3TULA

Crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
145
structure length
136
Chain Sequence
EGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKEMGISKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAATKKLTQAQNKLQSLAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell invasion protein sipB
publication title The Structures of Coiled-Coil Domains from Type III Secretion System Translocators Reveal Homology to Pore-Forming Toxins.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
total genus 52
structure length 136
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16535 T3SSipB Type III cell invasion protein SipB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3tulA00
4EBJA 3TULA 2JPUA 1WTYA 4XEFA 3L8JA 3RQGA 3JYYA 3BRJA 3O10A 1K05A 3GM1A 3GM2A 1OW8A 1OW7A 2YWAA 3RQEA 4R32A 1K04A 1WWPA 1ZZPA 3MFNA 3C18A 4XEVA 3AJMA 2Q00A 3GM3A 3K7DA 1V4AA 2JX0A 1K40A 2L6HA 3C8GB 3L8IA 3B71A 3U3FA 1QVXA 3RQFA 2PBEA 3U0CA 1PV3A 1JOGA 2KK1A 2L6FA 5F28E 4NQFA 3JZ0A 1WOLA 2LK4A 1O3UA 4EBKA 1UFBA 2HSBA 1KTMA 1KNYA 3S9OA 3C8GA 4XEKA 3C8GD 1OW6A 2L6GA
chains in the Genus database with same CATH superfamily
5JVEA 2VCCA 5L0CA 4ZLDA 4PR9A 4XEFA 1AEPA 1YA9A 2L9JA 3RF3A 1T5OA 3IPMO 4QI0A 5HSWA 4MW8A 1RXQA 2YWAA 4MVQA 1RKEA 1ZU5A 1WN0A 1MMDA 4CIHA 3HNLA 3NYMA 4CBEA 4DRJB 2KGOA 3M4BA 4HEAJ 4DOZA 2OU6A 1C02A 1YDIA 3LS1A 4CX9A 3G4ZA 4MVMA 3GWLA 1M2VB 2B0HA 5AGFA 1TWHA 3CEXA 3NYJA 4JJFA 2XL8A 5D92A 1KTMA 3FAPB 2EIMC 3NG1A 2BE5F 2KW3C 2EPKX 2QTVA 3DAGA 3DXJF 4XEKA 3WAQA 4CJGA 1XZQA 5KYNA 2R7UA 1M6TA 1J8YF 4MTFA 1C17M 4A2NB 1LI5A 4YT5A 4PK4A 2GA0A 3G4XA 4MW3A 3RQGA 3ZTMA 3MX3A 1E86A 1EQ1A 1Z6AA 3CSKA 2D5RB 4JTAB 3AQBA 3DE9A 2ZXPA 1RJ9A 2EILC 2PX3A 2CW0F 4K0DA 4KBLA 1E84A 3HTKC 2WL8A 4ULVA 2Q4FA 4LERA 2NUTA 4ANJA 5DS6A 4LDQA 3S29A 1HMOA 1OCCC 1NSGB 2J9BA 5L3VA 3R7CA 2Y3HA 5COFA 3T6JA 4PFPA 4AK9A 5IY5C 3B0UX 1TKNA 3ZIBA 1MNEA 2J0XA 2W45A 3LNRA 5KYUB 3JT1A 1KNYA 1ZW2A 3HLZA 4AL1A 5KYYA 3UGPA 3DJNB 3POVA 1TFOB 4Z9HA 3N24A 2D4UA 4MQ9F 1T01A 4FWVA 1FAPB 1M2OA 4OIOF 1HY5A 3AG2C 2KC3A 5AC5A 2W9YA 3EHNA 4JTCB 4RDAA 3C8ZA 3GEHA 4A4AA 2A69F 5AC4A 3K33A 5B3SC 2MWQA 3Q7GA 4PJNA 5JRAA 3T6GB 1QQ3A 1YAUO 2VASA 3C62A 2XLWA 2CYDA 1K40A 2A0UA 1PD1A 1Z5ZA 4JKVA 4LLCA 1SF8A 2PNOA 5GPGB 4QDLA 2X0CA 5DQZA 5E3AA 5TJ5E 4J7TA 2M64A 4PFOA 4G78A 2G62A 5L0GA 1VYIA 3JSZA 3K1HA 3KH2A 1RKEB 4JW1A 1JPNA 3S27A 4OIPF 2W4MA 1NG1A 3FHDA 3X2QC 2Q3TA 3H2UA 5A6BD 5EHHA 2YRFA 1Q0FA 4FESA 2J9VA 5BUOA 1T6IA 3EZIA 3QVYA 1VYKA 2IXNA 3FOPA 1H9GA 2VCBA 4CJOA 4R32A 5KYXA 2YL7A 1K04A 4XQ1A 2WZFA 4ER9A 4D4XA 1MMGA 4XPWA 5FZTA 4EKWA 5JS5A 3OWTA 1S7ZA 4EHPA 1H9TA 2HSQA 3ASNC 3M15A 3EGXA 2EPMX 3Q6MA 1ORJA 2CNWA 1DOVA 1Q0DA 1LVKA 1TR2A 2J0WA 1YJGA 1JOGA 4NTAA 2MHRA 3SP1A 1ZHXA 4JCZA 1NU7D 3FDQA 2BC5A 4C7OA 3I5PA 3EFOA 1LS1A 3O6XA 1C03A 2YQYA 3CZ6A 1YVIA 3CQZA 3B29A 4GQHA 2HJ3A 4IARA 4OD4A 2YVKA 3IQTA 4O6MA 4NC3A 1I5NA 4MVOA 5T1DB 4CS9C 4JEBA 4BEMJ 4EBJA 1D1BA 3FAJA 2H7OA 3AG3C 3KYIA 4DVYP 4YWQA 4ZLCA 1NU9C 4GYTA 1ZU4A 4I1OB 1OW8A 4E0HA 2XL6A 3RQEA 3LUTB 1NFNA 4E18A 3RW0A 4RBNA 2YLDA 4K7BA 2R25A 3DM5A 4Z9IA 2R7VA 3ECSA 2CDQA 2L7AA 2LSEA 5KYWB 3NKEA 2VH3A 2XLHA 3ABLC 5E2QA 2Q9AA 2ASRA 4O6YA 3QMKA 2IBFA 5CI9A 2KK1A 2EIJC 2OG2A 4MTOA 1BDJB 1IW7F 2RSEB 3AGUA 1WOLA 3LJBA 4MVRA 4CS7A 1Q0KA 2J45A 3EGDA 4J7YA 4JRZA 4DBRA 2XXAA 3ZDLA 4JIOA 1KU2A 1OW6A 4O6NA 4U9DA 4CS9A 3SEOA 3HNKA 1WASA 3FXHA 4U5BE 4F4BA 4G7ZF 2R7OA 2Y3DA 1Z7Qc 2A6HF 1HMDA 1LPEA 3PMRA 3U2LA 3UMHA 1M57C 1TFKB 3BRJA 3GANA 3L0IA 2HUJA 1CGOA 2EPOA 1L7CA 3W2WA 2LIGA 1G4US 3DJUB 3I5QA 4KC9A 2XM0A 2YEVA 1Q0MA 1VB5A 2EPLX 3QTHA 3RFYA 2I8BA 1ORSC 1TQGA 2DGJA 4WABA 3EJNA 3W2VA 3DZAA 3U3FA 4MVUA 3NMKA 2JD3A 4JJGA 3JRMO 3K1IC 2XS8A 1LM3B 2A68F 4J30B 3DI5A 4FX5A 4BJ1A 4E17A 1O5HA 3EH2A 3C63A 3H65A 2O9XA 3W8HA 2EINC 3S90A 3FVYA 5DS4A 2XM4A 4OIQF 3EG9A 4CS8C 1IZMA 4CDAA 3PDMP 2ETSA 3SXYA 2LP4A 3JTLO 4U9EA 2ZD9A 4X0RA 3TK0A 1TWGA 5L0DA 3MYIA 4JEAA 3F47A 3VF0A 4P6IC 4YL3A 4BJTA 1GM5A 3LEVA 1WGWA 2NPUA 4C7OB 3EFOB 1LI7A 5F5FA 5CI8A 2A6EF 2Q00A 4QI2A 1V4AA 1MNDA 5F5HA 1FNTc 2QUPA 4PJJA 4G7HF 4YJWA 3K1IA 1HE9A 3KL4A 4JC7A 3AG1C 4C3DA 2HV6A 1JR8A 4YN0B 3SYNA 3TQOA 2XS1A 3RIPA 3QVZA 2AP3A 2XLVA 4HFKB 2QNLA 4Q7CA 1A7EA 4CS8A 2LD6A 1BR1A 2ICWG 1Y6DA 2L6GA 3ATPA 3JRTA 4I44A 5L0HA 1N1CA 2JPUA 2M4EA 5JLIA 5JP7A 2ZPAA 4AL0A 4AX2A 2R03A 2CGEA 2TMVP 3C7JA 2Q9BA 1HE1A 3LAYA 2HMZA 4E7SA 3U3BA 4EWCA 3O55A 3S28A 3ABMC 3HKKA 4AE4A 4C3BA 4RD9A 2P0NA 3IHUA 3MFNA 1NFOA 3EGDB 3TD7A 1BR2A 1G8XA 1VLTA 3K7DA 5HV9A 1OKKD 1D1CA 2LCHA 1QPUA 2OEVA 2PF4E 1I4YA 2J7PD 1RMVA 3TOMA 5COGA 2F22A 4CIPA 1OXBA 3S84A 1RCPA 3Q6NA 1ZHTA 1ZHZA 3OA1A 5D91A 3JZ0A 3FOOA 3ZVRA 2XL4A 3Q7LA 4MTGA 4HFFB 3S9OA 3C8GA 4M63A 3DM9B 2ZXOA 3DWWA 3T4RA 3UMIA 1L3PA 1VK5A 1HW1A 1Y4CA 1V54C 4LLEA 1XWJA 3QW1A 2G3KA 3V7OA 3L8JA 3E9VA 3GEIA 3WG7C 3RH3A 4LDKA 4OINF 1T6QA 4IJJA 4CDYA 4DRHB 4FAPB 4YT4A 3DE8A 4O7GA 1WWPA 3VAYA 3EH1A 2L81A 4XPYA 3WODF 5BQHA 3TJ5A 2PX0A 2C04A 2JX0A 3GODA 3L8IA 4DJ9A 2IXPA 3B71A 4I3MA 1M56C 3RQFA 4YT2A 5E3CA 1OR2A 2OJED 256BA 1T9KA 2IYLD 4IB4A 1O3UA 2FGYA 3FMSA 2UUIA 2P61A 3O39A 1UG7A 1APCA 1R5ID 1OR3A 1AVOB 4MNDA 3AG4C 1RJ9B 4YK5A 1M2VA 3U9MA 1JRAA 2EPNA 1A41A 1GGQA 3DKAA 4E0IA 5T3WA 2W4BA 3OEOA 2NUTB 2GWWA 3W4YA 1QZXA 2GAQA 4IGGA 1U89A 3UR3C 3GEEA 4BJ6C 5T3TA 1YYJA 2H8AA 5KYYB 2L6HA 2YZSA 3ZC4A 2AU5A 2YKZA 2R02A 3LESA 4JURI 5JUAA 4JZAA 1S05A 1AUEA 2UUHA 3TJ6A 3WHNA 2IXMA 2YL1A 4EBKA 3ASOC 5A6JA 1QLEC 4KNWA 1MQVA 3GWNA 1LE2A 3ZTZA 2PP4A 4NY3A 4BG0A 1VOMA 1WTYA 2NUPA 3J06A 3JYYA 1YYXA 1PD0A 2OOCA 2C03A 1D0XA 1MMNA 3IEEA 1LIHA 2OEXA 3PCVA 2R7RA 1OW7A 1H6GA 4HE8D 3NDBB 2QLAA 4G0HA 2NG1A 2Y3BA 3AGTA 3KPHA 4JVSA 5B3IA 1PCXA 2XLDA 5BQIA 4P9TA 1ZVZA 2RD9A 1FMVA 4BJ6A 3AJMA 2DI3A 4G7OF 3MYFA 2P1AA 3T9OA 1A0BA 1OCZC 2LFDA 4Q5SF 1JPJA 2XSEA 3MBGA 3V5ZA 3M79A 3EHMA 4U5GA 4OD5A 4B6IA 4BJ5C 1RKCA 2OQMA 3JYHA 3VM6A 1T6UA 4XWJA 3U0CA 3UGOA 4DVZA 2BL2A 2DYSC 4U5HA 3IQ5A 3SNHA 1ZW3A 2XRHA 3JCUQ 3HJCA 3G50A 2R7SA 4WGZA 2V3CC 3R2PA 2R7TA 3EZHA 4H54A 1FFTC 2I15A 2XLEA 4KNVA 5A6BA 5KYXB 3TULA 3F46A 1JAFA 2VCAA 2QY9A 3DAFA 1GS9A 3VRCA 3T6BA 2Y39A 2WZLA 1A7DA 2KQ9A 2YHSA 3EGXB 2AWCA 3MLGA 1SYQA 2A0BA 1V55C 2AVKA 2YLGA 1J8MF 1MMAA 4H4KC 2QE9A 4JE9A 3RKOF 3SXMA 5DVWA 3ZSUA 1W2WA 4W8PA 1VTMP 3V5YA 4PACA 2HKVA 4DBQA 1WATA 1YA7O 1QKRA 1OCOC 2HZ8A 2Q7RA 2HMQA 3ZG1A 1FTSA 4BJ5A 1A7VA 1B68A 2CNWD 2FAPB 3RYLA 3KYJA 2J46A 3W8IA 4WGYA 1NBBA 4L6RA 5B1AC 4ULWA 5F28E 4EIYA 1R4TA 1D0ZA 3UMKA 4JCHA 4P9FA 1ZHYA 2YLIA 3NMIA 2HSBA 4MVSA 4PJLA 1CGNA 4YL1A 4DXWA 1SR2A 3E70C 4O79A 1H7IA 4U5EE 1ST6A 3TOLA 5L0FA 4CDVA 2B0JA 4N06A 4W8KA 1Z23A 1XZPA 3NKDA 5L0JA 3LS0A 2Y69C 1D1AA 3GM1A 4J32B 3K66A 5DLJA 4JTDB 4YL0A 1OXKA 3V5XA 5FCLA 1LE4A 2FFHA 5JSLA 2WVNA 2R05A 3ZWIA 3M4CA 3BEHA 2R7XA 3C18A 3B0PA 2XXAB 2IOQA 3H2VA 5DS5A 3GM3A 4N4WA 1SMYF 2WVQA 2HV7A 3HNIA 1ORYA 2L6FA 2NUPB 2OKUA 2AWYA 3A9CA 3LNMB 3U2MA 5KYWA 4IRUA 5B1BC 2XLOA 4ONSA 2VB6A 1E85A 1BR4A 3LLIA 4MVZA 1FMWA 1TWAA 2XLMA 1VLSA 4N6CA 4EBBA 5A69A 4XLPF 3DMDA 3ITFA 4LACB 1DOWA 1BZ4A 4XTKA 2PFDA 2NSGA 2WZGA 3ZQYA 3KKBA 4CSAC 1G4WR 4PJMA 3ABKC 4NTFA 1CPQA 3U8VA 2P7VA 1YLMA 2WVOA 3RVYA 3EPVA 2NSFA 2H7VC 5BQGA 1ZZPA 5EGYA 2OJQA 4D4NA 2R7WA 1E2XA 1G5ZA 3KMIA 2R7QA 1EKYA 4WJ0A 2KYHA 2J8WA 1OQCA 3DD7A 3SXKA 3U9JA 1FR0A 1JMWA 1QVXA 3EG9B 3IQ6A 4IWBA 3U5SA 3PHF2 4U5DE 3IQCA 1YZCA 3QZCA 4NQFA 2LK4A 2ZXRA 5JT4A 1UFBA 1D0YA 2J9UA 2KNHA 2Y3GA 1Q0GA 2H7BA 4YT8A 5EK0A 1NZEA 2EIKC 1CGME 4GEHA 3AQCA 4CSAA 3AOUA 2LQGA 1EI7A 3O10A 2J9WA 3GM2A 4KI2A 4I1MA 5A6AA 1SZIA 2G3VA 1HW2A 2HS5A 3US6A 1VMAA 3N0TA 3S0XA 4Q4ZF 2IM8A 3NYLA 1I4ZA 3L34A 2GDCA 4MS2A 3I4UA 4N6HA 1TWCA 3N2ZB 3L1MA 1ZYRF 2YL3A 3EQLF 3K6BA 4NCQA 3X1OA 3SXZA 1U6HA 3CAXA 3UNGC 2LFFA 3U8PA 1PV3A 2OCCC 4Z9JA 3NRHA 1E83A 4U5FE 2Q9CA 5L0IA 1EA8A 4E7ZA 2X51A 3ZQVA 3B0VC 4NTBA 4DRIB 1BBHA 4OIRF 3SZRA 1LS4A 1F1MA 1LKXA 2P6VA 2Z15A 1V74B 4XLNF 5A6KA 3HNJA 3M1CB 5COMA 4AE4B 4IAOA 1CPRA 1GQAA 5E33A 4BEJA 1YZAA 1K05A 2KJGA 5KYUA 5K0IA 2VC9A 1Z3IX 4EUKB 4IAQA 4U5CE 4LDRA 3QW0A 4BPMA 2HJMA 2WB7A 2HFIA 2KSFA 3JSEO 4XEVA 1QSPA 2V26A 3VYWA 2GFHA 3LLKA 1OKKA 2DYRC 4XPXA 3C8GB 1YARO 2J7PA 3GORA 1ZHWA 2IXOA 2ZXWC 5CIVA 2PBEA 2CCYA 3NMJA 5L3QA 1U0BB 1FFHA 1OCRC 3A11A 4UDVA 1NLXA 1O87A 3LEOA 2A1DD 5DQTA 1Z63A 3RVZA 3B9QA 2E87A 4K1OA 2DB4A 2MYSA 3C8GD 2YL0A 2R9RB 4C3EA
chains in the Genus database with same CATH topology
4EBJA 3TULA 2JPUA 1WTYA 4XEFA 3L8JA 3RQGA 3JYYA 3BRJA 3O10A 1K05A 3GM1A 3GM2A 1OW8A 1OW7A 2YWAA 3RQEA 4R32A 1K04A 1WWPA 1ZZPA 3MFNA 3C18A 4XEVA 3AJMA 2Q00A 3GM3A 3K7DA 1V4AA 2JX0A 1K40A 2L6HA 3C8GB 3L8IA 3B71A 3U3FA 1QVXA 3RQFA 2PBEA 3U0CA 1PV3A 1JOGA 2KK1A 2L6FA 5F28E 4NQFA 3JZ0A 1WOLA 2LK4A 1O3UA 4EBKA 1UFBA 2HSBA 1KTMA 1KNYA 3S9OA 3C8GA 4XEKA 3C8GD 1OW6A 2L6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBJ A;  3TUL A;  2JPU A;  1WTY A;  4XEF A;  3L8J A;  3RQG A;  3JYY A;  3BRJ A;  3O10 A;  1K05 A;  3GM1 A;  3GM2 A;  1OW8 A;  1OW7 A;  2YWA A;  3RQE A;  4R32 A;  1K04 A;  1WWP A;  1ZZP A;  3MFN A;  3C18 A;  4XEV A;  3AJM A;  2Q00 A;  3GM3 A;  3K7D A;  1V4A A;  2JX0 A;  1K40 A;  2L6H A;  3C8G B;  3L8I A;  3B71 A;  3U3F A;  1QVX A;  3RQF A;  2PBE A;  3U0C A;  1PV3 A;  1JOG A;  2KK1 A;  2L6F A;  5F28 E;  4NQF A;  3JZ0 A;  1WOL A;  2LK4 A;  1O3U A;  4EBK A;  1UFB A;  2HSB A;  1KTM A;  1KNY A;  3S9O A;  3C8G A;  4XEK A;  3C8G D;  1OW6 A;  2L6G A; 
#chains in the Genus database with same CATH topology
 5JVE A;  2VCC A;  5L0C A;  4ZLD A;  4PR9 A;  4XEF A;  1AEP A;  1YA9 A;  2L9J A;  3RF3 A;  1T5O A;  3IPM O;  4QI0 A;  5HSW A;  4MW8 A;  1RXQ A;  2YWA A;  4MVQ A;  1RKE A;  1ZU5 A;  1WN0 A;  1MMD A;  4CIH A;  3HNL A;  3NYM A;  4CBE A;  4DRJ B;  2KGO A;  3M4B A;  4HEA J;  4DOZ A;  2OU6 A;  1C02 A;  1YDI A;  3LS1 A;  4CX9 A;  3G4Z A;  4MVM A;  3GWL A;  1M2V B;  2B0H A;  5AGF A;  1TWH A;  3CEX A;  3NYJ A;  4JJF A;  2XL8 A;  5D92 A;  1KTM A;  3FAP B;  2EIM C;  3NG1 A;  2BE5 F;  2KW3 C;  2EPK X;  2QTV A;  3DAG A;  3DXJ F;  4XEK A;  3WAQ A;  4CJG A;  1XZQ A;  5KYN A;  2R7U A;  1M6T A;  1J8Y F;  4MTF A;  1C17 M;  4A2N B;  1LI5 A;  4YT5 A;  4PK4 A;  2GA0 A;  3G4X A;  4MW3 A;  3RQG A;  3ZTM A;  3MX3 A;  1E86 A;  1EQ1 A;  1Z6A A;  3CSK A;  2D5R B;  4JTA B;  3AQB A;  3DE9 A;  2ZXP A;  1RJ9 A;  2EIL C;  2PX3 A;  2CW0 F;  4K0D A;  4KBL A;  1E84 A;  3HTK C;  2WL8 A;  4ULV A;  2Q4F A;  4LER A;  2NUT A;  4ANJ A;  5DS6 A;  4LDQ A;  3S29 A;  1HMO A;  1OCC C;  1NSG B;  2J9B A;  5L3V A;  3R7C A;  2Y3H A;  5COF A;  3T6J A;  4PFP A;  4AK9 A;  5IY5 C;  3B0U X;  1TKN A;  3ZIB A;  1MNE A;  2J0X A;  2W45 A;  3LNR A;  5KYU B;  3JT1 A;  1KNY A;  1ZW2 A;  3HLZ A;  4AL1 A;  5KYY A;  3UGP A;  3DJN B;  3POV A;  1TFO B;  4Z9H A;  3N24 A;  2D4U A;  4MQ9 F;  1T01 A;  4FWV A;  1FAP B;  1M2O A;  4OIO F;  1HY5 A;  3AG2 C;  2KC3 A;  5AC5 A;  2W9Y A;  3EHN A;  4JTC B;  4RDA A;  3C8Z A;  3GEH A;  4A4A A;  2A69 F;  5AC4 A;  3K33 A;  5B3S C;  2MWQ A;  3Q7G A;  4PJN A;  5JRA A;  3T6G B;  1QQ3 A;  1YAU O;  2VAS A;  3C62 A;  2XLW A;  2CYD A;  1K40 A;  2A0U A;  1PD1 A;  1Z5Z A;  4JKV A;  4LLC A;  1SF8 A;  2PNO A;  5GPG B;  4QDL A;  2X0C A;  5DQZ A;  5E3A A;  5TJ5 E;  4J7T A;  2M64 A;  4PFO A;  4G78 A;  2G62 A;  5L0G A;  1VYI A;  3JSZ A;  3K1H A;  3KH2 A;  1RKE B;  4JW1 A;  1JPN A;  3S27 A;  4OIP F;  2W4M A;  1NG1 A;  3FHD A;  3X2Q C;  2Q3T A;  3H2U A;  5A6B D;  5EHH A;  2YRF A;  1Q0F A;  4FES A;  2J9V A;  5BUO A;  1T6I A;  3EZI A;  3QVY A;  1VYK A;  2IXN A;  3FOP A;  1H9G A;  2VCB A;  4CJO A;  4R32 A;  5KYX A;  2YL7 A;  1K04 A;  4XQ1 A;  2WZF A;  4ER9 A;  4D4X A;  1MMG A;  4XPW A;  5FZT A;  4EKW A;  5JS5 A;  3OWT A;  1S7Z A;  4EHP A;  1H9T A;  2HSQ A;  3ASN C;  3M15 A;  3EGX A;  2EPM X;  3Q6M A;  1ORJ A;  2CNW A;  1DOV A;  1Q0D A;  1LVK A;  1TR2 A;  2J0W A;  1YJG A;  1JOG A;  4NTA A;  2MHR A;  3SP1 A;  1ZHX A;  4JCZ A;  1NU7 D;  3FDQ A;  2BC5 A;  4C7O A;  3I5P A;  3EFO A;  1LS1 A;  3O6X A;  1C03 A;  2YQY A;  3CZ6 A;  1YVI A;  3CQZ A;  3B29 A;  4GQH A;  2HJ3 A;  4IAR A;  4OD4 A;  2YVK A;  3IQT A;  4O6M A;  4NC3 A;  1I5N A;  4MVO A;  5T1D B;  4CS9 C;  4JEB A;  4BEM J;  4EBJ A;  1D1B A;  3FAJ A;  2H7O A;  3AG3 C;  3KYI A;  4DVY P;  4YWQ A;  4ZLC A;  1NU9 C;  4GYT A;  1ZU4 A;  4I1O B;  1OW8 A;  4E0H A;  2XL6 A;  3RQE A;  3LUT B;  1NFN A;  4E18 A;  3RW0 A;  4RBN A;  2YLD A;  4K7B A;  2R25 A;  3DM5 A;  4Z9I A;  2R7V A;  3ECS A;  2CDQ A;  2L7A A;  2LSE A;  5KYW B;  3NKE A;  2VH3 A;  2XLH A;  3ABL C;  5E2Q A;  2Q9A A;  2ASR A;  4O6Y A;  3QMK A;  2IBF A;  5CI9 A;  2KK1 A;  2EIJ C;  2OG2 A;  4MTO A;  1BDJ B;  1IW7 F;  2RSE B;  3AGU A;  1WOL A;  3LJB A;  4MVR A;  4CS7 A;  1Q0K A;  2J45 A;  3EGD A;  4J7Y A;  4JRZ A;  4DBR A;  2XXA A;  3ZDL A;  4JIO A;  1KU2 A;  1OW6 A;  4O6N A;  4U9D A;  4CS9 A;  3SEO A;  3HNK A;  1WAS A;  3FXH A;  4U5B E;  4F4B A;  4G7Z F;  2R7O A;  2Y3D A;  1Z7Q c;  2A6H F;  1HMD A;  1LPE A;  3PMR A;  3U2L A;  3UMH A;  1M57 C;  1TFK B;  3BRJ A;  3GAN A;  3L0I A;  2HUJ A;  1CGO A;  2EPO A;  1L7C A;  3W2W A;  2LIG A;  1G4U S;  3DJU B;  3I5Q A;  4KC9 A;  2XM0 A;  2YEV A;  1Q0M A;  1VB5 A;  2EPL X;  3QTH A;  3RFY A;  2I8B A;  1ORS C;  1TQG A;  2DGJ A;  4WAB A;  3EJN A;  3W2V A;  3DZA A;  3U3F A;  4MVU A;  3NMK A;  2JD3 A;  4JJG A;  3JRM O;  3K1I C;  2XS8 A;  1LM3 B;  2A68 F;  4J30 B;  3DI5 A;  4FX5 A;  4BJ1 A;  4E17 A;  1O5H A;  3EH2 A;  3C63 A;  3H65 A;  2O9X A;  3W8H A;  2EIN C;  3S90 A;  3FVY A;  5DS4 A;  2XM4 A;  4OIQ F;  3EG9 A;  4CS8 C;  1IZM A;  4CDA A;  3PDM P;  2ETS A;  3SXY A;  2LP4 A;  3JTL O;  4U9E A;  2ZD9 A;  4X0R A;  3TK0 A;  1TWG A;  5L0D A;  3MYI A;  4JEA A;  3F47 A;  3VF0 A;  4P6I C;  4YL3 A;  4BJT A;  1GM5 A;  3LEV A;  1WGW A;  2NPU A;  4C7O B;  3EFO B;  1LI7 A;  5F5F A;  5CI8 A;  2A6E F;  2Q00 A;  4QI2 A;  1V4A A;  1MND A;  5F5H A;  1FNT c;  2QUP A;  4PJJ A;  4G7H F;  4YJW A;  3K1I A;  1HE9 A;  3KL4 A;  4JC7 A;  3AG1 C;  4C3D A;  2HV6 A;  1JR8 A;  4YN0 B;  3SYN A;  3TQO A;  2XS1 A;  3RIP A;  3QVZ A;  2AP3 A;  2XLV A;  4HFK B;  2QNL A;  4Q7C A;  1A7E A;  4CS8 A;  2LD6 A;  1BR1 A;  2ICW G;  1Y6D A;  2L6G A;  3ATP A;  3JRT A;  4I44 A;  5L0H A;  1N1C A;  2JPU A;  2M4E A;  5JLI A;  5JP7 A;  2ZPA A;  4AL0 A;  4AX2 A;  2R03 A;  2CGE A;  2TMV P;  3C7J A;  2Q9B A;  1HE1 A;  3LAY A;  2HMZ A;  4E7S A;  3U3B A;  4EWC A;  3O55 A;  3S28 A;  3ABM C;  3HKK A;  4AE4 A;  4C3B A;  4RD9 A;  2P0N A;  3IHU A;  3MFN A;  1NFO A;  3EGD B;  3TD7 A;  1BR2 A;  1G8X A;  1VLT A;  3K7D A;  5HV9 A;  1OKK D;  1D1C A;  2LCH A;  1QPU A;  2OEV A;  2PF4 E;  1I4Y A;  2J7P D;  1RMV A;  3TOM A;  5COG A;  2F22 A;  4CIP A;  1OXB A;  3S84 A;  1RCP A;  3Q6N A;  1ZHT A;  1ZHZ A;  3OA1 A;  5D91 A;  3JZ0 A;  3FOO A;  3ZVR A;  2XL4 A;  3Q7L A;  4MTG A;  4HFF B;  3S9O A;  3C8G A;  4M63 A;  3DM9 B;  2ZXO A;  3DWW A;  3T4R A;  3UMI A;  1L3P A;  1VK5 A;  1HW1 A;  1Y4C A;  1V54 C;  4LLE A;  1XWJ A;  3QW1 A;  2G3K A;  3V7O A;  3L8J A;  3E9V A;  3GEI A;  3WG7 C;  3RH3 A;  4LDK A;  4OIN F;  1T6Q A;  4IJJ A;  4CDY A;  4DRH B;  4FAP B;  4YT4 A;  3DE8 A;  4O7G A;  1WWP A;  3VAY A;  3EH1 A;  2L81 A;  4XPY A;  3WOD F;  5BQH A;  3TJ5 A;  2PX0 A;  2C04 A;  2JX0 A;  3GOD A;  3L8I A;  4DJ9 A;  2IXP A;  3B71 A;  4I3M A;  1M56 C;  3RQF A;  4YT2 A;  5E3C A;  1OR2 A;  2OJE D;  256B A;  1T9K A;  2IYL D;  4IB4 A;  1O3U A;  2FGY A;  3FMS A;  2UUI A;  2P61 A;  3O39 A;  1UG7 A;  1APC A;  1R5I D;  1OR3 A;  1AVO B;  4MND A;  3AG4 C;  1RJ9 B;  4YK5 A;  1M2V A;  3U9M A;  1JRA A;  2EPN A;  1A41 A;  1GGQ A;  3DKA A;  4E0I A;  5T3W A;  2W4B A;  3OEO A;  2NUT B;  2GWW A;  3W4Y A;  1QZX A;  2GAQ A;  4IGG A;  1U89 A;  3UR3 C;  3GEE A;  4BJ6 C;  5T3T A;  1YYJ A;  2H8A A;  5KYY B;  2L6H A;  2YZS A;  3ZC4 A;  2AU5 A;  2YKZ A;  2R02 A;  3LES A;  4JUR I;  5JUA A;  4JZA A;  1S05 A;  1AUE A;  2UUH A;  3TJ6 A;  3WHN A;  2IXM A;  2YL1 A;  4EBK A;  3ASO C;  5A6J A;  1QLE C;  4KNW A;  1MQV A;  3GWN A;  1LE2 A;  3ZTZ A;  2PP4 A;  4NY3 A;  4BG0 A;  1VOM A;  1WTY A;  2NUP A;  3J06 A;  3JYY A;  1YYX A;  1PD0 A;  2OOC A;  2C03 A;  1D0X A;  1MMN A;  3IEE A;  1LIH A;  2OEX A;  3PCV A;  2R7R A;  1OW7 A;  1H6G A;  4HE8 D;  3NDB B;  2QLA A;  4G0H A;  2NG1 A;  2Y3B A;  3AGT A;  3KPH A;  4JVS A;  5B3I A;  1PCX A;  2XLD A;  5BQI A;  4P9T A;  1ZVZ A;  2RD9 A;  1FMV A;  4BJ6 A;  3AJM A;  2DI3 A;  4G7O F;  3MYF A;  2P1A A;  3T9O A;  1A0B A;  1OCZ C;  2LFD A;  4Q5S F;  1JPJ A;  2XSE A;  3MBG A;  3V5Z A;  3M79 A;  3EHM A;  4U5G A;  4OD5 A;  4B6I A;  4BJ5 C;  1RKC A;  2OQM A;  3JYH A;  3VM6 A;  1T6U A;  4XWJ A;  3U0C A;  3UGO A;  4DVZ A;  2BL2 A;  2DYS C;  4U5H A;  3IQ5 A;  3SNH A;  1ZW3 A;  2XRH A;  3JCU Q;  3HJC A;  3G50 A;  2R7S A;  4WGZ A;  2V3C C;  3R2P A;  2R7T A;  3EZH A;  4H54 A;  1FFT C;  2I15 A;  2XLE A;  4KNV A;  5A6B A;  5KYX B;  3TUL A;  3F46 A;  1JAF A;  2VCA A;  2QY9 A;  3DAF A;  1GS9 A;  3VRC A;  3T6B A;  2Y39 A;  2WZL A;  1A7D A;  2KQ9 A;  2YHS A;  3EGX B;  2AWC A;  3MLG A;  1SYQ A;  2A0B A;  1V55 C;  2AVK A;  2YLG A;  1J8M F;  1MMA A;  4H4K C;  2QE9 A;  4JE9 A;  3RKO F;  3SXM A;  5DVW A;  3ZSU A;  1W2W A;  4W8P A;  1VTM P;  3V5Y A;  4PAC A;  2HKV A;  4DBQ A;  1WAT A;  1YA7 O;  1QKR A;  1OCO C;  2HZ8 A;  2Q7R A;  2HMQ A;  3ZG1 A;  1FTS A;  4BJ5 A;  1A7V A;  1B68 A;  2CNW D;  2FAP B;  3RYL A;  3KYJ A;  2J46 A;  3W8I A;  4WGY A;  1NBB A;  4L6R A;  5B1A C;  4ULW A;  5F28 E;  4EIY A;  1R4T A;  1D0Z A;  3UMK A;  4JCH A;  4P9F A;  1ZHY A;  2YLI A;  3NMI A;  2HSB A;  4MVS A;  4PJL A;  1CGN A;  4YL1 A;  4DXW A;  1SR2 A;  3E70 C;  4O79 A;  1H7I A;  4U5E E;  1ST6 A;  3TOL A;  5L0F A;  4CDV A;  2B0J A;  4N06 A;  4W8K A;  1Z23 A;  1XZP A;  3NKD A;  5L0J A;  3LS0 A;  2Y69 C;  1D1A A;  3GM1 A;  4J32 B;  3K66 A;  5DLJ A;  4JTD B;  4YL0 A;  1OXK A;  3V5X A;  5FCL A;  1LE4 A;  2FFH A;  5JSL A;  2WVN A;  2R05 A;  3ZWI A;  3M4C A;  3BEH A;  2R7X A;  3C18 A;  3B0P A;  2XXA B;  2IOQ A;  3H2V A;  5DS5 A;  3GM3 A;  4N4W A;  1SMY F;  2WVQ A;  2HV7 A;  3HNI A;  1ORY A;  2L6F A;  2NUP B;  2OKU A;  2AWY A;  3A9C A;  3LNM B;  3U2M A;  5KYW A;  4IRU A;  5B1B C;  2XLO A;  4ONS A;  2VB6 A;  1E85 A;  1BR4 A;  3LLI A;  4MVZ A;  1FMW A;  1TWA A;  2XLM A;  1VLS A;  4N6C A;  4EBB A;  5A69 A;  4XLP F;  3DMD A;  3ITF A;  4LAC B;  1DOW A;  1BZ4 A;  4XTK A;  2PFD A;  2NSG A;  2WZG A;  3ZQY A;  3KKB A;  4CSA C;  1G4W R;  4PJM A;  3ABK C;  4NTF A;  1CPQ A;  3U8V A;  2P7V A;  1YLM A;  2WVO A;  3RVY A;  3EPV A;  2NSF A;  2H7V C;  5BQG A;  1ZZP A;  5EGY A;  2OJQ A;  4D4N A;  2R7W A;  1E2X A;  1G5Z A;  3KMI A;  2R7Q A;  1EKY A;  4WJ0 A;  2KYH A;  2J8W A;  1OQC A;  3DD7 A;  3SXK A;  3U9J A;  1FR0 A;  1JMW A;  1QVX A;  3EG9 B;  3IQ6 A;  4IWB A;  3U5S A;  3PHF 2;  4U5D E;  3IQC A;  1YZC A;  3QZC A;  4NQF A;  2LK4 A;  2ZXR A;  5JT4 A;  1UFB A;  1D0Y A;  2J9U A;  2KNH A;  2Y3G A;  1Q0G A;  2H7B A;  4YT8 A;  5EK0 A;  1NZE A;  2EIK C;  1CGM E;  4GEH A;  3AQC A;  4CSA A;  3AOU A;  2LQG A;  1EI7 A;  3O10 A;  2J9W A;  3GM2 A;  4KI2 A;  4I1M A;  5A6A A;  1SZI A;  2G3V A;  1HW2 A;  2HS5 A;  3US6 A;  1VMA A;  3N0T A;  3S0X A;  4Q4Z F;  2IM8 A;  3NYL A;  1I4Z A;  3L34 A;  2GDC A;  4MS2 A;  3I4U A;  4N6H A;  1TWC A;  3N2Z B;  3L1M A;  1ZYR F;  2YL3 A;  3EQL F;  3K6B A;  4NCQ A;  3X1O A;  3SXZ A;  1U6H A;  3CAX A;  3UNG C;  2LFF A;  3U8P A;  1PV3 A;  2OCC C;  4Z9J A;  3NRH A;  1E83 A;  4U5F E;  2Q9C A;  5L0I A;  1EA8 A;  4E7Z A;  2X51 A;  3ZQV A;  3B0V C;  4NTB A;  4DRI B;  1BBH A;  4OIR F;  3SZR A;  1LS4 A;  1F1M A;  1LKX A;  2P6V A;  2Z15 A;  1V74 B;  4XLN F;  5A6K A;  3HNJ A;  3M1C B;  5COM A;  4AE4 B;  4IAO A;  1CPR A;  1GQA A;  5E33 A;  4BEJ A;  1YZA A;  1K05 A;  2KJG A;  5KYU A;  5K0I A;  2VC9 A;  1Z3I X;  4EUK B;  4IAQ A;  4U5C E;  4LDR A;  3QW0 A;  4BPM A;  2HJM A;  2WB7 A;  2HFI A;  2KSF A;  3JSE O;  4XEV A;  1QSP A;  2V26 A;  3VYW A;  2GFH A;  3LLK A;  1OKK A;  2DYR C;  4XPX A;  3C8G B;  1YAR O;  2J7P A;  3GOR A;  1ZHW A;  2IXO A;  2ZXW C;  5CIV A;  2PBE A;  2CCY A;  3NMJ A;  5L3Q A;  1U0B B;  1FFH A;  1OCR C;  3A11 A;  4UDV A;  1NLX A;  1O87 A;  3LEO A;  2A1D D;  5DQT A;  1Z63 A;  3RVZ A;  3B9Q A;  2E87 A;  4K1O A;  2DB4 A;  2MYS A;  3C8G D;  2YL0 A;  2R9R B;  4C3E A; 
#chains in the Genus database with same CATH homology
 4EBJ A;  3TUL A;  2JPU A;  1WTY A;  4XEF A;  3L8J A;  3RQG A;  3JYY A;  3BRJ A;  3O10 A;  1K05 A;  3GM1 A;  3GM2 A;  1OW8 A;  1OW7 A;  2YWA A;  3RQE A;  4R32 A;  1K04 A;  1WWP A;  1ZZP A;  3MFN A;  3C18 A;  4XEV A;  3AJM A;  2Q00 A;  3GM3 A;  3K7D A;  1V4A A;  2JX0 A;  1K40 A;  2L6H A;  3C8G B;  3L8I A;  3B71 A;  3U3F A;  1QVX A;  3RQF A;  2PBE A;  3U0C A;  1PV3 A;  1JOG A;  2KK1 A;  2L6F A;  5F28 E;  4NQF A;  3JZ0 A;  1WOL A;  2LK4 A;  1O3U A;  4EBK A;  1UFB A;  2HSB A;  1KTM A;  1KNY A;  3S9O A;  3C8G A;  4XEK A;  3C8G D;  1OW6 A;  2L6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...