3TTMA

Crystal structure of spud in complex with putrescine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
341
Chain Sequence
DNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Binding Specificity Revealed by the Crystal Structures of Polyamine Receptors SpuD and SpuE from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Polyamine transport protein
total genus 122
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttmA02
5HBCA 1NNPA 3IB0A 4IB2A 4YU0A 3C9HA 3ZSFA 2F34A 2PBWA 3A3UA 3TUSA 3D4GA 1XS5A 2A5TB 2DSFA 1MPDA 4JDFA 1MDQA 4RJZA 3W9VA 4G77A 4ELOA 2DE2A 1EU8A 2HZLA 4NF4A 3RQTA 4F2QA 5B7DA 5FHNA 3RTFB 3WAFA 3KN8A 3HHGA 4YICA 3S9EA 3BBRA 4ZZEA 1H76A 2R9JA 3VVFA 3GZGA 4QF9A 5A5XA 4R2FA 3V83A 1S9TA 4R9FA 3RGYA 1OVBA 4LZ8A 1IXGA 3UGWA 5AA3A 1IEJA 5H8HA 1B51A 4R74A 2V3TA 4KCCA 2Y7WA 4LZ5A 1Y3NA 4R6HA 3SEYA 4Q8RA 3KN7A 4OYVA 1MG1A 5ISUA 1ZLQA 5TP9B 2O68A 1N04A 2UYFA 3O6GA 3K1PA 4OVJA 4OZ9A 2ZYKA 2D21A 1JNFA 4G68C 3OELA 2O51A 4OTEA 2Z8DA 3O28A 1B2HA 4FORA 4PQJA 1O7TA 3LUYA 1FQAA 1VR5A 2ANJA 4UACA 4H65A 4U4SA 4YB5A 1I6AA 3ZKLA 4PP0A 4BLAA 4KCDA 3Q26A 4OERA 2HEUA 1MH4A 4KD5A 4R9GA 1IIWA 1N84A 2F7CA 4GF8A 1B1HA 3EHTA 2UVIA 1SI0A 1ZBMA 4K3FA 4ZE9A 3IJOB 1D9VA 3Q25A 4GL8A 4XKPA 4OEUA 1B4ZA 1BKAA 3TFLA 1MXYA 3D4CA 3W15C 1DPEA 3MWBA 1FTMA 3TELA 2F6PA 2CZLA 2IA4A 3LSFB 3PUYE 3A09A 1M5FA 2H5YA 2ONKE 3FVKA 4HCYA 5AA2B 2I3WA 5ITOA 5JTYA 3OOAA 4POWA 1EZ9A 1US5A 1LLSA 3IB1A 1POY1 4M1VA 1PB8A 1MDP1 3C4MA 1B1XA 1QUJA 3K6UA 3S4UA 1IUDA 1TWYA 5DVIA 1HSEA 3UA8A 3C35A 1MRPA 3MAMA 4KQPA 5TU0A 1US4A 1QUKA 3DP8A 3ZS6A 4X48A 4N07A 2ALUA 4OFJA 1NKXA 3EHUA 3PGFA 3QUFA 4G2ZA 4WXJA 1OQGA 3B6QA 2VGQA 4OWDA 2QJEA 4AB6A 2RCAA 2Q2CA 4UA8A 3FV2A 1B0HA 1QVSA 5JTYB 3VVEA 4E0XA 2O1LA 5I2NA 1MPBA 2QS1A 3UIFA 2H4IA 4XKQA 1N7WA 4AQ4A 2Q9TA 3CVGA 1D9YA 1UTBA 3H06B 3IX1A 3MC2A 4R75A 2O84X 3RNNA 3EPEA 4LATA 4ESWA 3THIA 3K6WA 1MQDA 2UVGA 3HPIA 4ND9A 1B4HA 4O3AA 2Y7RA 2W7YA 3UN6A 4KPTA 2XX9A 1L5TA 4FE8A 1MM6A 1LAXA 2LAOA 4U23A 3MZ1A 4MLQA 5CMBA 5I2KB 3TMGA 1D4NA 4YKKA 2O7UA 3PUXE 4X9TA 2XXQA 4WEDA 2ABHA 5CI5A 4PE5B 3LC8A 3T9HB 3U8QA 3M3FA 5K2YA 4EQ7A 5CC2A 1B7ZA 5I56B 4C1UA 5JK4A 2UXAA 4H6DA 1ANFA 2THIA 1FTJA 4EUOA 3UP9A 3MP1A 5CRYA 1B5IA 2DS9A 5TPAB 1NNFA 2OZZA 1N7XA 2I4BA 3K02A 1IXHA 3G3KA 5L9MA 3USDA 1PEBA 2OBGA 4JSOA 3U72A 2FA7A 4G4PA 5FTIA 1QJMA 2PYYA 4G8MA 3SEVA 3CFLA 4QFKA 2V93A 3CIJA 4DDDA 1QKAA 2F6GA 1Z7ME 1P1OA 2NOOA 3TYHA 3CRBA 3H3GA 3N94A 5H8QA 1VE4A 4DCXA 3TAJA 2VD2A 2VP1A 3OO7A 4E0WA 2UYEA 3OO9A 4MBPA 2HAVA 2HAUA 1B40A 1S50A 2PT1A 3G7WA 3H6VA 3MJNA 1Y9UA 1FQDA 2QMWA 1FQBA 4LA9A 3FXUA 2P1SA 3SDFA 3TTKA 5KDTB 4NF8B 3TTLA 3TZAA 1O64A 2I58A 5I58B 4YKPA 3TDJA 2D3IA 3FASA 4LZ7A 4O3BA 1M5CA 1B3LA 1RYXA 3UK4A 3ZKKA 4NF5B 2QS4A 2QS3A 4YB6A 2H9BA 5AA2A 2P0SA 4PFYA 2I48A 2Y7KA 1CB6A 1MH3A 1P99A 1Q35A 3S2VA 2F7AA 2X7PA 3DELB 4BDNA 2B65A 3MQ9A 1B5HA 4R6YA 5BUUA 3VVDA 3HO7A 3S9MC 3K6VA 1I6QA 4ZZAA 3O2AA 2O69A 3VLUA 1CE2A 3U92A 1JEUA 1BP5A 1URDA 1XVXA 1SW1A 1SQYA 2XXPA 3N26A 4FEBA 2R6GE 1FTKA 3I3VA 4GXSB 4JWOA 2P2AA 1OIBA 2A5SA 1PDAA 4OETA 4HS7A 1D3KA 5I57B 2O7IA 4DE8A 5I84A 2I6EA 4GD5A 5DEXA 4G68A 2XXVA 4P11A 4ZEKA 1OLCA 5B70A 1B3GA 2DWAA 1LBBA 1Q1KA 2DP8A 3IR1A 2XXHA 1B0LA 1Y4TA 3MZ9A 3FGSA 3L6HA 3O6IA 2ZNSA 3EQ1A 4P0GA 4HCWA 3QSLA 5AA2D 3OSQA 2AIXA 2X7QA 3H03A 3WAEA 5I59A 1ZMGA 1SVXB 5H8HB 5K2XA 2I0CA 4YKIA 3T9UA 4DZ1A 1DOTA 3VLWA 5I2KA 4QSDA 4U4XA 4U22A 2XXUA 1A8EA 1AMFA 1MS7A 2HZKA 3PU5A 4MLVA 1B3EA 1OVTA 3BKIB 3FJGA 2ZYOA 4OFOA 4ZEFA 2V84A 1RYOA 1UIVA 2R71A 1PB9A 4GFRA 1EZPA 4ZE8A 3VV5A 4FATA 3CI8A 1WDNA 2RC7A 4F31B 2G29A 1MY2A 4NWCA 3VDFA 1B5JA 4HW8A 3DP4A 3SESA 4AB5A 4L17A 2I0BA 3F11A 3KFMA 5DEXB 5IAIA 3KJ7A 4NE4A 3U94A 1LB9A 2B3FA 4OHNA 1O63A 4ZEIA 4WKMA 2GHBA 3W9WA 3U1OA 2Z8EA 3DM0A 4GXAA 1P1WA 4MH5A 4XTCQ 4BDMA 1FQFA 3PPOA 5ITPA 1B3FA 3MZBA 1GVCA 3Q27A 4PFUA 1M5EA 5CBSA 1B52A 3AXFA 3IORA 5I2NB 5ICTA 4RA1A 4FIMA 2PMSA 3FJ7A 3G3IA 3KN3A 3MBPA 4QFPA 1LSTA 1MXXA 4U1OA 4ZEBA 4ZEDA 2REGA 3S9LC 2ZNTA 1JETA 1TFAA 2QL3A 1FQEA 1TXFA 3I5OA 3H6TA 5KDTA 3M3KA 2I3VA 2XXWA 3DP6A 4F1VA 5CBRA 3KBRA 1NH8A 3V8XB 1B58A 2F5XA 2VHAA 3KSXA 3KSJA 2ONRA 3HN0A 3JV9A 1MQGA 2F78A 2GH9A 4NF8A 1AH5A 3FJMA 2RF1A 3MP6A 5IKBA 3VXCA 4I1DA 2GFEA 4IO4A 1I6BA 4U1ZA 2ZYMA 3KEIA 4U2RA 1A99A 3E4RA 3K0VA 1SYIA 3M3LA 2Z22A 3IJXB 1Y4CA 2PX1A 3C33A 1IQ7A 3T96B 4I8CA 1NNTA 3O29A 4F22A 5J1DA 3VLVA 1N76A 1YAEA 3OO6A 4N13A 2RC8A 4FEDA 1PBPA 4RYAA 4YB7A 1IITA 1QUIA 3E13X 3FIRA 4I9DA 4QHQA 5CMCA 5I56A 2QSXA 4BDQA 3PUZE 3PMXA 4TLMB 4ESXA 1MQHA 1ZKBA 3IO4A 4TLLB 5KZTA 4NMYA 1Y3QA 3OD7A 2Q2AA 3Q28A 3A3CA 2XX7A 5KCJB 2V3UA 4LQ2A 2Y84A 5L8DA 2QS2A 2XD3A 2OCUA 2F8DA 1YCJA 4IO3A 1UQWA 3Q29A 1LAHE 5FTHA 3B6TA 3TCGA 2XX8A 2DWJA 4PETA 1MM7A 2IEEA 1DTZA 1IXCA 2DQVA 5TPAA 4GWOA 1DMBA 1QULA 1J1NA 4OQOA 4Z7EA 4ISUA 1IXIA 1LBCA 1QKBA 3CR9A 3FXQA 3DLNA 2DOJA 4IGRA 1SW2A 4QRZA 5H8QB 4GIZA 4YZZA 3RT8A 3VXBA 4M4GA 1R9QA 4FJPA 1MQJA 3JZJA 1JW1A 2H98A 2F35A 4X1DA 2NWJA 4Q0CA 5H8NA 1MXVA 3VFJA 3CG1A 1MXZA 2E1SA 2F97A 3QIMA 2Q8JA 3R6UA 2V3QA 3EN3A 4OXVA 4X1BA 2XXIA 3ONMA 3QAXA 5CM6A 3MPKA 4NF5A 4KR5A 3G3FA 4Q5TA 4Q30B 1B32A 3MVZA 4H5FA 2XXTA 1B7HA 1NFTA 4H0WA 2B3BA 2ZXTA 3MUQA 2ESNA 4NWDA 3R7XA 1OQHA 1Y1MA 1GV8A 3SETA 3RTWB 2H99A 4F3GA 1BLFA 3S9NC 4F3BA 1UIUA 1SW5A 3CG3A 1GTKA 5DYHA 4F3SA 1MY3A 3OMBA 3IOUA 3K6XA 4R2BA 1LB8A 4F2OA 1H3DA 1P1UA 1A40A 2ONSA 3O9PA 2YPNA 3QUJA 5EHMA 4P0IA 5CMKA 1NNKA 2M8CA 4WEPA 4F1UA 3SEXA 2HQ0A 4TQUQ 4H8IA 1MXUA 1WODA 4IY5A 4EXKA 3IK6B 4BDOA 5DVFA 5JEIA 2HFBA 3PMVA 3FXRA 2XD2A 4QFOA 1SDXA 3OSRA 3C32A 3FUZA 4EQBA 4ZECA 2OK2A 1T0KA 1ZJLA 5FHMA 2UVJA 3G3HA 3GBBA 2AYSA 3G3GA 1PB7A 3KOSA 2DVZA 1LCFA 3FVNA 1BIYA 4OFLA 4ELQA 1Z7NE 3IB2A 3TTMA 1ATGA 3T66A 5HM4B 2X26A 5F1QA 1UTHA 4EDPA 5L9SA 3K01A 5I59B 4BDRA 3PMWA 3ECRA 5L9OA 1SW4A 2GHAA 2OWSA 1PC3A 1ZTYA 3MVYA 5EHSA 2Z8FA 3RLFE 5LOMA 3TEPA 4JB7A 4ECFA 1LFHA 2XHDA 4FECA 1B9JA 2DWHA 2ZYNA 3FATA 2XXXA 5CMMA 2QRYA 1Y3PA 1B6HA 1USYE 2F36A 5M2VA 3ILTB 1FQCA 1FTOA 1LFIA 5H8FA 1FTLA 3FD3A 4POXA 3V89B 3E9XA 4QFNA 4GQOA 1YTVA 1R1NA 4IGTA 4OESA 3RUMA 3TTRA 4DXUA 1BTJA 4KFQA 2GRVA 3CSGA 3R26A 4F29A 5A5XB 4EQ9A 1AIVA 2PVUA 2V25A 1Y1ZA 3MP8A 3IO6A 5ICQA 1MQIA 4GL0A 4RPNA 4IO7A 3FZVA 2DE3A 3M8UA 1JVXA 2VOZA 4N6PA 4YMBA 1WVJA 3MW0A 1VSOA 4H1XA 3BFUA 1M5BA 1TFDA 5F7VA 4C0RA 1A54A 1MY0A 2D5WA 1NMUA 4NTLA 4F1YA 4F39A 5AE4A 3MVXA 4LUBA 5ELVA 1EH3A 4ELRA 1B3HA 4JXIA 3HHFA 2KLFA 1VFEA 1H44A 4NEDA 3SERA 2DWIA 3PPPA 3TCFA 4LQ5A 1ZIUA 4H5GA 4DCYA 1KWHA 4BDLA 3PD8A 1TT1A 1XOCA 4KHZE 3C36A 1PBQA 2I4CA 2Y7PA 3OEKA 2CMOA 4NF6A 3T93B 5H8NB 5TP9A 3FVGA 1NL5A 5HPQA 1JW4A 1HSLA 3KZGA 1AOVA 3KGCA 4R72A 4DXBA 3GXAA 3OENA 3PUVE 1N3WA 1P1QA 3EHSA 1DTGA 2VD3A 1URGA 4LP2B 4ZDMA 2Q88A 1M5DA 4IO5A 5AA4A 1H43A 4OEVA 2E0SA 1DPPA 2G93A 3PV0E 3MVWA 4F3PA 3K1NA 4YAHX 1XHYA 1JW5A 1YPNA 4KI0E 2F7BA 3O97A 3TKDA 1VFDA 4R73A 4MFIA 2NVUB 1SYHA 4H67A 4IY6A 1JQFA 5KCJA 4XKNA 3PPNA 3B7DA 3C31A 4DIGA 5FHOA 3H4ZA 4U21A 5AA1A 2FYIA 3LSLA 3N6TA 3ODBA 4IO2A 3U93A 5DVJA 3CFXA 3RPWA 2XXYA 4NF4B 4JWYA 1H45A 3HSTA 1B7UA 1MXWA 2AL4A 1MPCA 1R9LA 4TOZA 2Z23A 3PUWE 5BWJA 1A7LA 3KJTA 5EYFA 2O6AA 1FCKA 3IL1B 1IZ1A 1FW0A 1LAGE 1MY4A 2OWTA 3LR1A 3PPQA 4G8HA 3UORA 1USYH 4QFLA 3TQWA 2Y7IA 3OO8A 3K4UA 3QXMA 3IAZA 4EF1A 4FAJA 1JVYA 1B05A 1GR2A 3K2DA 4GLIA 4ELPA 2OJTA 2FNCA 3IOTA 1LCTA 4JSDA 2UVHA 4YMAA 3RT6B 3TTNA 4DLDA 1N3XA 2RINA 4OENA 3T9VA 4O3CA 3TPAA 1ELJA 4KYEA 1B46A 3K00A 2DXRA 3H7MA 1XC1A 3N6UA 3CSBA 4GRKA 2AL5A 3IOVA 3K1MA 3QYTA 3T22A 3T9XB 4DXCA 3CFZA 1R6ZA 2DYXA 2DE4A 3BFTA 3GBAA 1QW0A 4C1TA 3O6HA 1II5A 1SI1A 3H6WA 3OXNA 2Q89A 3FVOA 1SD3A 2HXWA 1HSJA 3HV1A 3L6GA 2RCBA 4G8NA 4KYDA 5H8FB 4R6KA 3LBSA 4XKRA 3TQLA 2I49A 1GGGA 1XT8A 4ZS9A 4YKJA 4MF3A 4XXUA 2H25A 2PT2A 4OMBA 2QMXA 5H8SA 4RXLA 1F9BA 3V5AA 4KYSA 3TODA 1I69A 1MY1A 3PPRA 4F18A 5DTBA 1OMPA 2RKMA 2OLBA 3GLBA 3EF7A 2O1MA 4GVOA 3G3JA 1A55A 1N0TA 1LAFE 1P1NA 1S7YA 3LSWA 2DVCA 2A5TA 3QK6A 4PFTA 2YLNA 4RPOA 3H6UA 1OLAA 2XXRA 2NXOA 3RY3A 3HCQA 1ZU0A 4I62A 4LONB 5I58A 2YJPA 5DT6A 4H8JA 1SBPA 1JEVA 4F19A 3C34A 3P7IA 1LGBC 3KG2A 4QSEA 3VE1B 1UTBB 2RC9A 4NF6B 4RNSA 3RN8A 5AA4B 4RK2A 1LFGA 4Z0IA 1RKMA 3FV1A 2ZMBA 3JYRA 4THIA 3SEUA 2ZNUA 3OEMA 4PFWA 2HCAA 3ILUB 3KOTA 1POTA 2WKYA 4HTGA 3TCHA 2BJJX 3IOWA 4RK9A 4ONYA 1A8FA 2NUVA 4IO6A 1URSA 1UTHB 4RY1A 4EXLA 2REJA 3B6WA 4QSCA 3LSXA 3N5LA 4LVQA 3PD9A 1DSNA 1Y20A 3I6VA 4XIGQ 1AL3A 1NH7A 3E3KA 1XVYA 4JBZA 3SKPA 4JWXA 2DXYA 4EF2A 1EZOA 3SEWA 2QPQA 3MPLA 5I57A 3O66A 4G68B 4GOTA
chains in the Genus database with same CATH superfamily
4IB2A 1FPJA 3TUSA 4G77A 2DE2A 1EU8A 4NF4A 3RQTA 4F2QA 4FBPA 4YICA 3BBRA 3GZGA 4QF9A 2CZIA 1IXGA 1B51A 2Y7WA 3MSTA 4LZ5A 3KN7A 4OYVA 4OVSA 4ELQA 2O68A 3O6GA 4OVJA 3K1PA 1T0KA 4OTEA 4N4UA 1O7TA 1FQAA 4BLAA 4R9GA 4KD5A 2F7CA 2QFLA 1B1HA 3EHTA 1FBCA 4OEUA 3MWBA 2CZLA 3A09A 1INPA 1LLSA 1NV3A 3S4UA 1TWYA 1HSEA 4DI4B 3ROJA 5TU0A 4X48A 2ALUA 4G2ZA 5IZ1A 2VGQA 2RCAA 4UA8A 3FV2A 1B0HA 1QVSA 3VVEA 2O1LA 2H4IA 4XKQA 3MC2A 1UTBA 4JVIA 2Y5KA 1B4HA 2W7YA 2XX9A 4FE8A 5CMBA 5I2KB 4PE5B 3T9HB 3M3FA 5CC2A 1IMDA 2UXAA 1NUWA 1N7XA 3K02A 3USDA 4JSOA 2PYYA 2CEYA 4G8MA 3CFLA 2V93A 1Z7ME 1P1OA 3CRBA 4DCXA 4MEVA 2VP1A 4E0WA 3OO9A 4MBPA 4LA9A 1FQBA 3TTKA 4NF8B 3TZAA 4GWSA 3TDJA 4O3BA 4NF5B 2QS3A 1CB6A 1MH3A 4BDNA 3K6VA 2KR0A 4ZZAA 2O69A 3B8BA 3U92A 1KA1A 1BP5A 1URDA 2R6GE 1FSAA 5I57B 2I6EA 4G68A 2XXVA 1AWBA 2XXHA 3L6HA 5H8HB 5K2XA 4DZ1A 5I2KA 4QSDA 1MS7A 4ZEFA 2V84A 1UIVA 1EZPA 1PB9A 3CI8A 4PFBA 2G29A 1MY2A 4HW8A 4AB5A 4N8GA 2B3FA 1JP4A 4EXLA 3DM0A 4BDMA 3PPOA 1B3FA 1M5EA 5I2NB 5ICTA 2PMSA 3G3IA 3KN3A 3MBPA 4ZEBA 4ZEDA 3I5OA 3H6TA 2I3VA 3DP6A 4F1VA 3V8XB 3KSJA 3HN0A 5CRYA 1MQGA 2PFYA 1FPFA 4I1DA 2QVVA 5DW8A 2ZYMA 4U1ZA 1A99A 3E4RA 4GX3A 3M3LA 1SYIA 2Z22A 2PX1A 3C33A 5J1DA 4N8YA 4FEDA 4BDQA 4OVPA 3IO4A 5KZTA 3OD7A 2V3UA 2Y84A 2WYKA 3Q29A 4GWXA 4PETA 5TPAA 1IXCA 4GWOA 1J1NA 1IXIA 5H8QB 3CR9A 3DLNA 1SW2A 3VXBA 4NF0A 2ZZXA 3LUZA 1MQJA 4Q0CA 1FTAA 2V3QA 3EN3A 4LN5A 4OXVA 2XXIA 3QAXA 4KR5A 3G3FA 4Q5TA 1B32A 3MVZA 2FBPA 2XXTA 2ESNA 1OQHA 1GV8A 1LBZA 2H99A 3S9NC 2WEFA 2ONSA 3O9PA 5EHMA 2M8CA 3SEXA 2HQ0A 4IY5A 3IK6B 5DVFA 2HFBA 2XD2A 1XI6A 3C32A 2QVUA 3GBBA 3KOSA 3FVNA 4OFLA 5HM4B 1ATGA 5I59B 4NGUA 2GHAA 1FJ9A 2MKZA 1NI9A 1K9ZA 4FECA 2DWHA 2XWVA 3IFAA 5CMMA 1Y3PA 1USYE 3ILTB 5H8FA 4POXA 3RUMA 4MX6A 5A5XB 5ISUA 2V25A 1Y1ZA 1FPDA 4P3LA 1FBDA 4C0RA 2PFZA 1TFDA 1MY0A 4NTLA 1NMUA 1EH3A 2KLFA 1H44A 4H5GA 1KWHA 1XOCA 3C36A 4GBWA 4I3EA 5H8NB 3T93B 2XWIA 3KZGA 4R72A 3OENA 4ZDMA 1DTGA 2Q88A 1M5DA 2G93A 1YPNA 3T1BA 5ET6A 4U21A 3N6TA 3ODBA 3RPWA 1B7UA 1MXWA 2AL4A 3PUWE 2O6AA 1MY4A 3LR1A 1USYH 4P47A 2Y7IA 3TQWA 3IAZA 1GR2A 3IOTA 4YMAA 4OENA 3T9VA 3TPAA 1DCUA 3K00A 4GRKA 3K1MA 3CFZA 4N17A 3GBAA 1QW0A 4C1TA 3O6HA 3OXNA 3H6WA 1SD3A 5H8FB 3HV1A 2RCBA 4MF3A 5EQAA 4XXUA 1F9BA 2CZHA 3TODA 1I69A 2RKMA 1NV1A 1A55A 1LAFE 1P1NA 3RGYA 3QK6A 2KQZA 2A5TA 1OLAA 1LBXA 5I58A 4F19A 1LGBC 5EQ7A 3VE1B 1UTBB 2RC9A 4Z0IA 3JYRA 3SEUA 4PFWA 3ILUB 4HTGA 4ONYA 1A8FA 1URSA 1FRPA 2XWKA 4QSCA 1YZ0A 3N5LA 4LVQA 1DSNA 3I6VA 4XIGQ 4NHBA 1EZOA 3SEWA 3IB0A 2PBWA 3A3UA 4RJZA 5FHNA 3WAFA 3KN8A 4P56A 4PCDA 4R2FA 1LBWA 3UGWA 2V3TA 1Y3NA 3SEYA 2F3DA 4OZ9A 2UYFA 5IAIA 4F18A 2D21A 4G68C 4RPOA 2O51A 2NWJA 3O28A 1B2HA 4OERA 2HEUA 1MH4A 1IIWA 1N84A 1D9VA 3Q25A 4GWYA 1B4ZA 3TFLA 1DPEA 3RYDA 4GWUA 1FTMA 3TELA 3LSFB 2H5YA 2BJIA 2ONKE 5AA2B 4GWWA 1EZ9A 4M1VA 3IB1A 5DVIA 3DP8A 4N07A 3EHUA 4PAIA 3B6QA 4OWDA 2HXRA 2Q2CA 4E0XA 5I2NA 3UIFA 3CVGA 3RNNA 4LATA 3THIA 2UVGA 4P1LA 2P3NA 2Y7RA 3UN6A 2QVRA 1MM6A 1LAXA 2LAOA 2XXQA 3LC8A 4AS5A 3B50A 4EQ7A 5JK4A 1NUYA 4EUOA 3UP9A 3MP1A 1B5IA 2I4BA 1IXHA 5L9MA 2OBGA 5FTIA 1QJMA 1NUXA 4QFKA 2NOOA 1VE4A 1B40A 1S50A 1Y9UA 2QMWA 3FXUA 2P1SA 3SDFA 1SPIA 4I40A 1DBZA 3UK4A 2R8TA 4YB6A 2P0SA 4PFYA 3S2VA 2F7AA 1FBEA 2B65A 3MQ9A 1B5HA 5ET7A 1I6QA 3VLUA 3O2AA 4MCOA 1JEUA 1SW1A 1SQYA 3I3VA 3SZPA 1PDAA 4OETA 4GD5A 4NQ8A 5DEXA 4P11A 4ZEKA 2DWAA 3IR1A 1B0LA 4P0GA 4HCWA 4PDDA 2AIXA 2X7QA 4H45A 3WAEA 4N81A 4PGPA 4MNPA 4P9KA 1FBFA 4PFIA 3PU5A 3BKIB 3FJGA 4OFOA 1RYOA 4ZE8A 4F31B 3BIHA 4NWCA 2I0BA 3U94A 1LB9A 3KBZA 1RDYA 4OHNA 1O63A 4WKMA 2GHBA 1BK4A 2Z8EA 3GYYA 5IZ3A 3MZBA 1B52A 4FIMA 3FJ7A 3S9LC 4U1OA 2REGA 2ZNTA 1TFAA 1FQEA 5CBRA 3KBRA 2VHAA 2F78A 2GH9A 3MP6A 4GX6A 5EQ9A 2GFEA 4IO4A 4U2RA 3K0VA 3IJXB 3ISPA 1FBGA 1IQ7A 3T96B 1YAEA 4RYAA 3RT6B 2RC8A 1PBPA 1IITA 3E13X 3FIRA 4QHQA 4JVDA 2QSXA 1Y3QA 2Q2AA 2XX7A 5L8DA 4NN3A 4IO3A 4UABA 2F8DA 2DWJA 1MM7A 2IEEA 1QULA 4IGRA 1LBCA 1QKBA 1LBVA 4QRZA 4PF6A 4M4GA 1R9QA 3JZJA 4OVTA 5H8NA 3VFJA 1MXZA 2E1SA 2Q74A 5CM6A 4H5FA 4H0WA 2B3BA 2ZXTA 3MUQA 3SETA 4F3GA 4F3BA 1GTKA 1YYZA 4F2OA 1H3DA 1P1UA 3QUJA 3KC0A 4TQUQ 1MXUA 1WODA 1Q9DA 4EXKA 5IGAA 4ZECA 1NV4A 2Y5LA 1LCFA 3TTMA 5L9SA 1UTHA 5L9OA 2OWSA 3RLFE 2VPNA 5LOMA 3TEPA 2Z8FA 2XHDA 2F36A 5M2VA 1LFIA 3FD3A 4OESA 2GRVA 3CSGA 4QXDA 1D9QA 1MQIA 4GL0A 4IO7A 3FZVA 2DE3A 1JVXA 4OVQA 4N6PA 1WVJA 4H1XA 1VSOA 4N6KA 4IR8A 3MVXA 1FPKA 5ELVA 4ELRA 1B3HA 4JXIA 3HHFA 4NEDA 2DWIA 4DCYA 1ZIUA 3PD8A 1TT1A 4JVCA 3A29A 3KGCA 3PUVE 1N3WA 1URGA 1H43A 2E0SA 4MNCA 1DPPA 4F3PA 4YAHX 1JW5A 2F7BA 3TKDA 3LV0A 2NVUB 2HPGA 4XKNA 3PPNA 3B7DA 4DIGA 3H4ZA 1EYJA 3LSLA 4IO2A 3U93A 5DVJA 4JWYA 1H45A 3HSTA 1R9LA 1DK4A 1A7LA 1FCKA 3PPQA 4G8HA 4QFLA 3K4UA 1JVYA 3K2DA 4GLIA 4ELPA 1LCTA 3TTNA 1N3XA 1ELJA 1KA0A 4KYEA 1B46A 3H7MA 3N6UA 3CSBA 4HE2A 3T22A 4DXCA 4MAGA 1R6ZA 3BFTA 3L6GA 3VLWA 2HXWA 4G8NA 1NV6A 1GGGA 4ZS9A 4OMBA 2QMXA 5H8SA 3V5AA 2OLBA 3GLBA 4GVOA 1IMBA 1S7YA 1N0TA 3LSWA 1ZU0A 1G0IA 4I62A 4LONB 4MNIA 1SBPA 1JEVA 4H46A 3P7IA 4QSEA 4RK2A 1LFGA 3FV1A 2ZMBA 2ZNUA 3OEMA 3KOTA 2WKYA 4RY1A 2REJA 3LSXA 1AL3A 1XVYA 4JWXA 2DXYA 5I57A 2VPOA 2A5TB 3HFUA 5B7DA 4O94A 1H76A 3VVFA 5A5XA 1S9TA 1OVBA 4LZ8A 5A5LA 1IEJA 4KCCA 4R6HA 4Q8RA 1ZLQA 5TP9B 4PTKA 1N04A 2ZYKA 1JNFA 3OELA 4HE0A 5JTYA 3LUYA 4UACA 2ANJA 4H65A 4U4SA 3RPLA 4PP0A 2FVZA 3Q26A 4GF8A 2UVIA 3IJOB 4XKPA 1BKAA 3D4CA 3W15C 2F6PA 1M5FA 4HCYA 2I3WA 5ITOA 4POWA 1PB8A 3C4MA 4P1EA 1QUJA 3UA8A 3C35A 1MRPA 3MAMA 4KQPA 1US4A 3ZS6A 4OFJA 3QUFA 1OQGA 2P3VA 2QS1A 2Q9TA 3H06B 3IX1A 2O84X 4ESWA 3K6WA 4O3AA 1L5TA 4YKKA 2O7UA 4HXVA 4O7IA 2ABHA 3U8QA 5I56B 4H6DA 1FBHA 2THIA 2DS9A 5TPAB 1NNFA 3G3KA 3U72A 4DDDA 1QKAA 3N94A 3TAJA 3OO7A 5F24A 4PAFA 2HAUA 5FBPA 3MJNA 1FQDA 5ET5A 3TTLA 2I58A 5I58B 1IMCA 4YKPA 3FASA 1M5CA 2PCRA 5AA2A 2Y7KA 2Q8MA 1Q35A 1P99A 1FPLA 3DELB 2X7PA 4R6YA 4GWZA 3VVDA 3HO7A 1CE2A 2XXPA 4FEBA 3N26A 4XEQA 4GXSB 2A5SA 1D3KA 5I84A 1OLCA 1B3GA 1Q1KA 3MZ9A 2ZNSA 3EQ1A 1NV7A 4PGNA 5AA2D 3OSQA 3H03A 5I59A 2I0CA 3T9UA 1DOTA 4U4XA 1AMFA 2HZKA 1OVTA 2ZYOA 4MMPA 2R71A 3VV5A 4FATA 3VDFA 2JJKA 4L17A 3F11A 3KFMA 3KJ7A 4NE4A 4ZEIA 3U1OA 4GXAA 1P1WA 4XTCQ 1FQFA 1GVCA 4NAPA 5EYHA 4PFUA 5CBSA 3AXFA 4QFPA 1LSTA 1JETA 3M3KA 2XXWA 4NG7A 3JV9A 5IKBA 4NF8A 1AH5A 3VXCA 5I3SA 4XF5A 1Y4CA 1NNTA 3O29A 3VLVA 4N13A 3ZKKA 3NOHA 4YB7A 5CMCA 1FJ6A 4TLLB 4NMYA 3Q28A 3A3CA 5T3JA 2XD3A 2OCUA 1YCJA 4N15A 3TCGA 5FTHA 1DMBA 4OQOA 4ISUA 1FPBA 2ZZVA 3RT8A 3E79A 4YZZA 4FJPA 4N6DA 2H98A 2F35A 3BIGA 2Q8JA 3R6UA 3MYUA 3ONMA 4NF5A 4Q30B 1B7HA 4NWDA 3R7XA 2VT5A 3RTWB 1BLFA 1UIUA 1SW5A 4F3SA 1MY3A 3OMBA 1LB8A 1A40A 4O8MA 4G61A 4F1UA 4H8IA 4HE1A 4OA4A 4EQBA 1ZJLA 3G3GA 1PB7A 2DVZA 1BIYA 3IB2A 2X26A 5F1QA 4EDPA 3K01A 3ECRA 1SW4A 1ZTYA 5EHSA 4JB7A 1B9JA 3FXBA 3FBPA 1YTVA 1R1NA 1BTJA 4MHFA 3R26A 4PAKA 4EQ9A 1AIVA 5ICQA 3IO6A 4RPNA 3M8UA 1M5BA 5F7VA 4F39A 2WYPA 1LBYA 4PE3A 2WBBA 3SERA 3PPPA 4PFRA 4BDLA 4KHZE 5EQ8A 3OEKA 2Y7PA 5TP9A 3FVGA 1NL5A 3E78A 1P1QA 3EHSA 2VD3A 4LP2B 5AA4A 3PV0E 3MVWA 3K1NA 4KI0E 3EKIA 3O97A 1VFDA 4R73A 4H67A 4IY6A 1JQFA 5KCJA 3C31A 4X04A 5FHOA 3CFXA 2XXYA 4PBHA 2Z23A 3KC1A 5EYFA 1VDWA 3KJTA 1YXIA 1IZ1A 2OWTA 3UORA 3OO8A 3QXMA 3RPLB 2FNCA 2UVHA 1LEVA 4DLDA 1XC1A 2AL5A 3QYTA 2ZZWA 1II5A 1SI1A 4DXBA 2Q89A 3FVOA 4AQ4A 4KYDA 2DDKA 3TQLA 1G0HA 1XT8A 2H25A 4RXLA 4NX1A 4KYSA 5DTBA 3EF7A 2OX3A 4PFTA 2XA5A 2FHYA 3RY3A 4H8JA 3KG2A 4NF6B 3RN8A 1FBPA 1K9YA 2HCAA 1POTA 4QBAA 4PDHA 2NUVA 1UTHB 3B6WA 4I3YA 1Y20A 1NH7A 3SKPA 3MPLA 3O66A 4G68B 4GOTA 5HBCA 1NV2A 1NNPA 4YU0A 3C9HA 2F34A 3D4GA 1XS5A 2DSFA 1MPDA 4JDFA 1MDQA 5AA3A 3W9VA 4ELOA 2HZLA 3RTFB 3HHGA 3S9EA 4ZZEA 2R9JA 3V83A 1QGXA 4R9FA 5H8HA 4R74A 5IM2A 1MG1A 3PTYA 4PBQA 4EF2A 2Z8DA 4FORA 4PQJA 1VR5A 4YB5A 1I6AA 3ZKLA 4KCDA 4X8RA 2XXKA 4K3FA 1SI0A 1ZBMA 4ZE9A 2CZKA 4GL8A 1MXYA 2IA4A 3PUYE 3FVKA 5IZ3B 3OOAA 1US5A 1POY1 1MDP1 4MJOA 1B1XA 1EYIA 3K6UA 1IUDA 1QUKA 1NKXA 3PGFA 4O7MA 4WXJA 5ESYA 2QJEA 4AB6A 5JTYB 1MPBA 1N7WA 1D9YA 4R75A 3EPEA 4XFEA 1MQDA 3HPIA 4ND9A 4KPTA 4U23A 3TMGA 3MZ1A 4MLQA 1D4NA 3PUXE 4X9TA 4WEDA 5CI5A 5K2YA 1B7ZA 4C1UA 4PF8A 1ANFA 1FTJA 4DI3D 2OZZA 1PEBA 2FA7A 4G4PA 3SEVA 3CIJA 2F6GA 2B4MA 3TYHA 3H3GA 5H8QA 2VD2A 2UYEA 2HAVA 3G7WA 1FPIA 2PT1A 3H6VA 2HHMA 5IZZA 5KDTB 1O64A 2D3IA 4LZ7A 1B3LA 1RYXA 2QS4A 2H9BA 2I48A 2F3BA 5BUUA 2B4LA 1XVXA 1RDXA 1FTKA 4JWOA 2P2AA 1OIBA 4HS7A 2O7IA 4DE8A 5B70A 1LBBA 2DP8A 1Y4TA 5I5PA 3FGSA 3O6IA 3QSLA 1ZMGA 1SVXB 4YKIA 2GQ1A 4U22A 2XXUA 1A8EA 4MLVA 1B3EA 4GFRA 1WDNA 2RC7A 1B5JA 3DP4A 3SESA 5DEXB 3QMFA 3W9WA 1NUZA 5ITPA 4MH5A 3Q27A 5ET8A 1EYKA 3IORA 4RA1A 1MXXA 2QL3A 5LTCA 1TXFA 5KDTA 4AS4A 1NH8A 1B58A 2F5XA 3KSXA 3U65A 2ONRA 3FJMA 2RF1A 1I6BA 3KEIA 4KXPA 4OANA 1FPEA 3D1RA 4I8CA 4F22A 1N76A 3OO6A 1QUIA 4I9DA 5I56A 3PUZE 3PMXA 4TLMB 4ESXA 1MQHA 1ZKBA 5KCJB 4LQ2A 2QS2A 1IMEA 1UQWA 1LAHE 3B6TA 2XX8A 1DTZA 2DQVA 4GBVA 4Z7EA 3FXQA 2DOJA 4GIZA 1JW1A 4X1DA 1MXVA 3CG1A 2F97A 3QIMA 4X1BA 3MPKA 1IMFA 1NFTA 4PC9A 2V4CA 1Y1MA 3CG3A 5DYHA 3IOUA 3K6XA 4R2BA 2YPNA 4P0IA 5CMKA 1NNKA 4WEPA 4BDOA 5JEIA 3PMVA 3FXRA 4QFOA 1SDXA 4P8BA 3OSRA 3FUZA 2OK2A 5FHMA 2UVJA 3CHGA 3G3HA 2AYSA 1Z7NE 3T66A 4BDRA 3PMWA 3S9MC 3MVYA 1PC3A 4ECFA 1LFHA 2ZYNA 3FATA 1FPGA 2XXXA 2QRYA 1B6HA 1FQCA 1FTOA 1FTLA 3V89B 3E9XA 4QFNA 4GQOA 1CNQA 3TTRA 4IGTA 4DXUA 1RDZA 4KFQA 4F29A 3T0JA 2PVUA 3MP8A 2VOZA 4YMBA 3MW0A 3BFUA 2WBDA 1A54A 2D5WA 5AE4A 4LUBA 1NV5A 1VFEA 3TCFA 4LQ5A 4GX4A 2CEXA 1PBQA 2I4CA 2CMOA 4NF6A 2OWZA 1JW4A 5HPQA 1HSLA 1AOVA 3GXAA 4IO5A 4OEVA 1XHYA 2FIXA 4MFIA 1SYHA 2L5VA 5AA1A 2FYIA 4MIJA 4NF4B 4TOZA 1MPCA 5BWJA 3IL1B 1FW0A 1LAGE 4EF1A 4FAJA 1B05A 4OVRA 2OJTA 4JSDA 2RINA 4O3CA 2DXRA 3T9XB 5I7IA 3IOVA 2DYXA 2DE4A 5EYGA 1HSJA 1IMAA 4R6KA 3LBSA 4XKRA 2I49A 1NV0A 4YKJA 2FIEA 2PT2A 1MY1A 3PPRA 1OMPA 2O1MA 3G3JA 4N91A 2DVCA 3ZSFA 2YLNA 3H6UA 2XXRA 2NXOA 3HCQA 5J16A 2YJPA 5DT6A 5LDZA 1KZ8A 3C34A 3IFCA 4RNSA 5AA4B 1RKMA 4THIA 3TCHA 2BJJX 3IOWA 4RK9A 4IO6A 2XWOA 3PD9A 3E3KA 4JBZA 2QPQA 4F1YA 2WX9A
chains in the Genus database with same CATH topology
5HBCA 1NNPA 3IB0A 4IB2A 4YU0A 3C9HA 3ZSFA 2F34A 2PBWA 3A3UA 3TUSA 3D4GA 1XS5A 2A5TB 2DSFA 1MPDA 4JDFA 1MDQA 4RJZA 3W9VA 4G77A 4ELOA 2DE2A 1EU8A 2HZLA 4NF4A 3RQTA 4F2QA 5B7DA 5FHNA 3RTFB 3WAFA 3KN8A 3HHGA 4YICA 3S9EA 3BBRA 4ZZEA 1H76A 2R9JA 3VVFA 3GZGA 4QF9A 5A5XA 4R2FA 3V83A 1S9TA 4R9FA 3RGYA 1OVBA 4LZ8A 1IXGA 3UGWA 5AA3A 1IEJA 5H8HA 1B51A 4R74A 2V3TA 4KCCA 2Y7WA 4LZ5A 1Y3NA 4R6HA 3SEYA 4Q8RA 3KN7A 4OYVA 1MG1A 5ISUA 1ZLQA 5TP9B 2O68A 1N04A 2UYFA 3O6GA 3K1PA 4OVJA 4OZ9A 2ZYKA 2D21A 1JNFA 4G68C 3OELA 2O51A 4OTEA 2Z8DA 3O28A 1B2HA 4FORA 4PQJA 1O7TA 3LUYA 1FQAA 1VR5A 2ANJA 4UACA 4H65A 4U4SA 4YB5A 1I6AA 3ZKLA 4PP0A 4BLAA 4KCDA 3Q26A 4OERA 2HEUA 1MH4A 4KD5A 4R9GA 1IIWA 1N84A 2F7CA 4GF8A 1B1HA 3EHTA 2UVIA 1SI0A 1ZBMA 4K3FA 4ZE9A 3IJOB 1D9VA 3Q25A 4GL8A 4XKPA 4OEUA 1B4ZA 1BKAA 3TFLA 1MXYA 3D4CA 3W15C 1DPEA 3MWBA 1FTMA 3TELA 2F6PA 2CZLA 2IA4A 3LSFB 3PUYE 3A09A 1M5FA 2H5YA 2ONKE 3FVKA 4HCYA 5AA2B 2I3WA 5ITOA 5JTYA 3OOAA 4POWA 1EZ9A 1US5A 1LLSA 3IB1A 1POY1 4M1VA 1PB8A 1MDP1 3C4MA 1B1XA 1QUJA 3K6UA 3S4UA 1IUDA 1TWYA 5DVIA 1HSEA 3UA8A 3C35A 1MRPA 3MAMA 4KQPA 5TU0A 1US4A 1QUKA 3DP8A 3ZS6A 4X48A 4N07A 2ALUA 4OFJA 1NKXA 3EHUA 3PGFA 3QUFA 4G2ZA 4WXJA 1OQGA 3B6QA 2VGQA 4OWDA 2QJEA 4AB6A 2RCAA 2Q2CA 4UA8A 3FV2A 1B0HA 1QVSA 5JTYB 3VVEA 4E0XA 2O1LA 5I2NA 1MPBA 2QS1A 3UIFA 2H4IA 4XKQA 1N7WA 4AQ4A 2Q9TA 3CVGA 1D9YA 1UTBA 3H06B 3IX1A 3MC2A 4R75A 2O84X 3RNNA 3EPEA 4LATA 4ESWA 3THIA 3K6WA 1MQDA 2UVGA 3HPIA 4ND9A 1B4HA 4O3AA 2Y7RA 2W7YA 3UN6A 4KPTA 2XX9A 1L5TA 4FE8A 1MM6A 1LAXA 2LAOA 4U23A 3MZ1A 4MLQA 5CMBA 5I2KB 3TMGA 1D4NA 4YKKA 2O7UA 3PUXE 4X9TA 2XXQA 4WEDA 2ABHA 5CI5A 4PE5B 3LC8A 3T9HB 3U8QA 3M3FA 5K2YA 4EQ7A 5CC2A 1B7ZA 5I56B 4C1UA 5JK4A 2UXAA 4H6DA 1ANFA 2THIA 1FTJA 4EUOA 3UP9A 3MP1A 5CRYA 1B5IA 2DS9A 5TPAB 1NNFA 2OZZA 1N7XA 2I4BA 3K02A 1IXHA 3G3KA 5L9MA 3USDA 1PEBA 2OBGA 4JSOA 3U72A 2FA7A 4G4PA 5FTIA 1QJMA 2PYYA 4G8MA 3SEVA 3CFLA 4QFKA 2V93A 3CIJA 4DDDA 1QKAA 2F6GA 1Z7ME 1P1OA 2NOOA 3TYHA 3CRBA 3H3GA 3N94A 5H8QA 1VE4A 4DCXA 3TAJA 2VD2A 2VP1A 3OO7A 4E0WA 2UYEA 3OO9A 4MBPA 2HAVA 2HAUA 1B40A 1S50A 2PT1A 3G7WA 3H6VA 3MJNA 1Y9UA 1FQDA 2QMWA 1FQBA 4LA9A 3FXUA 2P1SA 3SDFA 3TTKA 5KDTB 4NF8B 3TTLA 3TZAA 1O64A 2I58A 5I58B 4YKPA 3TDJA 2D3IA 3FASA 4LZ7A 4O3BA 1M5CA 1B3LA 1RYXA 3UK4A 3ZKKA 4NF5B 2QS4A 2QS3A 4YB6A 2H9BA 5AA2A 2P0SA 4PFYA 2I48A 2Y7KA 1CB6A 1MH3A 1P99A 1Q35A 3S2VA 2F7AA 2X7PA 3DELB 4BDNA 2B65A 3MQ9A 1B5HA 4R6YA 5BUUA 3VVDA 3HO7A 3S9MC 3K6VA 1I6QA 4ZZAA 3O2AA 2O69A 3VLUA 1CE2A 3U92A 1JEUA 1BP5A 1URDA 1XVXA 1SW1A 1SQYA 2XXPA 3N26A 4FEBA 2R6GE 1FTKA 3I3VA 4GXSB 4JWOA 2P2AA 1OIBA 2A5SA 1PDAA 4OETA 4HS7A 1D3KA 5I57B 2O7IA 4DE8A 5I84A 2I6EA 4GD5A 5DEXA 4G68A 2XXVA 4P11A 4ZEKA 1OLCA 5B70A 1B3GA 2DWAA 1LBBA 1Q1KA 2DP8A 3IR1A 2XXHA 1B0LA 1Y4TA 3MZ9A 3FGSA 3L6HA 3O6IA 2ZNSA 3EQ1A 4P0GA 4HCWA 3QSLA 5AA2D 3OSQA 2AIXA 2X7QA 3H03A 3WAEA 5I59A 1ZMGA 1SVXB 5H8HB 5K2XA 2I0CA 4YKIA 3T9UA 4DZ1A 1DOTA 3VLWA 5I2KA 4QSDA 4U4XA 4U22A 2XXUA 1A8EA 1AMFA 1MS7A 2HZKA 3PU5A 4MLVA 1B3EA 1OVTA 3BKIB 3FJGA 2ZYOA 4OFOA 4ZEFA 2V84A 1RYOA 1UIVA 2R71A 1PB9A 4GFRA 1EZPA 4ZE8A 3VV5A 4FATA 3CI8A 1WDNA 2RC7A 4F31B 2G29A 1MY2A 4NWCA 3VDFA 1B5JA 4HW8A 3DP4A 3SESA 4AB5A 4L17A 2I0BA 3F11A 3KFMA 5DEXB 5IAIA 3KJ7A 4NE4A 3U94A 1LB9A 2B3FA 4OHNA 1O63A 4ZEIA 4WKMA 2GHBA 3W9WA 3U1OA 2Z8EA 3DM0A 4GXAA 1P1WA 4MH5A 4XTCQ 4BDMA 1FQFA 3PPOA 5ITPA 1B3FA 3MZBA 1GVCA 3Q27A 4PFUA 1M5EA 5CBSA 1B52A 3AXFA 3IORA 5I2NB 5ICTA 4RA1A 4FIMA 2PMSA 3FJ7A 3G3IA 3KN3A 3MBPA 4QFPA 1LSTA 1MXXA 4U1OA 4ZEBA 4ZEDA 2REGA 3S9LC 2ZNTA 1JETA 1TFAA 2QL3A 1FQEA 1TXFA 3I5OA 3H6TA 5KDTA 3M3KA 2I3VA 2XXWA 3DP6A 4F1VA 5CBRA 3KBRA 1NH8A 3V8XB 1B58A 2F5XA 2VHAA 3KSXA 3KSJA 2ONRA 3HN0A 3JV9A 1MQGA 2F78A 2GH9A 4NF8A 1AH5A 3FJMA 2RF1A 3MP6A 5IKBA 3VXCA 4I1DA 2GFEA 4IO4A 1I6BA 4U1ZA 2ZYMA 3KEIA 4U2RA 1A99A 3E4RA 3K0VA 1SYIA 3M3LA 2Z22A 3IJXB 1Y4CA 2PX1A 3C33A 1IQ7A 3T96B 4I8CA 1NNTA 3O29A 4F22A 5J1DA 3VLVA 1N76A 1YAEA 3OO6A 4N13A 2RC8A 4FEDA 1PBPA 4RYAA 4YB7A 1IITA 1QUIA 3E13X 3FIRA 4I9DA 4QHQA 5CMCA 5I56A 2QSXA 4BDQA 3PUZE 3PMXA 4TLMB 4ESXA 1MQHA 1ZKBA 3IO4A 4TLLB 5KZTA 4NMYA 1Y3QA 3OD7A 2Q2AA 3Q28A 3A3CA 2XX7A 5KCJB 2V3UA 4LQ2A 2Y84A 5L8DA 2QS2A 2XD3A 2OCUA 2F8DA 1YCJA 4IO3A 1UQWA 3Q29A 1LAHE 5FTHA 3B6TA 3TCGA 2XX8A 2DWJA 4PETA 1MM7A 2IEEA 1DTZA 1IXCA 2DQVA 5TPAA 4GWOA 1DMBA 1QULA 1J1NA 4OQOA 4Z7EA 4ISUA 1IXIA 1LBCA 1QKBA 3CR9A 3FXQA 3DLNA 2DOJA 4IGRA 1SW2A 4QRZA 5H8QB 4GIZA 4YZZA 3RT8A 3VXBA 4M4GA 1R9QA 4FJPA 1MQJA 3JZJA 1JW1A 2H98A 2F35A 4X1DA 2NWJA 4Q0CA 5H8NA 1MXVA 3VFJA 3CG1A 1MXZA 2E1SA 2F97A 3QIMA 2Q8JA 3R6UA 2V3QA 3EN3A 4OXVA 4X1BA 2XXIA 3ONMA 3QAXA 5CM6A 3MPKA 4NF5A 4KR5A 3G3FA 4Q5TA 4Q30B 1B32A 3MVZA 4H5FA 2XXTA 1B7HA 1NFTA 4H0WA 2B3BA 2ZXTA 3MUQA 2ESNA 4NWDA 3R7XA 1OQHA 1Y1MA 1GV8A 3SETA 3RTWB 2H99A 4F3GA 1BLFA 3S9NC 4F3BA 1UIUA 1SW5A 3CG3A 1GTKA 5DYHA 4F3SA 1MY3A 3OMBA 3IOUA 3K6XA 4R2BA 1LB8A 4F2OA 1H3DA 1P1UA 1A40A 2ONSA 3O9PA 2YPNA 3QUJA 5EHMA 4P0IA 5CMKA 1NNKA 2M8CA 4WEPA 4F1UA 3SEXA 2HQ0A 4TQUQ 4H8IA 1MXUA 1WODA 4IY5A 4EXKA 3IK6B 4BDOA 5DVFA 5JEIA 2HFBA 3PMVA 3FXRA 2XD2A 4QFOA 1SDXA 3OSRA 3C32A 3FUZA 4EQBA 4ZECA 2OK2A 1T0KA 1ZJLA 5FHMA 2UVJA 3G3HA 3GBBA 2AYSA 3G3GA 1PB7A 3KOSA 2DVZA 1LCFA 3FVNA 1BIYA 4OFLA 4ELQA 1Z7NE 3IB2A 3TTMA 1ATGA 3T66A 5HM4B 2X26A 5F1QA 1UTHA 4EDPA 5L9SA 3K01A 5I59B 4BDRA 3PMWA 3ECRA 5L9OA 1SW4A 2GHAA 2OWSA 1PC3A 1ZTYA 3MVYA 5EHSA 2Z8FA 3RLFE 5LOMA 3TEPA 4JB7A 4ECFA 1LFHA 2XHDA 4FECA 1B9JA 2DWHA 2ZYNA 3FATA 2XXXA 5CMMA 2QRYA 1Y3PA 1B6HA 1USYE 2F36A 5M2VA 3ILTB 1FQCA 1FTOA 1LFIA 5H8FA 1FTLA 3FD3A 4POXA 3V89B 3E9XA 4QFNA 4GQOA 1YTVA 1R1NA 4IGTA 4OESA 3RUMA 3TTRA 4DXUA 1BTJA 4KFQA 2GRVA 3CSGA 3R26A 4F29A 5A5XB 4EQ9A 1AIVA 2PVUA 2V25A 1Y1ZA 3MP8A 3IO6A 5ICQA 1MQIA 4GL0A 4RPNA 4IO7A 3FZVA 2DE3A 3M8UA 1JVXA 2VOZA 4N6PA 4YMBA 1WVJA 3MW0A 1VSOA 4H1XA 3BFUA 1M5BA 1TFDA 5F7VA 4C0RA 1A54A 1MY0A 2D5WA 1NMUA 4NTLA 4F1YA 4F39A 5AE4A 3MVXA 4LUBA 5ELVA 1EH3A 4ELRA 1B3HA 4JXIA 3HHFA 2KLFA 1VFEA 1H44A 4NEDA 3SERA 2DWIA 3PPPA 3TCFA 4LQ5A 1ZIUA 4H5GA 4DCYA 1KWHA 4BDLA 3PD8A 1TT1A 1XOCA 4KHZE 3C36A 1PBQA 2I4CA 2Y7PA 3OEKA 2CMOA 4NF6A 3T93B 5H8NB 5TP9A 3FVGA 1NL5A 5HPQA 1JW4A 1HSLA 3KZGA 1AOVA 3KGCA 4R72A 4DXBA 3GXAA 3OENA 3PUVE 1N3WA 1P1QA 3EHSA 1DTGA 2VD3A 1URGA 4LP2B 4ZDMA 2Q88A 1M5DA 4IO5A 5AA4A 1H43A 4OEVA 2E0SA 1DPPA 2G93A 3PV0E 3MVWA 4F3PA 3K1NA 4YAHX 1XHYA 1JW5A 1YPNA 4KI0E 2F7BA 3O97A 3TKDA 1VFDA 4R73A 4MFIA 2NVUB 1SYHA 4H67A 4IY6A 1JQFA 5KCJA 4XKNA 3PPNA 3B7DA 3C31A 4DIGA 5FHOA 3H4ZA 4U21A 5AA1A 2FYIA 3LSLA 3N6TA 3ODBA 4IO2A 3U93A 5DVJA 3CFXA 3RPWA 2XXYA 4NF4B 4JWYA 1H45A 3HSTA 1B7UA 1MXWA 2AL4A 1MPCA 1R9LA 4TOZA 2Z23A 3PUWE 5BWJA 1A7LA 3KJTA 5EYFA 2O6AA 1FCKA 3IL1B 1IZ1A 1FW0A 1LAGE 1MY4A 2OWTA 3LR1A 3PPQA 4G8HA 3UORA 1USYH 4QFLA 3TQWA 2Y7IA 3OO8A 3K4UA 3QXMA 3IAZA 4EF1A 4FAJA 1JVYA 1B05A 1GR2A 3K2DA 4GLIA 4ELPA 2OJTA 2FNCA 3IOTA 1LCTA 4JSDA 2UVHA 4YMAA 3RT6B 3TTNA 4DLDA 1N3XA 2RINA 4OENA 3T9VA 4O3CA 3TPAA 1ELJA 4KYEA 1B46A 3K00A 2DXRA 3H7MA 1XC1A 3N6UA 3CSBA 4GRKA 2AL5A 3IOVA 3K1MA 3QYTA 3T22A 3T9XB 4DXCA 3CFZA 1R6ZA 2DYXA 2DE4A 3BFTA 3GBAA 1QW0A 4C1TA 3O6HA 1II5A 1SI1A 3H6WA 3OXNA 2Q89A 3FVOA 1SD3A 2HXWA 1HSJA 3HV1A 3L6GA 2RCBA 4G8NA 4KYDA 5H8FB 4R6KA 3LBSA 4XKRA 3TQLA 2I49A 1GGGA 1XT8A 4ZS9A 4YKJA 4MF3A 4XXUA 2H25A 2PT2A 4OMBA 2QMXA 5H8SA 4RXLA 1F9BA 3V5AA 4KYSA 3TODA 1I69A 1MY1A 3PPRA 4F18A 5DTBA 1OMPA 2RKMA 2OLBA 3GLBA 3EF7A 2O1MA 4GVOA 3G3JA 1A55A 1N0TA 1LAFE 1P1NA 1S7YA 3LSWA 2DVCA 2A5TA 3QK6A 4PFTA 2YLNA 4RPOA 3H6UA 1OLAA 2XXRA 2NXOA 3RY3A 3HCQA 1ZU0A 4I62A 4LONB 5I58A 2YJPA 5DT6A 4H8JA 1SBPA 1JEVA 4F19A 3C34A 3P7IA 1LGBC 3KG2A 4QSEA 3VE1B 1UTBB 2RC9A 4NF6B 4RNSA 3RN8A 5AA4B 4RK2A 1LFGA 4Z0IA 1RKMA 3FV1A 2ZMBA 3JYRA 4THIA 3SEUA 2ZNUA 3OEMA 4PFWA 2HCAA 3ILUB 3KOTA 1POTA 2WKYA 4HTGA 3TCHA 2BJJX 3IOWA 4RK9A 4ONYA 1A8FA 2NUVA 4IO6A 1URSA 1UTHB 4RY1A 4EXLA 2REJA 3B6WA 4QSCA 3LSXA 3N5LA 4LVQA 3PD9A 1DSNA 1Y20A 3I6VA 4XIGQ 1AL3A 1NH7A 3E3KA 1XVYA 4JBZA 3SKPA 4JWXA 2DXYA 4EF2A 1EZOA 3SEWA 2QPQA 3MPLA 5I57A 3O66A 4G68B 4GOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBC A;  1NNP A;  3IB0 A;  4IB2 A;  4YU0 A;  3C9H A;  3ZSF A;  2F34 A;  2PBW A;  3A3U A;  3TUS A;  3D4G A;  1XS5 A;  2A5T B;  2DSF A;  1MPD A;  4JDF A;  1MDQ A;  4RJZ A;  3W9V A;  4G77 A;  4ELO A;  2DE2 A;  1EU8 A;  2HZL A;  4NF4 A;  3RQT A;  4F2Q A;  5B7D A;  5FHN A;  3RTF B;  3WAF A;  3KN8 A;  3HHG A;  4YIC A;  3S9E A;  3BBR A;  4ZZE A;  1H76 A;  2R9J A;  3VVF A;  3GZG A;  4QF9 A;  5A5X A;  4R2F A;  3V83 A;  1S9T A;  4R9F A;  3RGY A;  1OVB A;  4LZ8 A;  1IXG A;  3UGW A;  5AA3 A;  1IEJ A;  5H8H A;  1B51 A;  4R74 A;  2V3T A;  4KCC A;  2Y7W A;  4LZ5 A;  1Y3N A;  4R6H A;  3SEY A;  4Q8R A;  3KN7 A;  4OYV A;  1MG1 A;  5ISU A;  1ZLQ A;  5TP9 B;  2O68 A;  1N04 A;  2UYF A;  3O6G A;  3K1P A;  4OVJ A;  4OZ9 A;  2ZYK A;  2D21 A;  1JNF A;  4G68 C;  3OEL A;  2O51 A;  4OTE A;  2Z8D A;  3O28 A;  1B2H A;  4FOR A;  4PQJ A;  1O7T A;  3LUY A;  1FQA A;  1VR5 A;  2ANJ A;  4UAC A;  4H65 A;  4U4S A;  4YB5 A;  1I6A A;  3ZKL A;  4PP0 A;  4BLA A;  4KCD A;  3Q26 A;  4OER A;  2HEU A;  1MH4 A;  4KD5 A;  4R9G A;  1IIW A;  1N84 A;  2F7C A;  4GF8 A;  1B1H A;  3EHT A;  2UVI A;  1SI0 A;  1ZBM A;  4K3F A;  4ZE9 A;  3IJO B;  1D9V A;  3Q25 A;  4GL8 A;  4XKP A;  4OEU A;  1B4Z A;  1BKA A;  3TFL A;  1MXY A;  3D4C A;  3W15 C;  1DPE A;  3MWB A;  1FTM A;  3TEL A;  2F6P A;  2CZL A;  2IA4 A;  3LSF B;  3PUY E;  3A09 A;  1M5F A;  2H5Y A;  2ONK E;  3FVK A;  4HCY A;  5AA2 B;  2I3W A;  5ITO A;  5JTY A;  3OOA A;  4POW A;  1EZ9 A;  1US5 A;  1LLS A;  3IB1 A;  1POY 1;  4M1V A;  1PB8 A;  1MDP 1;  3C4M A;  1B1X A;  1QUJ A;  3K6U A;  3S4U A;  1IUD A;  1TWY A;  5DVI A;  1HSE A;  3UA8 A;  3C35 A;  1MRP A;  3MAM A;  4KQP A;  5TU0 A;  1US4 A;  1QUK A;  3DP8 A;  3ZS6 A;  4X48 A;  4N07 A;  2ALU A;  4OFJ A;  1NKX A;  3EHU A;  3PGF A;  3QUF A;  4G2Z A;  4WXJ A;  1OQG A;  3B6Q A;  2VGQ A;  4OWD A;  2QJE A;  4AB6 A;  2RCA A;  2Q2C A;  4UA8 A;  3FV2 A;  1B0H A;  1QVS A;  5JTY B;  3VVE A;  4E0X A;  2O1L A;  5I2N A;  1MPB A;  2QS1 A;  3UIF A;  2H4I A;  4XKQ A;  1N7W A;  4AQ4 A;  2Q9T A;  3CVG A;  1D9Y A;  1UTB A;  3H06 B;  3IX1 A;  3MC2 A;  4R75 A;  2O84 X;  3RNN A;  3EPE A;  4LAT A;  4ESW A;  3THI A;  3K6W A;  1MQD A;  2UVG A;  3HPI A;  4ND9 A;  1B4H A;  4O3A A;  2Y7R A;  2W7Y A;  3UN6 A;  4KPT A;  2XX9 A;  1L5T A;  4FE8 A;  1MM6 A;  1LAX A;  2LAO A;  4U23 A;  3MZ1 A;  4MLQ A;  5CMB A;  5I2K B;  3TMG A;  1D4N A;  4YKK A;  2O7U A;  3PUX E;  4X9T A;  2XXQ A;  4WED A;  2ABH A;  5CI5 A;  4PE5 B;  3LC8 A;  3T9H B;  3U8Q A;  3M3F A;  5K2Y A;  4EQ7 A;  5CC2 A;  1B7Z A;  5I56 B;  4C1U A;  5JK4 A;  2UXA A;  4H6D A;  1ANF A;  2THI A;  1FTJ A;  4EUO A;  3UP9 A;  3MP1 A;  5CRY A;  1B5I A;  2DS9 A;  5TPA B;  1NNF A;  2OZZ A;  1N7X A;  2I4B A;  3K02 A;  1IXH A;  3G3K A;  5L9M A;  3USD A;  1PEB A;  2OBG A;  4JSO A;  3U72 A;  2FA7 A;  4G4P A;  5FTI A;  1QJM A;  2PYY A;  4G8M A;  3SEV A;  3CFL A;  4QFK A;  2V93 A;  3CIJ A;  4DDD A;  1QKA A;  2F6G A;  1Z7M E;  1P1O A;  2NOO A;  3TYH A;  3CRB A;  3H3G A;  3N94 A;  5H8Q A;  1VE4 A;  4DCX A;  3TAJ A;  2VD2 A;  2VP1 A;  3OO7 A;  4E0W A;  2UYE A;  3OO9 A;  4MBP A;  2HAV A;  2HAU A;  1B40 A;  1S50 A;  2PT1 A;  3G7W A;  3H6V A;  3MJN A;  1Y9U A;  1FQD A;  2QMW A;  1FQB A;  4LA9 A;  3FXU A;  2P1S A;  3SDF A;  3TTK A;  5KDT B;  4NF8 B;  3TTL A;  3TZA A;  1O64 A;  2I58 A;  5I58 B;  4YKP A;  3TDJ A;  2D3I A;  3FAS A;  4LZ7 A;  4O3B A;  1M5C A;  1B3L A;  1RYX A;  3UK4 A;  3ZKK A;  4NF5 B;  2QS4 A;  2QS3 A;  4YB6 A;  2H9B A;  5AA2 A;  2P0S A;  4PFY A;  2I48 A;  2Y7K A;  1CB6 A;  1MH3 A;  1P99 A;  1Q35 A;  3S2V A;  2F7A A;  2X7P A;  3DEL B;  4BDN A;  2B65 A;  3MQ9 A;  1B5H A;  4R6Y A;  5BUU A;  3VVD A;  3HO7 A;  3S9M C;  3K6V A;  1I6Q A;  4ZZA A;  3O2A A;  2O69 A;  3VLU A;  1CE2 A;  3U92 A;  1JEU A;  1BP5 A;  1URD A;  1XVX A;  1SW1 A;  1SQY A;  2XXP A;  3N26 A;  4FEB A;  2R6G E;  1FTK A;  3I3V A;  4GXS B;  4JWO A;  2P2A A;  1OIB A;  2A5S A;  1PDA A;  4OET A;  4HS7 A;  1D3K A;  5I57 B;  2O7I A;  4DE8 A;  5I84 A;  2I6E A;  4GD5 A;  5DEX A;  4G68 A;  2XXV A;  4P11 A;  4ZEK A;  1OLC A;  5B70 A;  1B3G A;  2DWA A;  1LBB A;  1Q1K A;  2DP8 A;  3IR1 A;  2XXH A;  1B0L A;  1Y4T A;  3MZ9 A;  3FGS A;  3L6H A;  3O6I A;  2ZNS A;  3EQ1 A;  4P0G A;  4HCW A;  3QSL A;  5AA2 D;  3OSQ A;  2AIX A;  2X7Q A;  3H03 A;  3WAE A;  5I59 A;  1ZMG A;  1SVX B;  5H8H B;  5K2X A;  2I0C A;  4YKI A;  3T9U A;  4DZ1 A;  1DOT A;  3VLW A;  5I2K A;  4QSD A;  4U4X A;  4U22 A;  2XXU A;  1A8E A;  1AMF A;  1MS7 A;  2HZK A;  3PU5 A;  4MLV A;  1B3E A;  1OVT A;  3BKI B;  3FJG A;  2ZYO A;  4OFO A;  4ZEF A;  2V84 A;  1RYO A;  1UIV A;  2R71 A;  1PB9 A;  4GFR A;  1EZP A;  4ZE8 A;  3VV5 A;  4FAT A;  3CI8 A;  1WDN A;  2RC7 A;  4F31 B;  2G29 A;  1MY2 A;  4NWC A;  3VDF A;  1B5J A;  4HW8 A;  3DP4 A;  3SES A;  4AB5 A;  4L17 A;  2I0B A;  3F11 A;  3KFM A;  5DEX B;  5IAI A;  3KJ7 A;  4NE4 A;  3U94 A;  1LB9 A;  2B3F A;  4OHN A;  1O63 A;  4ZEI A;  4WKM A;  2GHB A;  3W9W A;  3U1O A;  2Z8E A;  3DM0 A;  4GXA A;  1P1W A;  4MH5 A;  4XTC Q;  4BDM A;  1FQF A;  3PPO A;  5ITP A;  1B3F A;  3MZB A;  1GVC A;  3Q27 A;  4PFU A;  1M5E A;  5CBS A;  1B52 A;  3AXF A;  3IOR A;  5I2N B;  5ICT A;  4RA1 A;  4FIM A;  2PMS A;  3FJ7 A;  3G3I A;  3KN3 A;  3MBP A;  4QFP A;  1LST A;  1MXX A;  4U1O A;  4ZEB A;  4ZED A;  2REG A;  3S9L C;  2ZNT A;  1JET A;  1TFA A;  2QL3 A;  1FQE A;  1TXF A;  3I5O A;  3H6T A;  5KDT A;  3M3K A;  2I3V A;  2XXW A;  3DP6 A;  4F1V A;  5CBR A;  3KBR A;  1NH8 A;  3V8X B;  1B58 A;  2F5X A;  2VHA A;  3KSX A;  3KSJ A;  2ONR A;  3HN0 A;  3JV9 A;  1MQG A;  2F78 A;  2GH9 A;  4NF8 A;  1AH5 A;  3FJM A;  2RF1 A;  3MP6 A;  5IKB A;  3VXC A;  4I1D A;  2GFE A;  4IO4 A;  1I6B A;  4U1Z A;  2ZYM A;  3KEI A;  4U2R A;  1A99 A;  3E4R A;  3K0V A;  1SYI A;  3M3L A;  2Z22 A;  3IJX B;  1Y4C A;  2PX1 A;  3C33 A;  1IQ7 A;  3T96 B;  4I8C A;  1NNT A;  3O29 A;  4F22 A;  5J1D A;  3VLV A;  1N76 A;  1YAE A;  3OO6 A;  4N13 A;  2RC8 A;  4FED A;  1PBP A;  4RYA A;  4YB7 A;  1IIT A;  1QUI A;  3E13 X;  3FIR A;  4I9D A;  4QHQ A;  5CMC A;  5I56 A;  2QSX A;  4BDQ A;  3PUZ E;  3PMX A;  4TLM B;  4ESX A;  1MQH A;  1ZKB A;  3IO4 A;  4TLL B;  5KZT A;  4NMY A;  1Y3Q A;  3OD7 A;  2Q2A A;  3Q28 A;  3A3C A;  2XX7 A;  5KCJ B;  2V3U A;  4LQ2 A;  2Y84 A;  5L8D A;  2QS2 A;  2XD3 A;  2OCU A;  2F8D A;  1YCJ A;  4IO3 A;  1UQW A;  3Q29 A;  1LAH E;  5FTH A;  3B6T A;  3TCG A;  2XX8 A;  2DWJ A;  4PET A;  1MM7 A;  2IEE A;  1DTZ A;  1IXC A;  2DQV A;  5TPA A;  4GWO A;  1DMB A;  1QUL A;  1J1N A;  4OQO A;  4Z7E A;  4ISU A;  1IXI A;  1LBC A;  1QKB A;  3CR9 A;  3FXQ A;  3DLN A;  2DOJ A;  4IGR A;  1SW2 A;  4QRZ A;  5H8Q B;  4GIZ A;  4YZZ A;  3RT8 A;  3VXB A;  4M4G A;  1R9Q A;  4FJP A;  1MQJ A;  3JZJ A;  1JW1 A;  2H98 A;  2F35 A;  4X1D A;  2NWJ A;  4Q0C A;  5H8N A;  1MXV A;  3VFJ A;  3CG1 A;  1MXZ A;  2E1S A;  2F97 A;  3QIM A;  2Q8J A;  3R6U A;  2V3Q A;  3EN3 A;  4OXV A;  4X1B A;  2XXI A;  3ONM A;  3QAX A;  5CM6 A;  3MPK A;  4NF5 A;  4KR5 A;  3G3F A;  4Q5T A;  4Q30 B;  1B32 A;  3MVZ A;  4H5F A;  2XXT A;  1B7H A;  1NFT A;  4H0W A;  2B3B A;  2ZXT A;  3MUQ A;  2ESN A;  4NWD A;  3R7X A;  1OQH A;  1Y1M A;  1GV8 A;  3SET A;  3RTW B;  2H99 A;  4F3G A;  1BLF A;  3S9N C;  4F3B A;  1UIU A;  1SW5 A;  3CG3 A;  1GTK A;  5DYH A;  4F3S A;  1MY3 A;  3OMB A;  3IOU A;  3K6X A;  4R2B A;  1LB8 A;  4F2O A;  1H3D A;  1P1U A;  1A40 A;  2ONS A;  3O9P A;  2YPN A;  3QUJ A;  5EHM A;  4P0I A;  5CMK A;  1NNK A;  2M8C A;  4WEP A;  4F1U A;  3SEX A;  2HQ0 A;  4TQU Q;  4H8I A;  1MXU A;  1WOD A;  4IY5 A;  4EXK A;  3IK6 B;  4BDO A;  5DVF A;  5JEI A;  2HFB A;  3PMV A;  3FXR A;  2XD2 A;  4QFO A;  1SDX A;  3OSR A;  3C32 A;  3FUZ A;  4EQB A;  4ZEC A;  2OK2 A;  1T0K A;  1ZJL A;  5FHM A;  2UVJ A;  3G3H A;  3GBB A;  2AYS A;  3G3G A;  1PB7 A;  3KOS A;  2DVZ A;  1LCF A;  3FVN A;  1BIY A;  4OFL A;  4ELQ A;  1Z7N E;  3IB2 A;  3TTM A;  1ATG A;  3T66 A;  5HM4 B;  2X26 A;  5F1Q A;  1UTH A;  4EDP A;  5L9S A;  3K01 A;  5I59 B;  4BDR A;  3PMW A;  3ECR A;  5L9O A;  1SW4 A;  2GHA A;  2OWS A;  1PC3 A;  1ZTY A;  3MVY A;  5EHS A;  2Z8F A;  3RLF E;  5LOM A;  3TEP A;  4JB7 A;  4ECF A;  1LFH A;  2XHD A;  4FEC A;  1B9J A;  2DWH A;  2ZYN A;  3FAT A;  2XXX A;  5CMM A;  2QRY A;  1Y3P A;  1B6H A;  1USY E;  2F36 A;  5M2V A;  3ILT B;  1FQC A;  1FTO A;  1LFI A;  5H8F A;  1FTL A;  3FD3 A;  4POX A;  3V89 B;  3E9X A;  4QFN A;  4GQO A;  1YTV A;  1R1N A;  4IGT A;  4OES A;  3RUM A;  3TTR A;  4DXU A;  1BTJ A;  4KFQ A;  2GRV A;  3CSG A;  3R26 A;  4F29 A;  5A5X B;  4EQ9 A;  1AIV A;  2PVU A;  2V25 A;  1Y1Z A;  3MP8 A;  3IO6 A;  5ICQ A;  1MQI A;  4GL0 A;  4RPN A;  4IO7 A;  3FZV A;  2DE3 A;  3M8U A;  1JVX A;  2VOZ A;  4N6P A;  4YMB A;  1WVJ A;  3MW0 A;  1VSO A;  4H1X A;  3BFU A;  1M5B A;  1TFD A;  5F7V A;  4C0R A;  1A54 A;  1MY0 A;  2D5W A;  1NMU A;  4NTL A;  4F1Y A;  4F39 A;  5AE4 A;  3MVX A;  4LUB A;  5ELV A;  1EH3 A;  4ELR A;  1B3H A;  4JXI A;  3HHF A;  2KLF A;  1VFE A;  1H44 A;  4NED A;  3SER A;  2DWI A;  3PPP A;  3TCF A;  4LQ5 A;  1ZIU A;  4H5G A;  4DCY A;  1KWH A;  4BDL A;  3PD8 A;  1TT1 A;  1XOC A;  4KHZ E;  3C36 A;  1PBQ A;  2I4C A;  2Y7P A;  3OEK A;  2CMO A;  4NF6 A;  3T93 B;  5H8N B;  5TP9 A;  3FVG A;  1NL5 A;  5HPQ A;  1JW4 A;  1HSL A;  3KZG A;  1AOV A;  3KGC A;  4R72 A;  4DXB A;  3GXA A;  3OEN A;  3PUV E;  1N3W A;  1P1Q A;  3EHS A;  1DTG A;  2VD3 A;  1URG A;  4LP2 B;  4ZDM A;  2Q88 A;  1M5D A;  4IO5 A;  5AA4 A;  1H43 A;  4OEV A;  2E0S A;  1DPP A;  2G93 A;  3PV0 E;  3MVW A;  4F3P A;  3K1N A;  4YAH X;  1XHY A;  1JW5 A;  1YPN A;  4KI0 E;  2F7B A;  3O97 A;  3TKD A;  1VFD A;  4R73 A;  4MFI A;  2NVU B;  1SYH A;  4H67 A;  4IY6 A;  1JQF A;  5KCJ A;  4XKN A;  3PPN A;  3B7D A;  3C31 A;  4DIG A;  5FHO A;  3H4Z A;  4U21 A;  5AA1 A;  2FYI A;  3LSL A;  3N6T A;  3ODB A;  4IO2 A;  3U93 A;  5DVJ A;  3CFX A;  3RPW A;  2XXY A;  4NF4 B;  4JWY A;  1H45 A;  3HST A;  1B7U A;  1MXW A;  2AL4 A;  1MPC A;  1R9L A;  4TOZ A;  2Z23 A;  3PUW E;  5BWJ A;  1A7L A;  3KJT A;  5EYF A;  2O6A A;  1FCK A;  3IL1 B;  1IZ1 A;  1FW0 A;  1LAG E;  1MY4 A;  2OWT A;  3LR1 A;  3PPQ A;  4G8H A;  3UOR A;  1USY H;  4QFL A;  3TQW A;  2Y7I A;  3OO8 A;  3K4U A;  3QXM A;  3IAZ A;  4EF1 A;  4FAJ A;  1JVY A;  1B05 A;  1GR2 A;  3K2D A;  4GLI A;  4ELP A;  2OJT A;  2FNC A;  3IOT A;  1LCT A;  4JSD A;  2UVH A;  4YMA A;  3RT6 B;  3TTN A;  4DLD A;  1N3X A;  2RIN A;  4OEN A;  3T9V A;  4O3C A;  3TPA A;  1ELJ A;  4KYE A;  1B46 A;  3K00 A;  2DXR A;  3H7M A;  1XC1 A;  3N6U A;  3CSB A;  4GRK A;  2AL5 A;  3IOV A;  3K1M A;  3QYT A;  3T22 A;  3T9X B;  4DXC A;  3CFZ A;  1R6Z A;  2DYX A;  2DE4 A;  3BFT A;  3GBA A;  1QW0 A;  4C1T A;  3O6H A;  1II5 A;  1SI1 A;  3H6W A;  3OXN A;  2Q89 A;  3FVO A;  1SD3 A;  2HXW A;  1HSJ A;  3HV1 A;  3L6G A;  2RCB A;  4G8N A;  4KYD A;  5H8F B;  4R6K A;  3LBS A;  4XKR A;  3TQL A;  2I49 A;  1GGG A;  1XT8 A;  4ZS9 A;  4YKJ A;  4MF3 A;  4XXU A;  2H25 A;  2PT2 A;  4OMB A;  2QMX A;  5H8S A;  4RXL A;  1F9B A;  3V5A A;  4KYS A;  3TOD A;  1I69 A;  1MY1 A;  3PPR A;  4F18 A;  5DTB A;  1OMP A;  2RKM A;  2OLB A;  3GLB A;  3EF7 A;  2O1M A;  4GVO A;  3G3J A;  1A55 A;  1N0T A;  1LAF E;  1P1N A;  1S7Y A;  3LSW A;  2DVC A;  2A5T A;  3QK6 A;  4PFT A;  2YLN A;  4RPO A;  3H6U A;  1OLA A;  2XXR A;  2NXO A;  3RY3 A;  3HCQ A;  1ZU0 A;  4I62 A;  4LON B;  5I58 A;  2YJP A;  5DT6 A;  4H8J A;  1SBP A;  1JEV A;  4F19 A;  3C34 A;  3P7I A;  1LGB C;  3KG2 A;  4QSE A;  3VE1 B;  1UTB B;  2RC9 A;  4NF6 B;  4RNS A;  3RN8 A;  5AA4 B;  4RK2 A;  1LFG A;  4Z0I A;  1RKM A;  3FV1 A;  2ZMB A;  3JYR A;  4THI A;  3SEU A;  2ZNU A;  3OEM A;  4PFW A;  2HCA A;  3ILU B;  3KOT A;  1POT A;  2WKY A;  4HTG A;  3TCH A;  2BJJ X;  3IOW A;  4RK9 A;  4ONY A;  1A8F A;  2NUV A;  4IO6 A;  1URS A;  1UTH B;  4RY1 A;  4EXL A;  2REJ A;  3B6W A;  4QSC A;  3LSX A;  3N5L A;  4LVQ A;  3PD9 A;  1DSN A;  1Y20 A;  3I6V A;  4XIG Q;  1AL3 A;  1NH7 A;  3E3K A;  1XVY A;  4JBZ A;  3SKP A;  4JWX A;  2DXY A;  4EF2 A;  1EZO A;  3SEW A;  2QPQ A;  3MPL A;  5I57 A;  3O66 A;  4G68 B;  4GOT A; 
#chains in the Genus database with same CATH topology
 4IB2 A;  1FPJ A;  3TUS A;  4G77 A;  2DE2 A;  1EU8 A;  4NF4 A;  3RQT A;  4F2Q A;  4FBP A;  4YIC A;  3BBR A;  3GZG A;  4QF9 A;  2CZI A;  1IXG A;  1B51 A;  2Y7W A;  3MST A;  4LZ5 A;  3KN7 A;  4OYV A;  4OVS A;  4ELQ A;  2O68 A;  3O6G A;  4OVJ A;  3K1P A;  1T0K A;  4OTE A;  4N4U A;  1O7T A;  1FQA A;  4BLA A;  4R9G A;  4KD5 A;  2F7C A;  2QFL A;  1B1H A;  3EHT A;  1FBC A;  4OEU A;  3MWB A;  2CZL A;  3A09 A;  1INP A;  1LLS A;  1NV3 A;  3S4U A;  1TWY A;  1HSE A;  4DI4 B;  3ROJ A;  5TU0 A;  4X48 A;  2ALU A;  4G2Z A;  5IZ1 A;  2VGQ A;  2RCA A;  4UA8 A;  3FV2 A;  1B0H A;  1QVS A;  3VVE A;  2O1L A;  2H4I A;  4XKQ A;  3MC2 A;  1UTB A;  4JVI A;  2Y5K A;  1B4H A;  2W7Y A;  2XX9 A;  4FE8 A;  5CMB A;  5I2K B;  4PE5 B;  3T9H B;  3M3F A;  5CC2 A;  1IMD A;  2UXA A;  1NUW A;  1N7X A;  3K02 A;  3USD A;  4JSO A;  2PYY A;  2CEY A;  4G8M A;  3CFL A;  2V93 A;  1Z7M E;  1P1O A;  3CRB A;  4DCX A;  4MEV A;  2VP1 A;  4E0W A;  3OO9 A;  4MBP A;  4LA9 A;  1FQB A;  3TTK A;  4NF8 B;  3TZA A;  4GWS A;  3TDJ A;  4O3B A;  4NF5 B;  2QS3 A;  1CB6 A;  1MH3 A;  4BDN A;  3K6V A;  2KR0 A;  4ZZA A;  2O69 A;  3B8B A;  3U92 A;  1KA1 A;  1BP5 A;  1URD A;  2R6G E;  1FSA A;  5I57 B;  2I6E A;  4G68 A;  2XXV A;  1AWB A;  2XXH A;  3L6H A;  5H8H B;  5K2X A;  4DZ1 A;  5I2K A;  4QSD A;  1MS7 A;  4ZEF A;  2V84 A;  1UIV A;  1EZP A;  1PB9 A;  3CI8 A;  4PFB A;  2G29 A;  1MY2 A;  4HW8 A;  4AB5 A;  4N8G A;  2B3F A;  1JP4 A;  4EXL A;  3DM0 A;  4BDM A;  3PPO A;  1B3F A;  1M5E A;  5I2N B;  5ICT A;  2PMS A;  3G3I A;  3KN3 A;  3MBP A;  4ZEB A;  4ZED A;  3I5O A;  3H6T A;  2I3V A;  3DP6 A;  4F1V A;  3V8X B;  3KSJ A;  3HN0 A;  5CRY A;  1MQG A;  2PFY A;  1FPF A;  4I1D A;  2QVV A;  5DW8 A;  2ZYM A;  4U1Z A;  1A99 A;  3E4R A;  4GX3 A;  3M3L A;  1SYI A;  2Z22 A;  2PX1 A;  3C33 A;  5J1D A;  4N8Y A;  4FED A;  4BDQ A;  4OVP A;  3IO4 A;  5KZT A;  3OD7 A;  2V3U A;  2Y84 A;  2WYK A;  3Q29 A;  4GWX A;  4PET A;  5TPA A;  1IXC A;  4GWO A;  1J1N A;  1IXI A;  5H8Q B;  3CR9 A;  3DLN A;  1SW2 A;  3VXB A;  4NF0 A;  2ZZX A;  3LUZ A;  1MQJ A;  4Q0C A;  1FTA A;  2V3Q A;  3EN3 A;  4LN5 A;  4OXV A;  2XXI A;  3QAX A;  4KR5 A;  3G3F A;  4Q5T A;  1B32 A;  3MVZ A;  2FBP A;  2XXT A;  2ESN A;  1OQH A;  1GV8 A;  1LBZ A;  2H99 A;  3S9N C;  2WEF A;  2ONS A;  3O9P A;  5EHM A;  2M8C A;  3SEX A;  2HQ0 A;  4IY5 A;  3IK6 B;  5DVF A;  2HFB A;  2XD2 A;  1XI6 A;  3C32 A;  2QVU A;  3GBB A;  3KOS A;  3FVN A;  4OFL A;  5HM4 B;  1ATG A;  5I59 B;  4NGU A;  2GHA A;  1FJ9 A;  2MKZ A;  1NI9 A;  1K9Z A;  4FEC A;  2DWH A;  2XWV A;  3IFA A;  5CMM A;  1Y3P A;  1USY E;  3ILT B;  5H8F A;  4POX A;  3RUM A;  4MX6 A;  5A5X B;  5ISU A;  2V25 A;  1Y1Z A;  1FPD A;  4P3L A;  1FBD A;  4C0R A;  2PFZ A;  1TFD A;  1MY0 A;  4NTL A;  1NMU A;  1EH3 A;  2KLF A;  1H44 A;  4H5G A;  1KWH A;  1XOC A;  3C36 A;  4GBW A;  4I3E A;  5H8N B;  3T93 B;  2XWI A;  3KZG A;  4R72 A;  3OEN A;  4ZDM A;  1DTG A;  2Q88 A;  1M5D A;  2G93 A;  1YPN A;  3T1B A;  5ET6 A;  4U21 A;  3N6T A;  3ODB A;  3RPW A;  1B7U A;  1MXW A;  2AL4 A;  3PUW E;  2O6A A;  1MY4 A;  3LR1 A;  1USY H;  4P47 A;  2Y7I A;  3TQW A;  3IAZ A;  1GR2 A;  3IOT A;  4YMA A;  4OEN A;  3T9V A;  3TPA A;  1DCU A;  3K00 A;  4GRK A;  3K1M A;  3CFZ A;  4N17 A;  3GBA A;  1QW0 A;  4C1T A;  3O6H A;  3OXN A;  3H6W A;  1SD3 A;  5H8F B;  3HV1 A;  2RCB A;  4MF3 A;  5EQA A;  4XXU A;  1F9B A;  2CZH A;  3TOD A;  1I69 A;  2RKM A;  1NV1 A;  1A55 A;  1LAF E;  1P1N A;  3RGY A;  3QK6 A;  2KQZ A;  2A5T A;  1OLA A;  1LBX A;  5I58 A;  4F19 A;  1LGB C;  5EQ7 A;  3VE1 B;  1UTB B;  2RC9 A;  4Z0I A;  3JYR A;  3SEU A;  4PFW A;  3ILU B;  4HTG A;  4ONY A;  1A8F A;  1URS A;  1FRP A;  2XWK A;  4QSC A;  1YZ0 A;  3N5L A;  4LVQ A;  1DSN A;  3I6V A;  4XIG Q;  4NHB A;  1EZO A;  3SEW A;  3IB0 A;  2PBW A;  3A3U A;  4RJZ A;  5FHN A;  3WAF A;  3KN8 A;  4P56 A;  4PCD A;  4R2F A;  1LBW A;  3UGW A;  2V3T A;  1Y3N A;  3SEY A;  2F3D A;  4OZ9 A;  2UYF A;  5IAI A;  4F18 A;  2D21 A;  4G68 C;  4RPO A;  2O51 A;  2NWJ A;  3O28 A;  1B2H A;  4OER A;  2HEU A;  1MH4 A;  1IIW A;  1N84 A;  1D9V A;  3Q25 A;  4GWY A;  1B4Z A;  3TFL A;  1DPE A;  3RYD A;  4GWU A;  1FTM A;  3TEL A;  3LSF B;  2H5Y A;  2BJI A;  2ONK E;  5AA2 B;  4GWW A;  1EZ9 A;  4M1V A;  3IB1 A;  5DVI A;  3DP8 A;  4N07 A;  3EHU A;  4PAI A;  3B6Q A;  4OWD A;  2HXR A;  2Q2C A;  4E0X A;  5I2N A;  3UIF A;  3CVG A;  3RNN A;  4LAT A;  3THI A;  2UVG A;  4P1L A;  2P3N A;  2Y7R A;  3UN6 A;  2QVR A;  1MM6 A;  1LAX A;  2LAO A;  2XXQ A;  3LC8 A;  4AS5 A;  3B50 A;  4EQ7 A;  5JK4 A;  1NUY A;  4EUO A;  3UP9 A;  3MP1 A;  1B5I A;  2I4B A;  1IXH A;  5L9M A;  2OBG A;  5FTI A;  1QJM A;  1NUX A;  4QFK A;  2NOO A;  1VE4 A;  1B40 A;  1S50 A;  1Y9U A;  2QMW A;  3FXU A;  2P1S A;  3SDF A;  1SPI A;  4I40 A;  1DBZ A;  3UK4 A;  2R8T A;  4YB6 A;  2P0S A;  4PFY A;  3S2V A;  2F7A A;  1FBE A;  2B65 A;  3MQ9 A;  1B5H A;  5ET7 A;  1I6Q A;  3VLU A;  3O2A A;  4MCO A;  1JEU A;  1SW1 A;  1SQY A;  3I3V A;  3SZP A;  1PDA A;  4OET A;  4GD5 A;  4NQ8 A;  5DEX A;  4P11 A;  4ZEK A;  2DWA A;  3IR1 A;  1B0L A;  4P0G A;  4HCW A;  4PDD A;  2AIX A;  2X7Q A;  4H45 A;  3WAE A;  4N81 A;  4PGP A;  4MNP A;  4P9K A;  1FBF A;  4PFI A;  3PU5 A;  3BKI B;  3FJG A;  4OFO A;  1RYO A;  4ZE8 A;  4F31 B;  3BIH A;  4NWC A;  2I0B A;  3U94 A;  1LB9 A;  3KBZ A;  1RDY A;  4OHN A;  1O63 A;  4WKM A;  2GHB A;  1BK4 A;  2Z8E A;  3GYY A;  5IZ3 A;  3MZB A;  1B52 A;  4FIM A;  3FJ7 A;  3S9L C;  4U1O A;  2REG A;  2ZNT A;  1TFA A;  1FQE A;  5CBR A;  3KBR A;  2VHA A;  2F78 A;  2GH9 A;  3MP6 A;  4GX6 A;  5EQ9 A;  2GFE A;  4IO4 A;  4U2R A;  3K0V A;  3IJX B;  3ISP A;  1FBG A;  1IQ7 A;  3T96 B;  1YAE A;  4RYA A;  3RT6 B;  2RC8 A;  1PBP A;  1IIT A;  3E13 X;  3FIR A;  4QHQ A;  4JVD A;  2QSX A;  1Y3Q A;  2Q2A A;  2XX7 A;  5L8D A;  4NN3 A;  4IO3 A;  4UAB A;  2F8D A;  2DWJ A;  1MM7 A;  2IEE A;  1QUL A;  4IGR A;  1LBC A;  1QKB A;  1LBV A;  4QRZ A;  4PF6 A;  4M4G A;  1R9Q A;  3JZJ A;  4OVT A;  5H8N A;  3VFJ A;  1MXZ A;  2E1S A;  2Q74 A;  5CM6 A;  4H5F A;  4H0W A;  2B3B A;  2ZXT A;  3MUQ A;  3SET A;  4F3G A;  4F3B A;  1GTK A;  1YYZ A;  4F2O A;  1H3D A;  1P1U A;  3QUJ A;  3KC0 A;  4TQU Q;  1MXU A;  1WOD A;  1Q9D A;  4EXK A;  5IGA A;  4ZEC A;  1NV4 A;  2Y5L A;  1LCF A;  3TTM A;  5L9S A;  1UTH A;  5L9O A;  2OWS A;  3RLF E;  2VPN A;  5LOM A;  3TEP A;  2Z8F A;  2XHD A;  2F36 A;  5M2V A;  1LFI A;  3FD3 A;  4OES A;  2GRV A;  3CSG A;  4QXD A;  1D9Q A;  1MQI A;  4GL0 A;  4IO7 A;  3FZV A;  2DE3 A;  1JVX A;  4OVQ A;  4N6P A;  1WVJ A;  4H1X A;  1VSO A;  4N6K A;  4IR8 A;  3MVX A;  1FPK A;  5ELV A;  4ELR A;  1B3H A;  4JXI A;  3HHF A;  4NED A;  2DWI A;  4DCY A;  1ZIU A;  3PD8 A;  1TT1 A;  4JVC A;  3A29 A;  3KGC A;  3PUV E;  1N3W A;  1URG A;  1H43 A;  2E0S A;  4MNC A;  1DPP A;  4F3P A;  4YAH X;  1JW5 A;  2F7B A;  3TKD A;  3LV0 A;  2NVU B;  2HPG A;  4XKN A;  3PPN A;  3B7D A;  4DIG A;  3H4Z A;  1EYJ A;  3LSL A;  4IO2 A;  3U93 A;  5DVJ A;  4JWY A;  1H45 A;  3HST A;  1R9L A;  1DK4 A;  1A7L A;  1FCK A;  3PPQ A;  4G8H A;  4QFL A;  3K4U A;  1JVY A;  3K2D A;  4GLI A;  4ELP A;  1LCT A;  3TTN A;  1N3X A;  1ELJ A;  1KA0 A;  4KYE A;  1B46 A;  3H7M A;  3N6U A;  3CSB A;  4HE2 A;  3T22 A;  4DXC A;  4MAG A;  1R6Z A;  3BFT A;  3L6G A;  3VLW A;  2HXW A;  4G8N A;  1NV6 A;  1GGG A;  4ZS9 A;  4OMB A;  2QMX A;  5H8S A;  3V5A A;  2OLB A;  3GLB A;  4GVO A;  1IMB A;  1S7Y A;  1N0T A;  3LSW A;  1ZU0 A;  1G0I A;  4I62 A;  4LON B;  4MNI A;  1SBP A;  1JEV A;  4H46 A;  3P7I A;  4QSE A;  4RK2 A;  1LFG A;  3FV1 A;  2ZMB A;  2ZNU A;  3OEM A;  3KOT A;  2WKY A;  4RY1 A;  2REJ A;  3LSX A;  1AL3 A;  1XVY A;  4JWX A;  2DXY A;  5I57 A;  2VPO A;  2A5T B;  3HFU A;  5B7D A;  4O94 A;  1H76 A;  3VVF A;  5A5X A;  1S9T A;  1OVB A;  4LZ8 A;  5A5L A;  1IEJ A;  4KCC A;  4R6H A;  4Q8R A;  1ZLQ A;  5TP9 B;  4PTK A;  1N04 A;  2ZYK A;  1JNF A;  3OEL A;  4HE0 A;  5JTY A;  3LUY A;  4UAC A;  2ANJ A;  4H65 A;  4U4S A;  3RPL A;  4PP0 A;  2FVZ A;  3Q26 A;  4GF8 A;  2UVI A;  3IJO B;  4XKP A;  1BKA A;  3D4C A;  3W15 C;  2F6P A;  1M5F A;  4HCY A;  2I3W A;  5ITO A;  4POW A;  1PB8 A;  3C4M A;  4P1E A;  1QUJ A;  3UA8 A;  3C35 A;  1MRP A;  3MAM A;  4KQP A;  1US4 A;  3ZS6 A;  4OFJ A;  3QUF A;  1OQG A;  2P3V A;  2QS1 A;  2Q9T A;  3H06 B;  3IX1 A;  2O84 X;  4ESW A;  3K6W A;  4O3A A;  1L5T A;  4YKK A;  2O7U A;  4HXV A;  4O7I A;  2ABH A;  3U8Q A;  5I56 B;  4H6D A;  1FBH A;  2THI A;  2DS9 A;  5TPA B;  1NNF A;  3G3K A;  3U72 A;  4DDD A;  1QKA A;  3N94 A;  3TAJ A;  3OO7 A;  5F24 A;  4PAF A;  2HAU A;  5FBP A;  3MJN A;  1FQD A;  5ET5 A;  3TTL A;  2I58 A;  5I58 B;  1IMC A;  4YKP A;  3FAS A;  1M5C A;  2PCR A;  5AA2 A;  2Y7K A;  2Q8M A;  1Q35 A;  1P99 A;  1FPL A;  3DEL B;  2X7P A;  4R6Y A;  4GWZ A;  3VVD A;  3HO7 A;  1CE2 A;  2XXP A;  4FEB A;  3N26 A;  4XEQ A;  4GXS B;  2A5S A;  1D3K A;  5I84 A;  1OLC A;  1B3G A;  1Q1K A;  3MZ9 A;  2ZNS A;  3EQ1 A;  1NV7 A;  4PGN A;  5AA2 D;  3OSQ A;  3H03 A;  5I59 A;  2I0C A;  3T9U A;  1DOT A;  4U4X A;  1AMF A;  2HZK A;  1OVT A;  2ZYO A;  4MMP A;  2R71 A;  3VV5 A;  4FAT A;  3VDF A;  2JJK A;  4L17 A;  3F11 A;  3KFM A;  3KJ7 A;  4NE4 A;  4ZEI A;  3U1O A;  4GXA A;  1P1W A;  4XTC Q;  1FQF A;  1GVC A;  4NAP A;  5EYH A;  4PFU A;  5CBS A;  3AXF A;  4QFP A;  1LST A;  1JET A;  3M3K A;  2XXW A;  4NG7 A;  3JV9 A;  5IKB A;  4NF8 A;  1AH5 A;  3VXC A;  5I3S A;  4XF5 A;  1Y4C A;  1NNT A;  3O29 A;  3VLV A;  4N13 A;  3ZKK A;  3NOH A;  4YB7 A;  5CMC A;  1FJ6 A;  4TLL B;  4NMY A;  3Q28 A;  3A3C A;  5T3J A;  2XD3 A;  2OCU A;  1YCJ A;  4N15 A;  3TCG A;  5FTH A;  1DMB A;  4OQO A;  4ISU A;  1FPB A;  2ZZV A;  3RT8 A;  3E79 A;  4YZZ A;  4FJP A;  4N6D A;  2H98 A;  2F35 A;  3BIG A;  2Q8J A;  3R6U A;  3MYU A;  3ONM A;  4NF5 A;  4Q30 B;  1B7H A;  4NWD A;  3R7X A;  2VT5 A;  3RTW B;  1BLF A;  1UIU A;  1SW5 A;  4F3S A;  1MY3 A;  3OMB A;  1LB8 A;  1A40 A;  4O8M A;  4G61 A;  4F1U A;  4H8I A;  4HE1 A;  4OA4 A;  4EQB A;  1ZJL A;  3G3G A;  1PB7 A;  2DVZ A;  1BIY A;  3IB2 A;  2X26 A;  5F1Q A;  4EDP A;  3K01 A;  3ECR A;  1SW4 A;  1ZTY A;  5EHS A;  4JB7 A;  1B9J A;  3FXB A;  3FBP A;  1YTV A;  1R1N A;  1BTJ A;  4MHF A;  3R26 A;  4PAK A;  4EQ9 A;  1AIV A;  5ICQ A;  3IO6 A;  4RPN A;  3M8U A;  1M5B A;  5F7V A;  4F39 A;  2WYP A;  1LBY A;  4PE3 A;  2WBB A;  3SER A;  3PPP A;  4PFR A;  4BDL A;  4KHZ E;  5EQ8 A;  3OEK A;  2Y7P A;  5TP9 A;  3FVG A;  1NL5 A;  3E78 A;  1P1Q A;  3EHS A;  2VD3 A;  4LP2 B;  5AA4 A;  3PV0 E;  3MVW A;  3K1N A;  4KI0 E;  3EKI A;  3O97 A;  1VFD A;  4R73 A;  4H67 A;  4IY6 A;  1JQF A;  5KCJ A;  3C31 A;  4X04 A;  5FHO A;  3CFX A;  2XXY A;  4PBH A;  2Z23 A;  3KC1 A;  5EYF A;  1VDW A;  3KJT A;  1YXI A;  1IZ1 A;  2OWT A;  3UOR A;  3OO8 A;  3QXM A;  3RPL B;  2FNC A;  2UVH A;  1LEV A;  4DLD A;  1XC1 A;  2AL5 A;  3QYT A;  2ZZW A;  1II5 A;  1SI1 A;  4DXB A;  2Q89 A;  3FVO A;  4AQ4 A;  4KYD A;  2DDK A;  3TQL A;  1G0H A;  1XT8 A;  2H25 A;  4RXL A;  4NX1 A;  4KYS A;  5DTB A;  3EF7 A;  2OX3 A;  4PFT A;  2XA5 A;  2FHY A;  3RY3 A;  4H8J A;  3KG2 A;  4NF6 B;  3RN8 A;  1FBP A;  1K9Y A;  2HCA A;  1POT A;  4QBA A;  4PDH A;  2NUV A;  1UTH B;  3B6W A;  4I3Y A;  1Y20 A;  1NH7 A;  3SKP A;  3MPL A;  3O66 A;  4G68 B;  4GOT A;  5HBC A;  1NV2 A;  1NNP A;  4YU0 A;  3C9H A;  2F34 A;  3D4G A;  1XS5 A;  2DSF A;  1MPD A;  4JDF A;  1MDQ A;  5AA3 A;  3W9V A;  4ELO A;  2HZL A;  3RTF B;  3HHG A;  3S9E A;  4ZZE A;  2R9J A;  3V83 A;  1QGX A;  4R9F A;  5H8H A;  4R74 A;  5IM2 A;  1MG1 A;  3PTY A;  4PBQ A;  4EF2 A;  2Z8D A;  4FOR A;  4PQJ A;  1VR5 A;  4YB5 A;  1I6A A;  3ZKL A;  4KCD A;  4X8R A;  2XXK A;  4K3F A;  1SI0 A;  1ZBM A;  4ZE9 A;  2CZK A;  4GL8 A;  1MXY A;  2IA4 A;  3PUY E;  3FVK A;  5IZ3 B;  3OOA A;  1US5 A;  1POY 1;  1MDP 1;  4MJO A;  1B1X A;  1EYI A;  3K6U A;  1IUD A;  1QUK A;  1NKX A;  3PGF A;  4O7M A;  4WXJ A;  5ESY A;  2QJE A;  4AB6 A;  5JTY B;  1MPB A;  1N7W A;  1D9Y A;  4R75 A;  3EPE A;  4XFE A;  1MQD A;  3HPI A;  4ND9 A;  4KPT A;  4U23 A;  3TMG A;  3MZ1 A;  4MLQ A;  1D4N A;  3PUX E;  4X9T A;  4WED A;  5CI5 A;  5K2Y A;  1B7Z A;  4C1U A;  4PF8 A;  1ANF A;  1FTJ A;  4DI3 D;  2OZZ A;  1PEB A;  2FA7 A;  4G4P A;  3SEV A;  3CIJ A;  2F6G A;  2B4M A;  3TYH A;  3H3G A;  5H8Q A;  2VD2 A;  2UYE A;  2HAV A;  3G7W A;  1FPI A;  2PT1 A;  3H6V A;  2HHM A;  5IZZ A;  5KDT B;  1O64 A;  2D3I A;  4LZ7 A;  1B3L A;  1RYX A;  2QS4 A;  2H9B A;  2I48 A;  2F3B A;  5BUU A;  2B4L A;  1XVX A;  1RDX A;  1FTK A;  4JWO A;  2P2A A;  1OIB A;  4HS7 A;  2O7I A;  4DE8 A;  5B70 A;  1LBB A;  2DP8 A;  1Y4T A;  5I5P A;  3FGS A;  3O6I A;  3QSL A;  1ZMG A;  1SVX B;  4YKI A;  2GQ1 A;  4U22 A;  2XXU A;  1A8E A;  4MLV A;  1B3E A;  4GFR A;  1WDN A;  2RC7 A;  1B5J A;  3DP4 A;  3SES A;  5DEX B;  3QMF A;  3W9W A;  1NUZ A;  5ITP A;  4MH5 A;  3Q27 A;  5ET8 A;  1EYK A;  3IOR A;  4RA1 A;  1MXX A;  2QL3 A;  5LTC A;  1TXF A;  5KDT A;  4AS4 A;  1NH8 A;  1B58 A;  2F5X A;  3KSX A;  3U65 A;  2ONR A;  3FJM A;  2RF1 A;  1I6B A;  3KEI A;  4KXP A;  4OAN A;  1FPE A;  3D1R A;  4I8C A;  4F22 A;  1N76 A;  3OO6 A;  1QUI A;  4I9D A;  5I56 A;  3PUZ E;  3PMX A;  4TLM B;  4ESX A;  1MQH A;  1ZKB A;  5KCJ B;  4LQ2 A;  2QS2 A;  1IME A;  1UQW A;  1LAH E;  3B6T A;  2XX8 A;  1DTZ A;  2DQV A;  4GBV A;  4Z7E A;  3FXQ A;  2DOJ A;  4GIZ A;  1JW1 A;  4X1D A;  1MXV A;  3CG1 A;  2F97 A;  3QIM A;  4X1B A;  3MPK A;  1IMF A;  1NFT A;  4PC9 A;  2V4C A;  1Y1M A;  3CG3 A;  5DYH A;  3IOU A;  3K6X A;  4R2B A;  2YPN A;  4P0I A;  5CMK A;  1NNK A;  4WEP A;  4BDO A;  5JEI A;  3PMV A;  3FXR A;  4QFO A;  1SDX A;  4P8B A;  3OSR A;  3FUZ A;  2OK2 A;  5FHM A;  2UVJ A;  3CHG A;  3G3H A;  2AYS A;  1Z7N E;  3T66 A;  4BDR A;  3PMW A;  3S9M C;  3MVY A;  1PC3 A;  4ECF A;  1LFH A;  2ZYN A;  3FAT A;  1FPG A;  2XXX A;  2QRY A;  1B6H A;  1FQC A;  1FTO A;  1FTL A;  3V89 B;  3E9X A;  4QFN A;  4GQO A;  1CNQ A;  3TTR A;  4IGT A;  4DXU A;  1RDZ A;  4KFQ A;  4F29 A;  3T0J A;  2PVU A;  3MP8 A;  2VOZ A;  4YMB A;  3MW0 A;  3BFU A;  2WBD A;  1A54 A;  2D5W A;  5AE4 A;  4LUB A;  1NV5 A;  1VFE A;  3TCF A;  4LQ5 A;  4GX4 A;  2CEX A;  1PBQ A;  2I4C A;  2CMO A;  4NF6 A;  2OWZ A;  1JW4 A;  5HPQ A;  1HSL A;  1AOV A;  3GXA A;  4IO5 A;  4OEV A;  1XHY A;  2FIX A;  4MFI A;  1SYH A;  2L5V A;  5AA1 A;  2FYI A;  4MIJ A;  4NF4 B;  4TOZ A;  1MPC A;  5BWJ A;  3IL1 B;  1FW0 A;  1LAG E;  4EF1 A;  4FAJ A;  1B05 A;  4OVR A;  2OJT A;  4JSD A;  2RIN A;  4O3C A;  2DXR A;  3T9X B;  5I7I A;  3IOV A;  2DYX A;  2DE4 A;  5EYG A;  1HSJ A;  1IMA A;  4R6K A;  3LBS A;  4XKR A;  2I49 A;  1NV0 A;  4YKJ A;  2FIE A;  2PT2 A;  1MY1 A;  3PPR A;  1OMP A;  2O1M A;  3G3J A;  4N91 A;  2DVC A;  3ZSF A;  2YLN A;  3H6U A;  2XXR A;  2NXO A;  3HCQ A;  5J16 A;  2YJP A;  5DT6 A;  5LDZ A;  1KZ8 A;  3C34 A;  3IFC A;  4RNS A;  5AA4 B;  1RKM A;  4THI A;  3TCH A;  2BJJ X;  3IOW A;  4RK9 A;  4IO6 A;  2XWO A;  3PD9 A;  3E3K A;  4JBZ A;  2QPQ A;  4F1Y A;  2WX9 A; 
#chains in the Genus database with same CATH homology
 5HBC A;  1NNP A;  3IB0 A;  4IB2 A;  4YU0 A;  3C9H A;  3ZSF A;  2F34 A;  2PBW A;  3A3U A;  3TUS A;  3D4G A;  1XS5 A;  2A5T B;  2DSF A;  1MPD A;  4JDF A;  1MDQ A;  4RJZ A;  3W9V A;  4G77 A;  4ELO A;  2DE2 A;  1EU8 A;  2HZL A;  4NF4 A;  3RQT A;  4F2Q A;  5B7D A;  5FHN A;  3RTF B;  3WAF A;  3KN8 A;  3HHG A;  4YIC A;  3S9E A;  3BBR A;  4ZZE A;  1H76 A;  2R9J A;  3VVF A;  3GZG A;  4QF9 A;  5A5X A;  4R2F A;  3V83 A;  1S9T A;  4R9F A;  3RGY A;  1OVB A;  4LZ8 A;  1IXG A;  3UGW A;  5AA3 A;  1IEJ A;  5H8H A;  1B51 A;  4R74 A;  2V3T A;  4KCC A;  2Y7W A;  4LZ5 A;  1Y3N A;  4R6H A;  3SEY A;  4Q8R A;  3KN7 A;  4OYV A;  1MG1 A;  5ISU A;  1ZLQ A;  5TP9 B;  2O68 A;  1N04 A;  2UYF A;  3O6G A;  3K1P A;  4OVJ A;  4OZ9 A;  2ZYK A;  2D21 A;  1JNF A;  4G68 C;  3OEL A;  2O51 A;  4OTE A;  2Z8D A;  3O28 A;  1B2H A;  4FOR A;  4PQJ A;  1O7T A;  3LUY A;  1FQA A;  1VR5 A;  2ANJ A;  4UAC A;  4H65 A;  4U4S A;  4YB5 A;  1I6A A;  3ZKL A;  4PP0 A;  4BLA A;  4KCD A;  3Q26 A;  4OER A;  2HEU A;  1MH4 A;  4KD5 A;  4R9G A;  1IIW A;  1N84 A;  2F7C A;  4GF8 A;  1B1H A;  3EHT A;  2UVI A;  1SI0 A;  1ZBM A;  4K3F A;  4ZE9 A;  3IJO B;  1D9V A;  3Q25 A;  4GL8 A;  4XKP A;  4OEU A;  1B4Z A;  1BKA A;  3TFL A;  1MXY A;  3D4C A;  3W15 C;  1DPE A;  3MWB A;  1FTM A;  3TEL A;  2F6P A;  2CZL A;  2IA4 A;  3LSF B;  3PUY E;  3A09 A;  1M5F A;  2H5Y A;  2ONK E;  3FVK A;  4HCY A;  5AA2 B;  2I3W A;  5ITO A;  5JTY A;  3OOA A;  4POW A;  1EZ9 A;  1US5 A;  1LLS A;  3IB1 A;  1POY 1;  4M1V A;  1PB8 A;  1MDP 1;  3C4M A;  1B1X A;  1QUJ A;  3K6U A;  3S4U A;  1IUD A;  1TWY A;  5DVI A;  1HSE A;  3UA8 A;  3C35 A;  1MRP A;  3MAM A;  4KQP A;  5TU0 A;  1US4 A;  1QUK A;  3DP8 A;  3ZS6 A;  4X48 A;  4N07 A;  2ALU A;  4OFJ A;  1NKX A;  3EHU A;  3PGF A;  3QUF A;  4G2Z A;  4WXJ A;  1OQG A;  3B6Q A;  2VGQ A;  4OWD A;  2QJE A;  4AB6 A;  2RCA A;  2Q2C A;  4UA8 A;  3FV2 A;  1B0H A;  1QVS A;  5JTY B;  3VVE A;  4E0X A;  2O1L A;  5I2N A;  1MPB A;  2QS1 A;  3UIF A;  2H4I A;  4XKQ A;  1N7W A;  4AQ4 A;  2Q9T A;  3CVG A;  1D9Y A;  1UTB A;  3H06 B;  3IX1 A;  3MC2 A;  4R75 A;  2O84 X;  3RNN A;  3EPE A;  4LAT A;  4ESW A;  3THI A;  3K6W A;  1MQD A;  2UVG A;  3HPI A;  4ND9 A;  1B4H A;  4O3A A;  2Y7R A;  2W7Y A;  3UN6 A;  4KPT A;  2XX9 A;  1L5T A;  4FE8 A;  1MM6 A;  1LAX A;  2LAO A;  4U23 A;  3MZ1 A;  4MLQ A;  5CMB A;  5I2K B;  3TMG A;  1D4N A;  4YKK A;  2O7U A;  3PUX E;  4X9T A;  2XXQ A;  4WED A;  2ABH A;  5CI5 A;  4PE5 B;  3LC8 A;  3T9H B;  3U8Q A;  3M3F A;  5K2Y A;  4EQ7 A;  5CC2 A;  1B7Z A;  5I56 B;  4C1U A;  5JK4 A;  2UXA A;  4H6D A;  1ANF A;  2THI A;  1FTJ A;  4EUO A;  3UP9 A;  3MP1 A;  5CRY A;  1B5I A;  2DS9 A;  5TPA B;  1NNF A;  2OZZ A;  1N7X A;  2I4B A;  3K02 A;  1IXH A;  3G3K A;  5L9M A;  3USD A;  1PEB A;  2OBG A;  4JSO A;  3U72 A;  2FA7 A;  4G4P A;  5FTI A;  1QJM A;  2PYY A;  4G8M A;  3SEV A;  3CFL A;  4QFK A;  2V93 A;  3CIJ A;  4DDD A;  1QKA A;  2F6G A;  1Z7M E;  1P1O A;  2NOO A;  3TYH A;  3CRB A;  3H3G A;  3N94 A;  5H8Q A;  1VE4 A;  4DCX A;  3TAJ A;  2VD2 A;  2VP1 A;  3OO7 A;  4E0W A;  2UYE A;  3OO9 A;  4MBP A;  2HAV A;  2HAU A;  1B40 A;  1S50 A;  2PT1 A;  3G7W A;  3H6V A;  3MJN A;  1Y9U A;  1FQD A;  2QMW A;  1FQB A;  4LA9 A;  3FXU A;  2P1S A;  3SDF A;  3TTK A;  5KDT B;  4NF8 B;  3TTL A;  3TZA A;  1O64 A;  2I58 A;  5I58 B;  4YKP A;  3TDJ A;  2D3I A;  3FAS A;  4LZ7 A;  4O3B A;  1M5C A;  1B3L A;  1RYX A;  3UK4 A;  3ZKK A;  4NF5 B;  2QS4 A;  2QS3 A;  4YB6 A;  2H9B A;  5AA2 A;  2P0S A;  4PFY A;  2I48 A;  2Y7K A;  1CB6 A;  1MH3 A;  1P99 A;  1Q35 A;  3S2V A;  2F7A A;  2X7P A;  3DEL B;  4BDN A;  2B65 A;  3MQ9 A;  1B5H A;  4R6Y A;  5BUU A;  3VVD A;  3HO7 A;  3S9M C;  3K6V A;  1I6Q A;  4ZZA A;  3O2A A;  2O69 A;  3VLU A;  1CE2 A;  3U92 A;  1JEU A;  1BP5 A;  1URD A;  1XVX A;  1SW1 A;  1SQY A;  2XXP A;  3N26 A;  4FEB A;  2R6G E;  1FTK A;  3I3V A;  4GXS B;  4JWO A;  2P2A A;  1OIB A;  2A5S A;  1PDA A;  4OET A;  4HS7 A;  1D3K A;  5I57 B;  2O7I A;  4DE8 A;  5I84 A;  2I6E A;  4GD5 A;  5DEX A;  4G68 A;  2XXV A;  4P11 A;  4ZEK A;  1OLC A;  5B70 A;  1B3G A;  2DWA A;  1LBB A;  1Q1K A;  2DP8 A;  3IR1 A;  2XXH A;  1B0L A;  1Y4T A;  3MZ9 A;  3FGS A;  3L6H A;  3O6I A;  2ZNS A;  3EQ1 A;  4P0G A;  4HCW A;  3QSL A;  5AA2 D;  3OSQ A;  2AIX A;  2X7Q A;  3H03 A;  3WAE A;  5I59 A;  1ZMG A;  1SVX B;  5H8H B;  5K2X A;  2I0C A;  4YKI A;  3T9U A;  4DZ1 A;  1DOT A;  3VLW A;  5I2K A;  4QSD A;  4U4X A;  4U22 A;  2XXU A;  1A8E A;  1AMF A;  1MS7 A;  2HZK A;  3PU5 A;  4MLV A;  1B3E A;  1OVT A;  3BKI B;  3FJG A;  2ZYO A;  4OFO A;  4ZEF A;  2V84 A;  1RYO A;  1UIV A;  2R71 A;  1PB9 A;  4GFR A;  1EZP A;  4ZE8 A;  3VV5 A;  4FAT A;  3CI8 A;  1WDN A;  2RC7 A;  4F31 B;  2G29 A;  1MY2 A;  4NWC A;  3VDF A;  1B5J A;  4HW8 A;  3DP4 A;  3SES A;  4AB5 A;  4L17 A;  2I0B A;  3F11 A;  3KFM A;  5DEX B;  5IAI A;  3KJ7 A;  4NE4 A;  3U94 A;  1LB9 A;  2B3F A;  4OHN A;  1O63 A;  4ZEI A;  4WKM A;  2GHB A;  3W9W A;  3U1O A;  2Z8E A;  3DM0 A;  4GXA A;  1P1W A;  4MH5 A;  4XTC Q;  4BDM A;  1FQF A;  3PPO A;  5ITP A;  1B3F A;  3MZB A;  1GVC A;  3Q27 A;  4PFU A;  1M5E A;  5CBS A;  1B52 A;  3AXF A;  3IOR A;  5I2N B;  5ICT A;  4RA1 A;  4FIM A;  2PMS A;  3FJ7 A;  3G3I A;  3KN3 A;  3MBP A;  4QFP A;  1LST A;  1MXX A;  4U1O A;  4ZEB A;  4ZED A;  2REG A;  3S9L C;  2ZNT A;  1JET A;  1TFA A;  2QL3 A;  1FQE A;  1TXF A;  3I5O A;  3H6T A;  5KDT A;  3M3K A;  2I3V A;  2XXW A;  3DP6 A;  4F1V A;  5CBR A;  3KBR A;  1NH8 A;  3V8X B;  1B58 A;  2F5X A;  2VHA A;  3KSX A;  3KSJ A;  2ONR A;  3HN0 A;  3JV9 A;  1MQG A;  2F78 A;  2GH9 A;  4NF8 A;  1AH5 A;  3FJM A;  2RF1 A;  3MP6 A;  5IKB A;  3VXC A;  4I1D A;  2GFE A;  4IO4 A;  1I6B A;  4U1Z A;  2ZYM A;  3KEI A;  4U2R A;  1A99 A;  3E4R A;  3K0V A;  1SYI A;  3M3L A;  2Z22 A;  3IJX B;  1Y4C A;  2PX1 A;  3C33 A;  1IQ7 A;  3T96 B;  4I8C A;  1NNT A;  3O29 A;  4F22 A;  5J1D A;  3VLV A;  1N76 A;  1YAE A;  3OO6 A;  4N13 A;  2RC8 A;  4FED A;  1PBP A;  4RYA A;  4YB7 A;  1IIT A;  1QUI A;  3E13 X;  3FIR A;  4I9D A;  4QHQ A;  5CMC A;  5I56 A;  2QSX A;  4BDQ A;  3PUZ E;  3PMX A;  4TLM B;  4ESX A;  1MQH A;  1ZKB A;  3IO4 A;  4TLL B;  5KZT A;  4NMY A;  1Y3Q A;  3OD7 A;  2Q2A A;  3Q28 A;  3A3C A;  2XX7 A;  5KCJ B;  2V3U A;  4LQ2 A;  2Y84 A;  5L8D A;  2QS2 A;  2XD3 A;  2OCU A;  2F8D A;  1YCJ A;  4IO3 A;  1UQW A;  3Q29 A;  1LAH E;  5FTH A;  3B6T A;  3TCG A;  2XX8 A;  2DWJ A;  4PET A;  1MM7 A;  2IEE A;  1DTZ A;  1IXC A;  2DQV A;  5TPA A;  4GWO A;  1DMB A;  1QUL A;  1J1N A;  4OQO A;  4Z7E A;  4ISU A;  1IXI A;  1LBC A;  1QKB A;  3CR9 A;  3FXQ A;  3DLN A;  2DOJ A;  4IGR A;  1SW2 A;  4QRZ A;  5H8Q B;  4GIZ A;  4YZZ A;  3RT8 A;  3VXB A;  4M4G A;  1R9Q A;  4FJP A;  1MQJ A;  3JZJ A;  1JW1 A;  2H98 A;  2F35 A;  4X1D A;  2NWJ A;  4Q0C A;  5H8N A;  1MXV A;  3VFJ A;  3CG1 A;  1MXZ A;  2E1S A;  2F97 A;  3QIM A;  2Q8J A;  3R6U A;  2V3Q A;  3EN3 A;  4OXV A;  4X1B A;  2XXI A;  3ONM A;  3QAX A;  5CM6 A;  3MPK A;  4NF5 A;  4KR5 A;  3G3F A;  4Q5T A;  4Q30 B;  1B32 A;  3MVZ A;  4H5F A;  2XXT A;  1B7H A;  1NFT A;  4H0W A;  2B3B A;  2ZXT A;  3MUQ A;  2ESN A;  4NWD A;  3R7X A;  1OQH A;  1Y1M A;  1GV8 A;  3SET A;  3RTW B;  2H99 A;  4F3G A;  1BLF A;  3S9N C;  4F3B A;  1UIU A;  1SW5 A;  3CG3 A;  1GTK A;  5DYH A;  4F3S A;  1MY3 A;  3OMB A;  3IOU A;  3K6X A;  4R2B A;  1LB8 A;  4F2O A;  1H3D A;  1P1U A;  1A40 A;  2ONS A;  3O9P A;  2YPN A;  3QUJ A;  5EHM A;  4P0I A;  5CMK A;  1NNK A;  2M8C A;  4WEP A;  4F1U A;  3SEX A;  2HQ0 A;  4TQU Q;  4H8I A;  1MXU A;  1WOD A;  4IY5 A;  4EXK A;  3IK6 B;  4BDO A;  5DVF A;  5JEI A;  2HFB A;  3PMV A;  3FXR A;  2XD2 A;  4QFO A;  1SDX A;  3OSR A;  3C32 A;  3FUZ A;  4EQB A;  4ZEC A;  2OK2 A;  1T0K A;  1ZJL A;  5FHM A;  2UVJ A;  3G3H A;  3GBB A;  2AYS A;  3G3G A;  1PB7 A;  3KOS A;  2DVZ A;  1LCF A;  3FVN A;  1BIY A;  4OFL A;  4ELQ A;  1Z7N E;  3IB2 A;  3TTM A;  1ATG A;  3T66 A;  5HM4 B;  2X26 A;  5F1Q A;  1UTH A;  4EDP A;  5L9S A;  3K01 A;  5I59 B;  4BDR A;  3PMW A;  3ECR A;  5L9O A;  1SW4 A;  2GHA A;  2OWS A;  1PC3 A;  1ZTY A;  3MVY A;  5EHS A;  2Z8F A;  3RLF E;  5LOM A;  3TEP A;  4JB7 A;  4ECF A;  1LFH A;  2XHD A;  4FEC A;  1B9J A;  2DWH A;  2ZYN A;  3FAT A;  2XXX A;  5CMM A;  2QRY A;  1Y3P A;  1B6H A;  1USY E;  2F36 A;  5M2V A;  3ILT B;  1FQC A;  1FTO A;  1LFI A;  5H8F A;  1FTL A;  3FD3 A;  4POX A;  3V89 B;  3E9X A;  4QFN A;  4GQO A;  1YTV A;  1R1N A;  4IGT A;  4OES A;  3RUM A;  3TTR A;  4DXU A;  1BTJ A;  4KFQ A;  2GRV A;  3CSG A;  3R26 A;  4F29 A;  5A5X B;  4EQ9 A;  1AIV A;  2PVU A;  2V25 A;  1Y1Z A;  3MP8 A;  3IO6 A;  5ICQ A;  1MQI A;  4GL0 A;  4RPN A;  4IO7 A;  3FZV A;  2DE3 A;  3M8U A;  1JVX A;  2VOZ A;  4N6P A;  4YMB A;  1WVJ A;  3MW0 A;  1VSO A;  4H1X A;  3BFU A;  1M5B A;  1TFD A;  5F7V A;  4C0R A;  1A54 A;  1MY0 A;  2D5W A;  1NMU A;  4NTL A;  4F1Y A;  4F39 A;  5AE4 A;  3MVX A;  4LUB A;  5ELV A;  1EH3 A;  4ELR A;  1B3H A;  4JXI A;  3HHF A;  2KLF A;  1VFE A;  1H44 A;  4NED A;  3SER A;  2DWI A;  3PPP A;  3TCF A;  4LQ5 A;  1ZIU A;  4H5G A;  4DCY A;  1KWH A;  4BDL A;  3PD8 A;  1TT1 A;  1XOC A;  4KHZ E;  3C36 A;  1PBQ A;  2I4C A;  2Y7P A;  3OEK A;  2CMO A;  4NF6 A;  3T93 B;  5H8N B;  5TP9 A;  3FVG A;  1NL5 A;  5HPQ A;  1JW4 A;  1HSL A;  3KZG A;  1AOV A;  3KGC A;  4R72 A;  4DXB A;  3GXA A;  3OEN A;  3PUV E;  1N3W A;  1P1Q A;  3EHS A;  1DTG A;  2VD3 A;  1URG A;  4LP2 B;  4ZDM A;  2Q88 A;  1M5D A;  4IO5 A;  5AA4 A;  1H43 A;  4OEV A;  2E0S A;  1DPP A;  2G93 A;  3PV0 E;  3MVW A;  4F3P A;  3K1N A;  4YAH X;  1XHY A;  1JW5 A;  1YPN A;  4KI0 E;  2F7B A;  3O97 A;  3TKD A;  1VFD A;  4R73 A;  4MFI A;  2NVU B;  1SYH A;  4H67 A;  4IY6 A;  1JQF A;  5KCJ A;  4XKN A;  3PPN A;  3B7D A;  3C31 A;  4DIG A;  5FHO A;  3H4Z A;  4U21 A;  5AA1 A;  2FYI A;  3LSL A;  3N6T A;  3ODB A;  4IO2 A;  3U93 A;  5DVJ A;  3CFX A;  3RPW A;  2XXY A;  4NF4 B;  4JWY A;  1H45 A;  3HST A;  1B7U A;  1MXW A;  2AL4 A;  1MPC A;  1R9L A;  4TOZ A;  2Z23 A;  3PUW E;  5BWJ A;  1A7L A;  3KJT A;  5EYF A;  2O6A A;  1FCK A;  3IL1 B;  1IZ1 A;  1FW0 A;  1LAG E;  1MY4 A;  2OWT A;  3LR1 A;  3PPQ A;  4G8H A;  3UOR A;  1USY H;  4QFL A;  3TQW A;  2Y7I A;  3OO8 A;  3K4U A;  3QXM A;  3IAZ A;  4EF1 A;  4FAJ A;  1JVY A;  1B05 A;  1GR2 A;  3K2D A;  4GLI A;  4ELP A;  2OJT A;  2FNC A;  3IOT A;  1LCT A;  4JSD A;  2UVH A;  4YMA A;  3RT6 B;  3TTN A;  4DLD A;  1N3X A;  2RIN A;  4OEN A;  3T9V A;  4O3C A;  3TPA A;  1ELJ A;  4KYE A;  1B46 A;  3K00 A;  2DXR A;  3H7M A;  1XC1 A;  3N6U A;  3CSB A;  4GRK A;  2AL5 A;  3IOV A;  3K1M A;  3QYT A;  3T22 A;  3T9X B;  4DXC A;  3CFZ A;  1R6Z A;  2DYX A;  2DE4 A;  3BFT A;  3GBA A;  1QW0 A;  4C1T A;  3O6H A;  1II5 A;  1SI1 A;  3H6W A;  3OXN A;  2Q89 A;  3FVO A;  1SD3 A;  2HXW A;  1HSJ A;  3HV1 A;  3L6G A;  2RCB A;  4G8N A;  4KYD A;  5H8F B;  4R6K A;  3LBS A;  4XKR A;  3TQL A;  2I49 A;  1GGG A;  1XT8 A;  4ZS9 A;  4YKJ A;  4MF3 A;  4XXU A;  2H25 A;  2PT2 A;  4OMB A;  2QMX A;  5H8S A;  4RXL A;  1F9B A;  3V5A A;  4KYS A;  3TOD A;  1I69 A;  1MY1 A;  3PPR A;  4F18 A;  5DTB A;  1OMP A;  2RKM A;  2OLB A;  3GLB A;  3EF7 A;  2O1M A;  4GVO A;  3G3J A;  1A55 A;  1N0T A;  1LAF E;  1P1N A;  1S7Y A;  3LSW A;  2DVC A;  2A5T A;  3QK6 A;  4PFT A;  2YLN A;  4RPO A;  3H6U A;  1OLA A;  2XXR A;  2NXO A;  3RY3 A;  3HCQ A;  1ZU0 A;  4I62 A;  4LON B;  5I58 A;  2YJP A;  5DT6 A;  4H8J A;  1SBP A;  1JEV A;  4F19 A;  3C34 A;  3P7I A;  1LGB C;  3KG2 A;  4QSE A;  3VE1 B;  1UTB B;  2RC9 A;  4NF6 B;  4RNS A;  3RN8 A;  5AA4 B;  4RK2 A;  1LFG A;  4Z0I A;  1RKM A;  3FV1 A;  2ZMB A;  3JYR A;  4THI A;  3SEU A;  2ZNU A;  3OEM A;  4PFW A;  2HCA A;  3ILU B;  3KOT A;  1POT A;  2WKY A;  4HTG A;  3TCH A;  2BJJ X;  3IOW A;  4RK9 A;  4ONY A;  1A8F A;  2NUV A;  4IO6 A;  1URS A;  1UTH B;  4RY1 A;  4EXL A;  2REJ A;  3B6W A;  4QSC A;  3LSX A;  3N5L A;  4LVQ A;  3PD9 A;  1DSN A;  1Y20 A;  3I6V A;  4XIG Q;  1AL3 A;  1NH7 A;  3E3K A;  1XVY A;  4JBZ A;  3SKP A;  4JWX A;  2DXY A;  4EF2 A;  1EZO A;  3SEW A;  2QPQ A;  3MPL A;  5I57 A;  3O66 A;  4G68 B;  4GOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...