3TUDA

Crystal structure of syk kinase domain with n-(4-methyl-3-(8-methyl-7-oxo-2-(phenylamino)-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(trifluoromethyl)benzamide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
256
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Identification of Type-II Inhibitors Using Kinase Structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 256
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tudA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tudA01
2BIYA 4IZYA 3AMYA 5IA4A 2C4GA 3FUPA 5TT7A 5EW3A 3TDWA 5FXQA 2X4FA 5DT4A 4BCOA 1H00A 4J97A 4EONA 2UV2A 4O1PA 1OIQA 4MD8E 5D1JA 3ACJA 3HP5A 4R78A 2ERZE 3EN6A 5AR4A 4RZWA 1DAYA 1H28A 4NH1A 2J50A 3FYJX 2B9HA 3S0OA 3F2RA 3KY2A 3QWKA 4FKSA 2JBOA 5CAVA 2QNJA 3LXLA 4Y5QA 5CXZA 3QTZA 5CNNA 2UVXA 2O8YA 3MN3A 5TR6A 2C0IA 3O8TA 5FQDC 3ZLXA 5EI8A 2O64A 1U54A 2O0UA 3Q4UA 4EWHA 3Q4ZA 1W84A 3O7LD 4R6VA 2W1EA 5FP5A 3QRIA 4G5PA 3Q9XA 4YGAA 3FMMA 3WIGA 3TT0A 3OXZA 3KC3A 3UNZA 2E9UA 2WAJA 1OL7A 2PVHA 4F0FA 3TUDA 1BX6A 3GU5A 5HQ0A 2IZUA 3ENHA 3O2MA 4MEDA 3D7TB 5J9LA 3MJ2A 5GJGA 4IZ7A 3KKVA 4OTFA 3S4QA 5IEYA 4H36A 2JKOA 4J96A 4U43A 3GFEA 2QOKA 5M4IA 4PPAA 2QOIA 3RPOA 5CU0A 3AXWA 3DBFA 4KSQA 4AA4A 3Q53A 3MPMA 4YZDA 5HESA 3N9XA 5EG3A 3ZCLA 4OR5A 1O6KA 3VS6A 3NUPA 2ITVA 3TIZA 1WBSA 1BI8A 1WMKA 1WZYA 3QYWA 3B8QA 3F66A 3GXLA 4W4VA 1YKRA 4YJPA 3NEWA 4QMPA 1J7LA 4TYGA 2JAMA 2VTMA 4J53A 4M0YA 4PL3A 4HZSA 4O0VA 4ZSGA 3VJNA 4FG7A 4PRJA 3FQHA 4ASXA 3UO4A 4F64A 4M15A 4XHKB 2R0UA 1HCKA 2BR1A 3ANRA 5I9WA 2C3LA 5CAPA 2IZRA 5EQEA 3C7QA 3KXHA 3OBJA 4ZTSA 5FWKK 4X21A 3V6RA 4WD5A 4O83A 4OBQA 1OUKA 5J87A 3PY3A 2VGPA 2W1HA 4FSYA 2IZSA 3IDPA 4WT6A 4D4YA 2UW8A 2PVNA 4QTAA 5IEXA 2UZWE 5IQDA 4FTTA 4MAOA 4D5HA 3PVWA 2IW9A 1XH6A 3D5WA 4ACDA 2FGIA 2I40A 4PPBA 2GPHA 2GS7A 5IQHA 3EYHA 4JG7A 1WFCA 4BF2A 4BCIA 4BZNA 4E4MA 2XK6A 5KBRA 4JDJA 2I0YA 3BU6A 4AGUA 2PVYA 4C58A 5DT3A 5L2IA 3BQRA 3DDPA 4Y72A 4DFLA 1Q3WA 4AUAA 4I4EA 4KBCA 5BYZA 1AQ1A 3A8XA 3PUPA 2VTTA 4O27B 3RAHA 4APPA 3RHXA 3TCPA 2FSOX 3W32A 2XF0A 2XM8A 5EHYA 3UJGA 4O1OA 4I0TA 3SRVA 4FEXA 2ETKA 3A4OX 3CIKA 5KMNA 4AOTA 5BVOA 2C5XA 4G3GA 5CEIA 3L9NA 1OPJA 4CSVA 2WMXA 4DCEA 3QZIA 3HYHA 2XH5A 4ENXA 2CKPA 4WNPA 2OU7A 4XV1A 3NNWA 3UMXA 5A6OA 3VS3A 5FEQA 2VWVA 4KRDA 4FK6A 4QO9A 5LCJA 2IG7A 4FGRA 2ZYBA 3JY0A 4IANA 5HLPA 2CGUA 1OL5A 1NVSA 4I6FA 3NRMA 1BL6A 1M52A 3G5DA 4FKWA 3QFVA 4DFXE 4FSTA 1SMHA 3GOPA 2HZ4A 4Z55A 1E9HA 3ZXZA 2HENA 4X6RA 2YHVA 4RIWA 4ZZOA 4G3CA 5K5NA 4L68A 2ZVAA 2W1ZA 2IO6A 5CT7A 3OTVA 3DXQA 5FTOA 4FSNA 2VRXA 4JRVA 3GFWA 4EH6A 3UOJA 1ERKA 3EMGA 4HYUA 3ZO2A 3EKKA 5I9XA 4AW1A 1PYEA 3JYAA 4HGSA 3MH0A 4H3BA 1XQZA 4CKRA 1RDQE 4YJQA 4S34A 1L3RE 2GCDA 3DLZA 4JR7A 4C35A 3DJ5A 4F70A 3VN9A 5E8WA 3SLSA 4WIHA 4ZZNA 5M06A 1UVRA 3LPBA 3KA0A 2X81A 4QYEA 4RIXA 4XG4A 3T9IA 4DBNA 4ZS4A 3Q2JA 5HE0A 4RLKA 4PWNA 3HMNA 2JDRA 2VWXA 1PYXA 3QZHA 2QO9A 2BRGA 3MTFA 1WCCA 4W8EA 3QRTA 4GVJA 2X9FA 4CV9A 4TL0A 4F9WA 3KCKA 4FV9A 4EEVA 4FNWA 3UOLA 4K77A 4G34A 4MF0A 4K2RA 4BIDA 4P7EA 3KFAA 4BWXA 3EFLA 4HPTE 2G01A 2VTRA 4V0GB 4L53A 3HAMA 1W8CA 4DLIA 4TKSA 4EK8A 1PXPA 2BILB 3LXPA 4QMVA 5T68A 3ZRMA 1KOAA 3VULA 3LIJA 4O96A 5BVDA 1QL6A 3R02A 1IEPA 4RC4A 4TW9A 5AUXA 2OSCA 4D0XA 4F9BA 1GZNA 4ZY4A 2VN9A 2X7GA 5FP6A 3QTSA 3CS9A 3LQ5A 5CVFA 4Q2AA 1T45A 1YI3A 4I22A 2C1BA 4Y83A 4BBMA 4EQUA 1J7IA 5HG8A 2QOCA 2WMUA 5DE2A 5AUUA 4YC3A 4S2ZA 4FODA 2XIRA 3CPBA 3WARA 3LFAA 3DK6A 5AR2A 3UBDA 3ZO3A 1GIIA 3I6UA 4RX5A 5BMMA 3AG9A 3M1SA 2CMWA 3ATSA 5AP6A 4N6ZA 1F5QA 2UVZA 4PL5A 4U0IA 5DEYA 4B7TA 4BDKA 4NM0A 3WZUA 2IW6A 3K54A 3ZDIA 1GZ8A 3HV6A 3PFQA 4FV8A 3HEGA 4OW8A 4M0ZA 2BROA 2CSNA 4O21A 2XB7A 1O6LA 3FQEA 2GNGA 4HJOA 4IMYA 4NFMA 5JRQA 1QPJA 1B38A 2CLQA 4IW0A 1PXJA 2BRNA 3UQGA 4I94A 3U6JA 2WELA 4U3ZA 5D9HA 5KCVA 2B1PA 1PMUA 3ORZA 4EKLA 3UPXA 4P5ZA 4D2SA 3VUTA 3SGCA 4ZY6A 1LUFA 4N57A 1AGWA 5ANIA 4NIFB 4QP4A 4DA5A 3R8UA 3R6XA 4WNKA 5L6WL 3ZSHA 3MB7A 3NS9A 2YA9A 4KAOA 5CQWA 3R7EA 2J51A 3O96A 2WTIA 3A7HA 4OLIA 4ZZMA 4YZ9A 3U6IA 3DZQA 3QL8A 4F09A 4ACHA 3R9OA 3BE9A 5HKMA 1U59A 4D9TA 2PVMA 5EW8A 3A7JA 3ET7A 5K0XA 2Z7LA 3D2IA 4FV0A 4I0SA 5HCYA 4EBVA 3VF9A 5AAEA 4EOLA 2UW0A 5IZFA 3RPYA 3IO7A 1BUHA 3HDMA 4X3FB 4E7WA 4MKCA 4NTTA 4UMRA 5HOAA 2W17A 2NNWB 5CWZA 4Q5HA 4QP7A 1U46A 5FLFA 3I79A 5LMKC 5AX3A 5BVFA 2XA4A 2GNIA 2ITYA 4FZAB 4PNIA 4C62A 5DHJA 2RF9A 3OOGA 4CFUA 5I9YA 4RX9A 4DFUA 4AW2A 2FYSA 3UZPA 4O81A 5HI2A 5HLWA 3ZHPC 3OY3A 4FL3A 5FBNC 5A3XA 5KMOA 2GQRA 3KGAA 5AUYA 3LCOA 3W8QA 4QMLA 4RIYA 3CC6A 2KTYA 4H58A 4CG9A 1GIHA 3BPRA 2YJSA 3COKA 4A4LA 3AMBA 3U54A 4HYSA 4YO6A 5G6VA 3KXZA 4JIKA 4WG4A 3FMLA 4FA2A 2PMOX 4G5JA 1UNGA 3RZBA 2WHBA 3OTUA 4C59A 3PJ1A 3I4BA 4XS2A 4ALWA 4CCBA 4NYEA 4YC8A 3QD2B 3CGFA 4EHGA 1ZZ2A 5CVHA 4EK3A 5CSVA 2Z8CA 4V04A 3QF9A 4Y95A 3FSKA 2JIUA 4IX5A 4RJ6A 4U42A 3R9DA 3N4TA 2YN8A 2X1NA 3QZGA 3H9RA 4EJNA 5M4CA 3ORKA 2E9OA 5J95A 3SXSA 4F7SA 4CCUA 5HX8A 1F3MC 3C0HA 5C27A 3P86A 2CKQA 3ZTXA 2WMQA 3E3PA 3PSBA 4MX9A 5KMKA 2WMSA 2VTLA 2RFSA 3ZYAA 3PIZA 3W55A 3HL7A 2P3GX 4RFZA 3R1QA 4BTJA 4BKYA 2PWLA 4ZLYA 3DAKA 2X7OA 4GCJA 1URWA 4FMQA 5AUVA 4QOXA 3MFTA 2RG6A 4K9YA 2XYUA 4O7LA 2OF4A 4ZSLA 3PA3A 2B54A 4GIHA 2PVJA 3MTLA 4DGGA 2XNBA 4S32A 1SYKA 5GJFA 4O7SA 4I21A 4NJDA 3ALNA 3VNTA 4I0RA 1Y8GA 4E5AX 4D5KA 2O2UA 3O8UA 3BLRA 4DTBA 2BKKA 2PMIA 2W96B 3D83A 3M42A 2XEYA 3IOKA 3SW7A 3R04A 3VBWA 2J0JA 4RG0A 1YXTA 4CRSA 3FLWA 3CQUA 3DAEA 1H1RA 1MRUA 3CXWA 3ZSGA 2BAJA 5EDRA 2XBAA 1IA8A 2CCIA 3EQRA 5A9UA 4UEUA 2ZMCA 4GK4A 5E1EA 4ZK5A 5KO1A 3EFKA 4YNEA 1MQBA 2GNHA 1H07A 3C4EA 2CN8A 3ROCA 4D2PA 4EOSA 2BAQA 3E64A 3PXRA 1GNGA 2YLFA 3OWLA 3NW6A 3EFWA 2P0CA 3RAWA 4AT5A 4G6OA 4JQ7A 5DA3A 4EOJA 4CLJA 4C3PA 4DE4A 4O38A 1R0EA 3KVXA 4B6LA 4X3FC 2GNLA 2ESMA 1YWNA 2XMYA 1S9IA 5BPYA 5JT2A 3R2YA 4RJ4A 2JKMA 3MV5A 4YJOA 3BHVA 5F20A 1PJKA 2OIBA 4K6ZA 5EOBA 2QOFA 2ZDUA 4HVGA 2EVAA 4XH6A 4ZSJA 3Q5ZA 3MVJA 4ZTQA 3VS2A 4DEGA 4FZ6A 4GT3A 3MDYA 5EYMA 3ZLWA 2WEVA 3OF0A 5KHWA 5M4FA 1Q97A 2V22A 2VTHA 2VTSA 4NJ3A 3TZ9A 5ANOA 3L8VA 4AZFA 5CANA 3RALA 4JBPA 5CEPA 4QMYA 3FMDA 2F49A 2WOTA 3PZHA 5CSHA 3R01A 5F1ZA 2YM4A 3P4KA 3R8VA 3SC1A 3V5WA 3LCSA 4DEHA 3GC0A 4YJTA 4HGEA 5AUWA 4ZMFA 4RX8A 2Y4PA 3O71A 2CN5A 2YABA 3FPQA 2F7ZE 1SM2A 5D41A 5B7VA 2V7OA 4OTIA 3BU5A 5L2QA 1ZOGA 3ZM9A 4RWLA 2BRMA 3E7OA 2R3IA 2XVDA 4KIQA 3L8XA 5EHLA 3EL8A 4DC2A 2W9FB 1ZAOA 5GZ9A 5IQIA 4I23A 4EHZA 3OEZA 5AV1A 2XK7A 1KE8A 3BX5A 4DN5A 3V04A 5D11A 4XOYA 5KZ0A 2C6OA 2WXVA 4AP7A 4BCHA 3KXNA 5AJQA 2X8IA 4C3FA 3P08A 4DEDA 3DAJA 3OW4A 5C26A 3GC8A 2I0VA 3SXFA 3QALE 3FEGA 4QNYA 2A27A 5AEPA 5IUGA 3LAUA 3R1NA 4BYJA 3CTJA 2HIWA 3PP1A 5CALA 4D1XA 4NM5A 4QP9A 4RZVA 3BU3A 3F3TA 3G9NA 3FKLA 5E7RA 1S9JA 3QX4A 4M14A 1Z57A 4EH5A 2R3MA 4LGDA 3VHEA 4JR3A 4BB4A 2OZOA 2VD5A 3AGMA 4C2WA 3RM7A 5DRBA 1XHAA 3QTRA 3BGQA 4MQ1A 4I5HA 4IAAA 1RQQA 1U54B 5CY3A 2WQOA 4DGMA 2JIVA 5LVMA 4HVSA 1OKZA 3S00A 2I0HA 1JWHA 4DH5A 4DEEA 5CSXA 2JBPA 4YSJA 2FSMX 4QP8A 4YSMA 3E93A 4YU2A 1UWJA 3L8PA 3TZ7A 4JI9A 2GS2A 3UOKA 1FVRA 4FI1A 3T3VA 4QYHA 3U87A 4AZVA 3DXNA 1XO2B 4G3DA 4Y5HA 5DR2A 4GVAA 1PXIA 3E63A 4JIAA 2PZPA 2WEIA 3QGYA 4YBJA 5CEOA 1VZOA 3QD3A 4GL9A 4UXLA 5JSMA 4G3FA 2QCSA 4MXOA 2YDKA 4DAWA 3QRUA 3I60A 4FC0A 4WNMA 3QQKA 1MUOA 1PHKA 4MD9E 2W7XA 4AXAA 5M56A 4EYMA 3H30A 2IVTA 2XJ1A 5HVKA 3F7ZA 4FEUA 2WMVA 3OVVA 3KRLA 3BQCA 5FBOA 2PY3A 4KBKA 5HEZA 1W82A 3KN6A 2ZM1A 1ZMWA 3ZDUA 2XK9A 1Q5KA 3SOAA 4FTAA 2W1IA 5DVRA 5C4LA 3QTQA 2CNQA 4EK6A 3SX9A 4G2FA 2XJ0A 2YIRA 2B52A 3PXKA 2QHNA 3E8NA 4F1MA 2BFXA 1YVJA 3A7IA 4GUBA 3TNPC 3ZU7A 3PG3A 4NWMA 3I7BA 3GBZA 4Q5EA 5HCXA 4E6CA 4F0GA 2OZAA 1UKIA 5IF1A 2GDOA 4N0SA 1ZYSA 4YJRA 3U51A 4GUEA 3GOKA 4GFMA 1TQIA 3PPZA 4G31A 4DH7A 3ORNA 1YXXA 4LQMA 4ZTRA 1V0PA 3L8SA 4FZFB 5AP2A 3KCFA 3KULA 4H39A 4ACMA 4GFGA 2BHHA 2X2MA 3PSCA 2WQEA 3HUCA 1OKVA 5C01A 4O0RA 4EH8A 3GCUA 3VVHA 2VNYA 4LI5A 4C61A 2X39A 4CKIA 1GZKA 1A9UA 1M2RA 4YHFA 5IU2A 3QHWA 3VQUA 5HBHA 1Q8ZA 3RKBA 4KA3A 4UN0C 3BIZA 4RWKA 3FZSA 4X2FA 1H26A 3HLLA 5CF8A 2BZIB 1JPAA 5TKDA 3FKNA 4M67A 5H2UA 5EYCA 4M7IA 2XK3A 4NT4A 3SAYA 2QHMA 4KRCA 5ICPA 2BAKA 3EYGA 2XCKA 4IDVA 3MSSA 2OLCA 2GNFA 2R7BA 4ANBA 5I3OA 5ANKA 5KX8A 5B0XA 3ZO4A 1URCA 5HO6A 2F7EE 2C3KA 2RG5A 4BVUA 1RE8A 4IAIA 3VS0A 3SRVB 1P4FA 4DFZE 4FICA 4ANQA 3DS6A 4DGNA 1PW2A 3FL4A 5E8YA 3F82A 4MF1A 4DT9A 1H8FA 4LV8A 5IQEA 3AT4A 4PDSA 4R7HA 4JRNA 3L1SA 3UP2A 2ETMA 4NCTA 2PPQA 3WF6A 4CT2A 1OZ1A 5IDPA 2CGXA 2W5AA 4ZP5A 2J6MA 1R39A 1YHSA 3HX4A 3PY0A 3RGFA 4F6WA 4DFBA 1KOBA 1OPLA 4MXXA 4OTDA 3QXPA 4IZ5A 4LOOA 3ORTA 2XRUA 3FWQA 5EK7A 3WF7A 4UMUA 5E4HA 5F4NA 3SG9A 3H9OA 3A99A 3LFEA 1WBOA 4FV5A 4GU6A 3BHUA 1PXMA 3IW5A 3THBA 3OT8A 2GHMA 2EXMA 2HAKA 3BLHA 1EH4A 4RIWB 1CDKA 2IJMA 3QCSA 3DOGA 4ANOA 2ITQA 3F6XA 3PJ3A 5AUTA 3HAVA 4FOBA 4TYEA 4UWCA 5ACKA 2H96A 3HNGA 1OIUA 4EC8A 1UU7A 5CT0A 1PMVA 3D0EA 4UWYA 4ASZA 5JKGA 2WQMA 3D94A 2J4ZA 2IW8A 4BKJA 4BIEA 3IK3A 5JFXA 2OGVA 3O17A 2AC3A 2VWZA 1E1VA 3UYTA 4BIBA 3MVMA 3G9LX 4B0GA 3EQIA 3SHEA 4V05A 3RPSA 4HVDA 1TVOA 3OUNB 4XG3A 4YBKA 2C6LA 4F6UA 3UNJA 4FK3A 2NRUA 4M69B 3OCGA 1QPDA 4V01A 2ZM4A 4IHPA 4FT3A 1UA2A 3ACKA 4RIXB 4D55A 3C9WA 2YIXA 4MNFA 2HZIA 3R7IA 3JR1A 3EHAA 2Q0NA 4NM7A 3TI1A 3RVGA 3Q5IA 3NUUA 2XNMA 5HTCA 1OECA 4FKQA 4JX7A 2IVVA 3VQHA 2B7AA 3FQSA 2I6LA 4U97A 5DFPA 5LMBA 3WZJA 4YZNA 5DPVA 5L6PA 3NW5A 2ZMDA 3LMIA 3VS5A 3H0ZA 3D5UA 2JC6A 4AE6A 2OG8A 4H3PA 3TNHA 3QWJA 4XRJA 2BDFA 2J5EA 3K5VA 3MVHA 2UVYA 4FZDB 4J7BA 3U55A 4D0WA 2YM7A 4IVBA 1FBNA 4F7NA 3EJ1A 2J5FA 4FYNA 5CENA 4BDHA 3RI1A 2LAVA 1SZMA 3CSVA 2NO3A 3R00A 3BZ3A 2C6IA 3R7UA 4LOPA 4AW0A 4HW7A 1TQMA 4LG4A 1UWHA 1OL2A 3R30A 4NSTA 2ZM3A 3W8LA 4BCNA 2J90A 3AC8A 3IONA 3P7BA 3UIMA 3DGKA 3Q04A 4O7VA 1YI4A 3BGZA 4QMUA 3KXGA 5I4NA 4QMXA 1Q8WA 2VO3A 3G2FA 4K18A 4U44A 4ZMEA 4ZTNA 4DEAA 1OVEA 4WA9A 4TXCA 4UZHA 5B2KA 5C8KA 3TV7A 3TUBA 4CRLA 3IG7A 1LPUA 2J2IB 2FUMA 2ZB1A 3F2NA 3L9MA 4GSBA 4I5MA 4LOQA 3GC7A 4NU1A 3EWHA 4DGOA 3E5AA 1UU9A 4IJPA 3U8WA 4Z7HA 3FY2A 5IPJA 4DG0E 2O65A 3O51A 4LMUA 1FMOE 2HYYA 3R21A 4F0IA 4DEIA 4G6LA 3TTIA 5G1XA 3MESA 1UNLA 2Z2WA 4GYGA 4CLIA 4YLKA 3HKOA 4RC2A 4TT7A 5JQ8A 1Z9XA 4XOZA 2CDZA 3F5GA 3GCVA 3C5IA 4EH4A 2X7FA 3O8PA 3MW1A 3QA0A 3P1AA 2PL0A 3QQFA 4OTPA 3VIDA 3TG1A 3ZFYA 2NRYA 3Q52A 2PK9A 2OFVA 4ZOGA 3GU4A 2YFXA 4AU8A 5AP0A 4BI0A 2UZLA 3B8RA 4FG8A 5HNBA 5HIEA 1XH9A 4TWNA 2RKUA 4FTMA 4FUXA 2QQ7A 2WTJA 4AS0A 4F7LA 4EZ7A 4GG5A 3TKUA 3ORLA 5A14A 2WMWA 3BYSA 3UC3A 5EH0A 2WTWA 4J99A 3EZVA 1MQ4A 1WBNA 3NLBA 2J0MB 4TPTA 5HICA 4AGWA 4YJSA 4IC8A 4JBQA 3TTJA 2YCRA 4I6HA 4YHTA 4RJ8A 4F1TA 3FMEA 4LGHA 2HZNA 3C13A 3GGFA 4HCVA 2JGZA 3C4WA 3GCSA 1ZOHA 4U80A 4M66A 5L2SA 3I81A 3F3UA 3PRFA 3LM0A 3VS4A 3WZKA 1JQHA 1PKDA 3Q32A 4H05A 4JXFA 4JJRA 4AA5A 4PUZA 2X6DA 1J1BA 1O9UA 2VUWA 2H34A 3IOPA 1H1PA 4IM0A 4TYHA 2HK5A 5J1WA 3MJ1A 4JBOA 3A60A 5IA5A 4HCUA 4CEGA 1ZMVA 1G3NA 4RJ5A 1VYWA 5E8XA 4M13A 4ZS0A 5JH6A 3WIKA 2CCHA 1KV2A 2C6DA 3GC9A 4GIIA 4RIYB 3GCQA 3UGCA 3KRJA 2QOQA 2V5QA 2XJ2A 3H0YA 4I41A 3VW8A 3UPZA 4L6QA 3PVUA 3QGWA 4DH8A 2Z60A 1M2QA 3FLYA 2OIDA 5KE0A 4CV8A 2J0LA 3OP5A 4BHZA 5IUHA 4FIEA 4B4LA 3F3WA 5EYKA 4DH3A 1FPUA 2BDJA 2OBJA 4E93A 4QPAA 3R28A 4KKGA 3ZFXA 4J95A 2R3GA 4EZ5A 5M44A 4D58A 3KMWA 2QC6A 2OJIA 5LOHA 3F3VA 3UQFA 5IQBA 4ANLA 5IA3A 2VX1A 4AN9A 4KSPA 3FXXA 3PP0A 5ACBC 4U6RA 4L44A 3NW7A 4AACA 3UZTA 4USDA 3DK7A 3AC2A 3HV3A 4ANNA 5HGIA 2WTVA 5H8EA 3MA6A 4XP2A 2ZAZA 3RWQA 4CT1A 2DUVA 5CTPA 3ZLYA 4K1BA 4FKGA 3W2CA 3QUPA 4KBAA 4M84A 4FOCA 3GP0A 4JBVA 4TNDA 2YJRA 4KINA 3Q4CA 3WILA 4MQ2A 4PTGA 5AR3A 2XKFA 2C69A 3BELA 1Q99A 4GH2A 4IXPA 5C9CA 3VC4A 2O63A 2FSLX 3HRCA 4FSWA 3R7OA 3SDJA 4BCGA 3PJ8A 2UZTA 3IDCA 1P5EA 3RHKA 3T9TA 3UODA 5JRSA 2C5OA 2R3OA 3FE3A 3DB8A 4E20A 4BGQA 4XYFA 3RAKA 4FTKA 3NVMB 5HU3A 4CQGA 4XBRA 2IZTA 2OJ9A 1UNHA 4HYIA 4BCPA 2YZLA 4QMSA 3DKCA 5DGZA 4C02A 2Z02A 1NVQA 3LM5A 3PG1A 3ULIA 3FV8A 3ZM4A 4C4HA 4D2TA 5D7AA 4C7TA 4FE2A 4C38A 1NVRA 4CMUA 5K5XA 2XYNA 3CTQA 3CQWA 3RNIA 1BMKA 1W7HA 4N4SA 3AGLA 4NKAA 5FXSA 5KZIA 5AA8A 4AT4A 1SNUA 2PMNX 3ERKA 4L01A 2PU8A 2IWIA 3K3JA 3QC9A 3V51A 4Z16A 4EOQA 4MNEA 4WBBB 2XCHA 2YEXA 3PZEA 5E92A 4UBAA 3R9HA 3WZDA 2QODA 4FV2A 4WBOA 3DDQA 3PLSA 4K0YA 3TACA 4IH8A 2E9PA 4Y85A 4O6EA 4C57A 3CD3A 4CD0A 4KUJA 3ZRKA 2CNUA 3Q60A 4L3LA 2RSVA 2XNGA 3UMWA 4CNHA 3PWYA 4E3CA 2JDVA 3UDBA 1PRYA 3K5UA 4J8MA 4W9WA 4D4VA 1BKXA 1Y91A 2QLQA 4NKSA 4GFOA 2A2AA 4FKTA 3B2WA 1PMNA 3DCVA 4I20A 1BYGA 5HIBA 2BVAA 2OO8X 1G5SA 4JVGA 3LQ3A 2BHEA 4TZRA 2F9GA 2R3KA 4RWIA 1K9AA 1OMWA 5EYDA 3ZFMA 2YZAA 1T46A 4O7RA 3FPMA 4JL9A 4QTDA 3U4WA 4FIGA 4MXCA 4HPUE 4RVTA 4FGBA 4QTCA 4IWOA 4JS8A 1WVXA 4D2WA 3EKNA 2ZDTA 3FBVA 5C03A 5I9ZA 3QBNA 2XRWA 3Q9WA 3ZBFA 2KULA 4YP8A 2Q0BA 3AD6A 3EN5A 4MTAA 5E8VA 2BRHA 2OJJA 5GIPE 4F6SA 1OM1A 2EB3A 3FLZA 4E1ZA 3BHHA 3FC1X 4KKEA 5L8LA 2B9IA 1JOWB 3DB6A 3BGPA 3BYOA 3FMHA 2C5NA 3NYOA 1ZYLA 3ULZA 2BFYA 2DWBA 3NYNA 4C8BA 5LARA 1JNKA 3I1AA 5LQFA 3H4JA 3DKGA 5D10A 5CZHA 4USEA 2CPKE 4BDEA 3QUDA 5FEDA 3FLNC 4QTEA 2ITWA 1OB3A 3P5KA 3W10A 4EORA 3HVCA 4LRKA 4PMTA 5F9EA 5IA1A 2EUFB 2VO0A 4IX4A 4UZDA 5EQPA 3KXMA 4PY1A 3OG7A 4U45A 3V3VA 4LMNA 4JNWA 4CMTA 2W4KA 2R3FA 3BWJA 2RFDA 3NCGA 3OBGA 4GT4A 3JUHA 3MFRA 3POOA 4QMWA 4R5YA 4W9XA 5EDPA 4CFFA 2RFEA 5CAOA 5HU9A 1G8AA 1UU3A 4NK9A 4C4JA 3ZUVA 2X8DA 4ONAA 3UVRA 5IEVA 2YWVA 1Z5MA 1ZYDA 3LQ8A 3MY0A 5DOSA 5H9BA 4YTCA 2WZJA 3A2CA 4FT5A 2UZVA 3ODYX 3DPKA 5AR8A 2OF2A 2VX3A 2R3LA 3QUEA 2ZV2A 3RK9A 4D1SA 5DNRA 4PMMA 4U40A 3G90X 4ITJA 4I4FA 4GT5A 1NW1A 1HOWA 5K4IA 2P2HA 4XEYA 2GMXA 4A4OA 2DS1A 3A62A 2P55A 4CZUA 2I0EA 4RQKA 3QA8A 4JDKA 4O0SA 5GZAA 4H1MA 3FLQA 1YRPA 1Q8YA 4WO5A 4YC6A 1O6YA 1SNXA 4FVRA 1UU8A 4OUCA 4W8DA 2HW7A 3V01A 4NW5A 4BDFA 5GINE 3MFUA 4MYGA 4OTRA 4EOIA 3Q4TA 1KE7A 1P14A 3A61A 3CD8A 4FKIA 5AV3A 3RCJA 2WTDA 4DG2E 4EH2A 3N4UA 1Y6AA 4N70A 3OS3A 3HA8A 4QTBA 1XBCA 1OL1A 1IAJA 2ITPA 4IC7A 1IRKA 5E8UA 4FSMA 3MY1A 3MI9A 4AX8A 5AV0A 3DKFA 2VAGA 4IFCA 2PZ5A 4PTCA 2G1TA 4U9AA 4TY1A 2JDSA 3AD5A 2GTNA 3Q9YA 4FF8A 1MP8A 2X6EA 2JITA 3COIA 3TWJA 3VRYA 3G33A 3N51A 3FKOA 4W4YA 1IASA 3HA6A 2OZAB 5FG8A 4QD6A 1J3HA 4I5CA 4E6DA 3MFSA 1JKSA 2YIWA 3LMGA 4FG9A 2HY81 4ACGA 2X4ZA 3B2TA 4L42A 2OFUA 3KK8A 2VU3A 5L4QA 3EQCA 2H9VA 2UUEA 4FTNA 4DBXA 3C4ZA 4AAAA 1H08A 1OL6A 2FH9A 2XNOA 3II5A 3KULB 4L7SA 3U4UA 3UQCA 1YW2A 4L3PA 1GOLA 2PE0A 5M55A 4AOIA 2Z7QA 4RSSA 4B99A 3GCPA 4RJ3A 1ZXEA 3EOCA 3G6GA 4R3PA 4QMZA 2H6DA 5DMZA 4PQNA 4ZSAA 3UP7A 4ANMA 3C50A 3PVGA 3QKLA 4BWKA 4JG8A 2C0TA 2XK4A 4C0TA 5IKWA 4G6NA 4EWQA 5HE2A 3MVLA 2WQNA 1G8SA 2VWWA 2WMBA 2BKZA 4FKJA 3T8OA 5AMNA 2PZIA 3UO6A 3CBLA 4QMMA 3V8WA 4Z3VA 1H24A 3V5QA 2JFLA 5EI2A 3F9NA 3VBXA 3JVSA 4A9SA 4P2KA 2QI8A 2GTMA 3FI8A 1FGIA 5DR9A 2HZ0A 4PDYA 1FMKA 3BCEA 2C6TA 3KMUA 4KIKB 1DAWA 4TYJA 4EOOA 2IPXA 3QLFA 2WMRA 2PVFA 3CCNA 5H3QA 4U81A 4AN3A 1OUYA 2BMCA 2YISA 2UW9A 4ASDA 4BZOA 3TM0A 3UVPA 2VO7A 4QMQA 4K33A 4AT3A 3CE3A 4ZSEA 2OJFE 4N6YA 1UKHA 4LUEA 4FV4A 4WHZA 4BDIA 1VR2A 3DJ6A 4LGGA 4AZEA 4APCA 1M7QA 2Y7JA 3PXFA 1KWPA 4YPDA 4YPSA 3CGOA 2ZV9A 2WIPA 1SVEA 4I1ZA 5DR6A 3ZH8A 5M07A 5C8MA 3QQHA 3E7VA 3MH3A 5DT0A 3TV4A 2PHKA 4FSZA 5JMSA 4F7JA 1WBWA 3QKKA 4O0UA 4ZIMA 3KRXA 3HECA 2SRCA 3VBTA 4BCQA 4UMPA 2YM5A 1Q4LA 1NY3A 4WRSA 4CMOA 4XP0A 5CI6A 3NR9A 2PUPA 4G9RA 4XP3A 2YM6A 3QAME 1ND4A 2XIKA 4DHFA 3NWWA 5GJDA 2JDOA 2OIQA 3VF8A 4FVPA 2PE1A 1H1SA 5L8KA 2BZJA 2I1MA 3WBLA 5JZNA 3ZC6A 2RFNA 3HV5A 5J9ZA 4TN6A 4HOKA 4BYIA 5BVNA 3NUNA 2XM9A 5GHVA 2HOGA 5M51A 4YZCA 3QTWA 4O7WA 4GKHA 1PXLA 4B8LA 1YWVA 1GAGA 4O82A 3TUCA 3Q6WA 4LFIA 1WVYA 5FM2A 4X2GA 4ACCA 1JSUA 5TOZA 2REIA 5HG7A 1H27A 4MBJA 3R1YA 3MIAA 5HD7A 2YM8A 3MYGA 4UMTA 3WZEA 3RINA 3GUBA 2O3PA 2C6KA 1RW8A 5HD4A 3D14A 3HMIA 4HYHA 5CS6A 5BUEA 2X8EA 3GVUA 5IH5A 1YWRA 3IW7A 3DQXA 2E9NA 1H1QA 4O22A 4YHJA 3FL5A 2A4LA 3FMKA 3H9FA 3REPA 3TNQB 4BBEA 4PP7A 3ATTA 1WBTA 4FV6A 5AP1A 4PL4A 1HCLA 3IGGA 2F2UA 1REJA 3IW8A 3OWKA 5CAQA 4RBLA 2GHLA 5ETIA 4NM3A 4G16A 5AP5A 3FZPA 3PJ2A 4YLJA 3G51A 1PKGA 4IAZA 2PULA 3EQHA 4D1ZA 3IECA 3VHKA 4GEOA 3QQLA 3NDMA 2XEZA 3PA5A 3DNDA 4XG7A 3VBYA 4S33A 2FA2A 2QOLA 4D2VA 4U7ZA 2VGOA 3LFNA 4GG7A 2PMLX 1PY5A 4MH7A 3I5NA 1L8TA 4RIOA 3KVWA 5A46A 5KHXA 3AD4A 4GKIA 4NCTC 4KWPA 3PA4A 3FI4A 5BVWA 5FXRA 3TJCA 2ITTA 3RAIA 4DINA 2YIQA 3P7AA 4EHVA 2IVUA 3W2PA 4XUFA 3A7GA 3UNKA 3E92A 1YXVA 2QG5A 3ENMA 4RPVA 2QD9A 1DM2A 1NA7A 1WBPA 1YHVA 2XP2A 1IA9A 5JK3A 3LJ2A 3TKIA 5L2WA 4DCAA 1R3CA 5AM6A 3SQQA 4Z9LA 3ZZWA 3MA3A 4IB1A 4RJ7A 5H8GA 1CKIA 4QQTA 3TEIA 4CFMA 5HCZA 2Z7RA 2CKOA 2ONLA 3LXKA 4XV9A 1GIJA 2X2KA 3RPRA 3BRBA 3O7LB 4IZAA 4FKLA 2VTPA 5AV4A 2OICA 4RX7A 1M17A 2F57A 4GRBA 4EH9A 2ZJWA 5JGDA 5K4JA 3V5JA 5JGBA 2WKMA 4AA0A 3HMMA 3QTUA 4ANSA 2OH0E 4FYOA 3C4CA 3VUHA 5K0KA 4C4EA 2V7AA 3OWPA 4ZJJA 5JFVA 2VTJA 3FYKX 4YO4A 1YDRE 1OITA 4FSQA 4IVDA 3VO3A 2OXXA 4TYIA 4IJ9A 4JOAA 4B9DA 3BHYA 3QC4A 5AX9A 2XK8A 1FGKA 4TYHB 4O6LA 5IA2A 5AP4A 3VS1A 5L2TA 4XRLA 3IDBA 1JKKA 3KRWA 4U8ZA 3GQIA 5FGKA 2WGJA 2B9FA 1OPKA 4ZEGA 1IG1A 2WOUA 3TKHA 4F9CA 3W2SA 3HV7A 1X8BA 4L3JA 2G2IA 3AC5A 1CMKE 3DTWA 2C5VA 4WSYA 3MY5A 5IDNA 4YZMA 4FIJA 5J79A 3TIYA 1QMZA 3OXTA 2QOHA 3NCZA 1YDTE 4HVIA 2UZEA 4EC9A 4W4WA 4BTKA 3HUBA 3LJ1A 4G1WA 2VTQA 3DBQA 5ETCA 1RJBA 4YLLA 4GYIA 2UW4A 2VNWA 1SVHA 5IISA 5LMAA 1M7NA 3OOMA 2DYLA 1R1WA 3E8DA 1ZZLA 2XNPA 3JXWA 5CXHA 4CFVA 2GS6A 3ORIA 3ZEWA 2CJMA 2PVLA 4IIRA 4A07A 3SA0A 2QG7A 4BDDA 2G15A 4MXYA 1H0WA 2C30A 5E1SA 2WQBA 5EM6A 3TJDA 4BI2A 5A6NA 5HHWA 4C2VA 2RL5A 2WU6A 1YOJA 4BY9E 3CEKA 2YAKA 1I44A 5C8NA 4JQ8A 2OWBA 5EOLA 2W99B 1AD5A 3LFQA 4QYYA 3WI6A 2VWYA 4TWCA 3DA6A 1ZRZA 3DTCA 1XR1A 3PXYA 4NTSA 4GJ3A 4U79A 2WD1A 3RM6A 3BV3A 4FIHA 2R64A 2YIYA 4O7YA 3KK9A 3UG1A 4I6BA 3IGOA 4I93A 3LJ0A 5CU3A 4CZYB 2VO6A 5AWMA 4O0WA 4YMJA 4U41A 4FNXA 3VUKA 4KIOA 5DG5A 4F1OA 3HRBA 3FMJA 3W2QA 3QYZA 3ZXTA 3G0FA 3EQDA 4XG2A 5E8ZA 4G9CA 4F9YA 3O50A 1PMEA 2BTSA 5ITAA 4KD1A 3D7ZA 1U5RA 3QKMA 4QYGA 2OJGA 3BLQA 5AADA 2WFYA 4IADA 4UX9A 3IS5A 3K3IA 1FINA 3R1SA 4I6QA 3EZRA 5FEEA 3BWFA 1LR4A 4UWBA 4XJ0A 5J7BA 3HGKA 5DRDA 3GB2A 1ATPE 3Q9ZA 3VUIA 5AV2A 4E5BA 4DTAA 5JFWA 2XS0A 2VWBA 4EYJA 3JS2A 3C51A 3NYXA 4UYNA 5KMJA 3DFCB 3P78A 4A9TA 5LXMA 2YWPA 1JAMA 3AOXA 3HMOA 2QR7A 2ITOA 4MNEB 4NEUA 3OXIA 5ANDA 3CR0A 3KF7A 5CNOA 1Q61A 5ETAA 4DEBA 5GZ8A 1W98A 2XIXA 5C1QB 3W18A 1P4OA 5HVYA 4QYFA 4O86A 4XLIA 3ZUTA 2PTKA 4YZBA 1H01A 2UW7A 3S95A 3UE4A 4OT5A 1BL7A 3FHIA 4FKUA 4JDHA 5EM5A 4C37A 3QX2A 2QO2A 4TTHB 2PSQA 4L46A 2Y0AA 4IAYA 4JT3A 1VJYA 3W16A 2XKEA 3QU0A 4NW6A 4WNOA 4XV2A 3SV0A 2RGPA 4CKJA 4JDIA 2XUUA 4D4RA 4PMPA 3R7YA 3TNWA 5EM8A 4FSUA 4FIIA 2H8HA 2XKDA 3BEGA 5TO8A 4CFXA 4DGLC 2R2PA 4CQEA 3OC1A 5CAUA 4CZTA 3DLSA 3FJQE 4FT9A 4EHEA 4P4CA 3F3ZA 3GU8A 4ZTMA 2CNVA 3DT1A 5LVPA 3TV6A 2EXEA 3QQGA 4RRVA 1KE9A 1BLXA 3E88A 4FL1A 3QQJA 4IEBA 4L9IA 1XKKA 3VUDA 4FKPA 2VWIA 3JY9A 2W9ZB 3QZFA 3I7CA 2J0KA 2VTAA 5E8SA 1JSTA 1JSVA 1W83A 3QHRA 5LWMA 5A4LA 4TNBA 1U4DA 4GK2A 2WB8A 3CLYA 2ITUA 1W0XC 4RQVA 2WTCA 4ZY5A 4JLCA 2VTIA 1APME 3C4XA 2HXQA 2ERKA 2A1AB 3BYUA 4II5A 3EN7A 4MD7E 5HE1A 4L45A 3RK7A 5EHOA 4GK3A 3D15A 4MHAA 5AM7A 3TZMA 4ARKA 5J1VA 2Y6OA 4FZ7A 5J7HA 3GT8A 3OROA 2J7TA 4FX3A 3R73A 4RFYA 1PXOA 3COMA 3BBWA 4M8TA 3ID6C 4HGLA 4DLJA 3E8CA 4EL9A 5BVKA 3HP2A 4PDPA 3LW0A 2PVRA 2PZYA 4FKRA 4C34A 3R2BA 3EQBA 3EB0A 4IB0A 1YQJA 4J98A 1OI9A 2W5BA 2C3JA 3DK3A 4OT6A 4QMOA 4A7CA 4CTBA 3OT3A 4CYIA 3O0GA 2GNJA 3DV3A 3D5XA 3EH9A 1YXUA 4S30A 1ZYJA 5BMSA 4FVQA 4QRCA 5IQFA 3AC3A 4BICA 5FTQA 3LVPA 2V62A 2ZB0A 3NYVA 5C4KA 2X9EA 4RVKA 3H10A 3OCTA 3PIYA 4R3RA 4IFGA 4BCKA 4CVAA 4E6QA 2UW5A 3QTIA 3ODZX 3QQUA 4K11A 5HBEA 4RFMA 4EJ7A 2PUUA 3R8MA 5IH4A 3R22A 3T3UA 3COHA 4BDGA 2PZRA 5DN3A 4C4FA 1Y57A 1YHWA 2BUJA 2IN6A 4BRXA 4FTLA 3BHTA 4FBXA 2YCSA 3FXZA 2CGWA 2QU5A 4DT8A 2JKQA 1BI7A 2AYPA 4UALA 3U9CA 4XV3A 2X0GA 5GNKA 3VWAA 4YJVA 5LJJA 2IVSA 3SG8A 3E3BX 3F88A 4P90A 3LKMA 5LVLA 3LXNA 2QR8A 5EKNA 3NAXA 4I24A 3UIXA 4IX6A 3RNYA 4RVLA 5HNGA 2G2HA 2F2CB 1GZOA 4OBPA 5ANJA 3PPJA 4ZXTA 1GJOA 2CHLA 4G17A 2YITA 2BIKB 2ZV7A 4FTRA 3WE8A 1QCFA 4FTQA 5HTBA 4KNBA 5HO8A 3FAAA 2VV9A 3GNIB 4L8MA 3AC4A 4UY9A 2B9JA 3R7VA 4HNFA 2GQGA 4YTIA 4EH3A 5HX6A 2WIHA 2WPAA 4FTCA 3FZOA 4WG3A 4DH1A 2LGCA 1ZY5A 2A0CX 3UG2A 3JPVA 4O7ZA 1FVVA 4WOVA 3FXWA 4R77A 4FNYA 4I3ZA 3GI3A 5CSWA 4C36A 3LCKA 3HRFA 4RA5A 5KUPA 3LLTA 1MRYA 3LFDA 3NUAA 2QU6A 4ORKA 4KKHA 5IUIA 2G2FA 4IAFA 2HWOA 3IW6A 1ZLTA 1M2PA 4X2NA 4EQMA 5CQUA 3FHRA 4GW8A 3FY0A 2W4OA 1K2PA 3P23A 2AC5A 4AFEA 4FTIA 5FM3A 5IQCA 1ZY4A 3ZSIA 4G3EA 3BYMA 3AT3A 4DFNA 2XNEA 5EI6A 2YERA 4LRJA 5DH3A 3BYVA 1KSWA 3R8ZA 3I5ZA 1Y6BA 3FI2A 4M69A 4I92A 5HG5A 2V0DA 2B53A 3OD6X 4MXAA 5CVGA 4BCFA 2W1CA 2Y9QA 5KNJA 3UTOA 1SVGA 2A19B 3RCDA 2QOBA 3Q96A 2XBJA 2QURA 3GU7A 1QPEA 3ZONA 3V6SA 4ASEA 1H4LA 3PXZA 5A4QA 5CSPA 3PPKA 4IE9A 5ANGA 2EU9A 3VRZA 5IQGA 4YTFA 2BALA 5A54A 4O0XA 3G15A 4QPMA 3VAPA 4D2RA 2ZOQA 3AQVA 5FRIA 2O5KA 4BDCA 3NZ0A 4EZ3A 3F2AA 5JZJA 3PYYA 3FC2A 2QLUA 3QCYA 4USFA 3LE6A 5IMXA 2PYWA 4O84A 4E26A 4FEWA 4O7NA 3LFBA 2F7XE 2UZDA 1ZMUA 5L3AA 4BL1A 5AIKA 5BYLA 3Q3BA 4YJUA 3V5PA 5AA9A 5JN2A 4L43A 2WTKB 5J8IA 4WKQA 2GU8A 4UMQA 4LL5A 4AZWA 2JIIA 3A7FA 3OMVA 5CYIA 4NL0A 4J52A 1XJDA 3QD4A 4S31A 5L8JA 5T6KA 3AC1A 2R3RA 3FLSA 5HNIX 1OBDA 4A9UA 2OH4A 1V0OA 3LOKA 4FKOA 4XG8A 2W1GA 4M97A 3F61A 4QQ5A 4DF3A 2X2LA 5I3RA 1CTPE 3WF5A 3RZFA 3ZBXA 5HO7A 3CKWA 4C4IA 4F63A 4BZDA 1WAKA 5H8BA 5BUIA 2HW6A 4FV3A 4X0MA 1R0PA 3QCQA 3TL8A 4Y73A 3DU8A 4CYJA 3D7TA 3ZLSA 4O91A 3I0QA 3O23A 4BN1A 4GS6A 3TDVA 3MGYA 3C0IA 1H1WA 4DG3E 1OIYA 3KU2A 2QONA 2QKWB 5HBJA 2GSFA 2UZOA 1ZYCA 1PXNA 5AAGA 1FVTA 4O0YA 4XCUA 5HVJA 3DBCA 3SW4A 4FTUA 4HCTA 5AP7A 2GHGA 1YXSA 3EIDA 1IAHA 5A4TA 3PRIA 3D4QA 3RMFA 3BBTB 3EN4A 4ZTLA 4ZJVA 4E5WA 2V55A 4GU9A 4AG8A 2Y6MA 4H3QA 3D9VA 3RBWA 3DXPA 1OKYA 4R1YA 5CU2A 5JFSA 3RTPA 1NT2A 1J91A 4P5QA 2W4JA 4L00A 1XH8A 3OHTA 5EFQA 5M4UA 3M11A 4RA4A 3NUXA 4EBWA 5AUZA 3I6WA 5BYYA 4X2JA 4DYMA 5EDQA 3KQ7A 4BBFA 4XG9A 1K3AA 4M68A 4FIFA 4ERWA 1Q8TA 5E91A 5M57A 3WF9A 1OKWA 5AR7A 2JAVA 5K9IA 5A4EA 5ETFA 4PMSA 2C1AA 4CG8A 4OTHA 5E90A 3QD0A 5J5TA 3RJCA 4ALVA 3BEAA 1CKJA 1YDSE 1J7UA 3CJGA 1YOMA 2YCQA 3CP9A 3QCXA 4IX3A 4D9UA 4A9RA 4EKKA 5CZIA 4XLVA 1NXKA 2YLEA 3S3IA 2Y4IB 4FKVA 4E8AA 3BKBA 2FO0A 1Y8YA 2FVDA 2P2IA 4PNKA 2B0QA 3NNUA 3ZEPA 1DI9A 2W1DA 3W2RA 3ANQA 4QP6A 2RIOA 2CGVA 5HTIA 1JVPP 2HY0A 1M14A 4I5PA 3FDNA 4NZWB 2GFCA 4ALUA 2W06A 1KE5A 4EH7A 4C4GA 4Q9SA 4FEQA 2C3IB 3CJFA 1F0QA 2HXLA 3F5XA 4FTJA 5F95A 4CFNA 4UB7A 1CSNA 3EQPA 3D5VA 4IB3A 5DWRA 1GY3A 2WTKC 2WMAA 3NUYA 1Q3DA 4F9AA 3A4PA 3HZTA 3W1FA 4EUTA 3F5PA 1XH4A 3WYYA 4JQEA 2HWPA 4OTGA 4DTKA 5FDXA 4FR4A 4IM3A 4BGGA 3GENA 3ZRLA 3NSZA 3HV4A 5CF5A 4OGRA 4D28A 4LYNA 1DS5A 4MBLA 3PJCA 1B6CB 2GQSA 2UZUE 2DQ7X 3PTGA 3PDTA 4BR3A 2UZBA 4UV0A 5CEQA 5AIRA 3FZTA 4O7TA 3KL8A 3DQWA 4IWPA 4PPCA 4C3RA 4HZRA 4KB8A 4D4SA 2UZNA 4PX6A 4Y8DA 3U6HA 2BPMA 3R83A 4WSQA 5E8TA 4E4XA 4RC3A 4JAJA 1JLUE 3HMPA 4PTEA 3LHJA 2HELA 4AF3A 5AR5A 3BI6A 2W0JA 4LRMA 4F99A 5HE3A 3S2PA 5CF4A 3GU6A 3WYXA 5JEBA 2XNNA 2C6EA 3H3CA 3LFCA 3RPVA 3UOHA 1DI8A 3N4VA 3LFSA 4JAIA 4OTQA 3AT2A 3ORXA 4EOMA 4DFYA 4K8AA 4WG5A 3V5TA 5L6OA 3SKCA 4AGCA 5KMIA 4O2PA 1VYZA 4O2ZA 4ZTHA 3W2OA 4EOPA 5LMKA 4LL0A 4OAUC 2YDIA 3WE4A 3OEFX 5HORA 2WO6A 1P2AA 4O0TA 2PVKA 3DJ7A 2VTOA 2BZKB 1LP4A 2JDTA 5DBXA 4JX3A 2P4IA 2WMTA 3PE2A 1CKPA 5LVNA 4XG6A 3FZRA 1TKIA 3K2LA 3OCSA 4V0GA 4XMOA 5CU4A 3W33A 1ZOEA 3EN9A 5IA0A 3NUSA 3D2KA 4BCMA 4EK5A 3QRJA 2C0OA 3OY1A 4QP3A 4U5JA 3EL7A 3ZOSA 2UW3A 4ERKA 2BCJA 2PUNA 3ETAA 5KKRB 1JKTA 1R78A 2Y4IC 4ITIA 4BTMA 3R9RA 4LUDA 4MWIA 5AAFA 2JFMA 1H0VA 5LCKA 4KS8A 3VW6A 3NPCA 4BGHA 5IH6A 3V8TA 3UVQA 2EB2A 1Q62A 5I0BA 5J9YA 4IACA 3E87A 4IWQA 2C47A 3MS9A 2JD5A 1B39A 1E1XA 2B4SB 5DEWA 2OI4X 3R7GA 3KXXA 3OW3A 5FDPA 2ACXA 4GJ2A 3DKOA 4KS7A 4XNEA 3WF8A 3KN5A 5EKOA 3ZC5A 5CEKA 2VWUA 1LEZA 4Q9ZA 2OXDA 1IR3A 4ZJIA 2E2BA 2ONLC 5EQYA 4UYAA 4L7FA 1CM8A 4LV5A 4FTOA 5AP3A 3UZRA 4U3YA 4PF4A 4MXZA 2BRBA 3ROYA 4MK0A 3IKAA 4J8NA 4TWPA 1XBBA 4FL2A 4ZLZA 3BE2A 4L52A 3NNVA 2FSTX 2G9XA 4MVFA 4BKZA 1PF8A 3TXOA 5FD2A 4AN2A 3L9PA 5BVEA 2YM3A 5TF9A 3UC4A 1ZARA 3MH2A 2JLDA 4QMNA 3LFFA 2QO7A 4NIFA 4QQJA 5I9UA 3I0OA 3MB6A 4XBUA 1WVWA 3ZUUA 4CXAA 3V5LA 4EOKA 4E4LA 4ENYA 4QQCA 3NVKI 2VZ6A 5A4CA 5BUJA 4BFMA 2C5YA 4WUNA 2OKRA 3R8PA 2ITZA 4EK4A 4YR8A 5FTGA 3PLAE 3RWPA 3LMHA 4BCJA 1KUTA 2JKKA 3KRRA 3PXQA 2Y8OA 4MBIA 5IQAA 2P33A 5I5ZA 2R3PA 2Z7SA 5BNJA 5HIDA 4TWOA 3IW4A 2OXYA 3CTHA 4F4PA 3UIBA 4CGAA 4UXQA 2R5TA 1YI6A 1XH7A 5M09A 4ZAUA 4X3FA 4M12A 2OK1A 2ETRA 5D7VA 4H1JA 4L67A 3OZ6A 4F65A 4X3JA 3CQEA 4IDTA 1Q24A 1OGUA 4M3QA 2BDWA 4EI4A 3UIUA 1UV5A 3NX8A 4FSRA 1LEWA 3DY7A 3MBLA 1Q41A 2JEDA 4GMYA 4EQCA 2C68A 1V1KA 5AFVA 3VBVA 2YCFA 4PDOA 3VJOA 4PP9A 4IM2A 3OFMA 3F5UA 4KABA 3UYSA 5D12A 2C6MA 4FT7A 5E9EA 3M2WA 4RT7A 2HCKA 4OAVB 4RLLA 1REKA 2ITXA 5HG9A 3WOWA 5KKRC 2R0IA 2VTNA 3FMNA 3HDNA 3ZO1A 2UW6A 4QT1A 4FV1A 5M53A 3KREA 4YUQA 2QOOA 2W05A 4RVMA 5KMMA 4RWJA 4BDBA 1FOTA 3PSDA 3NMUF 2W5HA 4KIPA 4E73A 3PE1A 3MWUA 4QP1A 1TQPA 3CKXA 1MRVA 5DYJA 3LCTA 4DITA 2CKEA 2GFSA 3S1HA 3ORPA 3OUKA 4BTFA 5BQ0A 3PWDA 2R3NA 2R3QA 3EQGA 2B55A 4BHNA 3DNEA 5T3QA 4JG6A 3P9JA 5EW9A 4HVHA 4YTHA 4TRLA 4YURA 3VBQA 4X6QC 3VS7A 3DBDA 3MPTA 4IB5A 5KMLA 2R7IA 4FUYA 4OTWA 5IMEA 2YACA 1WBVA 4R1VA 3Q6UA 2I7QA 4BI1A 5JQ5A 4QPSA 2ITNA 4AW5A 4Z7GA 5EM7A 1QPCA 3G6HA 3ORMA 2BZHB 1J1CA 2F4JA 3QTXA 4IVAA 5KBQA 4PV0A 4RMZA 3SOCA 5TE0A 4R7IA 4B8MA 5CASA 5J5SA 5F94A 5DIAA 3GQLA 3KMMA 1VEBA 3EFJA 3RK5A 3G0EA 4AFJA 4CFWA 1OBGA 3P79A 2OW3A 2XKCA 3F7WA 1A06A 4LM5A 4FT0A 4QMTA 5B2MA 2E9VA 1V0BA 3P0MA 3QXOA 2R4BA 3R63A 3EQFA 3QRKA 3R0TA 4FEVA 3NAYA 4YJNA 3KF4A 4XX9A 4F08A 4E4NA 4FV7A 3NNXA 2CLXA 3E62A 4NUSA 1STCE 4AZTA 2NPQA 3FSFA 4ZLOA 5LVOA 2XZSA 3NGAA 3Q2MA 4WUAA 4IAKA 3MPAA 3ALOA 4QNAA 3SD0A 4A06A 1Q8UA 3CY2A 2QKRA 4X2KA 3CPCA 4IVCA 1KE6A 4IBMA 4ITHA 3ZMMA 4AE9A 4CTCA 4GV1A 3U9NA 1PXKA 2J0IA 3UO5A 1JBPE 5HLNA 4OBOA 5ANEA 3BV2A 1XWSA 5M08A 3NIEA 4KIKA 2W1FA 3MIYA 4X7QA 2FB8A 3QLGA 3OWJA 4R5SA 2EXCX 3LZBA 3JVRA 4BWPA 4HNIA 2ZV8A 3ITZA 4QP2A 3FI3A 4J1RA 3TNIA 4IQ6A 1KV1A 2Q83A 1XBAA 2NP8A 2R3JA 2VX0A 4R8QA 4BDAA 2QVSE 4A9YA 4FNZA 4AZSA 2WU7A 3DFAA 5IG1A 1YOLA 4J71A 3KB7A 5CU6A 5CLPA 3RP9A 4BC6A 4A4XA 5BX0A 5DLSA 3F69A 4IWDA 5B2LA 2AUHA 3C1XA 3L9LA 1XH5A 3DZOA 3ZS5A 3SXRA 3C5UA 1ZWSA 3VUMA 2XIYA 4NFNA 3DBEA 5JGAA 1JKLA 3KEXA 3IPHA 3R9NA 2YAAA 4C33A 2EWAA 2YDJA 4MWHA 5CX9A 2J9MA 2PUIA 4HGTA 1FQ1B 4AOJA 3C4FA 4AGDA 4BDJA 2PE2A 4W4XA 5I9VA 4Y46A 3TN8A 4E6AA 3C0GA 4MCVA 1A48A 3LCDA 3PIXA 3PVBA 4R3CA 3ZZEA 3IQ7A 3OCBA 4R7BA 2R9SA 5CI7A 5CF6A 5HZNA 5GIOE 1OIRA 3POZA 4RGJA 3SVVA 3TZ8A 5CEMA 1I09A 3E8EA 3A8WA 1H25A 4ID7A 5DI1A 3VUGA 2XIZA 3R8LA 3PY1A 3P7CA 3AMAA 2WNTA 3FZ1A 4AQCA 3GEQA 5FUTA 1U5QA 5K3YA 3ELJA 2BTRA 4YNOA 3MH1A 3LLAA 3V8SA 3NIZA 4EUUA 4WRGA 5LWNA 4AWIA 3R71A 3CY3A 2R3HA
chains in the Genus database with same CATH superfamily
2BIYA 4IZYA 3AMYA 5IA4A 2C4GA 3FUPA 5TT7A 5EW3A 3TDWA 5FXQA 2X4FA 5DT4A 4BCOA 1H00A 4J97A 4EONA 2UV2A 4O1PA 1OIQA 4MD8E 5D1JA 3ACJA 3HP5A 4R78A 2ERZE 3EN6A 5AR4A 4RZWA 1DAYA 1H28A 4NH1A 2J50A 3FYJX 2B9HA 1W2DA 3S0OA 3F2RA 3KY2A 3QWKA 4FKSA 2JBOA 5CAVA 2QNJA 3LXLA 4Y5QA 5CXZA 3QTZA 5CNNA 2UVXA 2O8YA 3MN3A 5TR6A 2C0IA 3O8TA 5FQDC 3ZLXA 5EI8A 2O64A 1U54A 2O0UA 3Q4UA 4EWHA 3Q4ZA 1W84A 3O7LD 4R6VA 2W1EA 5FP5A 3QRIA 4G5PA 3Q9XA 4YGAA 3FMMA 3WIGA 3TT0A 3OXZA 3KC3A 3UNZA 2E9UA 2WAJA 1OL7A 2PVHA 4F0FA 3TUDA 1BX6A 3GU5A 5HQ0A 2IZUA 3ENHA 3O2MA 4MEDA 3D7TB 5J9LA 3MJ2A 5GJGA 4IZ7A 3KKVA 4OTFA 3S4QA 5IEYA 4H36A 1G8KA 2JKOA 4J96A 4U43A 3GFEA 2QOKA 5M4IA 4PPAA 2QOIA 3RPOA 5CU0A 3AXWA 3DBFA 4KSQA 4AA4A 3Q53A 3MPMA 4YZDA 5HESA 3N9XA 5EG3A 3ZCLA 4OR5A 1O6KA 3VS6A 3NUPA 2ITVA 3TIZA 1WBSA 1BI8A 1WMKA 1WZYA 3QYWA 3B8QA 3F66A 3GXLA 4W4VA 1YKRA 4YJPA 3NEWA 4QMPA 1J7LA 4TYGA 2JAMA 2VTMA 4J53A 4M0YA 4PL3A 4HZSA 4O0VA 4ZSGA 3VJNA 4FG7A 4PRJA 3FQHA 4ASXA 3UO4A 4F64A 4M15A 4XHKB 2R0UA 1HCKA 2BR1A 3ANRA 5I9WA 2C3LA 5CAPA 2IZRA 5EQEA 3C7QA 3KXHA 3OBJA 4ZTSA 5FWKK 4X21A 3V6RA 4WD5A 4O83A 4OBQA 1OUKA 5J87A 3PY3A 2VGPA 2W1HA 4F78A 4FSYA 2IZSA 3IDPA 4WT6A 4D4YA 2UW8A 2PVNA 4QTAA 5IEXA 2UZWE 5IQDA 4FTTA 4MAOA 4D5HA 3PVWA 2IW9A 1XH6A 3D5WA 4ACDA 2FGIA 2I40A 4PPBA 2GPHA 2GS7A 5IQHA 3EYHA 4JG7A 1WFCA 4BF2A 4BCIA 4BZNA 4E4MA 2XK6A 5KBRA 4JDJA 2I0YA 3BU6A 4AGUA 2PVYA 4C58A 5DT3A 5L2IA 3BQRA 3DDPA 4Y72A 4DFLA 1Q3WA 4AUAA 4I4EA 4KBCA 5BYZA 1AQ1A 3A8XA 3PUPA 2VTTA 4O27B 3RAHA 4APPA 3RHXA 3TCPA 2FSOX 3W32A 2XF0A 2XM8A 5EHYA 3UJGA 4O1OA 4I0TA 3SRVA 4FEXA 2ETKA 3A4OX 3CIKA 5KMNA 4AOTA 5BVOA 2C5XA 4G3GA 5CEIA 3L9NA 1OPJA 4CSVA 2WMXA 4DCEA 3QZIA 3HYHA 2XH5A 4ENXA 2CKPA 4WNPA 2OU7A 4XV1A 3NNWA 3UMXA 5A6OA 3VS3A 5FEQA 2VWVA 4KRDA 4FK6A 4QO9A 5LCJA 2IG7A 4FGRA 2ZYBA 3JY0A 5BV3A 4IANA 5HLPA 2CGUA 1OL5A 1NVSA 4I6FA 3NRMA 1BL6A 1M52A 3G5DA 4FKWA 3QFVA 4DFXE 4FSTA 1SMHA 3GOPA 2HZ4A 4Z55A 1E9HA 3ZXZA 2HENA 4X6RA 2YHVA 4RIWA 4ZZOA 4G3CA 5K5NA 4L68A 2ZVAA 2W1ZA 2IO6A 5CT7A 3OTVA 4O4FA 3DXQA 5FTOA 4FSNA 2VRXA 4JRVA 3GFWA 4EH6A 3UOJA 1ERKA 3EMGA 4HYUA 3ZO2A 2ZFYA 3EKKA 5I9XA 4AW1A 1PYEA 3JYAA 4HGSA 3MH0A 4H3BA 1XQZA 4CKRA 1RDQE 4YJQA 4S34A 2IEWA 1L3RE 2GCDA 3DLZA 4JR7A 4C35A 3DJ5A 4F70A 3VN9A 5E8WA 3SLSA 4WIHA 4ZZNA 5M06A 1UVRA 3LPBA 3KA0A 2X81A 4QYEA 4RIXA 4XG4A 3T9IA 4DBNA 4ZS4A 2A98A 3Q2JA 5HE0A 4RLKA 4PWNA 3HMNA 2JDRA 2VWXA 1PYXA 3QZHA 2QO9A 2BRGA 3MTFA 1WCCA 4W8EA 3QRTA 4GVJA 2X9FA 4CV9A 2X0OA 4TL0A 4F9WA 3KCKA 4FV9A 4EEVA 4FNWA 3UOLA 4K77A 3BLAA 4G34A 4MF0A 4K2RA 4BIDA 4P7EA 3KFAA 4BWXA 3EFLA 4HPTE 2G01A 2VTRA 4V0GB 4L53A 3HAMA 1W8CA 4DLIA 4TKSA 4EK8A 1PXPA 2BILB 3LXPA 4QMVA 5T68A 3ZRMA 1KOAA 3VULA 3LIJA 4O96A 5BVDA 1QL6A 3R02A 1IEPA 4RC4A 4TW9A 5AUXA 2OSCA 4D0XA 4F9BA 1GZNA 4ZY4A 2VN9A 3AKLA 2X7GA 5FP6A 3QTSA 3CS9A 3LQ5A 2IF8A 5CVFA 4Q2AA 1T45A 1YI3A 4I22A 2C1BA 4Y83A 4BBMA 4EQUA 1J7IA 5HG8A 2QOCA 2WMUA 5DE2A 5AUUA 4YC3A 4S2ZA 4FODA 2XIRA 3CPBA 3WARA 3LFAA 3DK6A 5AR2A 3UBDA 3ZO3A 1GIIA 3I6UA 4RX5A 5BMMA 3AG9A 3M1SA 2CMWA 3ATSA 5AP6A 4N6ZA 1F5QA 2UVZA 4PL5A 4U0IA 5DEYA 4B7TA 4BDKA 4NM0A 3WZUA 2IW6A 3K54A 3ZDIA 2AQXA 1GZ8A 3HV6A 3PFQA 4FV8A 3HEGA 4OW8A 4M0ZA 2BROA 2CSNA 4O21A 2XB7A 1O6LA 3FQEA 2GNGA 4HJOA 4IMYA 4NFMA 5JRQA 1QPJA 1B38A 2CLQA 4IW0A 1PXJA 2BRNA 3UQGA 4I94A 3U6JA 2WELA 4U3ZA 5D9HA 5KCVA 2B1PA 1PMUA 3ORZA 4EKLA 3UPXA 4P5ZA 4D2SA 3VUTA 3SGCA 4ZY6A 1LUFA 4DDGA 4N57A 1AGWA 5ANIA 4NIFB 4QP4A 4DA5A 3R8UA 3R6XA 4WNKA 5L6WL 3ZSHA 3MB7A 3NS9A 2YA9A 4KAOA 5CQWA 3R7EA 2J51A 3O96A 3W0QA 2WTIA 3A7HA 4OLIA 4ZZMA 4YZ9A 3U6IA 3DZQA 3QL8A 4F09A 4ACHA 3R9OA 3BE9A 5HKMA 1U59A 4LDTA 4D9TA 2PVMA 5EW8A 3A7JA 3ET7A 5K0XA 2Z7LA 3D2IA 4FV0A 4I0SA 5HCYA 4EBVA 3VF9A 5AAEA 4EOLA 2UW0A 5IZFA 3RPYA 3IO7A 1BUHA 3HDMA 4X3FB 4E7WA 4MKCA 4NTTA 4UMRA 5HOAA 2W17A 2NNWB 5CWZA 4Q5HA 4QP7A 1U46A 5FLFA 3I79A 5LMKC 5AX3A 5BVFA 2XA4A 2GNIA 2ITYA 4FZAB 4PNIA 4C62A 5DHJA 2RF9A 3OOGA 4CFUA 5I9YA 4RX9A 4DFUA 4AW2A 4AXDA 2FYSA 3UZPA 4O81A 5HI2A 4DHZA 5HLWA 3ZHPC 3OY3A 1W2FA 4FL3A 5FBNC 5A3XA 5KMOA 3KGAA 5AUYA 3LCOA 3W8QA 4QMLA 4RIYA 3CC6A 2KTYA 4H58A 3O5AA 4CG9A 1GIHA 3BPRA 2YJSA 3COKA 4A4LA 3AMBA 3U54A 4HYSA 4YO6A 5G6VA 3KXZA 4JIKA 4WG4A 3FMLA 4FA2A 2PMOX 4G5JA 1UNGA 3RZBA 2WHBA 3OTUA 4C59A 3PJ1A 3I4BA 4XS2A 4ALWA 4CCBA 4NYEA 4YC8A 3QD2B 3CGFA 4EHGA 1ZZ2A 5CVHA 4EK3A 5CSVA 2Z8CA 2XAMA 4V04A 3QF9A 4Y95A 3FSKA 2JIUA 4IX5A 4RJ6A 4U42A 3R9DA 3N4TA 2YN8A 2X1NA 3QZGA 3H9RA 4EJNA 5M4CA 3ORKA 2E9OA 5J95A 3SXSA 4F7SA 4CCUA 5HX8A 1F3MC 3C0HA 5C27A 3P86A 2CKQA 3ZTXA 2WMQA 3E3PA 3PSBA 4MX9A 5KMKA 2WMSA 2VTLA 2RFSA 3ZYAA 3PIZA 3W55A 3HL7A 2P3GX 4RFZA 3R1QA 4BTJA 4BKYA 2PWLA 4ZLYA 3DAKA 2X7OA 4GCJA 1URWA 4FMQA 5AUVA 4QOXA 3MFTA 2RG6A 4K9YA 4BJJB 2XYUA 4O7LA 2OF4A 4ZSLA 3PA3A 2B54A 4GIHA 2PVJA 3MTLA 4DGGA 2XNBA 4S32A 1SYKA 5GJFA 4O7SA 4I21A 4NJDA 3ALNA 3VNTA 4I0RA 1Y8GA 4E5AX 4D5KA 2O2UA 3O8UA 3BLRA 4DTBA 2BKKA 2PMIA 2W96B 3D83A 3M42A 2XEYA 3IOKA 3SW7A 3R04A 3VBWA 2J0JA 4RG0A 1YXTA 4CRSA 3FLWA 3CQUA 3DAEA 1H1RA 1MRUA 3CXWA 3ZSGA 2BAJA 5EDRA 2XBAA 1IA8A 2CCIA 3EQRA 5A9UA 4UEUA 2ZMCA 4GK4A 5E1EA 4ZK5A 5KO1A 3EFKA 4YNEA 1MQBA 2GNHA 1H07A 3C4EA 2CN8A 3ROCA 4D2PA 4EOSA 2BAQA 3E64A 3PXRA 1GNGA 2YLFA 3OWLA 3NW6A 3EFWA 2P0CA 3RAWA 4AT5A 4G6OA 4JQ7A 5DA3A 4EOJA 4CLJA 4C3PA 4DE4A 4O38A 1R0EA 3KVXA 4B6LA 4X3FC 2GNLA 2ESMA 1YWNA 2XMYA 1S9IA 5BPYA 5JT2A 3R2YA 4RJ4A 2JKMA 3MV5A 4YJOA 3BHVA 5F20A 1PJKA 1ST4A 2OIBA 4K6ZA 5EOBA 2QOFA 2ZDUA 4HVGA 2EVAA 4XH6A 4ZSJA 3Q5ZA 3MVJA 4ZTQA 3VS2A 4DEGA 4FZ6A 4GT3A 3MDYA 5EYMA 3ZLWA 2WEVA 3OF0A 5KHWA 5M4FA 1Q97A 2V22A 2VTHA 2VTSA 4NJ3A 3TZ9A 5ANOA 3L8VA 4AZFA 5CANA 3RALA 2XAOA 4JBPA 5CEPA 4QMYA 3FMDA 2F49A 2WOTA 3PZHA 5CSHA 3R01A 5F1ZA 2YM4A 3P4KA 3R8VA 3SC1A 3V5WA 3LCSA 4DEHA 3GC0A 4YJTA 4HGEA 5AUWA 4ZMFA 4RX8A 2Y4PA 3O71A 2CN5A 2YABA 3FPQA 2F7ZE 1SM2A 5D41A 5B7VA 2V7OA 4OTIA 3BL9A 3BU5A 5L2QA 1ZOGA 3ZM9A 4RWLA 2BRMA 3E7OA 2R3IA 2XVDA 4KIQA 3L8XA 5EHLA 3EL8A 4DC2A 2W9FB 1ZAOA 5GZ9A 5IQIA 4I23A 4EHZA 3OEZA 5AV1A 2XK7A 1KE8A 3BX5A 4DN5A 3V04A 5D11A 4XOYA 5KZ0A 2C6OA 2WXVA 4AP7A 4BCHA 3KXNA 5AJQA 2X8IA 4C3FA 3P08A 4DEDA 3DAJA 3OW4A 5C26A 3GC8A 2I0VA 3SXFA 3QALE 3FEGA 4QNYA 2A27A 5AEPA 5IUGA 3LAUA 3R1NA 4BYJA 3CTJA 2HIWA 2AEGA 3PP1A 5CALA 4D1XA 4NM5A 4QP9A 4RZVA 3BU3A 3F3TA 3G9NA 4FRFA 3FKLA 5E7RA 1S9JA 3QX4A 4M14A 1Z57A 4EH5A 2R3MA 4LGDA 3VHEA 4JR3A 4BB4A 2OZOA 2VD5A 3AGMA 4C2WA 3RM7A 5DRBA 1XHAA 3QTRA 3BGQA 4MQ1A 4I5HA 4IAAA 1RQQA 1U54B 5CY3A 2WQOA 4DGMA 2JIVA 5LVMA 4HVSA 1OKZA 3S00A 2I0HA 1JWHA 4DH5A 4DEEA 5CSXA 2JBPA 4YSJA 2FSMX 4QP8A 4YSMA 3E93A 4YU2A 1UWJA 3L8PA 3TZ7A 4JI9A 2GS2A 3UOKA 1FVRA 4FI1A 3T3VA 4QYHA 3U87A 4AZVA 3DXNA 1XO2B 4G3DA 4Y5HA 5DR2A 1W2CA 1PXIA 3E63A 4GVAA 2PZPA 2WEIA 3QGYA 4JIAA 4YBJA 1VZOA 3QD3A 4GL9A 4UXLA 5CEOA 5JSMA 4G3FA 2QCSA 4MXOA 2YDKA 4DAWA 3QRUA 3I60A 4FC0A 4WNMA 3QQKA 1MUOA 1PHKA 4MD9E 2W7XA 4AXAA 5M56A 4EYMA 3H30A 2IVTA 2XJ1A 5HVKA 3F7ZA 4FEUA 2WMVA 3OVVA 3KRLA 3BQCA 5FBOA 2PY3A 4KBKA 5HEZA 1W82A 3KN6A 2ZM1A 1ZMWA 3ZDUA 2XK9A 1Q5KA 3SOAA 4FTAA 2W1IA 5DVRA 3AKJA 3QTQA 5C4LA 2CNQA 4EK6A 3SX9A 4G2FA 2XJ0A 2YIRA 2B52A 3PXKA 2QHNA 3E8NA 4F1MA 2BFXA 1YVJA 3A7IA 4GUBA 3TNPC 3ZU7A 3PG3A 4NWMA 3I7BA 3GBZA 4Q5EA 5HCXA 4E6CA 4F0GA 2OZAA 1UKIA 5IF1A 2GDOA 4N0SA 1ZYSA 4YJRA 3U51A 4GUEA 3GOKA 4GFMA 1TQIA 3PPZA 4G31A 4DH7A 3ORNA 1YXXA 4LQMA 4ZTRA 1V0PA 3L8SA 4FZFB 5AP2A 3KCFA 3KULA 4H39A 4ACMA 4GFGA 2BHHA 2X2MA 3PSCA 2WQEA 3HUCA 1OKVA 5C01A 4O0RA 4EH8A 3GCUA 3VVHA 2VNYA 4LI5A 4C61A 2X39A 4CKIA 1GZKA 1A9UA 1M2RA 4YHFA 5IU2A 3QHWA 3VQUA 5HBHA 1Q8ZA 3RKBA 4KA3A 4UN0C 3BIZA 4RWKA 3FZSA 4X2FA 1H26A 3HLLA 5CF8A 2BZIB 1JPAA 5TKDA 3FKNA 4M67A 5H2UA 5EYCA 4M7IA 2XK3A 4NT4A 3SAYA 2QHMA 4KRCA 5ICPA 2BAKA 3EYGA 2XCKA 4IDVA 3MSSA 2OLCA 2GNFA 2R7BA 4ANBA 5I3OA 5ANKA 5KX8A 5B0XA 3ZO4A 1URCA 5HO6A 2F7EE 2C3KA 2RG5A 4BVUA 1RE8A 4IAIA 3VS0A 3SRVB 1P4FA 4DFZE 4I6LA 4FICA 4ANQA 3DS6A 4DGNA 1PW2A 3FL4A 5E8YA 3F82A 4MF1A 4DT9A 1H8FA 4LV8A 5IQEA 3AT4A 4PDSA 4R7HA 4JRNA 3L1SA 3UP2A 2ETMA 4NCTA 2PPQA 3WF6A 4CT2A 1OZ1A 5IDPA 2CGXA 2W5AA 4ZP5A 2J6MA 1R39A 1YHSA 3HX4A 3PY0A 3RGFA 4F6WA 4DFBA 1KOBA 1OPLA 4MXXA 4OTDA 3QXPA 4IZ5A 4LOOA 3ORTA 2XRUA 3FWQA 5EK7A 3WF7A 4UMUA 5E4HA 5F4NA 3SG9A 3H9OA 3A99A 3LFEA 1WBOA 4FV5A 4GU6A 3BHUA 1PXMA 3IW5A 3THBA 3OT8A 2GHMA 2EXMA 2HAKA 3BLHA 1EH4A 4RIWB 1CDKA 2IJMA 3QCSA 3DOGA 4ANOA 2ITQA 3F6XA 3PJ3A 5AUTA 3HAVA 4FOBA 4TYEA 4UWCA 5ACKA 2H96A 3HNGA 1OIUA 4EC8A 1UU7A 5CT0A 1PMVA 3D0EA 4UWYA 4ASZA 5JKGA 2WQMA 3D94A 2J4ZA 2IW8A 4BKJA 4BIEA 3IK3A 5JFXA 2OGVA 3O17A 2AC3A 2VWZA 1E1VA 3UYTA 4BIBA 3MVMA 3G9LX 4B0GA 3EQIA 3SHEA 4V05A 3RPSA 4HVDA 1TVOA 3OUNB 4XG3A 4YBKA 2C6LA 4F6UA 3UNJA 4FK3A 2NRUA 4M69B 3OCGA 1QPDA 4V01A 2ZM4A 4IHPA 4FT3A 1UA2A 3ACKA 4RIXB 4D55A 3C9WA 2YIXA 4MNFA 2HZIA 3R7IA 3JR1A 3EHAA 2Q0NA 4NM7A 3TI1A 3RVGA 3Q5IA 3NUUA 2XNMA 5HTCA 1OECA 4FKQA 4JX7A 2IVVA 3W0RA 3VQHA 2B7AA 4AAYA 3FQSA 2I6LA 4U97A 5DFPA 5LMBA 3WZJA 4YZNA 5DPVA 5L6PA 3NW5A 2ZMDA 3LMIA 3VS5A 3H0ZA 3D5UA 2JC6A 4AE6A 2OG8A 4H3PA 3TNHA 3QWJA 4XRJA 2BDFA 2J5EA 3K5VA 3MVHA 2UVYA 4FZDB 4J7BA 3U55A 4D0WA 2YM7A 4IVBA 1FBNA 4F7NA 3EJ1A 2J5FA 4FYNA 5CENA 4BDHA 3RI1A 2LAVA 1SZMA 3CSVA 2NO3A 3R00A 3BZ3A 2C6IA 3R7UA 4LOPA 4AW0A 4HW7A 1TQMA 4LG4A 1UWHA 1OL2A 3R30A 4NSTA 2ZM3A 3W8LA 4BCNA 2J90A 3AC8A 3IONA 3P7BA 3UIMA 3DGKA 3Q04A 4O7VA 1YI4A 3BGZA 4QMUA 3KXGA 4LV7A 5I4NA 4QMXA 1Q8WA 2VO3A 3G2FA 4K18A 4U44A 4ZMEA 4ZTNA 4DEAA 1OVEA 4WA9A 4TXCA 4UZHA 5B2KA 5C8KA 3TV7A 3TUBA 4CRLA 3IG7A 1LPUA 2J2IB 2FUMA 2ZB1A 3F2NA 3L9MA 4GSBA 4I5MA 4LOQA 3GC7A 4NU1A 3EWHA 4DGOA 3E5AA 1UU9A 4IJPA 3U8WA 4Z7HA 3FY2A 5IPJA 4DG0E 2O65A 3O51A 4LMUA 1FMOE 2HYYA 3R21A 4F0IA 4DEIA 4G6LA 3TTIA 5G1XA 2XANA 3MESA 1UNLA 2Z2WA 4GYGA 4CLIA 4YLKA 3HKOA 4RC2A 4TT7A 5JQ8A 1Z9XA 4XOZA 2CDZA 3F5GA 3GCVA 3C5IA 4EH4A 2X7FA 3O8PA 3MW1A 3QA0A 3P1AA 2PL0A 3QQFA 4OTPA 3VIDA 3TG1A 3ZFYA 2NRYA 3Q52A 2PK9A 2OFVA 4ZOGA 3GU4A 2YFXA 4AU8A 5AP0A 4BI0A 2UZLA 3B8RA 4FG8A 5HNBA 5HIEA 1XH9A 4TWNA 2RKUA 4FTMA 4FUXA 2QQ7A 2WTJA 4AS0A 4F7LA 4EZ7A 4GG5A 3TKUA 3ORLA 5A14A 2WMWA 3BYSA 3UC3A 4FJVA 5EH0A 2WTWA 4J99A 3EZVA 1MQ4A 1WBNA 3NLBA 2J0MB 4TPTA 5HICA 4AGWA 2GQRA 4YJSA 4IC8A 4JBQA 3TTJA 2YCRA 4I6HA 4YHTA 4RJ8A 4F1TA 3FMEA 4LGHA 2HZNA 3C13A 3GGFA 4HCVA 2JGZA 3C4WA 3GCSA 1ZOHA 4U80A 4M66A 5L2SA 3I81A 3F3UA 3PRFA 3LM0A 3VS4A 3WZKA 1JQHA 1PKDA 3Q32A 4H05A 4JXFA 4JJRA 4AA5A 4PUZA 2X6DA 1J1BA 1O9UA 2VUWA 2H34A 3IOPA 1H1PA 4IM0A 4TYHA 2HK5A 5J1WA 3MJ1A 4JBOA 3A60A 5IA5A 4HCUA 4CEGA 1ZMVA 1G3NA 4RJ5A 1VYWA 5E8XA 4M13A 4ZS0A 5JH6A 3WIKA 2CCHA 1KV2A 2C6DA 3GC9A 4GIIA 4RIYB 3GCQA 3UGCA 3KRJA 2QOQA 2V5QA 2XJ2A 3H0YA 4I41A 3VW8A 3UPZA 4L6QA 3PVUA 3QGWA 4DH8A 2Z60A 1M2QA 3FLYA 2OIDA 5KE0A 4CV8A 2J0LA 3OP5A 4BHZA 5IUHA 4FIEA 4B4LA 3F3WA 5EYKA 4DH3A 1FPUA 2BDJA 2OBJA 4E93A 4QPAA 3R28A 4KKGA 3ZFXA 4J95A 2R3GA 4EZ5A 5M44A 4D58A 3KMWA 2QC6A 2OJIA 5LOHA 3F3VA 3UQFA 5IQBA 4ANLA 5IA3A 2VX1A 4AN9A 4KSPA 3FXXA 3PP0A 5ACBC 4U6RA 4L44A 3NW7A 4AACA 3UZTA 4USDA 3DK7A 3AC2A 3HV3A 4ANNA 5HGIA 2WTVA 5H8EA 3MA6A 4XP2A 2ZAZA 3RWQA 4CT1A 2DUVA 5CTPA 3ZLYA 4K1BA 4FKGA 3W2CA 3QUPA 4KBAA 4M84A 4FOCA 3GP0A 4JBVA 4TNDA 2YJRA 4KINA 3Q4CA 3WILA 4MQ2A 4PTGA 5AR3A 2XKFA 2C69A 3BELA 1Q99A 4GH2A 4IXPA 5C9CA 3VC4A 2O63A 2FSLX 3HRCA 4FSWA 3R7OA 3SDJA 4BCGA 3PJ8A 2UZTA 3IDCA 1P5EA 3RHKA 3T9TA 3UODA 5JRSA 2C5OA 2R3OA 3FE3A 3DB8A 4E20A 4BGQA 4XYFA 3RAKA 4FTKA 3NVMB 5HU3A 4JMQA 4CQGA 4XBRA 2IZTA 2OJ9A 1UNHA 4HYIA 4BCPA 2YZLA 4QMSA 3DKCA 5DGZA 4C02A 2Z02A 1NVQA 3LM5A 3PG1A 3ULIA 3W0NA 3FV8A 3ZM4A 4C4HA 4D2TA 5D7AA 4C7TA 4FE2A 4C38A 1NVRA 4CMUA 5K5XA 2XYNA 3CTQA 3CQWA 3RNIA 1BMKA 1W7HA 4N4SA 3AGLA 4NKAA 5FXSA 5KZIA 5AA8A 4AT4A 1SNUA 2PMNX 3ERKA 4L01A 2PU8A 2IWIA 3K3JA 3QC9A 3V51A 4Z16A 4EOQA 4MNEA 4WBBB 2XCHA 2YEXA 3PZEA 5E92A 4UBAA 3R9HA 3WZDA 4AQKA 2QODA 4FV2A 4WBOA 3DDQA 3PLSA 4K0YA 3TACA 4IH8A 2E9PA 4Y85A 4O6EA 4C57A 3CD3A 4CD0A 4KUJA 3ZRKA 2CNUA 3Q60A 4L3LA 2RSVA 2XNGA 3UMWA 4CNHA 3PWYA 4E3CA 2JDVA 3UDBA 1PRYA 3K5UA 4J8MA 4W9WA 4D4VA 1TFFA 1BKXA 1Y91A 2QLQA 4NKSA 4GFOA 2A2AA 4FKTA 3B2WA 1PMNA 3DCVA 4I20A 1BYGA 5HIBA 2BVAA 2OO8X 1G5SA 4JVGA 3LQ3A 2BHEA 4TZRA 2F9GA 2R3KA 4RWIA 1K9AA 1OMWA 5EYDA 3ZFMA 2YZAA 1T46A 4O7RA 3FPMA 4JL9A 4QTDA 3U4WA 4FIGA 4MXCA 4HPUE 4RVTA 4FGBA 4QTCA 4IWOA 4JS8A 1WVXA 4O4EA 4D2WA 3EKNA 2ZDTA 3FBVA 5C03A 5I9ZA 3QBNA 2XRWA 3Q9WA 3ZBFA 2KULA 4YP8A 2Q0BA 3AD6A 3EN5A 4MTAA 5E8VA 2BRHA 2OJJA 5GIPE 4F6SA 1OM1A 2EB3A 3FLZA 4E1ZA 3BHHA 3FC1X 4KKEA 5L8LA 2B9IA 1JOWB 3DB6A 3BGPA 3BYOA 3FMHA 2C5NA 3NYOA 1ZYLA 3ULZA 2BFYA 2DWBA 3NYNA 4C8BA 5LARA 3PFYA 1JNKA 3I1AA 5LQFA 3H4JA 3DKGA 5D10A 5CZHA 4USEA 2CPKE 4BDEA 3QUDA 5FEDA 3FLNC 4QTEA 2ITWA 1OB3A 3P5KA 3W10A 4EORA 3HVCA 4LRKA 4PMTA 5F9EA 5IA1A 2EUFB 2VO0A 4IX4A 4UZDA 5EQPA 3KXMA 4PY1A 3OG7A 4U45A 3V3VA 4LMNA 4JNWA 4CMTA 2W4KA 2R3FA 3BWJA 2RFDA 3NCGA 3OBGA 4GT4A 3JUHA 3MFRA 3POOA 4QMWA 4R5YA 4W9XA 5EDPA 4CFFA 2RFEA 5CAOA 5HU9A 1G8AA 1UU3A 4NK9A 4C4JA 3NFFB 3ZUVA 2X8DA 4ONAA 3UVRA 5IEVA 2YWVA 1Z5MA 1ZYDA 3LQ8A 3MY0A 5DOSA 5H9BA 4YTCA 2WZJA 3A2CA 4FT5A 2UZVA 3ODYX 3DPKA 5AR8A 2OF2A 2VX3A 2R3LA 3QUEA 2ZV2A 3RK9A 4D1SA 5DNRA 4PMMA 4U40A 3G90X 4ITJA 4I4FA 4GT5A 1NW1A 1HOWA 5K4IA 2P2HA 4XEYA 2GMXA 4A4OA 2DS1A 3A62A 2P55A 4CZUA 2I0EA 4RQKA 3QA8A 4JDKA 4O0SA 5GZAA 4H1MA 3FLQA 1YRPA 1Q8YA 4WO5A 4YC6A 1O6YA 1SNXA 4FVRA 1UU8A 4OUCA 4W8DA 2HW7A 3V01A 4NW5A 4BDFA 5GINE 3MFUA 4MYGA 4OTRA 4EOIA 3Q4TA 1KE7A 1P14A 3A61A 3CD8A 4FKIA 5AV3A 3RCJA 2WTDA 4DG2E 4EH2A 3N4UA 1Y6AA 4N70A 3OS3A 3HA8A 4QTBA 1XBCA 1OL1A 1IAJA 2ITPA 4IC7A 1IRKA 5E8UA 4FSMA 3MY1A 3MI9A 4AX8A 5AV0A 3DKFA 2VAGA 4IFCA 2PZ5A 4PTCA 2G1TA 4U9AA 4TY1A 2JDSA 3AD5A 2GTNA 3Q9YA 4FF8A </