;  4HS7 A;  1NUZ A;  2F35 A;  4NAP A;  2Y7I A;  2VPO A;  2O1M A;  3O6H A;  1LFG A;  3FJM A;  4JWO A;  3R7X A;  2YPN A;  3VLU A;  2ZYN A;  1NV6 A;  1QUL A;  3AXF A;  2NUV A;  2REG A;  1Y4T A;  3K0V A;  1FPJ A;  4O3B A;  4F31 B;  2REJ A;  3M3L A;  4NF4 A;  4F1U A;  1EU8 A;  4ELQ A;  4HXV A;  5F7V A;  2HXW A;  4KR5 A;  3UP9 A;  3VFJ A;  3MW0 A;  4KHZ E;  1B51 A;  2AIX A;  4PBH A;  2DXY A;  1D3K A;  4OVP A;  1GR2 A;  3FJ7 A;  4EXK A;  4JWY A;  4H8I A;  1MM6 A;  2O84 X;  4LQ2 A;  1UTH B;  4F3G A;  1JQF A;  3G3G A;  4EQB A;  4PFI A;  5I59 B;  1DTG A;  5H8N B;  5H8F A;  3ZKL A;  3CG3 A;  5IM2 A;  2GHB A;  3KSJ A;  1IXH A;  1B1H A;  2DXR A;  4R9G A;  4JBZ A;  3MVW A;  1DCU A;  2ONK E;  2GRV A;  2AL4 A;  1N04 A;  1NNP A;  3MP6 A;  1HSJ A;  4H65 A;  4OFL A;  3GZG A;  4IGR A;  4MEV A;  2VP1 A;  3MYU A;  1RDZ A;  5J1D A;  4M4G A;  3U93 A;  1VDW A;  3DP6 A;  3TTK A;  1EZP A;  4I3Y A;  1SW5 A;  1OMP A;  1MRP A;  2HCA A;  5IZ1 A;  4F1Y A;  2DE4 A;  3RYD A;  3VE1 B;  2XX7 A;  2UYF A;  3OEK A;  5I2N A;  1N7X A;  2I58 A;  3KOT A;  3A3C A;  3SER A;  4F29 A;  3S9M C;  3MJN A;  4IO3 A;  1JEV A;  1MXY A;  2G29 A;  2DWH A;  2B65 A;  3CVG A;  3KBZ A;  1A99 A;  5I56 B;  2V3T A;  1B46 A;  4X1D A;  1SVX B;  4GX3 A;  1JET A;  2R9J A;  5BUU A;  4FBP A;  4ND9 A;  3TEL A;  5L9S A;  3ODB A;  4DXC A;  3K1M A;  3TFL A;  4R2B A;  2I6E A;  4OXV A;  1SD3 A;  1O64 A;  5I2K A;  2DWJ A;  4GXS B;  3T96 B;  4OVJ A;  5IZ3 B;  4R2F A;  3VVD A;  2RCB A;  3RLF E;  3B8B A;  2F97 A;  4P11 A;  4KXP A;  1DSN A;  1US5 A;  2QMW A;  3PD8 A;  4G8N A;  4OA4 A;  3OO8 A;  3M3F A;  3SET A;  1P99 A;  1Q9D A;  4QFP A;  4BDQ A;  3EQ1 A;  4OVT A;  1B4Z A;  2DWI A;  4K3F A;  4GRK A;  4NF5 B;  4FEB A;  3VV5 A;  3NOH A;  3SZP A;  4ZZE A;  1A8F A;  3KOS A;  3O9P A;  2XWV A;  2THI A;  2QSX A;  1FPD A;  3KC0 A;  3T0J A;  4NQ8 A;  1G0H A;  3UA8 A;  4MNI A;  3KG2 A;  3CIJ A;  3B6W A;  4LON B;  4OVS A;  2OWS A;  2RC9 A;  1MXU A;  5HPQ A;  1QGX A;  3P7I A;  5M2V A;  4NN3 A;  4P47 A;  1BP5 A;  3HO7 A;  2GHA A;  2XXK A;  4YKK A;  3S9L C;  3TUS A;  4KPT A;  3HHF A;  4Q5T A;  3PPN A;  1MXZ A;  4GBW A;  4F2Q A;  3KN8 A;  1N0T A;  4LZ8 A;  3LUZ A;  4RY1 A;  1QJM A;  3FZV A;  1URG A;  3CSB A;  4IO2 A;  3S9E A;  4GD5 A;  2UYE A;  3OO7 A;  2P3V A;  4JWX A;  1GGG A;  2UVH A;  5T3J A;  4OVR A;  2PCR A;  4X1B A;  4NHB A;  3A29 A;  3T9V A;  4NTL A;  1LFH A;  4OET A;  2JJK A;  2RCA A;  4MH5 A;  3CFX A;  4OVQ A;  1YZ0 A;  1OQH A;  1MQI A;  3TKD A;  4HW8 A;  3IOW A;  3LV0 A;  4I9D A;  5ITP A;  2UXA A;  4GFR A;  2DOJ A;  2D21 A;  2DS9 A;  4N13 A;  3Q29 A;  4OEN A;  4EXL A;  2BJJ X;  4O3A A;  3WAE A;  4GL0 A;  1NL5 A;  3QSL A;  4DI3 D;  4N07 A;  3E78 A;  2X7Q A;  3RPW A;  1VFD A;  2H9B A;  4NF0 A;  2GH9 A;  1PDA A;  5CRY A;  2F34 A;  5I5P A;  1FQF A;  3QK6 A;  3QUF A;  1PC3 A;  2BJI A;  2R8T A;  3KSX A;  1IUD A;  4RNS A;  1XVY A;  4N6K A;  5DEX B;  4OMB A;  4E0W A;  1NKX A;  2XXW A;  3BIH A;  2Z8F A;  4IB2 A;  1AOV A;  1N3X A;  1B40 A;  5TP9 B;  1A8E A;  2FNC A;  2AYS A;  5ET8 A;  2F7B A;  1B4H A;  4Q8R A;  2XX8 A;  2XXQ A;  2O51 A;  2PMS A;  1FBP A;  3N6U A;  1US4 A;  2OX3 A;  4FEC A;  3C32 A;  5JTY A;  3FVK A;  1FJ9 A;  3FBP A;  3HN0 A;  1R9L A;  1NV0 A;  4G2Z A;  1B1X A;  5EQ8 A;  3MVY A;  2XWK A;  3BFT A;  5DVF A;  1S50 A;  1R1N A;  2F3D A;  3T66 A;  5I58 A;  2OBG A;  1YPN A;  2QS4 A;  3K1N A;  3TQW A;  1Y9U A;  3W9W A;  3FAT A;  4THI A;  1M5C A;  4RK2 A;  1B3L A;  2O69 A;  1B7U A;  1LBX A;  1J1N A;  1QKA A;  1T0K A;  4MNP A;  3G3J A;  4YAH X;  5EHM A;  3KJT A;  2B4M A;  3FXU A;  4QSE A;  1XVX A;  3K2D A;  1FBD A;  2ZYM A;  3IFC A;  4NF4 B;  4JB7 A;  1IIT A;  1NFT A;  4DI4 B;  3FXB A;  4N8Y A;  3OEL A;  2D5W A;  3MP8 A;  2H98 A;  3H6W A;  1MS7 A;  1XOC A;  4BDL A;  1QUI A;  3GXA A;  1UTB A;  4X8R A;  1JW1 A;  2HQ0 A;  4ESX A;  3MQ9 A;  4C1T A;  1FCK A;  4C0R A;  3C33 A;  4ZEI A;  4F1V A;  5AA2 A;  4QSC A;  2Q74 A;  1YCJ A;  1TFD A;  3H6V A;  2CZK A;  1NV1 A;  1N3W A;  5FTI A;  5H8F B;  1MQJ A;  2G93 A;  1LGB C;  4NF8 A;  3ZS6 A;  3MP1 A;  2QS1 A;  2H99 A;  1ZLQ A;  3CG1 A;  3M8U A;  3C4M A;  5J16 A;  1LAX A;  1MY2 A;  4JSD A;  4WED A;  4GLI A;  3E4R A;  3K6X A;  4IO7 A;  5K2Y A;  3TTR A;  4XKR A;  3SDF A;  5AA3 A;  3S4U A;  1PB9 A;  1LFI A;  4F3P A;  4WXJ A;  4BDN A;  2WKY A;  4YB6 A;  1N84 A;  4PP0 A;  4HE1 A;  4OEU A;  3G3F A;  1Y3N A;  4WKM A;  3RN8 A;  5I2N B;  1DBZ A;  4ZEB A;  3IOT A;  5CI5 A;  4YZZ A;  1MQG A;  3K01 A;  2DDK A;  3JV9 A;  4DCX A;  1D9Y A;  3B6T A;  3MZB A;  4ZE9 A;  3G3K A;  4TLM B;  3DP8 A;  4NWD A;  5I2K B;  3F11 A;  4QRZ A;  4P8B A;  4O8M A;  4KFQ A;  1TFA A;  1UQW A;  3IO6 A;  3HHG A;  3PMV A;  3VVF A;  4HE0 A;  4GWS A;  3IB2 A;  3LR1 A;  4PBQ A;  3B6Q A;  2FHY A;  4H46 A;  4KYD A;  2P1S A;  3D4C A;  1DMB A;  1JNF A;  4N4U A;  3G7W A;  2UVG A;  2ZYK A;  4MF3 A;  1URD A;  4PFR A;  4RYA A;  1DPP A;  3ONM A;  4PFB A;  4GBV A;  5B7D A;  5LOM A;  1LBY A;  1FBC A;  4IO4 A;  4U1O A;  5I57 A;  4WEP A;  4AB6 A;  1H43 A;  4Q30 B;  4P3L A;  4RPO A;  3MST A;  1MXV A;  3TEP A;  1LAF E;  2DE3 A;  5ICT A;  5CMK A;  1IMB A;  1FBF A;  3E79 A;  2YJP A;  2OZZ A;  5AA4 A;  3A09 A;  4DLD A;  3KEI A;  2ESN A;  2PFY A;  4BDR A;  3HV1 A;  1SW4 A;  4F18 A;  3SKP A;  2RIN A;  1UIU A;  1QW0 A;  2PT1 A;  4GWX A;  3K6W A;  4DDD A;  3E9X A;  4FIM A;  5ISU A;  3TYH A;  4FAT A;  2Q89 A;  2QVU A;  4F3B A;  1UIV A;  2P3N A;  1A40 A;  2RKM A;  3HCQ A;  1O63 A;  1O7T A;  1VSO A;  3LSX A;  1M5E A;  5AA2 D;  4IY5 A;  3GBB A;  2VD3 A;  4TOZ A;  1FJ6 A;  1XC1 A;  2Z23 A;  4EQ9 A;  5EQ7 A;  4G8H A;  4NF6 A;  4KYE A;  2KLF A;  4YU0 A;  1QKB A;  1N76 A;  5K2X A;  2D3I A;  2IEE A;  3K02 A;  4YB7 A;  4ECF A;  2QPQ A;  1LBZ A;  1MQD A;  1IME A;  5ET6 A;  4MFI A;  1I69 A;  3ECR A;  3K00 A;  1QUJ A;  3PUV E;  1WDN A;  3LBS A;  2E0S A;  1IIW A;  4I62 A;  1DOT A;  1RYX A;  2HPG A;  3FVO A;  2IA4 A;  3ZSF A;  3TMG A;  3K1P A;  2HHM A;  1CE2 A;  4FED A;  1OIB A;  3MZ1 A;  4POW A;  4MIJ A;  1B52 A;  4BDM A;  4ELO A;  3DM0 A;  3TTM A;  2V3U A;  4G8M A;  1PB7 A;  4P1L A;  1BLF A;  1LBB A;  1B0H A;  2ABH A;  1LCF A;  2B3F A;  1SW1 A;  3IR1 A;  3BIG A; 
#chains in the Genus database with same CATH homology
 4ZEF A;  3O2A A;  3RUM A;  3UN6 A;  1ZJL A;  1HSL A;  2I49 A;  5TPA A;  3H6U A;  2QRY A;  3T93 B;  2ZMB A;  4U2R A;  1LB9 A;  4U4X A;  4DCY A;  5JTY B;  4OFJ A;  2VOZ A;  4OEV A;  4F3S A;  1Y1Z A;  1Y1M A;  1FQE A;  5B70 A;  4PFU A;  3JYR A;  5I58 B;  1GVC A;  2XHD A;  3UIF A;  1XS5 A;  3OO6 A;  2O7U A;  5I84 A;  4NE4 A;  4OWD A;  3TAJ A;  4JDF A;  3IOV A;  3EHS A;  1B3G A;  2GFE A;  1M5F A;  4U22 A;  4O3C A;  5EHS A;  4JSO A;  2O1L A;  2NWJ A;  4KQP A;  4QHQ A;  1UTB B;  1YAE A;  4LAT A;  4LA9 A;  3OSQ A;  1ATG A;  3KGC A;  3L6G A;  2XXP A;  4X48 A;  1XHY A;  5AA2 B;  1AMF A;  2DP8 A;  3MBP A;  3MVZ A;  4GWO A;  1PBP A;  1AIV A;  3PV0 E;  3IX1 A;  3PPQ A;  1A54 A;  2F36 A;  5DT6 A;  4NF8 B;  2PT2 A;  1Q35 A;  4DIG A;  3I5O A;  4FOR A;  4RXL A;  3T9H B;  4PFT A;  1D4N A;  2I3V A;  2P0S A;  5ELV A;  3PUX E;  4R72 A;  5DVJ A;  1WOD A;  2Y7R A;  2DYX A;  2ZNS A;  1MXX A;  3EHU A;  1B3H A;  5CM6 A;  3CSG A;  3PGF A;  3D4G A;  2NOO A;  1IXC A;  4QFL A;  2I0B A;  4HCW A;  1SDX A;  2Q8J A;  5H8S A;  1I6Q A;  3PUZ E;  1DTZ A;  2I0C A;  4I1D A;  1D9V A;  3H03 A;  4PFY A;  1OLC A;  3HPI A;  4ZE8 A;  3TCH A;  4M1V A;  1EZO A;  4DE8 A;  2W7Y A;  1P1Q A;  1ZTY A;  4RPN A;  3RTW B;  4XKP A;  1JVX A;  1CB6 A;  2I48 A;  3H7M A;  3N26 A;  1IZ1 A;  3A3U A;  3FV1 A;  5DTB A;  5BWJ A;  1FTL A;  3PU5 A;  2ALU A;  1MG1 A;  1MPB A;  5DYH A;  3CR9 A;  5I57 B;  2VD2 A;  2DQV A;  5CMM A;  2VGQ A;  2I3W A;  2OJT A;  1SQY A;  3MZ9 A;  2E1S A;  1ANF A;  1NNT A;  1Y20 A;  1FQA A;  5H8Q A;  4ZEC A;  5AA4 B;  1ZKB A;  3CI8 A;  1IEJ A;  2DSF A;  4U4S A;  1QUK A;  4PQJ A;  4DXU A;  3G3I A;  1JW5 A;  4KCD A;  1FTJ A;  3LUY A;  2Q9T A;  1BTJ A;  3U92 A;  4GIZ A;  1JW4 A;  1SI1 A;  3I6V A;  4AB5 A;  1MDP 1;  2CZL A;  1B2H A;  2ZXT A;  2ZNT A;  4C1U A;  3PD9 A;  4G77 A;  4NF6 B;  3OOA A;  4Z0I A;  1S9T A;  1A7L A;  4EF2 A;  4BDO A;  4XKQ A;  4UA8 A;  4X9T A;  3SEW A;  1R6Z A;  1VFE A;  5A5X A;  3QUJ A;  2RF1 A;  1M5D A;  3E13 X;  1R9Q A;  5L9O A;  3RGY A;  4ISU A;  1P1O A;  3PPP A;  2OLB A;  1MPC A;  3M3K A;  3TDJ A;  2HEU A;  4LUB A;  1GTK A;  4IY6 A;  2F7C A;  4I8C A;  3C36 A;  3U1O A;  3K6V A;  4H0W A;  1OLA A;  3ILU B;  1BKA A;  2H4I A;  1B3E A;  1Y3P A;  3RT8 A;  4HTG A;  3TCG A;  4H6D A;  1SW2 A;  3FJG A;  4KCC A;  5TPA B;  3U72 A;  4ZDM A;  1XT8 A;  4RA1 A;  1HSE A;  1MY3 A;  3T9X B;  4YMA A;  3OD7 A;  5CMC A;  1VE4 A;  4GVO A;  4NWC A;  3QAX A;  3HST A;  5EYF A;  1ELJ A;  5CMB A;  1IXI A;  2XD2 A;  3H4Z A;  3EF7 A;  4ELP A;  1B5J A;  1FQD A;  4QFO A;  2LAO A;  4PFW A;  2H5Y A;  1B5H A;  1M5B A;  1GV8 A;  5HBC A;  3SES A;  5AA1 A;  2V93 A;  5CBS A;  3CFL A;  2H25 A;  3TPA A;  3FXR A;  1PBQ A;  4KD5 A;  2Y7W A;  4NED A;  5KCJ A;  3FD3 A;  3IB0 A;  4FJP A;  2HFB A;  4P0I A;  2O6A A;  1USY H;  1B58 A;  2F5X A;  3MPL A;  2PYY A;  1B7H A;  3L6H A;  3IOU A;  3IJO B;  4R6K A;  2A5T A;  3JZJ A;  2XX9 A;  3TTL A;  3BKI B;  4YB5 A;  2XXR A;  3H06 B;  1MH3 A;  4IO5 A;  3KN3 A;  1RYO A;  3RTF B;  4ONY A;  3ILT B;  2Q2C A;  3E3K A;  2Z8E A;  5F1Q A;  3IB1 A;  3S2V A;  3MAM A;  2QL3 A;  1MDQ A;  1WVJ A;  1B5I A;  3FXQ A;  3C34 A;  4DXB A;  1MY1 A;  4XXU A;  3G3H A;  2HZK A;  2X7P A;  1LST A;  3CFZ A;  2M8C A;  4OZ9 A;  3H3G A;  2OK2 A;  2R71 A;  5L8D A;  5H8H B;  4QFK A;  3TTN A;  2XXY A;  3V5A A;  3MPK A;  3MWB A;  3KJ7 A;  2Q88 A;  1MY4 A;  2OCU A;  3FV2 A;  3KFM A;  3LSL A;  1H76 A;  4QSD A;  4H8J A;  1Y3Q A;  4FE8 A;  1H3D A;  2AL5 A;  2P2A A;  4MBP A;  3OMB A;  4YMB A;  4RJZ A;  1LAG E;  3MC2 A;  1RKM A;  2F6G A;  2O68 A;  3DP4 A;  2XD3 A;  4POX A;  4E0X A;  4U23 A;  3PMW A;  5TU0 A;  1MQH A;  3FVG A;  4P0G A;  1QVS A;  1YTV A;  1Z7M E;  2R6G E;  1A55 A;  4ZS9 A;  3LSF B;  1P1W A;  5L9M A;  3N94 A;  3OSR A;  4U21 A;  1JVY A;  4KI0 E;  1OVB A;  1Y4C A;  2DWA A;  4LQ5 A;  4F2O A;  4H67 A;  2F8D A;  2Z8D A;  3VDF A;  3TZA A;  4F19 A;  4UAC A;  2PBW A;  3S9N C;  5H8Q B;  1FTM A;  2FA7 A;  4EF1 A;  3N6T A;  3VXC A;  3LSW A;  3QIM A;  2XXI A;  2ZNU A;  3UK4 A;  2Y7P A;  3RY3 A;  3RNN A;  3KBR A;  3SEX A;  5FHO A;  4EQ7 A;  3K6U A;  1FW0 A;  4G68 A;  3C35 A;  4LZ7 A;  3DLN A;  4R73 A;  4ESW A;  4LVQ A;  1LCT A;  3UOR A;  3FUZ A;  3R6U A;  4R9F A;  3I3V A;  1L5T A;  3Q27 A;  4RK9 A;  4GQO A;  4ZZA A;  3GBA A;  4ZEK A;  2QJE A;  5A5X B;  1ZBM A;  1P1U A;  1MM7 A;  1USY E;  1S7Y A;  3IJX B;  3U8Q A;  5CBR A;  4NMY A;  4AQ4 A;  2I4B A;  5HM4 B;  2ONR A;  5FHM A;  1B7Z A;  2HAV A;  3O66 A;  4H1X A;  1POY 1;  5FHN A;  3O28 A;  2HZL A;  5AE4 A;  2RC8 A;  1DPE A;  4G68 C;  1ZU0 A;  4TQU Q;  3R26 A;  4OYV A;  3KZG A;  5H8H A;  4U1Z A;  3PUY E;  3FGS A;  3O29 A;  1B05 A;  4KYS A;  2FYI A;  3W15 C;  1LLS A;  1UTH A;  1B9J A;  3VVE A;  5I59 A;  5H8N A;  2ONS A;  1FQB A;  3QYT A;  4EUO A;  1I6B A;  1EH3 A;  3C9H A;  1FTO A;  4XKN A;  4DZ1 A;  5KDT B;  1MXW A;  2Y84 A;  1H44 A;  3TQL A;  1NMU A;  1VR5 A;  2B3B A;  2Q2A A;  4TLL B;  1MY0 A;  3N5L A;  4JXI A;  4Q0C A;  3MVX A;  4OER A;  1SI0 A;  3T22 A;  1SBP A;  1Z7N E;  1ZMG A;  3IL1 B;  4ELR A;  5KCJ B;  1KWH A;  2I4C A;  1B6H A;  4R6H A;  3O6I A;  5DVI A;  1B3F A;  2DVZ A;  4BLA A;  4PE5 B;  3MUQ A;  1SYI A;  4OHN A;  1PEB A;  2A5T B;  2VHA A;  3FAS A;  4N6P A;  4HCY A;  1FQC A;  1TT1 A;  4ZED A;  3LC8 A;  2HAU A;  1LAH E;  5ICQ A;  4GF8 A;  2V25 A;  1SYH A;  5I56 A;  4MLV A;  4LZ5 A;  3H6T A;  3PPO A;  2Y7K A;  3PMX A;  4PET A;  4R75 A;  5JEI A;  2DE2 A;  3V8X B;  3V83 A;  1NH8 A;  2CMO A;  3VXB A;  5JK4 A;  4GOT A;  1II5 A;  4YKJ A;  1F9B A;  3BBR A;  3BFU A;  5KZT A;  4L17 A;  1LB8 A;  1B0L A;  3VLW A;  2ANJ A;  3SEV A;  1BIY A;  4MLQ A;  3SEU A;  4QF9 A;  4NF5 A;  3RQT A;  3TCF A;  3THI A;  1MPD A;  2QS3 A;  4OTE A;  3OEM A;  3FVN A;  2PX1 A;  2O7I A;  2OWT A;  1POT A;  1NNF A;  4GL8 A;  2F7A A;  1FTK A;  3VLV A;  3W9V A;  2NXO A;  1NNK A;  3SEY A;  5FTH A;  3Q28 A;  2XXH A;  2F78 A;  4YKP A;  2QMX A;  2XXX A;  3GLB A;  2V3Q A;  1IXG A;  3FIR A;  3IK6 B;  1LBC A;  4R74 A;  1EZ9 A;  3O6G A;  4EDP A;  4OFO A;  4QFN A;  3T9U A;  1OVT A;  3USD A;  4OQO A;  2V84 A;  4H5G A;  4YKI A;  1OQG A;  2RC7 A;  4IGT A;  2NVU B;  3KN7 A;  1P1N A;  3QXM A;  3OEN A;  3U94 A;  3PUW E;  2XXU A;  4F22 A;  5IKB A;  5ITO A;  2X26 A;  3Q25 A;  5KDT A;  1Q1K A;  1ZIU A;  3PPR A;  4XTC Q;  4GXA A;  3RT6 B;  3OO9 A;  3EHT A;  3EN3 A;  2UVJ A;  3EPE A;  2Z22 A;  1H45 A;  3DEL B;  1TWY A;  3B7D A;  5IAI A;  4G4P A;  4H5F A;  3CRB A;  1TXF A;  3C31 A;  1URS A;  3IO4 A;  2DVC A;  5DEX A;  3UGW A;  3O97 A;  3Q26 A;  3TOD A;  1JEU A;  1MH4 A;  5TP9 A;  1NH7 A;  4LP2 B;  4G68 B;  1I6A A;  4IO6 A;  4F39 A;  1N7W A;  3IOR A;  4OES A;  4R6Y A;  3WAF A;  3ZKK A;  2YLN A;  3OXN A;  4Z7E A;  2PVU A;  4XIG Q;  3V89 B;  4FAJ A;  2ZYO A;  1PB8 A;  2A5S A;  2XXT A;  1B32 A;  1IQ7 A;  5CC2 A;  1AL3 A;  3K4U A;  1AH5 A;  3IAZ A;  2QS2 A;  2F6P A;  2UVI A;  2XXV A;  4YIC A;  4HS7 A;  2F35 A;  2Y7I A;  2O1M A;  3O6H A;  1LFG A;  3FJM A;  4JWO A;  3R7X A;  2YPN A;  3VLU A;  2ZYN A;  1QUL A;  3AXF A;  2NUV A;  2REG A;  1Y4T A;  3K0V A;  4O3B A;  4F31 B;  2REJ A;  3M3L A;  4NF4 A;  4F1U A;  1EU8 A;  4ELQ A;  5F7V A;  2HXW A;  4KR5 A;  3UP9 A;  3VFJ A;  3MW0 A;  4KHZ E;  1B51 A;  2AIX A;  2DXY A;  1D3K A;  1GR2 A;  3FJ7 A;  4EXK A;  4JWY A;  4H8I A;  1MM6 A;  2O84 X;  4LQ2 A;  1UTH B;  4F3G A;  1JQF A;  3G3G A;  4EQB A;  5I59 B;  1DTG A;  5H8N B;  5H8F A;  3ZKL A;  3CG3 A;  2GHB A;  3KSJ A;  1IXH A;  1B1H A;  2DXR A;  4R9G A;  4JBZ A;  3MVW A;  2ONK E;  2GRV A;  2AL4 A;  1N04 A;  1NNP A;  3MP6 A;  1HSJ A;  4H65 A;  4OFL A;  3GZG A;  4IGR A;  2VP1 A;  5J1D A;  4M4G A;  3U93 A;  3TTK A;  3DP6 A;  1EZP A;  1SW5 A;  1OMP A;  1MRP A;  2HCA A;  4F1Y A;  2DE4 A;  3VE1 B;  2XX7 A;  2UYF A;  3OEK A;  5I2N A;  1N7X A;  2I58 A;  3KOT A;  3A3C A;  3SER A;  4F29 A;  3S9M C;  3MJN A;  4IO3 A;  1JEV A;  1MXY A;  2G29 A;  2DWH A;  2B65 A;  3CVG A;  1A99 A;  5I56 B;  2V3T A;  1B46 A;  4X1D A;  1SVX B;  1JET A;  2R9J A;  5BUU A;  4ND9 A;  3TEL A;  5L9S A;  3ODB A;  4DXC A;  3K1M A;  3TFL A;  4R2B A;  2I6E A;  4OXV A;  1SD3 A;  1O64 A;  5I2K A;  2DWJ A;  4GXS B;  3T96 B;  4OVJ A;  4R2F A;  3VVD A;  2RCB A;  3RLF E;  4P11 A;  2F97 A;  1DSN A;  1US5 A;  2QMW A;  3PD8 A;  4G8N A;  3OO8 A;  3M3F A;  3SET A;  1P99 A;  4QFP A;  4BDQ A;  3EQ1 A;  1B4Z A;  2DWI A;  4K3F A;  4GRK A;  4NF5 B;  4FEB A;  3VV5 A;  4ZZE A;  1A8F A;  3KOS A;  3O9P A;  2THI A;  2QSX A;  3UA8 A;  3KG2 A;  3CIJ A;  3B6W A;  4LON B;  2OWS A;  2RC9 A;  1MXU A;  5HPQ A;  3P7I A;  5M2V A;  1BP5 A;  3HO7 A;  2GHA A;  4YKK A;  3S9L C;  3TUS A;  4KPT A;  3HHF A;  4Q5T A;  3PPN A;  1MXZ A;  4F2Q A;  3KN8 A;  1N0T A;  4LZ8 A;  4RY1 A;  1QJM A;  3FZV A;  1URG A;  3CSB A;  4IO2 A;  3S9E A;  4GD5 A;  2UYE A;  3OO7 A;  4JWX A;  1GGG A;  2UVH A;  4X1B A;  3T9V A;  4NTL A;  1LFH A;  4OET A;  2RCA A;  4MH5 A;  3CFX A;  1OQH A;  1MQI A;  3TKD A;  4HW8 A;  3IOW A;  4I9D A;  5ITP A;  2UXA A;  4GFR A;  2DOJ A;  2D21 A;  2DS9 A;  4N13 A;  3Q29 A;  4OEN A;  4EXL A;  2BJJ X;  4O3A A;  3WAE A;  4GL0 A;  1NL5 A;  3QSL A;  4N07 A;  2X7Q A;  3RPW A;  1VFD A;  2H9B A;  2GH9 A;  1PDA A;  5CRY A;  2F34 A;  1FQF A;  3QK6 A;  3QUF A;  1PC3 A;  3KSX A;  1IUD A;  4RNS A;  1XVY A;  5DEX B;  4OMB A;  4E0W A;  1NKX A;  2XXW A;  2Z8F A;  4IB2 A;  1AOV A;  1N3X A;  1B40 A;  5TP9 B;  1A8E A;  2FNC A;  2AYS A;  2F7B A;  1B4H A;  4Q8R A;  2XX8 A;  2XXQ A;  2O51 A;  2PMS A;  3N6U A;  1US4 A;  4FEC A;  3C32 A;  5JTY A;  3FVK A;  3HN0 A;  1R9L A;  4G2Z A;  1B1X A;  3MVY A;  3BFT A;  5DVF A;  1S50 A;  1R1N A;  3T66 A;  5I58 A;  2OBG A;  1YPN A;  2QS4 A;  3K1N A;  3TQW A;  1Y9U A;  3W9W A;  3FAT A;  4THI A;  1M5C A;  4RK2 A;  1B3L A;  2O69 A;  1B7U A;  1J1N A;  1QKA A;  1T0K A;  3G3J A;  4YAH X;  5EHM A;  3KJT A;  3FXU A;  1XVX A;  3K2D A;  4QSE A;  2ZYM A;  4NF4 B;  4JB7 A;  1IIT A;  1NFT A;  3OEL A;  2D5W A;  3MP8 A;  2H98 A;  3H6W A;  1MS7 A;  1XOC A;  4BDL A;  1QUI A;  3GXA A;  1UTB A;  1JW1 A;  2HQ0 A;  4ESX A;  3MQ9 A;  4C1T A;  1FCK A;  4C0R A;  3C33 A;  4ZEI A;  4F1V A;  5AA2 A;  4QSC A;  1YCJ A;  1TFD A;  3H6V A;  1N3W A;  5FTI A;  5H8F B;  1MQJ A;  2G93 A;  1LGB C;  4NF8 A;  3ZS6 A;  3MP1 A;  2QS1 A;  2H99 A;  1ZLQ A;  3CG1 A;  3M8U A;  3C4M A;  1LAX A;  1MY2 A;  4JSD A;  4WED A;  4GLI A;  3E4R A;  3K6X A;  4IO7 A;  5K2Y A;  3TTR A;  4XKR A;  3SDF A;  5AA3 A;  3S4U A;  1PB9 A;  1LFI A;  4F3P A;  4WXJ A;  4BDN A;  2WKY A;  4YB6 A;  1N84 A;  4PP0 A;  4OEU A;  3G3F A;  1Y3N A;  4WKM A;  3RN8 A;  5I2N B;  4ZEB A;  3IOT A;  5CI5 A;  4YZZ A;  1MQG A;  3K01 A;  3JV9 A;  4DCX A;  1D9Y A;  3B6T A;  3MZB A;  4ZE9 A;  3G3K A;  4TLM B;  3DP8 A;  4NWD A;  5I2K B;  3F11 A;  4QRZ A;  4KFQ A;  1TFA A;  1UQW A;  3IO6 A;  3HHG A;  3PMV A;  3VVF A;  3IB2 A;  3LR1 A;  3B6Q A;  4KYD A;  2P1S A;  3D4C A;  1DMB A;  1JNF A;  3G7W A;  2UVG A;  2ZYK A;  4MF3 A;  1URD A;  4RYA A;  1DPP A;  3ONM A;  5B7D A;  5LOM A;  4IO4 A;  4U1O A;  5I57 A;  4WEP A;  4AB6 A;  1H43 A;  4Q30 B;  4RPO A;  1MXV A;  3TEP A;  1LAF E;  2DE3 A;  5ICT A;  5CMK A;  2YJP A;  2OZZ A;  5AA4 A;  3A09 A;  4DLD A;  3KEI A;  2ESN A;  4BDR A;  3HV1 A;  1SW4 A;  4F18 A;  3SKP A;  2RIN A;  1UIU A;  1QW0 A;  2PT1 A;  3K6W A;  4DDD A;  3E9X A;  4FIM A;  5ISU A;  3TYH A;  4FAT A;  2Q89 A;  4F3B A;  1UIV A;  1A40 A;  2RKM A;  3HCQ A;  1O63 A;  1O7T A;  1VSO A;  3LSX A;  1M5E A;  5AA2 D;  4IY5 A;  3GBB A;  2VD3 A;  4TOZ A;  2Z23 A;  1XC1 A;  4EQ9 A;  4G8H A;  4NF6 A;  4KYE A;  2KLF A;  4YU0 A;  1QKB A;  1N76 A;  5K2X A;  2D3I A;  2IEE A;  3K02 A;  4YB7 A;  4ECF A;  2QPQ A;  1MQD A;  4MFI A;  1I69 A;  3ECR A;  3K00 A;  1QUJ A;  3PUV E;  1WDN A;  3LBS A;  2E0S A;  1IIW A;  4I62 A;  1DOT A;  1RYX A;  3FVO A;  2IA4 A;  3ZSF A;  3TMG A;  3K1P A;  1CE2 A;  4FED A;  1OIB A;  3MZ1 A;  4POW A;  1B52 A;  4BDM A;  4ELO A;  3DM0 A;  3TTM A;  2V3U A;  4G8M A;  1PB7 A;  1BLF A;  1LBB A;  1B0H A;  2ABH A;  1LCF A;  2B3F A;  1SW1 A;  3IR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...