3TULA

Crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
145
structure length
136
Chain Sequence
EGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKEMGISKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAATKKLTQAQNKLQSLAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell invasion protein sipB
publication title The Structures of Coiled-Coil Domains from Type III Secretion System Translocators Reveal Homology to Pore-Forming Toxins.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
total genus 52
structure length 136
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16535 T3SSipB Type III cell invasion protein SipB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3tulA00
2LK4A 3L8IA 3C8GD 3K7DA 3GM3A 2L6HA 1KNYA 1QVXA 3JYYA 4XEFA 1K40A 1OW6A 1V4AA 1OW8A 1UFBA 2JX0A 3C18A 3B71A 1K04A 3GM1A 3JZ0A 2KK1A 2PBEA 2JPUA 3RQFA 1JOGA 3C8GA 2HSBA 3U3FA 2Q00A 4NQFA 3O10A 4R32A 3U0CA 4EBJA 5F28E 3MFNA 3C8GB 1ZZPA 3S9OA 1O3UA 3TULA 3RQGA 3GM2A 1OW7A 1WWPA 3RQEA 2L6FA 2L6GA 1PV3A 2YWAA 1K05A 4XEKA 1WTYA 4EBKA 3AJMA 1KTMA 3L8JA 4XEVA 3BRJA 1WOLA
chains in the Genus database with same CATH superfamily
2J45A 1GS9A 1VOMA 3K7DA 2EPNA 4P6IC 1OW6A 5T3WA 1UFBA 3K66A 4KI2A 1A0BA 2MHRA 3K6BA 3NMJA 2PBEA 5GPGB 4E0HA 2ASRA 2ZD9A 2YZSA 2HS5A 3C63A 1HE1A 2HSBA 4QDLA 1NU7D 2PFDA 2VB6A 4BJ6C 3SEOA 3AGUA 5JUAA 4FX5A 2A0BA 3UGPA 1T9KA 256BA 1NZEA 4IWBA 3ASNC 3IEEA 2V26A 1MNEA 3PDMP 4BJTA 5EK0A 4B6IA 4ZLDA 2W4BA 1PD0A 3VAYA 4MW3A 4YT2A 3QW0A 1OR3A 4MVSA 3L8JA 4JZAA 2EIKC 4JEAA 1Q0MA 2Y3BA 5E3AA 4EBBA 3TD7A 2Q9BA 4YWQA 3L8IA 4LERA 3GORA 3QVZA 3N24A 4MTFA 1HW2A 1K04A 2R02A 2CGEA 2NUPB 4JRZA 2W4MA 2ZPAA 1OR2A 2YLDA 4BJ6A 4JVSA 4E7SA 4OIPF 1Y6DA 1HMOA 4O79A 5D91A 2IBFA 2R7UA 3QW1A 1T6QA 1MQVA 4U9EA 3SXKA 2Q9AA 1WWPA 2XS8A 4DRJB 2XM4A 3X1OA 2XLOA 3WHNA 1TWHA 1TR2A 3JCUQ 4AK9A 5AC4A 3B0VC 5F5FA 2OJQA 2QTVA 1LE4A 4KNVA 3KPHA 4CS8C 3I4UA 1OCZC 4JJGA 2VCAA 1WOLA 3C8ZA 2NUPA 1VB5A 2YLGA 3I5PA 3TULA 3H2UA 1ZW3A 2LP4A 3RFYA 1SYQA 2KSFA 3ABLC 2YHSA 3V5YA 3EHMA 1AUEA 2JD3A 3KMIA 3UMHA 2J0XA 4EBJA 2AP3A 5A6JA 5L0FA 2WZFA 4AL1A 2H8AA 3LJBA 4Q4ZF 3M1CB 1V55C 4HFFB 1I5NA 1NFOA 4OD4A 2HUJA 2XM0A 2XSEA 1OW7A 3IQ5A 4CJOA 2OCCC 1O5HA 2AWCA 4GEHA 1LI7A 2AWYA 1TKNA 1TQGA 4XLPF 3LUTB 3VM6A 3U2MA 3AJMA 2R7TA 3JTLO 3UMIA 2R7RA 4GYTA 4J30B 4P9FA 1GQAA 1HW1A 3A9CA 4XPXA 1BZ4A 3X2QC 4CS9A 1C02A 3TQOA 3DKAA 2O9XA 4JCZA 3DJNB 3RF3A 1HMDA 2Y39A 3AQBA 2WZGA 3LESA 5DS5A 2YEVA 1D1BA 1TWCA 1YYJA 2R7OA 3LLIA 1TWAA 2H7OA 2WVOA 4NY3A 5JVEA 2Y3DA 1JPNA 3LNRA 3UR3C 4DBRA 4MVQA 1LVKA 1ZHXA 2L81A 4ONSA 1CPQA 4WGYA 5JT4A 3LLKA 2CDQA 3U8PA 3AQCA 3S0XA 4OIOF 1Z63A 3EJNA 1M56C 2KQ9A 1NU9C 2XXAB 1OCOC 2R7QA 4ANJA 4XEKA 1E83A 1W2WA 2YL7A 3DZAA 2MWQA 3GANA 3NMKA 3PMRA 1RKCA 2YL1A 3GM3A 2OOCA 3AG4C 4IJJA 4Z9IA 2D5RB 2J0WA 2EPOA 4G7ZF 3SXMA 2L7AA 5COFA 4WABA 3VF0A 3JYHA 5KYNA 3HTKC 3AOUA 4E17A 2EINC 3EFOA 1QQ3A 4U5GA 3ZSUA 1SF8A 4E0IA 5L0CA 4Z9JA 2G3VA 2KGOA 2P7VA 2Y69C 3MYFA 1GM5A 4ER9A 4PFPA 1V74B 5L0JA 1NBBA 2B0HA 2Y3HA 4K0DA 2XXAA 2HZ8A 1M2VB 3EZHA 4WJ0A 1JMWA 2XL4A 2J9UA 4PFOA 5AGFA 1PV3A 4DRHB 3RW0A 2CYDA 2EILC 4IB4A 2PF4E 1D0ZA 1Q0DA 1Z3IX 1ZYRF 5FCLA 2QE9A 4W8KA 4KBLA 1A7DA 4X0RA 1ORYA 3JT1A 4BEMJ 1LS1A 1OW8A 2WZLA 2FGYA 2HV7A 3H2VA 3LAYA 3M79A 4OD5A 4JKVA 4YK5A 5T1DB 2P61A 3RKOF 4YL3A 4YJWA 2PX0A 2UUHA 1MMNA 1DOVA 3NRHA 3S29A 3C8GB 3EZIA 1O87A 1RJ9B 2HJ3A 1E85A 1RMVA 2EPMX 5COMA 1M2VA 3ABMC 4MQ9F 4LLEA 3S90A 2TMVP 4OIQF 1ORJA 2AU5A 3ZTZA 4NTFA 4NCQA 3NYLA 4C7OA 1YZAA 4JW1A 1J8MF 4A2NB 2YL3A 1HE9A 1FMVA 2NUTB 3FHDA 2NG1A 1G4WR 2ZXWC 1XWJA 2LK4A 2RSEB 4CDYA 1FFTC 3QMKA 2IYLD 1G5ZA 2J9BA 2XS1A 3EPVA 1SZIA 1YVIA 3DMDA 1MMGA 4MNDA 4OIRF 1BDJB 2JPUA 2Q3TA 1ZU4A 4J7YA 3C8GA 2VH3A 2LQGA 1MNDA 1RJ9A 4YL0A 2WVQA 3JRTA 3Q6NA 3EH2A 3O10A 4NQFA 3CZ6A 5COGA 3PCVA 3W2VA 1T6IA 2XLEA 3IQ6A 3RYLA 3DM5A 1O3UA 4RDAA 5KYWB 1AEPA 3M4BA 4MS2A 3CQZA 1CGNA 4KC9A 2J9WA 3G4XA 2NUTA 3TK0A 4AE4B 2ZXPA 1YJGA 2P6VA 1JPJA 3H65A 2WVNA 2R9RB 2NSFA 2HKVA 1Q0GA 1G8XA 2LIGA 3M4CA 4I44A 2OJED 1YZCA 1AVOB 2C03A 3FOPA 4U5HA 1J8YF 1QZXA 2CW0F 4H54A 1LM3B 5EGYA 3MYIA 1QKRA 1ZW2A 2NPUA 1Y4CA 2P1AA 3OWTA 4IAOA 1WGWA 2CCYA 4N6CA 5B1BC 4GQHA 4CS9C 5L3QA 3EGXB 3VYWA 3DAFA 4PJMA 1JRAA 5F28E 3JSZA 1CPRA 4DRIB 2HFIA 5T3TA 5K0IA 3T9OA 2ZXOA 2KJGA 1ZHYA 3HKKA 3LEOA 4AE4A 4DOZA 1NSGB 1Q0KA 4E7ZA 2HSQA 4I1OB 3U5SA 5DLJA 2EPLX 5A6AA 2VASA 3EGDB 3FAPB 4CSAA 3JRMO 1S7ZA 2Y3GA 2Q4FA 3F47A 2NSGA 4D4XA 3AG3C 4U5CE 3S84A 2YLIA 2BC5A 1EA8A 1WASA 3U8VA 3B29A 4Q7CA 2DB4A 2GA0A 4M63A 1FFHA 3C8GD 2PNOA 3LNMB 3NYMA 2XRHA 3DE8A 3DJUB 5BQIA 4LACB 4IAQA 3EGXA 4XQ1A 1OKKA 4CJGA 3FMSA 1XZPA 2FFHA 1A7VA 1Q0FA 1R5ID 2H7BA 3A11A 3S28A 5BQHA 3MLGA 1A41A 2W45A 3CSKA 1KU2A 2E87A 2OG2A 2X51A 5A6KA 3HNLA 3EGDA 3GEIA 1PD1A 3R2PA 3U9JA 2XLDA 2IXNA 2QY9A 3EHNA 3EFOB 3HNJA 3N0TA 3RQGA 3B0UX 5AC5A 4A4AA 1MMDA 3KYJA 3O6XA 2XLMA 4FESA 3NYJA 2EIJC 1Z5ZA 4C3BA 3T4RA 4MTGA 3SYNA 1EQ1A 2LSEA 1YDIA 2KYHA 1I4ZA 1E84A 1DOWA 3WG7C 4AX2A 3DI5A 4DJ9A 2R05A 3C7JA 4O6YA 2R7VA 1TFOB 4G78A 3FDQA 2KK1A 2WL8A 2Q7RA 3GEEA 2IOQA 4BEJA 4FAPB 2BL2A 3B0PA 4U5FE 1UG7A 1NG1A 1OXKA 4J32B 2LFFA 4U5EE 5D92A 3SZRA 2OEXA 2XL8A 2A6HF 4XPYA 3ASOC 4PJJA 4ULWA 1YLMA 2LD6A 2OQMA 3HLZA 3DWWA 2G3KA 5B3IA 2GFHA 2A69F 2L6FA 3LEVA 4AL0A 2YWAA 2A0UA 3DE9A 3BEHA 3L0IA 1OKKD 2VCBA 2C04A 4JTCB 4BPMA 1LIHA 2R7WA 3DAGA 2BE5F 1JR8A 1KNYA 1QVXA 2D4UA 5CI8A 1H9GA 4RBNA 5DQZA 1BR4A 4CBEA 3L1MA 2PP4A 1ZHZA 3IHUA 2I8BA 1JOGA 5EHHA 1OXBA 1YYXA 2WB7A 4KNWA 1FMWA 4N6HA 5JP7A 5A69A 3G4ZA 3POVA 2GWWA 2ETSA 3KKBA 3QVYA 4W8PA 2OKUA 3ZWIA 2M4EA 1ZZPA 2R7SA 2EIMC 1T01A 2W9YA 3W4YA 5L0IA 2HV6A 2RD9A 1LKXA 1EKYA 2QUPA 3ITFA 4NTBA 4PK4A 1LE2A 2IXMA 2LCHA 1T6UA 2XLWA 2KNHA 4FWVA 4MVZA 4EHPA 3NMIA 1CGOA 4C3EA 3M15A 2L6GA 3AG2C 4YT8A 3JSEO 3OA1A 1M2OA 5JRAA 4G0HA 4IGGA 1M57C 2IXPA 2OU6A 3FAJA 3NDBB 1GGQA 4K7BA 4IARA 3US6A 5KYYB 3ZG1A 1WN0A 3E70C 1Z23A 3PHF2 1ZU5A 3GEHA 1H9TA 1SMYF 2Q9CA 3AGTA 3B71A 3W8HA 1C17M 3ZVRA 1H7IA 4MTOA 5DS6A 2HMZA 3B9QA 4MVRA 5B1AC 5KYXA 3K1HA 3O39A 3OEOA 4U9DA 3RH3A 2QLAA 1V54C 3W2WA 4YT4A 1FAPB 1D0YA 2XLHA 3HNKA 1BBHA 4MW8A 1U0BB 4CDAA 2DI3A 3T6GB 2LFDA 4C7OB 1VMAA 1D1AA 2H7VC 1A7EA 1RKEB 4JE9A 4J7TA 2HMQA 3K33A 4L6RA 4N06A 3C62A 4LDQA 4CSAC 5KYYA 2IXOA 4Q5SF 1YA9A 3TJ6A 3W8IA 4JURI 4LDRA 1SR2A 4DXWA 5L0GA 3TOLA 1XZQA 1M6TA 2I15A 1RXQA 4P9TA 2GAQA 1C03A 3O55A 3ZIBA 5F5HA 3IQCA 4CX9A 1V4AA 4JCHA 3WAQA 4EUKB 1T5OA 3GM1A 2YVKA 2M64A 4U5DE 3FXHA 2XL6A 4ZLCA 2J7PA 4JIOA 1CGME 1S05A 3DM9B 3KL4A 3Q7LA 3MX3A 1B68A 3N2ZB 4JTAB 5E33A 3SXZA 4D4NA 4EKWA 4K1OA 2V3CC 3IPMO 3HNIA 3S9OA 1I4YA 3NG1A 1ST6A 5HV9A 1OQCA 1JAFA 1RKEA 2A1DD 2FAPB 1ZVZA 4E18A 2DYSC 1BR1A 4JTDB 3T6BA 3EG9B 1TWGA 5BQGA 3VRCA 2YRFA 3G50A 3K1IC 3RVYA 1TFKB 4HEAJ 2YQYA 3IQTA 4O7GA 5FZTA 3SNHA 4C3DA 5A6BA 2OEVA 4YN0B 4EBKA 1HY5A 4LDKA 4PJNA 4DVZA 4CIPA 1PCXA 3DXJF 4DBQA 2VC9A 2XLVA 3U2LA 3SXYA 5JLIA 2L6HA 2F22A 4XEFA 4XPWA 5HSWA 2EPKX 3V5XA 3EQLF 3LS0A 2IM8A 3JZ0A 3TJ5A 5BUOA 3V7OA 4CS7A 5KYWA 3HJCA 5DS4A 1LS4A 2R25A 1FNTc 4O6MA 1VLTA 2A68F 5KYUA 2CNWA 2J8WA 3ABKC 4BJ5C 4MVOA 3MFNA 3U0CA 3ECSA 3EG9A 5CI9A 1NLXA 1N1CA 2KW3C 1QLEC 4H4KC 1L7CA 4JJFA 4PJLA 2P0NA 5IY5C 4G7OF 3K1IA 1ZHWA 3NKDA 3QZCA 4IRUA 4CDVA 5DVWA 3T6JA 3AG1C 1VTMP 4CS8A 3ZC4A 2A6EF 2UUIA 4XWJA 4YT5A 3Q6MA 4LLCA 4N4WA 3ZTMA 5E3CA 3BRJA 5TJ5E 3RVZA 2X0CA 4NC3A 3V5ZA 1VYKA 5L3VA 2J7PD 3JYYA 4HFKB 3NKEA 4MVMA 4CIHA 2JX0A 2ICWG 2R7XA 5JS5A 2VCCA 3RQFA 4UDVA 3EH1A 2KC3A 1E86A 1IW7F 1ORSC 2J46A 4JEBA 4ULVA 1APCA 4WGZA 3CEXA 2J9VA 1YARO 3F46A 4BJ5A 4QI2A 1YA7O 4I3MA 4YL1A 4Z9HA 1YAUO 5KYUB 3ZQYA 3ATPA 3R7CA 1D1CA 1QSPA 3KH2A 1QPUA 1VYIA 5L0HA 1RCPA 3CAXA 3KYIA 3FOOA 4EWCA 2HJMA 5A6BD 1L3PA 3DD7A 4G7HF 1FR0A 1VK5A 3GM2A 2R03A 3LS1A 4HE8D 2G62A 5CIVA 1OCRC 4BJ1A 3GWNA 4MVUA 3WODF 2B0JA 1NFNA 5L0DA 3GODA 1KTMA 2DGJA 4XEVA 2AVKA 2L9JA 2ZXRA 3E9VA 3QTHA 3ZQVA 1E2XA 2PX3A 3MBGA 4XLNF 5B3SC 3FVYA 1K40A 4F4BA 5JSLA 2CNWD 3C18A 1BR2A 4QI0A 4BG0A 1U6HA 4JC7A 3TOMA 1WATA 2GDCA 3ZDLA 4EIYA 3U3FA 2Q00A 4PACA 3SP1A 3RIPA 1IZMA 4R32A 3U3BA 3I5QA 1EI7A 3UMKA 4PR9A 5DQTA 1ZHTA 1R4TA 4I1MA 1FTSA 3J06A 4U5BE 1LI5A 1MMAA 3L34A 1F1MA 1U89A 1Z6AA 4XTKA 2MYSA 2YL0A 1LPEA 5KYXB 1VLSA 2DYRC 3S27A 2Z15A 4O6NA 3U9MA 3Q7GA 1H6GA 1G4US 2QNLA 4NTAA 4RD9A 4OINF 3RQEA 1OCCC 5E2QA 1K05A 4DVYP 3UNGC 1WTYA 1D0XA 2YKZA 3UGOA 3GWLA 1Z7Qc
chains in the Genus database with same CATH topology
2LK4A 3L8IA 3C8GD 3K7DA 3GM3A 2L6HA 1KNYA 1QVXA 3JYYA 4XEFA 1K40A 1OW6A 1V4AA 1OW8A 1UFBA 2JX0A 3C18A 3B71A 1K04A 3GM1A 3JZ0A 2KK1A 2PBEA 2JPUA 3RQFA 1JOGA 3C8GA 2HSBA 3U3FA 2Q00A 4NQFA 3O10A 4R32A 3U0CA 4EBJA 5F28E 3MFNA 3C8GB 1ZZPA 3S9OA 1O3UA 3TULA 3RQGA 3GM2A 1OW7A 1WWPA 3RQEA 2L6FA 2L6GA 1PV3A 2YWAA 1K05A 4XEKA 1WTYA 4EBKA 3AJMA 1KTMA 3L8JA 4XEVA 3BRJA 1WOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LK4 A;  3L8I A;  3C8G D;  3K7D A;  3GM3 A;  2L6H A;  1KNY A;  1QVX A;  3JYY A;  4XEF A;  1K40 A;  1OW6 A;  1V4A A;  1OW8 A;  1UFB A;  2JX0 A;  3C18 A;  3B71 A;  1K04 A;  3GM1 A;  3JZ0 A;  2KK1 A;  2PBE A;  2JPU A;  3RQF A;  1JOG A;  3C8G A;  2HSB A;  3U3F A;  2Q00 A;  4NQF A;  3O10 A;  4R32 A;  3U0C A;  4EBJ A;  5F28 E;  3MFN A;  3C8G B;  1ZZP A;  3S9O A;  1O3U A;  3TUL A;  3RQG A;  3GM2 A;  1OW7 A;  1WWP A;  3RQE A;  2L6F A;  2L6G A;  1PV3 A;  2YWA A;  1K05 A;  4XEK A;  1WTY A;  4EBK A;  3AJM A;  1KTM A;  3L8J A;  4XEV A;  3BRJ A;  1WOL A; 
#chains in the Genus database with same CATH topology
 2J45 A;  1GS9 A;  1VOM A;  3K7D A;  2EPN A;  4P6I C;  1OW6 A;  5T3W A;  1UFB A;  3K66 A;  4KI2 A;  1A0B A;  2MHR A;  3K6B A;  3NMJ A;  2PBE A;  5GPG B;  4E0H A;  2ASR A;  2ZD9 A;  2YZS A;  2HS5 A;  3C63 A;  1HE1 A;  2HSB A;  4QDL A;  1NU7 D;  2PFD A;  2VB6 A;  4BJ6 C;  3SEO A;  3AGU A;  5JUA A;  4FX5 A;  2A0B A;  3UGP A;  1T9K A;  256B A;  1NZE A;  4IWB A;  3ASN C;  3IEE A;  2V26 A;  1MNE A;  3PDM P;  4BJT A;  5EK0 A;  4B6I A;  4ZLD A;  2W4B A;  1PD0 A;  3VAY A;  4MW3 A;  4YT2 A;  3QW0 A;  1OR3 A;  4MVS A;  3L8J A;  4JZA A;  2EIK C;  4JEA A;  1Q0M A;  2Y3B A;  5E3A A;  4EBB A;  3TD7 A;  2Q9B A;  4YWQ A;  3L8I A;  4LER A;  3GOR A;  3QVZ A;  3N24 A;  4MTF A;  1HW2 A;  1K04 A;  2R02 A;  2CGE A;  2NUP B;  4JRZ A;  2W4M A;  2ZPA A;  1OR2 A;  2YLD A;  4BJ6 A;  4JVS A;  4E7S A;  4OIP F;  1Y6D A;  1HMO A;  4O79 A;  5D91 A;  2IBF A;  2R7U A;  3QW1 A;  1T6Q A;  1MQV A;  4U9E A;  3SXK A;  2Q9A A;  1WWP A;  2XS8 A;  4DRJ B;  2XM4 A;  3X1O A;  2XLO A;  3WHN A;  1TWH A;  1TR2 A;  3JCU Q;  4AK9 A;  5AC4 A;  3B0V C;  5F5F A;  2OJQ A;  2QTV A;  1LE4 A;  4KNV A;  3KPH A;  4CS8 C;  3I4U A;  1OCZ C;  4JJG A;  2VCA A;  1WOL A;  3C8Z A;  2NUP A;  1VB5 A;  2YLG A;  3I5P A;  3TUL A;  3H2U A;  1ZW3 A;  2LP4 A;  3RFY A;  1SYQ A;  2KSF A;  3ABL C;  2YHS A;  3V5Y A;  3EHM A;  1AUE A;  2JD3 A;  3KMI A;  3UMH A;  2J0X A;  4EBJ A;  2AP3 A;  5A6J A;  5L0F A;  2WZF A;  4AL1 A;  2H8A A;  3LJB A;  4Q4Z F;  3M1C B;  1V55 C;  4HFF B;  1I5N A;  1NFO A;  4OD4 A;  2HUJ A;  2XM0 A;  2XSE A;  1OW7 A;  3IQ5 A;  4CJO A;  2OCC C;  1O5H A;  2AWC A;  4GEH A;  1LI7 A;  2AWY A;  1TKN A;  1TQG A;  4XLP F;  3LUT B;  3VM6 A;  3U2M A;  3AJM A;  2R7T A;  3JTL O;  3UMI A;  2R7R A;  4GYT A;  4J30 B;  4P9F A;  1GQA A;  1HW1 A;  3A9C A;  4XPX A;  1BZ4 A;  3X2Q C;  4CS9 A;  1C02 A;  3TQO A;  3DKA A;  2O9X A;  4JCZ A;  3DJN B;  3RF3 A;  1HMD A;  2Y39 A;  3AQB A;  2WZG A;  3LES A;  5DS5 A;  2YEV A;  1D1B A;  1TWC A;  1YYJ A;  2R7O A;  3LLI A;  1TWA A;  2H7O A;  2WVO A;  4NY3 A;  5JVE A;  2Y3D A;  1JPN A;  3LNR A;  3UR3 C;  4DBR A;  4MVQ A;  1LVK A;  1ZHX A;  2L81 A;  4ONS A;  1CPQ A;  4WGY A;  5JT4 A;  3LLK A;  2CDQ A;  3U8P A;  3AQC A;  3S0X A;  4OIO F;  1Z63 A;  3EJN A;  1M56 C;  2KQ9 A;  1NU9 C;  2XXA B;  1OCO C;  2R7Q A;  4ANJ A;  4XEK A;  1E83 A;  1W2W A;  2YL7 A;  3DZA A;  2MWQ A;  3GAN A;  3NMK A;  3PMR A;  1RKC A;  2YL1 A;  3GM3 A;  2OOC A;  3AG4 C;  4IJJ A;  4Z9I A;  2D5R B;  2J0W A;  2EPO A;  4G7Z F;  3SXM A;  2L7A A;  5COF A;  4WAB A;  3VF0 A;  3JYH A;  5KYN A;  3HTK C;  3AOU A;  4E17 A;  2EIN C;  3EFO A;  1QQ3 A;  4U5G A;  3ZSU A;  1SF8 A;  4E0I A;  5L0C A;  4Z9J A;  2G3V A;  2KGO A;  2P7V A;  2Y69 C;  3MYF A;  1GM5 A;  4ER9 A;  4PFP A;  1V74 B;  5L0J A;  1NBB A;  2B0H A;  2Y3H A;  4K0D A;  2XXA A;  2HZ8 A;  1M2V B;  3EZH A;  4WJ0 A;  1JMW A;  2XL4 A;  2J9U A;  4PFO A;  5AGF A;  1PV3 A;  4DRH B;  3RW0 A;  2CYD A;  2EIL C;  4IB4 A;  2PF4 E;  1D0Z A;  1Q0D A;  1Z3I X;  1ZYR F;  5FCL A;  2QE9 A;  4W8K A;  4KBL A;  1A7D A;  4X0R A;  1ORY A;  3JT1 A;  4BEM J;  1LS1 A;  1OW8 A;  2WZL A;  2FGY A;  2HV7 A;  3H2V A;  3LAY A;  3M79 A;  4OD5 A;  4JKV A;  4YK5 A;  5T1D B;  2P61 A;  3RKO F;  4YL3 A;  4YJW A;  2PX0 A;  2UUH A;  1MMN A;  1DOV A;  3NRH A;  3S29 A;  3C8G B;  3EZI A;  1O87 A;  1RJ9 B;  2HJ3 A;  1E85 A;  1RMV A;  2EPM X;  5COM A;  1M2V A;  3ABM C;  4MQ9 F;  4LLE A;  3S90 A;  2TMV P;  4OIQ F;  1ORJ A;  2AU5 A;  3ZTZ A;  4NTF A;  4NCQ A;  3NYL A;  4C7O A;  1YZA A;  4JW1 A;  1J8M F;  4A2N B;  2YL3 A;  1HE9 A;  1FMV A;  2NUT B;  3FHD A;  2NG1 A;  1G4W R;  2ZXW C;  1XWJ A;  2LK4 A;  2RSE B;  4CDY A;  1FFT C;  3QMK A;  2IYL D;  1G5Z A;  2J9B A;  2XS1 A;  3EPV A;  1SZI A;  1YVI A;  3DMD A;  1MMG A;  4MND A;  4OIR F;  1BDJ B;  2JPU A;  2Q3T A;  1ZU4 A;  4J7Y A;  3C8G A;  2VH3 A;  2LQG A;  1MND A;  1RJ9 A;  4YL0 A;  2WVQ A;  3JRT A;  3Q6N A;  3EH2 A;  3O10 A;  4NQF A;  3CZ6 A;  5COG A;  3PCV A;  3W2V A;  1T6I A;  2XLE A;  3IQ6 A;  3RYL A;  3DM5 A;  1O3U A;  4RDA A;  5KYW B;  1AEP A;  3M4B A;  4MS2 A;  3CQZ A;  1CGN A;  4KC9 A;  2J9W A;  3G4X A;  2NUT A;  3TK0 A;  4AE4 B;  2ZXP A;  1YJG A;  2P6V A;  1JPJ A;  3H65 A;  2WVN A;  2R9R B;  2NSF A;  2HKV A;  1Q0G A;  1G8X A;  2LIG A;  3M4C A;  4I44 A;  2OJE D;  1YZC A;  1AVO B;  2C03 A;  3FOP A;  4U5H A;  1J8Y F;  1QZX A;  2CW0 F;  4H54 A;  1LM3 B;  5EGY A;  3MYI A;  1QKR A;  1ZW2 A;  2NPU A;  1Y4C A;  2P1A A;  3OWT A;  4IAO A;  1WGW A;  2CCY A;  4N6C A;  5B1B C;  4GQH A;  4CS9 C;  5L3Q A;  3EGX B;  3VYW A;  3DAF A;  4PJM A;  1JRA A;  5F28 E;  3JSZ A;  1CPR A;  4DRI B;  2HFI A;  5T3T A;  5K0I A;  3T9O A;  2ZXO A;  2KJG A;  1ZHY A;  3HKK A;  3LEO A;  4AE4 A;  4DOZ A;  1NSG B;  1Q0K A;  4E7Z A;  2HSQ A;  4I1O B;  3U5S A;  5DLJ A;  2EPL X;  5A6A A;  2VAS A;  3EGD B;  3FAP B;  4CSA A;  3JRM O;  1S7Z A;  2Y3G A;  2Q4F A;  3F47 A;  2NSG A;  4D4X A;  3AG3 C;  4U5C E;  3S84 A;  2YLI A;  2BC5 A;  1EA8 A;  1WAS A;  3U8V A;  3B29 A;  4Q7C A;  2DB4 A;  2GA0 A;  4M63 A;  1FFH A;  3C8G D;  2PNO A;  3LNM B;  3NYM A;  2XRH A;  3DE8 A;  3DJU B;  5BQI A;  4LAC B;  4IAQ A;  3EGX A;  4XQ1 A;  1OKK A;  4CJG A;  3FMS A;  1XZP A;  2FFH A;  1A7V A;  1Q0F A;  1R5I D;  2H7B A;  3A11 A;  3S28 A;  5BQH A;  3MLG A;  1A41 A;  2W45 A;  3CSK A;  1KU2 A;  2E87 A;  2OG2 A;  2X51 A;  5A6K A;  3HNL A;  3EGD A;  3GEI A;  1PD1 A;  3R2P A;  3U9J A;  2XLD A;  2IXN A;  2QY9 A;  3EHN A;  3EFO B;  3HNJ A;  3N0T A;  3RQG A;  3B0U X;  5AC5 A;  4A4A A;  1MMD A;  3KYJ A;  3O6X A;  2XLM A;  4FES A;  3NYJ A;  2EIJ C;  1Z5Z A;  4C3B A;  3T4R A;  4MTG A;  3SYN A;  1EQ1 A;  2LSE A;  1YDI A;  2KYH A;  1I4Z A;  1E84 A;  1DOW A;  3WG7 C;  4AX2 A;  3DI5 A;  4DJ9 A;  2R05 A;  3C7J A;  4O6Y A;  2R7V A;  1TFO B;  4G78 A;  3FDQ A;  2KK1 A;  2WL8 A;  2Q7R A;  3GEE A;  2IOQ A;  4BEJ A;  4FAP B;  2BL2 A;  3B0P A;  4U5F E;  1UG7 A;  1NG1 A;  1OXK A;  4J32 B;  2LFF A;  4U5E E;  5D92 A;  3SZR A;  2OEX A;  2XL8 A;  2A6H F;  4XPY A;  3ASO C;  4PJJ A;  4ULW A;  1YLM A;  2LD6 A;  2OQM A;  3HLZ A;  3DWW A;  2G3K A;  5B3I A;  2GFH A;  2A69 F;  2L6F A;  3LEV A;  4AL0 A;  2YWA A;  2A0U A;  3DE9 A;  3BEH A;  3L0I A;  1OKK D;  2VCB A;  2C04 A;  4JTC B;  4BPM A;  1LIH A;  2R7W A;  3DAG A;  2BE5 F;  1JR8 A;  1KNY A;  1QVX A;  2D4U A;  5CI8 A;  1H9G A;  4RBN A;  5DQZ A;  1BR4 A;  4CBE A;  3L1M A;  2PP4 A;  1ZHZ A;  3IHU A;  2I8B A;  1JOG A;  5EHH A;  1OXB A;  1YYX A;  2WB7 A;  4KNW A;  1FMW A;  4N6H A;  5JP7 A;  5A69 A;  3G4Z A;  3POV A;  2GWW A;  2ETS A;  3KKB A;  3QVY A;  4W8P A;  2OKU A;  3ZWI A;  2M4E A;  1ZZP A;  2R7S A;  2EIM C;  1T01 A;  2W9Y A;  3W4Y A;  5L0I A;  2HV6 A;  2RD9 A;  1LKX A;  1EKY A;  2QUP A;  3ITF A;  4NTB A;  4PK4 A;  1LE2 A;  2IXM A;  2LCH A;  1T6U A;  2XLW A;  2KNH A;  4FWV A;  4MVZ A;  4EHP A;  3NMI A;  1CGO A;  4C3E A;  3M15 A;  2L6G A;  3AG2 C;  4YT8 A;  3JSE O;  3OA1 A;  1M2O A;  5JRA A;  4G0H A;  4IGG A;  1M57 C;  2IXP A;  2OU6 A;  3FAJ A;  3NDB B;  1GGQ A;  4K7B A;  4IAR A;  3US6 A;  5KYY B;  3ZG1 A;  1WN0 A;  3E70 C;  1Z23 A;  3PHF 2;  1ZU5 A;  3GEH A;  1H9T A;  1SMY F;  2Q9C A;  3AGT A;  3B71 A;  3W8H A;  1C17 M;  3ZVR A;  1H7I A;  4MTO A;  5DS6 A;  2HMZ A;  3B9Q A;  4MVR A;  5B1A C;  5KYX A;  3K1H A;  3O39 A;  3OEO A;  4U9D A;  3RH3 A;  2QLA A;  1V54 C;  3W2W A;  4YT4 A;  1FAP B;  1D0Y A;  2XLH A;  3HNK A;  1BBH A;  4MW8 A;  1U0B B;  4CDA A;  2DI3 A;  3T6G B;  2LFD A;  4C7O B;  1VMA A;  1D1A A;  2H7V C;  1A7E A;  1RKE B;  4JE9 A;  4J7T A;  2HMQ A;  3K33 A;  4L6R A;  4N06 A;  3C62 A;  4LDQ A;  4CSA C;  5KYY A;  2IXO A;  4Q5S F;  1YA9 A;  3TJ6 A;  3W8I A;  4JUR I;  4LDR A;  1SR2 A;  4DXW A;  5L0G A;  3TOL A;  1XZQ A;  1M6T A;  2I15 A;  1RXQ A;  4P9T A;  2GAQ A;  1C03 A;  3O55 A;  3ZIB A;  5F5H A;  3IQC A;  4CX9 A;  1V4A A;  4JCH A;  3WAQ A;  4EUK B;  1T5O A;  3GM1 A;  2YVK A;  2M64 A;  4U5D E;  3FXH A;  2XL6 A;  4ZLC A;  2J7P A;  4JIO A;  1CGM E;  1S05 A;  3DM9 B;  3KL4 A;  3Q7L A;  3MX3 A;  1B68 A;  3N2Z B;  4JTA B;  5E33 A;  3SXZ A;  4D4N A;  4EKW A;  4K1O A;  2V3C C;  3IPM O;  3HNI A;  3S9O A;  1I4Y A;  3NG1 A;  1ST6 A;  5HV9 A;  1OQC A;  1JAF A;  1RKE A;  2A1D D;  2FAP B;  1ZVZ A;  4E18 A;  2DYS C;  1BR1 A;  4JTD B;  3T6B A;  3EG9 B;  1TWG A;  5BQG A;  3VRC A;  2YRF A;  3G50 A;  3K1I C;  3RVY A;  1TFK B;  4HEA J;  2YQY A;  3IQT A;  4O7G A;  5FZT A;  3SNH A;  4C3D A;  5A6B A;  2OEV A;  4YN0 B;  4EBK A;  1HY5 A;  4LDK A;  4PJN A;  4DVZ A;  4CIP A;  1PCX A;  3DXJ F;  4DBQ A;  2VC9 A;  2XLV A;  3U2L A;  3SXY A;  5JLI A;  2L6H A;  2F22 A;  4XEF A;  4XPW A;  5HSW A;  2EPK X;  3V5X A;  3EQL F;  3LS0 A;  2IM8 A;  3JZ0 A;  3TJ5 A;  5BUO A;  3V7O A;  4CS7 A;  5KYW A;  3HJC A;  5DS4 A;  1LS4 A;  2R25 A;  1FNT c;  4O6M A;  1VLT A;  2A68 F;  5KYU A;  2CNW A;  2J8W A;  3ABK C;  4BJ5 C;  4MVO A;  3MFN A;  3U0C A;  3ECS A;  3EG9 A;  5CI9 A;  1NLX A;  1N1C A;  2KW3 C;  1QLE C;  4H4K C;  1L7C A;  4JJF A;  4PJL A;  2P0N A;  5IY5 C;  4G7O F;  3K1I A;  1ZHW A;  3NKD A;  3QZC A;  4IRU A;  4CDV A;  5DVW A;  3T6J A;  3AG1 C;  1VTM P;  4CS8 A;  3ZC4 A;  2A6E F;  2UUI A;  4XWJ A;  4YT5 A;  3Q6M A;  4LLC A;  4N4W A;  3ZTM A;  5E3C A;  3BRJ A;  5TJ5 E;  3RVZ A;  2X0C A;  4NC3 A;  3V5Z A;  1VYK A;  5L3V A;  2J7P D;  3JYY A;  4HFK B;  3NKE A;  4MVM A;  4CIH A;  2JX0 A;  2ICW G;  2R7X A;  5JS5 A;  2VCC A;  3RQF A;  4UDV A;  3EH1 A;  2KC3 A;  1E86 A;  1IW7 F;  1ORS C;  2J46 A;  4JEB A;  4ULV A;  1APC A;  4WGZ A;  3CEX A;  2J9V A;  1YAR O;  3F46 A;  4BJ5 A;  4QI2 A;  1YA7 O;  4I3M A;  4YL1 A;  4Z9H A;  1YAU O;  5KYU B;  3ZQY A;  3ATP A;  3R7C A;  1D1C A;  1QSP A;  3KH2 A;  1QPU A;  1VYI A;  5L0H A;  1RCP A;  3CAX A;  3KYI A;  3FOO A;  4EWC A;  2HJM A;  5A6B D;  1L3P A;  3DD7 A;  4G7H F;  1FR0 A;  1VK5 A;  3GM2 A;  2R03 A;  3LS1 A;  4HE8 D;  2G62 A;  5CIV A;  1OCR C;  4BJ1 A;  3GWN A;  4MVU A;  3WOD F;  2B0J A;  1NFN A;  5L0D A;  3GOD A;  1KTM A;  2DGJ A;  4XEV A;  2AVK A;  2L9J A;  2ZXR A;  3E9V A;  3QTH A;  3ZQV A;  1E2X A;  2PX3 A;  3MBG A;  4XLN F;  5B3S C;  3FVY A;  1K40 A;  4F4B A;  5JSL A;  2CNW D;  3C18 A;  1BR2 A;  4QI0 A;  4BG0 A;  1U6H A;  4JC7 A;  3TOM A;  1WAT A;  2GDC A;  3ZDL A;  4EIY A;  3U3F A;  2Q00 A;  4PAC A;  3SP1 A;  3RIP A;  1IZM A;  4R32 A;  3U3B A;  3I5Q A;  1EI7 A;  3UMK A;  4PR9 A;  5DQT A;  1ZHT A;  1R4T A;  4I1M A;  1FTS A;  3J06 A;  4U5B E;  1LI5 A;  1MMA A;  3L34 A;  1F1M A;  1U89 A;  1Z6A A;  4XTK A;  2MYS A;  2YL0 A;  1LPE A;  5KYX B;  1VLS A;  2DYR C;  3S27 A;  2Z15 A;  4O6N A;  3U9M A;  3Q7G A;  1H6G A;  1G4U S;  2QNL A;  4NTA A;  4RD9 A;  4OIN F;  3RQE A;  1OCC C;  5E2Q A;  1K05 A;  4DVY P;  3UNG C;  1WTY A;  1D0X A;  2YKZ A;  3UGO A;  3GWL A;  1Z7Q c; 
#chains in the Genus database with same CATH homology
 2LK4 A;  3L8I A;  3C8G D;  3K7D A;  3GM3 A;  2L6H A;  1KNY A;  1QVX A;  3JYY A;  4XEF A;  1K40 A;  1OW6 A;  1V4A A;  1OW8 A;  1UFB A;  2JX0 A;  3C18 A;  3B71 A;  1K04 A;  3GM1 A;  3JZ0 A;  2KK1 A;  2PBE A;  2JPU A;  3RQF A;  1JOG A;  3C8G A;  2HSB A;  3U3F A;  2Q00 A;  4NQF A;  3O10 A;  4R32 A;  3U0C A;  4EBJ A;  5F28 E;  3MFN A;  3C8G B;  1ZZP A;  3S9O A;  1O3U A;  3TUL A;  3RQG A;  3GM2 A;  1OW7 A;  1WWP A;  3RQE A;  2L6F A;  2L6G A;  1PV3 A;  2YWA A;  1K05 A;  4XEK A;  1WTY A;  4EBK A;  3AJM A;  1KTM A;  3L8J A;  4XEV A;  3BRJ A;  1WOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...