3TUOA

Crystal structure of n-terminal domain of dna-binding protein satb1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PGSGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein SATB1
publication title The structural basis for the oligomerization of the N-terminal domain of SATB1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tuoA00
3TUOA 4Q2JA
chains in the Genus database with same CATH superfamily
1UNSA 4A8XC 3AM9A 3ETRA 2WQYB 1QT9A 3U52E 2WXMA 1E7PB 3VTVA 3APDA 4A3OA 4FLHA 1I4GA 3DBHI 1QF6A 3ZJUA 1L7YA 2G3QB 4C7YA 5JXVA 3PVLA 2EMSA 5DPRA 1E8YA 1C79A 3DVGY 4OZAA 4HJGE 1YN3A 2KTRA 5EE9A 5BYSA 2VRRB 3DWMA 2JT4B 4ZRIA 1FPYA 3DCGA 2M19A 3PV1A 5FKAC 2R2OA 4L2YA 1I4HA 4WAFA 2D2QA 2KDEB 1M4VA 5CHWA 1JWAD 3ZDTA 1WIAA 1PYWD 2J0JA 3ZQ4A 1LM8B 3BVZA 3ZIMA 3PGEA 3EHVA 1YJJA 3AI5A 2I38A 2I1JA 4MELA 3L17A 1N61A 1Z2MA 4C80A 2CS4A 4EKUA 3URYA 2TSSA 2LFIA 1YOVB 2WDQB 4GSWA 3ZLZA 2GLSA 2LHDA 1PGBA 4XWWA 3VRBB 3PSEB 4MDKE 5BO4B 2ZCBA 3V05A 4JWSC 2LRWA 2H88B 2PE9A 3LYYA 3QK0A 5GMVA 3M3JA 4B9KA 1JW9D 3DVNV 3ZJVA 2GI9A 3DWGC 4UDUC 3FKYA 1NI3A 1SE3A 3L16A 4II3B 2PE6B 3AE6B 2LXAA 4HRSA 4FULA 3EGRA 4HDQA 2GB1A 2KVRA 1KJTA 1NYRA 2SAKA 1WX8A 3C8YA 4BAXA 2KLGA 1AARA 1L6UA 4LNFA 1J8CA 2KZRA 2BYTA 2IDYA 3P1MA 1WX9A 2BW2A 3TEWA 3W1SA 3Q2AC 4DWFA 2KTFA 1X1MA 2RPQA 3R66C 2KYWA 3DBHB 2N4FA 2R61A 2W55A 4URKA 2M0AA 1L5PA 1DOIA 2X8XX 4ITKA 4BZAA 4EZKA 2FIDA 1TT5B 4LK0M 3TSSA 3ECIA 2LGSA 1E8WA 1UBIA 4GN1A 3U7DA 2K5PA 4S0RA 3DQVA 2WDRB 2K39A 1M94A 3H7SA 1SE9A 4KV2A 3EFUA 2DAFA 1P9DU 4ZOHC 2FAZA 2JZ3B 2MBEA 3N32A 5GXGB 3BZDB 2V4LA 3FILA 2JSVX 4HDOA 1N6ZA 4MM3B 4DXFA 3BIID 3EECA 4WWOA 2E6XA 2C7NB 1QOFA 3PT2B 3IVFA 4HK2A 1CQVA 3H6NA 3ZGZA 1CK1A 1NBFC 4IWPA 4F7ZA 2PTLA 1VJKA 2C5LC 4RGOS 1YX5B 3BYYB 4LLGM 2KFKA 1GUAB 4AQ7A 1TZ1A 4NZLB 3AH7A 5IKCM 3LJ3A 1UZXB 1WWTA 4E74A 5BYQA 4ZYNA 3SEBA 3M63B 1WMHA 2W3SA 3NJTA 1P1AA 4A90A 1HTQA 5J2RA 3B1LX 1NYQA 3EUB2 1RLFA 1FEHA 4ZRKA 4X57B 3P4QB 3VRAB 1LO5D 3HVDA 2DLBA 4EE2A 2ZEQA 1TS3A 3ZUNA 5KHQA 1IGDA 2NS5A 2ICIA 2K1FA 2BF8B 3VTUA 1F1HA 4ZHPA 3TBLD 1C4AA 1K50A 1XCQL 2ZNVB 1I4QA 1QLBB 3BY4B 1JWUD 1F9JA 1Q0WB 2MJEA 2QEJC 5AZGA 1VRAB 2I2YA 2NBUA 4ARIA 1SJED 1YD8U 4NAMA 3BK2A 2Z8LA 2FBWB 4HPPA 1XD3B 1UF0A 1MJDA 5I4DA 1EUVB 3N1YC 1WM2A 2ZW0A 3BVMA 1NDDA 2K22A 3RN9C 1T0YA 2BS3B 3P63A 2DWQA 2NR2A 2ZVNA 1JCKB 4XE0A 4G50A 4WURA 3A9KA 2LGXA 2GBJA 1R4MI 3PHWB 2LASA 1V1PA 2UU7A 2WDTB 2D07B 3JW0X 4H2AA 2ZNVC 1WJUA 5BMGA 5AUIA 2WXFA 2D3BA 3IBEA 3PLUA 4M02A 3PHXB 2BBCA 2Z0DB 1K51A 1WJNA 3UQBA 5FR6A 4BBNC 1DYQA 2L52A 3B9JA 3OAWA 1N5XA 1J19A 4JGHB 3B2FA 1Q1OA 2WXPA 1D5ZC 1VZ8A 1TY2A 4YTNB 1XF5L 5IP4D 2MLBA 1MHXA 2NBWB 3LDZE 4ICVA 2WWZA 1WGKA 3B0AA 1NI2A 3ZYYX 4IWOA 3UIPB 3PPAA 1WYWB 2JU6X 3H7PB 5E6PA 2G4SA 2AQ1B 4US8A 3KQ4A 2MX2A 3IG3A 3SR6A 2CHZA 2R2QA 5JH5C 2A4ZA 2LEKA 1FXIA 2K8BA 3Q3NC 1XT9B 2KX3A 2FCMA 2LI5A 1Z5SB 5CX3A 3DBSA 3NS1A 1C1YB 2Y5BB 4GMVA 2FIFA 2AX5A 2ZVOA 2DENB 3VUXA 2WXRA 5EE0A 4KGSA 4W9EA 2L7RA 3AE1B 4W9KA 1SSNA 2MCNB 2OOBB 5D3IB 2KAJA 2AYOB 2RDBC 1EF1A 2LGIA 4XDCA 4K81A 4M00A 2FUHB 1K8RB 2IZVB 5AUKA 4LNIA 1QOAA 2GBKA 2KWCA 3WA0A 1WR6E 1VCBA 1GC7A 2KANA 2HDEA 3Q14C 2KDBA 1JWBD 4I6NB 3K9PB 3U30A 3NVVA 2BKFA 3UGBB 4FJYA 2JZPA 3R3MA 4HKZE 3ZVVA 1P98A 4P7IA 4PYUA 1AN8A 4IW0A 4JLCA 3KYDD 1FCLA 3PRMB 3BVGA 1C4CA 1R4MB 3UI3A 4TUUA 4FJZA 2K9XA 4KIKA 1VR9A 3I57A 2MW5A 4BOSC 1H8CA 2KKCA 2ASQA 2W3RA 3E9SA 4OW0A 2DZJA 2NCNA 2DNFA 1ZPSA 2PVOD 4LJPB 3ZDMC 5HKHA 4HXDA 1PUTA 4C00A 2JYEA 1FD6A 3EC8A 4XYCA 3L13A 3A1QB 2ON8A 4OVVA 2JXXA 4BKSD 4NY0A 3OJ3A 2K6QA 4WJOA 1V97A 1E7VA 1WXSA 2BQQA 1XLNA 1ZP0B 3MC0B 3ML9A 2WXNA 4W9IA 2JQRB 1HXYD 2HTME 1TIFA 1WX7A 4MJSA 2FCNA 3HHMA 1R4NI 4YTMB 1WYGA 3KUZA 4AOFA 1IGCA 2GBNA 2MWSB 4KX6B 1E8XA 1YQ4B 2YEPF 4LCDE 1WXVA 1RWSA 2C7HA 2QHOA 4HJKA 3MJWA 1S1QB 2NBVB 5BMIA 2PVGC 4XDDA 1GC6A 1JROA 2MJ3A 2O2VB 4L1BA 4RGTA 4ANWA 2JY6A 3JSVA 3V60A 4ANVA 1E8ZA 1TYGB 2J52A 2N9PC 3FC4A 1KH0A 1YIWA 1FFUA 2LWPA 3DVGX 1AYFA 2NVUI 1YMHE 1B9RA 4KKIA 2LRUA 1L4ZB 4B0EA 5LLIA 4NJCA 3APFA 3NOBA 1ACCA 2L0FA 4GDLB 4AJWA 3Q6BA 3K9OB 5IAAC 2INDC 4NJ6A 2D3GA 3C19A 3AE4B 3AEFB 3Q69A 3SFEB 1UD7A 1UUPA 1HZ6A 4DDID 4B95A 3IHPC 4ACFA 3RUIB 4YSZB 1RFKA 4J3OD 5D6JB 3CSTA 2B3AA 1V1OA 1LXDA 2WXOA 3R2TA 1HZ5A 1C4PA 1KF6B 4IDIA 3VH3B 3DBLI 2C9WB 2EKIA 3PLVA 1EU3A 4NAWB 1T0RC 3V6CB 2RMMA 2LGDA 4MH0E 3A9JA 3TUOA 5C3JB 3P4RB 3AN1A 1ZE3D 5HFYA 3GE8C 4DBGA 3I9V1 1DOXA 1V81A 4HPMB 2LVQA 1OEYJ 1PGAA 2WXIA 2IY1B 5G5HA 3AE5B 3NG0A 5G5GA 2IBIB 4MACA 3GS2A 2Y5PA 1JRUA 2RSUA 3KUCB 2PW9A 2MP2A 3NZ3A 1H4RA 4GGQA 4P16A 1BUIC 2DYMA 3DDCB 2WS3B 2L32A 3SU8X 3ZJTA 4REZA 3NS8A 4OVZA 4KSKC 3P42A 3MHSD 1FXTB 4R3DA 4FHKA 2N1VA 2VZKD 4RM8A 3AMZA 2E3TA 3SHQA 1YJ1A 4C4VB 4MGKE 3RZWC 3AEGB 3PZ8A 2X38A 3KWVA 1TY0A 4ZYSA 2V3PA 2WXLA 4US9A 3CWIA 3Q8AA 2O6VB 2VH2A 3A4SC 3R2IA 1J7CA 2NPTB 1C76A 1CMXB 4GDKA 4JQWC 2AQ2B 4B0MA 2KWDA 2BGFA 2CJNA 1QOBA 4F1SA 1ZW7A 2GMIC 4YSXB 2K6DB 4XC2A 4M0WA 3D32A 4LDTB 3W1YA 3QCAA 3A4RA 1I42A 1YX6B 1SGHA 2INPE 2WXHA 5E6JA 3BYTB 2IGGA 2KHWB 1Q10A 2L0TA 2XK5A 3VQIA 3JVZX 1L0XB 5KHOA 2RPVA 3T8MA 3L0WB 2GOWA 4G0NB 1IPGA 4Q2JA 4LNOA 4WQMA 1K53A 4RH6A 4BKSA 5C23A 1L6VA 2JUOA 3KUDB 3RNEC 1QZEA 3PREA 4P6VF 3TEZA 1WJ6A 2KO3A 2BYEA 1AW7A 2KLCA 4KZCA 2QIEB 2CR5A 2LVPA 3V3XA 1ROEA 2ZPYA 4LNKA 4HCPB 5L95C 2J0KA 4OZCA 2RD0A 4WJPA 2PMVA 1TS5A 3ZTDA 2QILA 3UF8A 2B76B 5G55A 1KLUD 4AJYB 1SB3C 3NRZA 4LNNA 2KN5A 3C0RB 1UWXA 2JF5A 4A3PA 3VUYA 1SJHD 5IN7A 3RNCC 4MGIE 5HG2A 1SXTA 3AE2B 1I7HA 2Z59B 4XWTA 3N1ZC 5DCNA 1FFVA 1PGXA 4NJ7A 4MSQB 1V9JA 4DK5A 1CZPA 3RMKC 1D5MC 2G45B 2KTRB 3N20C 2N7DA 5LNK1 4RF1A 3P4PB 2M17A 4JL9A 1SEBD 4MT5A 4YWGG 4FJVB 3VAWA 1ZXHA 1P3QU 3V62A 4WJQA 3AEDB 1TGZB 4A9AA 1OQYA 2ZZPB 3E56A 3L4PA 2WP9B 1XQQA 2I1KA 3MP9A 3RNAC 5CTRC 2YEPB 3RCZA 4C7ZA 1JMLA 3V6EB 2LUMA 4K3BA 2KMAA 1F0ZA 1TBEA 2ZJDA 2IYDB 3VFKA 2CHXA 2DZMA 4ZDVA 3AEAB 5D94A 4EEWA 1WI0A 4KGTA 4O1NA 1HA5A 3VVWB 2ZCCA 1TKYA 2EELA 3RZFA 3GE3C 4HKQA 4HWIB 1QKZA 2FUG1 2L83A 4RCOA 2ZPNA 2RR9A 1XEEA 4N9F4 4TMAB 3FAHA 2PJHA 4HPLB 1WFYA 3WALA 2W54A 2AEHA 3VR9B 1WXAA 1IBXA 2OHFA 2ONQA 4DHJB 4DHZE 4FN2A 2SEBD 4P1CC 3KW5B 3ZO5B 2NTTA 2N9KA 5DPTA 1WE7A 5TR5A 2N9XA 3BK1A 1STEA 3TJPA 1XXGA 2L3ZA 2CU1A 5E6NA 2AL6A 2KQSA 2IY0B 3DOWA 4HROA 4CO7A 4EOYA 3CF6E 2BS2B 4WH4A 3ZNGC 3IXSA 4LJOB 4AUQC 2BWFA 4W9DA 3WAMA 3P2BA 2AL3A 1WR1A 1L2NA 3ENEA 3TMPB 2RDHA 1V86A 3PS6A 3VXWA 1D4BA 1JRPA 2W9NA 3AU4A 1NEKB 1AWDA 2PIAA 1WGYA 3J9CA 1V80A 2JVCA 4W9FA 1BXTA 1WGGA 1WXQA 3AE7B 2QSDA 1ZUD2 3HM3A 2WXGA 3QX1A 3FILB 2WHIA 5MPOA 4M8NA 3RNFC 3W1SC 3IFWB 1EWYC 4K7UA 1DOYA 4CQNA 2JWZA 2EMTA 2N7JA 4IM0A 4EFOA 1QILA 3AULA 2BVCA 1NENB 4IUMB 2IO2B 1XLQA 3QC8B 1T3QA 2FCQA 2LVOA 5BYRA 1F2RI 2GRIA 1MG4A 1T6BX 2V3SA 2KFKB 4KDIC 1GOZA 1HE8A 5D3DA 3CMMB 5TSSA 3KH0A 3VDZA 2Q5WD 1WMHB 2DZKA 4K7WA 4KZ0A 1E0ZA 3PRZA 1G6JA 2HTHA 2M1MA 4WWMA 3RPFC 2HJ1A 1SBBB 5H8YE 4NPNA 4YT0B 4JPSA 5EE3A 4BVUC 1ISNA 1EWCA 3B2GA 1KM7A 4FXCA 2KQ4X 2MSED 4D2KA 2BWES 2BT6A 2K8CA 3ZXVA 3N3KB 3N9YC 1SIFA 4KKJA 3WAOA 2JRHA 2J53A 1UGJA 1MI0A 4QAYA 2KD0A 2UWQA 3MFGA 1OEYA 2LHEA 2WU5B 2KMMA 3RULA 3UQAA 4JE3B 2LMCA 3UINB 2L00B 2CKHB 3PRPB 2G1EA 1WGRA 2BTEA 2RDGA 3ZXRA 3GP7A 1XLPA 1VDVA 3KWLA 2LJ5A 2BYVE 4MGYE 1EU4A 2DHZA 4AWJA 1T5XD 3ABVB 4XGAB 2KJRA 2KJHB 4N59A 3A9KB 2CHWA 1HQRD 1Q5WB 1ZDXA 2KFJA 1GG3A 3Q3FA 2MJDA 5FR3A 1V1PB 2OJRA 4PT5A 4FHJA 4NQLB 2V9HA 3NY5A 3I5JC 4B6WA 1GNUA 3N30A 4JWUC 4TSSA 1YJIA 3SFDB 2KN4A 3OWEB 1YN5A 2EKEC 2AQ3B 2JRIB 1SF0A 4HCNB 1CJEA 1JALA 2PKOA 1N60A 3H1UA 3ZRCA 2WXQA 3WCQA 3APCA 1DGJA 1Y8RC 2FCSA 3AE8B 5J17A 4MM3A 1IYFA 2ZW1A 1FXAA 3ML8A 4ZHOA 2HE7A 3PZDA 5HHDG 1R7SA 4M8MA 4AP4C 5JZEB 1U4AA 2XBBC 3QJZA 3RI7C 1QOGA 2MBQA 5FK9C 3OJ4B 1PFDA 3KYCD 5AZHA 2VZKB 4A20A 4K1RB 4KGRA 2QC8A 4N58A 3AU5A 1BT0A 1KOTA 2LUEA 3T9LA 1YQ3B 1SE2A 2KACA 2L05A 1OFFA 4IC7B 2AWTA 2BPSA 1F2RC 1FRRA 2JZZA 4PS8A 2KC1A 2DX5B 3WANA 4XZ4A 1XLOA 4BOZB 1UBQA 1GB1A 4WQOB 2V0GA 3IAM1 2DYBA 3Q8BA 1R4NB 3W5VB 4OVUA 1OQRA 3OLMD 3KLSX 4WIPA 1N5WA 2IO3B 3DHHC 1L4DB 1XO3A 3NVWA 2IGHA 2V4IB 3SD5A 1ZDVA 3DPDA 1GPXA 1EF5A 1TJEA 1J0GA 3HIZA 4IKGA 1P7FA 2LZ6A 1I4XA 1IUEA 2WXKA 4USAA 2IO0B 4WAAA 2XEWA 3IT6B 4IOIE 2WDVB 1WZ0A 1NVID 2UYZB 2K0PA 5LXHA 2KOXA 2MBHA 2LXCA 2WX0A 3U7ZA 1V8CA 2IJ0A 4BKGA 3AV8A 4KIKB 1GJZA 2CJOA 2NMQA 2REXA 1UGMA 4JX1C 3L08A 3QA8A 4G11A 5AEKB 2LGYA 2V3NA 1OQQA 2RGFA 3WAPA 3RFZB 1TS2A 4YXDB 1Y56A 1WGDA 3Q8CA 1B1ZA 4JIOU 2Y3AA 4GLSC 1WRIA 4W9GA 3U8ZA 2H89B 2XNAC 1MHHE 4GXBA 4ZRPA 3AEEB 2WYQA 2D10A 5DPWA 2K25A 3QQ8B 3TL5A 2D11A 2PEAA 1KFYB 3JYUA 2MA9B 2QCZA 5CHVC 4MJSB 2INNE 3DBLB 1ESFA 2KK8A 1GB4A 5IO9A 1RYJA 4W9LA 2JPHA 3HRDD 2KC2A 1MPEA 2KNBA 1WM3A 3NZSA 3DHIC 4G3XB 3VUWA 5IOIA 3T3NA 3GB1A 1HTOA 4K7SA 3H7PA 3ZNHB 1FRDA 1VLBA 3ZNZB 1RRBA 1KLVA 3ZW3A 2INCC 4CHKA 2V1YA 4N6EB 3RYTA 1V2YA 3JSVB 3Q3JA 3ZTCA 4ANXA 3HM6X 2K3UA 3MJ5A 3AE9B 1ET9A 1WRDB 1WF9A 1N63A 4II2B 1J7BA 1SIJA 5L83A 1JWMD 3L54A 1WE6A 3VH4B 4RF0A 4OZBA 1KRHA 1V5OA 2O6VD 4GIVA 2FE8A 1L0VB 1TZOA 1UELA 2WU2B 3AECB 1RAXA 1WY8A 3IT4B 1ZXIA 4GOCA 3AB5A 2YLMA 4FA6A 2GBRA 1E7UA 1V6EA 4I6LB 4TQ0A 1E9MA 2OJWA 3LB8C 5D2MB 3ZKJC 4LDTD 2M0XA 3NVYA 4C56C 3GZNI 5JHAA 1UWMA 4TV3A 2NTSA 4RM9A 1EO6A 4OHJA 4ASWC 3OG5A 4MSMB 1ET6A 2DAJA 3ZRFA 3R7QA 3A9JB 4KSLC 4RNAA 2D5GA 4L23A 1K52A 1EM7A 1TKEA 4MEMA 1FNUA 4DHZB 2LD9A 4RMAA 1A70A 2DYOA 3R7RA 4PK1A 4P1BC 1MVKA 3DBRI 3V61A 3A1QA 1E10A 2L8JA 4EZLA 4MGZE 5HI1A 3QIJA 2QDFA 3QHTA 2C7MB 2MP2B 1RFAA 2MBOA 2QJLA 3O65B 3ONSA 1E90A 2MEKA 1E5WA 3RD2A 3CSFA 1FO4A 1V49A 1C78A 2BKRB 4HEA1 3TEXA 4ARCA 1HEZE 1T0SC 2HJ8A 4PS7A 3N1XC 3Q8FA 1YN4A 5EDSA 1WXMA 2D3AA 3NHEB 3VTWA 3I3TB 1VD2A 2J7QB 2QMTA 4HVBA 4WWPA 3PZ7A 2Z0EB 4NNJB 3RNBC 3BINA 4PYZA 5BMHA 4AS1A 2N9EB 4BFRA 4ANUA 2N7EA 3AE3B 5CHFA 4PS3A 3PO0A 5DPSA 2O2VA 2BYFA 2KDFB 2KQ7A 2WLBA 3MTNB 1N62A 4A55A 3O13A 1A5RA 4XX5A 2M4NA 4GDKB 1I4PA 4FBJB 4I6PA 1OTRB 2KXJA 1JQ4A 1SE4A 1VZ6A 1I4RA 1FMAD 4ZRJA 2C60A 2FNJB 5T8IA 3VR8B 5AZFA 1V5TA 4GDLA 4YL8A 4M0WB 2VH1A 4WJNA 2A5UA 1F52A 3BWUD 1TS4A 3GZNB 4IM2A 4A6QA 1I35A 3U4EG 1WZ3A 4WWNA 4ZRQA 4W9JA 4ICUA 1TTNA 3DHGC 2J4XA 2XK5B 3MC9A 1WH3A 4TKNA 5JHBA 1C3TA 1ZGUB 3L10B 1FNWA 2BB5A 2IGDA 3P4SB 1VZ7A 5D7GA 1MFWA 1E6EB 4DDGD 1P7EA 3SDLC 4IWQA 2J0MA 1ZKHA 5IA7A 1LGRA 3DBRB 2MHJA 2IO1B 4NAWA 2L76A 1WJ4A 5G2NA 1F77A 4DXGA 2BB6A 1WSPA 2N0SB 3KVFB 3HVZA 3ZNID 3NZUA 3MHZA 1RM6C 1FNVA 2BS4B 2CU3A 2N1WA 2WNMA 2PPHA 3Q8EA 1BMLC 1L0YB 5E6OA 2G9HD 4DHJD 3UIOB 2KVZA 1OGWA 3HK0A 3Q3MC 5J18A 2JYTA 4RGMA 2JXTA 2N9LA 3X0WA 5H92C 4KDLB 3R8BA 1KTKA 3CIRB 1FIQA 4CYEA 3DVNU 4GB9A 3GOEA 2GBMA 3MC8A 1UH6A 2ACZB 4MH8A 3LXFA 5C1ZA 4RGNA 3W5UB 4IM3A 1D5XC 2K8HA 2DZIA 3AEBB 3IAS1 1KLGD 3ALBA 1FM0D 1XCTL 2YVCA 1IP9A 2JX5A 2G4DB 3NUHB 2Y5CA 4YTPB 4C4VA 1ZOYB 4LTUA 2MQJA 2WX1A 1D3ZA 4RFBA 3TIXA 1LFDA 4J6IA 3M62B 3TCAA 1T0QC 2O6VA 2IPKD 2NPTA 3WIMA 1P0RA 3W9CB 1PQSA 4W9HA 4S17A 3AXCA 2WXJA 5EE1A 3M95A 3U2SC 2KT7A 4DXAB 2LJIA 1ENFA 2PLPA 4TQ1A 3W2DA 2D3CA 2MBBB 2MRPA 3S2AA 4KVGB 3HUIA 2KMCA 4EZJA 1WGHA 4W9CA 3PTFC 4BBNF 2M56B 4NQKE 3I63C 5C2TB 5LXIB 1PDXA 2KWVB 2L1AA 4YSYB 2HD5B 3QARA 2KDIA 2J42A 1TKGA 3RT3B 2DBYA 4GU2A 2KDMA 3B08A 2OEDA 3NVZA 4FADA 2KJ6A 3EA6A 1IBXB 1QQRA 4BKTA 3VHTC 2W82A 3Q3OC 1YQBA 1GAQB 1LQBA 4EUTA 1YNTE 3T3OA 1S3SG 3RNGC 4M01A 3EFCA 3H8HA 1C77A 4HLEA 3QWZB 2JWUA 1C9FA 4DQOC 2KX0A 4IG7B 3QAQA 4E3CA 3X23A 1MG8A 3TEYA 2KWUB 2WGSA 3H9DA 1J7AA 1JWSD 3A33B 4F8CB 1FCCC 2M8SA 1D6EC 2XN9C 4E71A 2MH7A 4K3CA
chains in the Genus database with same CATH topology
1TKYA 2EELA 1UNSA 4A8XC 3AM9A 3ETRA 2WQYB 2K9XA 1FRDA 1QT9A 3U52E 1VLBA 2WXMA 4HKQA 1E7PB 1QKZA 1VR9A 2FUG1 3I57A 2W3RA 3E9SA 2L83A 4N6EB 1I4GA 4RCOA 4OW0A 1QF6A 3ZJUA 1XEEA 4TMAB 1ZPSA 2PVOD 3FAHA 4C7YA 1PUTA 2K3UA 2JYEA 3MJ5A 1FD6A 2W54A 3AE9B 5JXVA 1ET9A 3VR9B 1IBXA 2OHFA 2ONQA 2ON8A 1N63A 1J7BA 1C79A 1SIJA 2SEBD 1JWMD 4OZAA 4HJGE 1YN3A 5EE9A 5BYSA 4RF0A 3DWMA 4OZBA 1KRHA 2NTTA 2N9KA 1V97A 2M19A 2FE8A 5FKAC 1XLNA 1ZP0B 1L0VB 3MC0B 1TZOA 3BK1A 4L2YA 2WXNA 1I4HA 4WAFA 2WU2B 3AECB 1STEA 1M4VA 3IT4B 1JWAD 1ZXIA 1XXGA 1PYWD 3ZQ4A 2JQRB 3AB5A 1HXYD 3BVZA 2HTME 1YJJA 2I38A 4YTMB 1N61A 1WYGA 4HROA 4TQ0A 1E9MA 2BS2B 3LB8C 4WH4A 1IGCA 3IXSA 4KX6B 4C80A 1YQ4B 2TSSA 2YEPF 3URYA 2LFIA 3NVYA 2WDQB 4C56C 1UWMA 1RWSA 2NTSA 4OHJA 2LHDA 2RDHA 5BMIA 1D4BA 1JRPA 2PVGC 1PGBA 1ET6A 4XDDA 4XWWA 3VRBB 1JROA 1AWDA 1NEKB 2PIAA 2D5GA 4L23A 1K52A 2MJ3A 3J9CA 4RNAA 1EM7A 1TKEA 4JWSC 1FNUA 3V05A 2H88B 4L1BA 4RGTA 1BXTA 1WXQA 3LYYA 1TYGB 3AE7B 2J52A 3FC4A 1KH0A 1JW9D 2QSDA 1FFUA 1AYFA 1A70A 2GI9A 3DWGC 3ZJVA 2DYOA 1ZUD2 4UDUC 1NI3A 2WXGA 1SE3A 1MVKA 3FILB 1YMHE 1B9RA 4KKIA 1L4ZB 4B0EA 5MPOA 1E10A 3AE6B 4HRSA 4NJCA 1EWYC 3EGRA 5HI1A 2GB1A 1DOYA 4CQNA 1ACCA 1NYRA 2N7JA 4GDLB 1QILA 2SAKA 3C8YA 1NENB 1L6UA 1XLQA 2BYTA 1T3QA 2IDYA 5BYRA 1F2RI 3AE4B 3AEFB 3P1MA 2QJLA 2GRIA 3Q69A 3SFEB 2BW2A 1UUPA 3TEWA 3W1SA 1T6BX 1HZ6A 2MEKA 1GOZA 1FO4A 5D3DA 4YSZB 5TSSA 1RFKA 4J3OD 2W55A 1C78A 2R61A 4HEA1 3TEXA 2Q5WD 4ARCA 1HEZE 1V1OA 2WXOA 2M0AA 3R2TA 1HZ5A 1L5PA 1DOIA 4ITKA 1E0ZA 1C4PA 1KF6B 4IDIA 4WWMA 4LK0M 3TSSA 3Q8FA 1YN4A 2EKIA 3RPFC 1SBBB 5H8YE 1EU3A 4NAWB 2QMTA 4YT0B 4JPSA 3PZ7A 2K5PA 2RMMA 5EE3A 5BMHA 1EWCA 3B2GA 3TUOA 4AS1A 5C3JB 3AE3B 2WDRB 3P4RB 4FXCA 2KQ4X 3PO0A 3AN1A 1ZE3D 4D2KA 5HFYA 2BT6A 2WLBA 1N62A 3I9V1 3N9YC 4ZOHC 1DOXA 4A55A 3O13A 4GDKB 4KKJA 1I4PA 5GXGB 3BZDB 2J53A 1PGAA 1MI0A 1UGJA 2JSVX 3FILA 1JQ4A 4MM3B 1SE4A 1VZ6A 2WXIA 1I4RA 3MFGA 5G5HA 1FMAD 2LHEA 2WU5B 3AE5B 5G5GA 3BIID 4MACA 4DXFA 3GS2A 2E6XA 2KMMA 5T8IA 3VR8B 2Y5PA 1QOFA 4JE3B 2LMCA 3BWUD 1TS4A 1CQVA 3ZGZA 2PW9A 1CK1A 3NZ3A 4A6QA 2PTLA 1BUIC 1VJKA 4P16A 3U4EG 2G1EA 2DYMA 4RGOS 2WS3B 2L32A 2BTEA 3BYYB 4ZRQA 3ZJTA 4REZA 2RDGA 4LLGM 3GP7A 1XLPA 2J4XA 1VDVA 4AQ7A 4OVZA 3P42A 3KWLA 4NZLB 3AH7A 4R3DA 1EU4A 1FNWA 1WWTA 2BB5A 2IGDA 1VZ7A 1T5XD 3ABVB 3P4SB 5D7GA 1E6EB 5BYQA 3SEBA 4N59A 2VZKD 2W3SA 1P7EA 1HQRD 3AMZA 4A90A 1ZDXA 2E3TA 2MJDA 1NYQA 3EUB2 3AEGB 5FR3A 1V1PB 3PZ8A 2X38A 4PT5A 3KWVA 1FEHA 3P4QB 1TY0A 3VRAB 1LO5D 3HVDA 2DLBA 4ZYSA 2V3PA 2WXLA 4EE2A 4US9A 4JWUC 1TS3A 4TSSA 3CWIA 1YJIA 3Q8AA 3SFDB 1F77A 3R2IA 2KN4A 3OWEB 1IGDA 1YN5A 1J7CA 2BB6A 4DXGA 2ICIA 1WSPA 2N0SB 1C76A 2AQ3B 3HVZA 1SF0A 1CJEA 1JALA 1RM6C 2PKOA 3MHZA 1FNVA 1N60A 4ZHPA 2BS4B 2CU3A 1C4AA 2WXQA 1K50A 3WCQA 2WNMA 1XCQL 1DGJA 1I4QA 1QLBB 1BMLC 3AE8B 1L0YB 2AQ2B 2G9HD 1JWUD 2KWDA 3Q8EA 2MJEA 4B0MA 2QEJC 2ZW1A 1VRAB 1FXAA 2I2YA 2CJNA 1QOBA 2JYTA 2JXTA 4RGMA 4ZHOA 2N9LA 5HHDG 5H92C 1R7SA 4YSXB 3R8BA 4ARIA 1KTKA 4M0WA 1SJED 3CIRB 4NAMA 1FIQA 3BK2A 2Z8LA 2FBWB 2INPE 1QOGA 2WXHA 5E6JA 5I4DA 5FK9C 2ACZB 3BYTB 1PFDA 2IGGA 4MH8A 3LXFA 4RGNA 3W5UB 2ZW0A 1D5XC 1Q10A 3AEBB 3BVMA 2VZKB 3IAS1 2K22A 4KGRA 4N58A 3VQIA 3P63A 2BS3B 1KLGD 2DWQA 1L0XB 4XE0A 1JCKB 1FM0D 1XCTL 2RPVA 4WURA 1YQ3B 2JX5A 1SE2A 2KACA 1OFFA 3NUHB 2Y5CA 4YTPB 1ZOYB 4LTUA 1F2RC 1FRRA 4Q2JA 1V1PA 4WQMA 1XLOA 1K53A 4H2AA 4RFBA 5BMGA 1GB1A 4RH6A 5AUIA 2V0GA 2WXFA 1L6VA 3IAM1 4P6VF 2BBCA 2IPKD 3Q8BA 1K51A 3W5VB 3TEZA 1OQRA 3KLSX 1DYQA 2L52A 4WIPA 1N5WA 3B9JA 1AW7A 1L4DB 1XO3A 2IGHA 1N5XA 2V4IB 3NVWA 1ZDVA 3W9CB 1GPXA 2QIEB 1TJEA 3B2FA 3V3XA 3U2SC 2WXJA 5EE1A 1ROEA 2WXPA 1P7FA 4IKGA 1D5ZC 1I4XA 2LJIA 1IUEA 1ENFA 1TY2A 1VZ8A 1XF5L 2PLPA 2WXKA 4TQ1A 4USAA 4YTNB 3W2DA 4OZCA 3IT6B 4IOIE 1MHXA 2WDVB 2PMVA 1TS5A 1NVID 2K0PA 2QILA 1WGKA 2B76B 3HUIA 3ZYYX 1KLUD 1SB3C 3U7ZA 1V8CA 3NRZA 2IJ0A 2M56B 1UWXA 2JU6X 3AV8A 5C2TB 2AQ1B 4US8A 1SJHD 2CJOA 1PDXA 2NMQA 2L1AA 3KQ4A 4YSYB 4JX1C 3SR6A 2LEKA 1FXIA 2V3NA 1OQQA 1TKGA 2J42A 5HG2A 1SXTA 3AE2B 1I7HA 3RFZB 1TS2A 3NS1A 2DBYA 4XWTA 4YXDB 2KDMA 1Y56A 1FFVA 3Q8CA 2AX5A 2OEDA 3NVZA 1PGXA 1B1ZA 3EA6A 1IBXB 2WXRA 2Y3AA 1QQRA 5EE0A 4GLSC 4KGSA 1WRIA 2W82A 3AE1B 1CZPA 1SSNA 1GAQB 2H89B 1D5MC 1YNTE 2XNAC 1MHHE 5D3IB 3T3OA 2KAJA 5LNK1 4ZRPA 3AEEB 4RF1A 2LGIA 4XDCA 3P4PB 3H8HA 1C77A 1SEBD 2JWUA 1C9FA 4MT5A 4DQOC 4YWGG 1ZXHA 5AUKA 1QOAA 3AEDB 1KFYB 4A9AA 2HDEA 3TEYA 1JWBD 3E56A 3L4PA 2WP9B 3NVVA 3MP9A 2JZPA 2INNE 1ESFA 2YEPB 4C7ZA 1GB4A 1JMLA 1J7AA 1RYJA 2LUMA 4HKZE 1JWSD 1F0ZA 1AN8A 3HRDD 1MPEA 1FCCC 3AEAB 1FCLA 1D6EC 3T3NA 4KGTA 4O1NA 1HA5A 2XN9C 3BVGA 3GB1A 1C4CA 2MH7A 3UI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUO A;  4Q2J A; 
#chains in the Genus database with same CATH topology
 1UNS A;  4A8X C;  3AM9 A;  3ETR A;  2WQY B;  1QT9 A;  3U52 E;  2WXM A;  1E7P B;  3VTV A;  3APD A;  4A3O A;  4FLH A;  1I4G A;  3DBH I;  1QF6 A;  3ZJU A;  1L7Y A;  2G3Q B;  4C7Y A;  5JXV A;  3PVL A;  2EMS A;  5DPR A;  1E8Y A;  1C79 A;  3DVG Y;  4OZA A;  4HJG E;  1YN3 A;  2KTR A;  5EE9 A;  5BYS A;  2VRR B;  3DWM A;  2JT4 B;  4ZRI A;  1FPY A;  3DCG A;  2M19 A;  3PV1 A;  5FKA C;  2R2O A;  4L2Y A;  1I4H A;  4WAF A;  2D2Q A;  2KDE B;  1M4V A;  5CHW A;  1JWA D;  3ZDT A;  1WIA A;  1PYW D;  2J0J A;  3ZQ4 A;  1LM8 B;  3BVZ A;  3ZIM A;  3PGE A;  3EHV A;  1YJJ A;  3AI5 A;  2I38 A;  2I1J A;  4MEL A;  3L17 A;  1N61 A;  1Z2M A;  4C80 A;  2CS4 A;  4EKU A;  3URY A;  2TSS A;  2LFI A;  1YOV B;  2WDQ B;  4GSW A;  3ZLZ A;  2GLS A;  2LHD A;  1PGB A;  4XWW A;  3VRB B;  3PSE B;  4MDK E;  5BO4 B;  2ZCB A;  3V05 A;  4JWS C;  2LRW A;  2H88 B;  2PE9 A;  3LYY A;  3QK0 A;  5GMV A;  3M3J A;  4B9K A;  1JW9 D;  3DVN V;  3ZJV A;  2GI9 A;  3DWG C;  4UDU C;  3FKY A;  1NI3 A;  1SE3 A;  3L16 A;  4II3 B;  2PE6 B;  3AE6 B;  2LXA A;  4HRS A;  4FUL A;  3EGR A;  4HDQ A;  2GB1 A;  2KVR A;  1KJT A;  1NYR A;  2SAK A;  1WX8 A;  3C8Y A;  4BAX A;  2KLG A;  1AAR A;  1L6U A;  4LNF A;  1J8C A;  2KZR A;  2BYT A;  2IDY A;  3P1M A;  1WX9 A;  2BW2 A;  3TEW A;  3W1S A;  3Q2A C;  4DWF A;  2KTF A;  1X1M A;  2RPQ A;  3R66 C;  2KYW A;  3DBH B;  2N4F A;  2R61 A;  2W55 A;  4URK A;  2M0A A;  1L5P A;  1DOI A;  2X8X X;  4ITK A;  4BZA A;  4EZK A;  2FID A;  1TT5 B;  4LK0 M;  3TSS A;  3ECI A;  2LGS A;  1E8W A;  1UBI A;  4GN1 A;  3U7D A;  2K5P A;  4S0R A;  3DQV A;  2WDR B;  2K39 A;  1M94 A;  3H7S A;  1SE9 A;  4KV2 A;  3EFU A;  2DAF A;  1P9D U;  4ZOH C;  2FAZ A;  2JZ3 B;  2MBE A;  3N32 A;  5GXG B;  3BZD B;  2V4L A;  3FIL A;  2JSV X;  4HDO A;  1N6Z A;  4MM3 B;  4DXF A;  3BII D;  3EEC A;  4WWO A;  2E6X A;  2C7N B;  1QOF A;  3PT2 B;  3IVF A;  4HK2 A;  1CQV A;  3H6N A;  3ZGZ A;  1CK1 A;  1NBF C;  4IWP A;  4F7Z A;  2PTL A;  1VJK A;  2C5L C;  4RGO S;  1YX5 B;  3BYY B;  4LLG M;  2KFK A;  1GUA B;  4AQ7 A;  1TZ1 A;  4NZL B;  3AH7 A;  5IKC M;  3LJ3 A;  1UZX B;  1WWT A;  4E74 A;  5BYQ A;  4ZYN A;  3SEB A;  3M63 B;  1WMH A;  2W3S A;  3NJT A;  1P1A A;  4A90 A;  1HTQ A;  5J2R A;  3B1L X;  1NYQ A;  3EUB 2;  1RLF A;  1FEH A;  4ZRK A;  4X57 B;  3P4Q B;  3VRA B;  1LO5 D;  3HVD A;  2DLB A;  4EE2 A;  2ZEQ A;  1TS3 A;  3ZUN A;  5KHQ A;  1IGD A;  2NS5 A;  2ICI A;  2K1F A;  2BF8 B;  3VTU A;  1F1H A;  4ZHP A;  3TBL D;  1C4A A;  1K50 A;  1XCQ L;  2ZNV B;  1I4Q A;  1QLB B;  3BY4 B;  1JWU D;  1F9J A;  1Q0W B;  2MJE A;  2QEJ C;  5AZG A;  1VRA B;  2I2Y A;  2NBU A;  4ARI A;  1SJE D;  1YD8 U;  4NAM A;  3BK2 A;  2Z8L A;  2FBW B;  4HPP A;  1XD3 B;  1UF0 A;  1MJD A;  5I4D A;  1EUV B;  3N1Y C;  1WM2 A;  2ZW0 A;  3BVM A;  1NDD A;  2K22 A;  3RN9 C;  1T0Y A;  2BS3 B;  3P63 A;  2DWQ A;  2NR2 A;  2ZVN A;  1JCK B;  4XE0 A;  4G50 A;  4WUR A;  3A9K A;  2LGX A;  2GBJ A;  1R4M I;  3PHW B;  2LAS A;  1V1P A;  2UU7 A;  2WDT B;  2D07 B;  3JW0 X;  4H2A A;  2ZNV C;  1WJU A;  5BMG A;  5AUI A;  2WXF A;  2D3B A;  3IBE A;  3PLU A;  4M02 A;  3PHX B;  2BBC A;  2Z0D B;  1K51 A;  1WJN A;  3UQB A;  5FR6 A;  4BBN C;  1DYQ A;  2L52 A;  3B9J A;  3OAW A;  1N5X A;  1J19 A;  4JGH B;  3B2F A;  1Q1O A;  2WXP A;  1D5Z C;  1VZ8 A;  1TY2 A;  4YTN B;  1XF5 L;  5IP4 D;  2MLB A;  1MHX A;  2NBW B;  3LDZ E;  4ICV A;  2WWZ A;  1WGK A;  3B0A A;  1NI2 A;  3ZYY X;  4IWO A;  3UIP B;  3PPA A;  1WYW B;  2JU6 X;  3H7P B;  5E6P A;  2G4S A;  2AQ1 B;  4US8 A;  3KQ4 A;  2MX2 A;  3IG3 A;  3SR6 A;  2CHZ A;  2R2Q A;  5JH5 C;  2A4Z A;  2LEK A;  1FXI A;  2K8B A;  3Q3N C;  1XT9 B;  2KX3 A;  2FCM A;  2LI5 A;  1Z5S B;  5CX3 A;  3DBS A;  3NS1 A;  1C1Y B;  2Y5B B;  4GMV A;  2FIF A;  2AX5 A;  2ZVO A;  2DEN B;  3VUX A;  2WXR A;  5EE0 A;  4KGS A;  4W9E A;  2L7R A;  3AE1 B;  4W9K A;  1SSN A;  2MCN B;  2OOB B;  5D3I B;  2KAJ A;  2AYO B;  2RDB C;  1EF1 A;  2LGI A;  4XDC A;  4K81 A;  4M00 A;  2FUH B;  1K8R B;  2IZV B;  5AUK A;  4LNI A;  1QOA A;  2GBK A;  2KWC A;  3WA0 A;  1WR6 E;  1VCB A;  1GC7 A;  2KAN A;  2HDE A;  3Q14 C;  2KDB A;  1JWB D;  4I6N B;  3K9P B;  3U30 A;  3NVV A;  2BKF A;  3UGB B;  4FJY A;  2JZP A;  3R3M A;  4HKZ E;  3ZVV A;  1P98 A;  4P7I A;  4PYU A;  1AN8 A;  4IW0 A;  4JLC A;  3KYD D;  1FCL A;  3PRM B;  3BVG A;  1C4C A;  1R4M B;  3UI3 A;  4TUU A;  4FJZ A;  2K9X A;  4KIK A;  1VR9 A;  3I57 A;  2MW5 A;  4BOS C;  1H8C A;  2KKC A;  2ASQ A;  2W3R A;  3E9S A;  4OW0 A;  2DZJ A;  2NCN A;  2DNF A;  1ZPS A;  2PVO D;  4LJP B;  3ZDM C;  5HKH A;  4HXD A;  1PUT A;  4C00 A;  2JYE A;  1FD6 A;  3EC8 A;  4XYC A;  3L13 A;  3A1Q B;  2ON8 A;  4OVV A;  2JXX A;  4BKS D;  4NY0 A;  3OJ3 A;  2K6Q A;  4WJO A;  1V97 A;  1E7V A;  1WXS A;  2BQQ A;  1XLN A;  1ZP0 B;  3MC0 B;  3ML9 A;  2WXN A;  4W9I A;  2JQR B;  1HXY D;  2HTM E;  1TIF A;  1WX7 A;  4MJS A;  2FCN A;  3HHM A;  1R4N I;  4YTM B;  1WYG A;  3KUZ A;  4AOF A;  1IGC A;  2GBN A;  2MWS B;  4KX6 B;  1E8X A;  1YQ4 B;  2YEP F;  4LCD E;  1WXV A;  1RWS A;  2C7H A;  2QHO A;  4HJK A;  3MJW A;  1S1Q B;  2NBV B;  5BMI A;  2PVG C;  4XDD A;  1GC6 A;  1JRO A;  2MJ3 A;  2O2V B;  4L1B A;  4RGT A;  4ANW A;  2JY6 A;  3JSV A;  3V60 A;  4ANV A;  1E8Z A;  1TYG B;  2J52 A;  2N9P C;  3FC4 A;  1KH0 A;  1YIW A;  1FFU A;  2LWP A;  3DVG X;  1AYF A;  2NVU I;  1YMH E;  1B9R A;  4KKI A;  2LRU A;  1L4Z B;  4B0E A;  5LLI A;  4NJC A;  3APF A;  3NOB A;  1ACC A;  2L0F A;  4GDL B;  4AJW A;  3Q6B A;  3K9O B;  5IAA C;  2IND C;  4NJ6 A;  2D3G A;  3C19 A;  3AE4 B;  3AEF B;  3Q69 A;  3SFE B;  1UD7 A;  1UUP A;  1HZ6 A;  4DDI D;  4B95 A;  3IHP C;  4ACF A;  3RUI B;  4YSZ B;  1RFK A;  4J3O D;  5D6J B;  3CST A;  2B3A A;  1V1O A;  1LXD A;  2WXO A;  3R2T A;  1HZ5 A;  1C4P A;  1KF6 B;  4IDI A;  3VH3 B;  3DBL I;  2C9W B;  2EKI A;  3PLV A;  1EU3 A;  4NAW B;  1T0R C;  3V6C B;  2RMM A;  2LGD A;  4MH0 E;  3A9J A;  3TUO A;  5C3J B;  3P4R B;  3AN1 A;  1ZE3 D;  5HFY A;  3GE8 C;  4DBG A;  3I9V 1;  1DOX A;  1V81 A;  4HPM B;  2LVQ A;  1OEY J;  1PGA A;  2WXI A;  2IY1 B;  5G5H A;  3AE5 B;  3NG0 A;  5G5G A;  2IBI B;  4MAC A;  3GS2 A;  2Y5P A;  1JRU A;  2RSU A;  3KUC B;  2PW9 A;  2MP2 A;  3NZ3 A;  1H4R A;  4GGQ A;  4P16 A;  1BUI C;  2DYM A;  3DDC B;  2WS3 B;  2L32 A;  3SU8 X;  3ZJT A;  4REZ A;  3NS8 A;  4OVZ A;  4KSK C;  3P42 A;  3MHS D;  1FXT B;  4R3D A;  4FHK A;  2N1V A;  2VZK D;  4RM8 A;  3AMZ A;  2E3T A;  3SHQ A;  1YJ1 A;  4C4V B;  4MGK E;  3RZW C;  3AEG B;  3PZ8 A;  2X38 A;  3KWV A;  1TY0 A;  4ZYS A;  2V3P A;  2WXL A;  4US9 A;  3CWI A;  3Q8A A;  2O6V B;  2VH2 A;  3A4S C;  3R2I A;  1J7C A;  2NPT B;  1C76 A;  1CMX B;  4GDK A;  4JQW C;  2AQ2 B;  4B0M A;  2KWD A;  2BGF A;  2CJN A;  1QOB A;  4F1S A;  1ZW7 A;  2GMI C;  4YSX B;  2K6D B;  4XC2 A;  4M0W A;  3D32 A;  4LDT B;  3W1Y A;  3QCA A;  3A4R A;  1I42 A;  1YX6 B;  1SGH A;  2INP E;  2WXH A;  5E6J A;  3BYT B;  2IGG A;  2KHW B;  1Q10 A;  2L0T A;  2XK5 A;  3VQI A;  3JVZ X;  1L0X B;  5KHO A;  2RPV A;  3T8M A;  3L0W B;  2GOW A;  4G0N B;  1IPG A;  4Q2J A;  4LNO A;  4WQM A;  1K53 A;  4RH6 A;  4BKS A;  5C23 A;  1L6V A;  2JUO A;  3KUD B;  3RNE C;  1QZE A;  3PRE A;  4P6V F;  3TEZ A;  1WJ6 A;  2KO3 A;  2BYE A;  1AW7 A;  2KLC A;  4KZC A;  2QIE B;  2CR5 A;  2LVP A;  3V3X A;  1ROE A;  2ZPY A;  4LNK A;  4HCP B;  5L95 C;  2J0K A;  4OZC A;  2RD0 A;  4WJP A;  2PMV A;  1TS5 A;  3ZTD A;  2QIL A;  3UF8 A;  2B76 B;  5G55 A;  1KLU D;  4AJY B;  1SB3 C;  3NRZ A;  4LNN A;  2KN5 A;  3C0R B;  1UWX A;  2JF5 A;  4A3P A;  3VUY A;  1SJH D;  5IN7 A;  3RNC C;  4MGI E;  5HG2 A;  1SXT A;  3AE2 B;  1I7H A;  2Z59 B;  4XWT A;  3N1Z C;  5DCN A;  1FFV A;  1PGX A;  4NJ7 A;  4MSQ B;  1V9J A;  4DK5 A;  1CZP A;  3RMK C;  1D5M C;  2G45 B;  2KTR B;  3N20 C;  2N7D A;  5LNK 1;  4RF1 A;  3P4P B;  2M17 A;  4JL9 A;  1SEB D;  4MT5 A;  4YWG G;  4FJV B;  3VAW A;  1ZXH A;  1P3Q U;  3V62 A;  4WJQ A;  3AED B;  1TGZ B;  4A9A A;  1OQY A;  2ZZP B;  3E56 A;  3L4P A;  2WP9 B;  1XQQ A;  2I1K A;  3MP9 A;  3RNA C;  5CTR C;  2YEP B;  3RCZ A;  4C7Z A;  1JML A;  3V6E B;  2LUM A;  4K3B A;  2KMA A;  1F0Z A;  1TBE A;  2ZJD A;  2IYD B;  3VFK A;  2CHX A;  2DZM A;  4ZDV A;  3AEA B;  5D94 A;  4EEW A;  1WI0 A;  4KGT A;  4O1N A;  1HA5 A;  3VVW B;  2ZCC A;  1TKY A;  2EEL A;  3RZF A;  3GE3 C;  4HKQ A;  4HWI B;  1QKZ A;  2FUG 1;  2L83 A;  4RCO A;  2ZPN A;  2RR9 A;  1XEE A;  4N9F 4;  4TMA B;  3FAH A;  2PJH A;  4HPL B;  1WFY A;  3WAL A;  2W54 A;  2AEH A;  3VR9 B;  1WXA A;  1IBX A;  2OHF A;  2ONQ A;  4DHJ B;  4DHZ E;  4FN2 A;  2SEB D;  4P1C C;  3KW5 B;  3ZO5 B;  2NTT A;  2N9K A;  5DPT A;  1WE7 A;  5TR5 A;  2N9X A;  3BK1 A;  1STE A;  3TJP A;  1XXG A;  2L3Z A;  2CU1 A;  5E6N A;  2AL6 A;  2KQS A;  2IY0 B;  3DOW A;  4HRO A;  4CO7 A;  4EOY A;  3CF6 E;  2BS2 B;  4WH4 A;  3ZNG C;  3IXS A;  4LJO B;  4AUQ C;  2BWF A;  4W9D A;  3WAM A;  3P2B A;  2AL3 A;  1WR1 A;  1L2N A;  3ENE A;  3TMP B;  2RDH A;  1V86 A;  3PS6 A;  3VXW A;  1D4B A;  1JRP A;  2W9N A;  3AU4 A;  1NEK B;  1AWD A;  2PIA A;  1WGY A;  3J9C A;  1V80 A;  2JVC A;  4W9F A;  1BXT A;  1WGG A;  1WXQ A;  3AE7 B;  2QSD A;  1ZUD 2;  3HM3 A;  2WXG A;  3QX1 A;  3FIL B;  2WHI A;  5MPO A;  4M8N A;  3RNF C;  3W1S C;  3IFW B;  1EWY C;  4K7U A;  1DOY A;  4CQN A;  2JWZ A;  2EMT A;  2N7J A;  4IM0 A;  4EFO A;  1QIL A;  3AUL A;  2BVC A;  1NEN B;  4IUM B;  2IO2 B;  1XLQ A;  3QC8 B;  1T3Q A;  2FCQ A;  2LVO A;  5BYR A;  1F2R I;  2GRI A;  1MG4 A;  1T6B X;  2V3S A;  2KFK B;  4KDI C;  1GOZ A;  1HE8 A;  5D3D A;  3CMM B;  5TSS A;  3KH0 A;  3VDZ A;  2Q5W D;  1WMH B;  2DZK A;  4K7W A;  4KZ0 A;  1E0Z A;  3PRZ A;  1G6J A;  2HTH A;  2M1M A;  4WWM A;  3RPF C;  2HJ1 A;  1SBB B;  5H8Y E;  4NPN A;  4YT0 B;  4JPS A;  5EE3 A;  4BVU C;  1ISN A;  1EWC A;  3B2G A;  1KM7 A;  4FXC A;  2KQ4 X;  2MSE D;  4D2K A;  2BWE S;  2BT6 A;  2K8C A;  3ZXV A;  3N3K B;  3N9Y C;  1SIF A;  4KKJ A;  3WAO A;  2JRH A;  2J53 A;  1UGJ A;  1MI0 A;  4QAY A;  2KD0 A;  2UWQ A;  3MFG A;  1OEY A;  2LHE A;  2WU5 B;  2KMM A;  3RUL A;  3UQA A;  4JE3 B;  2LMC A;  3UIN B;  2L00 B;  2CKH B;  3PRP B;  2G1E A;  1WGR A;  2BTE A;  2RDG A;  3ZXR A;  3GP7 A;  1XLP A;  1VDV A;  3KWL A;  2LJ5 A;  2BYV E;  4MGY E;  1EU4 A;  2DHZ A;  4AWJ A;  1T5X D;  3ABV B;  4XGA B;  2KJR A;  2KJH B;  4N59 A;  3A9K B;  2CHW A;  1HQR D;  1Q5W B;  1ZDX A;  2KFJ A;  1GG3 A;  3Q3F A;  2MJD A;  5FR3 A;  1V1P B;  2OJR A;  4PT5 A;  4FHJ A;  4NQL B;  2V9H A;  3NY5 A;  3I5J C;  4B6W A;  1GNU A;  3N30 A;  4JWU C;  4TSS A;  1YJI A;  3SFD B;  2KN4 A;  3OWE B;  1YN5 A;  2EKE C;  2AQ3 B;  2JRI B;  1SF0 A;  4HCN B;  1CJE A;  1JAL A;  2PKO A;  1N60 A;  3H1U A;  3ZRC A;  2WXQ A;  3WCQ A;  3APC A;  1DGJ A;  1Y8R C;  2FCS A;  3AE8 B;  5J17 A;  4MM3 A;  1IYF A;  2ZW1 A;  1FXA A;  3ML8 A;  4ZHO A;  2HE7 A;  3PZD A;  5HHD G;  1R7S A;  4M8M A;  4AP4 C;  5JZE B;  1U4A A;  2XBB C;  3QJZ A;  3RI7 C;  1QOG A;  2MBQ A;  5FK9 C;  3OJ4 B;  1PFD A;  3KYC D;  5AZH A;  2VZK B;  4A20 A;  4K1R B;  4KGR A;  2QC8 A;  4N58 A;  3AU5 A;  1BT0 A;  1KOT A;  2LUE A;  3T9L A;  1YQ3 B;  1SE2 A;  2KAC A;  2L05 A;  1OFF A;  4IC7 B;  2AWT A;  2BPS A;  1F2R C;  1FRR A;  2JZZ A;  4PS8 A;  2KC1 A;  2DX5 B;  3WAN A;  4XZ4 A;  1XLO A;  4BOZ B;  1UBQ A;  1GB1 A;  4WQO B;  2V0G A;  3IAM 1;  2DYB A;  3Q8B A;  1R4N B;  3W5V B;  4OVU A;  1OQR A;  3OLM D;  3KLS X;  4WIP A;  1N5W A;  2IO3 B;  3DHH C;  1L4D B;  1XO3 A;  3NVW A;  2IGH A;  2V4I B;  3SD5 A;  1ZDV A;  3DPD A;  1GPX A;  1EF5 A;  1TJE A;  1J0G A;  3HIZ A;  4IKG A;  1P7F A;  2LZ6 A;  1I4X A;  1IUE A;  2WXK A;  4USA A;  2IO0 B;  4WAA A;  2XEW A;  3IT6 B;  4IOI E;  2WDV B;  1WZ0 A;  1NVI D;  2UYZ B;  2K0P A;  5LXH A;  2KOX A;  2MBH A;  2LXC A;  2WX0 A;  3U7Z A;  1V8C A;  2IJ0 A;  4BKG A;  3AV8 A;  4KIK B;  1GJZ A;  2CJO A;  2NMQ A;  2REX A;  1UGM A;  4JX1 C;  3L08 A;  3QA8 A;  4G11 A;  5AEK B;  2LGY A;  2V3N A;  1OQQ A;  2RGF A;  3WAP A;  3RFZ B;  1TS2 A;  4YXD B;  1Y56 A;  1WGD A;  3Q8C A;  1B1Z A;  4JIO U;  2Y3A A;  4GLS C;  1WRI A;  4W9G A;  3U8Z A;  2H89 B;  2XNA C;  1MHH E;  4GXB A;  4ZRP A;  3AEE B;  2WYQ A;  2D10 A;  5DPW A;  2K25 A;  3QQ8 B;  3TL5 A;  2D11 A;  2PEA A;  1KFY B;  3JYU A;  2MA9 B;  2QCZ A;  5CHV C;  4MJS B;  2INN E;  3DBL B;  1ESF A;  2KK8 A;  1GB4 A;  5IO9 A;  1RYJ A;  4W9L A;  2JPH A;  3HRD D;  2KC2 A;  1MPE A;  2KNB A;  1WM3 A;  3NZS A;  3DHI C;  4G3X B;  3VUW A;  5IOI A;  3T3N A;  3GB1 A;  1HTO A;  4K7S A;  3H7P A;  3ZNH B;  1FRD A;  1VLB A;  3ZNZ B;  1RRB A;  1KLV A;  3ZW3 A;  2INC C;  4CHK A;  2V1Y A;  4N6E B;  3RYT A;  1V2Y A;  3JSV B;  3Q3J A;  3ZTC A;  4ANX A;  3HM6 X;  2K3U A;  3MJ5 A;  3AE9 B;  1ET9 A;  1WRD B;  1WF9 A;  1N63 A;  4II2 B;  1J7B A;  1SIJ A;  5L83 A;  1JWM D;  3L54 A;  1WE6 A;  3VH4 B;  4RF0 A;  4OZB A;  1KRH A;  1V5O A;  2O6V D;  4GIV A;  2FE8 A;  1L0V B;  1TZO A;  1UEL A;  2WU2 B;  3AEC B;  1RAX A;  1WY8 A;  3IT4 B;  1ZXI A;  4GOC A;  3AB5 A;  2YLM A;  4FA6 A;  2GBR A;  1E7U A;  1V6E A;  4I6L B;  4TQ0 A;  1E9M A;  2OJW A;  3LB8 C;  5D2M B;  3ZKJ C;  4LDT D;  2M0X A;  3NVY A;  4C56 C;  3GZN I;  5JHA A;  1UWM A;  4TV3 A;  2NTS A;  4RM9 A;  1EO6 A;  4OHJ A;  4ASW C;  3OG5 A;  4MSM B;  1ET6 A;  2DAJ A;  3ZRF A;  3R7Q A;  3A9J B;  4KSL C;  4RNA A;  2D5G A;  4L23 A;  1K52 A;  1EM7 A;  1TKE A;  4MEM A;  1FNU A;  4DHZ B;  2LD9 A;  4RMA A;  1A70 A;  2DYO A;  3R7R A;  4PK1 A;  4P1B C;  1MVK A;  3DBR I;  3V61 A;  3A1Q A;  1E10 A;  2L8J A;  4EZL A;  4MGZ E;  5HI1 A;  3QIJ A;  2QDF A;  3QHT A;  2C7M B;  2MP2 B;  1RFA A;  2MBO A;  2QJL A;  3O65 B;  3ONS A;  1E90 A;  2MEK A;  1E5W A;  3RD2 A;  3CSF A;  1FO4 A;  1V49 A;  1C78 A;  2BKR B;  4HEA 1;  3TEX A;  4ARC A;  1HEZ E;  1T0S C;  2HJ8 A;  4PS7 A;  3N1X C;  3Q8F A;  1YN4 A;  5EDS A;  1WXM A;  2D3A A;  3NHE B;  3VTW A;  3I3T B;  1VD2 A;  2J7Q B;  2QMT A;  4HVB A;  4WWP A;  3PZ7 A;  2Z0E B;  4NNJ B;  3RNB C;  3BIN A;  4PYZ A;  5BMH A;  4AS1 A;  2N9E B;  4BFR A;  4ANU A;  2N7E A;  3AE3 B;  5CHF A;  4PS3 A;  3PO0 A;  5DPS A;  2O2V A;  2BYF A;  2KDF B;  2KQ7 A;  2WLB A;  3MTN B;  1N62 A;  4A55 A;  3O13 A;  1A5R A;  4XX5 A;  2M4N A;  4GDK B;  1I4P A;  4FBJ B;  4I6P A;  1OTR B;  2KXJ A;  1JQ4 A;  1SE4 A;  1VZ6 A;  1I4R A;  1FMA D;  4ZRJ A;  2C60 A;  2FNJ B;  5T8I A;  3VR8 B;  5AZF A;  1V5T A;  4GDL A;  4YL8 A;  4M0W B;  2VH1 A;  4WJN A;  2A5U A;  1F52 A;  3BWU D;  1TS4 A;  3GZN B;  4IM2 A;  4A6Q A;  1I35 A;  3U4E G;  1WZ3 A;  4WWN A;  4ZRQ A;  4W9J A;  4ICU A;  1TTN A;  3DHG C;  2J4X A;  2XK5 B;  3MC9 A;  1WH3 A;  4TKN A;  5JHB A;  1C3T A;  1ZGU B;  3L10 B;  1FNW A;  2BB5 A;  2IGD A;  3P4S B;  1VZ7 A;  5D7G A;  1MFW A;  1E6E B;  4DDG D;  1P7E A;  3SDL C;  4IWQ A;  2J0M A;  1ZKH A;  5IA7 A;  1LGR A;  3DBR B;  2MHJ A;  2IO1 B;  4NAW A;  2L76 A;  1WJ4 A;  5G2N A;  1F77 A;  4DXG A;  2BB6 A;  1WSP A;  2N0S B;  3KVF B;  3HVZ A;  3ZNI D;  3NZU A;  3MHZ A;  1RM6 C;  1FNV A;  2BS4 B;  2CU3 A;  2N1W A;  2WNM A;  2PPH A;  3Q8E A;  1BML C;  1L0Y B;  5E6O A;  2G9H D;  4DHJ D;  3UIO B;  2KVZ A;  1OGW A;  3HK0 A;  3Q3M C;  5J18 A;  2JYT A;  4RGM A;  2JXT A;  2N9L A;  3X0W A;  5H92 C;  4KDL B;  3R8B A;  1KTK A;  3CIR B;  1FIQ A;  4CYE A;  3DVN U;  4GB9 A;  3GOE A;  2GBM A;  3MC8 A;  1UH6 A;  2ACZ B;  4MH8 A;  3LXF A;  5C1Z A;  4RGN A;  3W5U B;  4IM3 A;  1D5X C;  2K8H A;  2DZI A;  3AEB B;  3IAS 1;  1KLG D;  3ALB A;  1FM0 D;  1XCT L;  2YVC A;  1IP9 A;  2JX5 A;  2G4D B;  3NUH B;  2Y5C A;  4YTP B;  4C4V A;  1ZOY B;  4LTU A;  2MQJ A;  2WX1 A;  1D3Z A;  4RFB A;  3TIX A;  1LFD A;  4J6I A;  3M62 B;  3TCA A;  1T0Q C;  2O6V A;  2IPK D;  2NPT A;  3WIM A;  1P0R A;  3W9C B;  1PQS A;  4W9H A;  4S17 A;  3AXC A;  2WXJ A;  5EE1 A;  3M95 A;  3U2S C;  2KT7 A;  4DXA B;  2LJI A;  1ENF A;  2PLP A;  4TQ1 A;  3W2D A;  2D3C A;  2MBB B;  2MRP A;  3S2A A;  4KVG B;  3HUI A;  2KMC A;  4EZJ A;  1WGH A;  4W9C A;  3PTF C;  4BBN F;  2M56 B;  4NQK E;  3I63 C;  5C2T B;  5LXI B;  1PDX A;  2KWV B;  2L1A A;  4YSY B;  2HD5 B;  3QAR A;  2KDI A;  2J42 A;  1TKG A;  3RT3 B;  2DBY A;  4GU2 A;  2KDM A;  3B08 A;  2OED A;  3NVZ A;  4FAD A;  2KJ6 A;  3EA6 A;  1IBX B;  1QQR A;  4BKT A;  3VHT C;  2W82 A;  3Q3O C;  1YQB A;  1GAQ B;  1LQB A;  4EUT A;  1YNT E;  3T3O A;  1S3S G;  3RNG C;  4M01 A;  3EFC A;  3H8H A;  1C77 A;  4HLE A;  3QWZ B;  2JWU A;  1C9F A;  4DQO C;  2KX0 A;  4IG7 B;  3QAQ A;  4E3C A;  3X23 A;  1MG8 A;  3TEY A;  2KWU B;  2WGS A;  3H9D A;  1J7A A;  1JWS D;  3A33 B;  4F8C B;  1FCC C;  2M8S A;  1D6E C;  2XN9 C;  4E71 A;  2MH7 A;  4K3C A; 
#chains in the Genus database with same CATH homology
 1TKY A;  2EEL A;  1UNS A;  4A8X C;  3AM9 A;  3ETR A;  2WQY B;  2K9X A;  1FRD A;  1QT9 A;  3U52 E;  1VLB A;  2WXM A;  4HKQ A;  1E7P B;  1QKZ A;  1VR9 A;  2FUG 1;  3I57 A;  2W3R A;  3E9S A;  2L83 A;  4N6E B;  1I4G A;  4RCO A;  4OW0 A;  1QF6 A;  3ZJU A;  1XEE A;  4TMA B;  1ZPS A;  2PVO D;  3FAH A;  4C7Y A;  1PUT A;  2K3U A;  2JYE A;  3MJ5 A;  1FD6 A;  2W54 A;  3AE9 B;  5JXV A;  1ET9 A;  3VR9 B;  1IBX A;  2OHF A;  2ONQ A;  2ON8 A;  1N63 A;  1J7B A;  1C79 A;  1SIJ A;  2SEB D;  1JWM D;  4OZA A;  4HJG E;  1YN3 A;  5EE9 A;  5BYS A;  4RF0 A;  3DWM A;  4OZB A;  1KRH A;  2NTT A;  2N9K A;  1V97 A;  2M19 A;  2FE8 A;  5FKA C;  1XLN A;  1ZP0 B;  1L0V B;  3MC0 B;  1TZO A;  3BK1 A;  4L2Y A;  2WXN A;  1I4H A;  4WAF A;  2WU2 B;  3AEC B;  1STE A;  1M4V A;  3IT4 B;  1JWA D;  1ZXI A;  1XXG A;  1PYW D;  3ZQ4 A;  2JQR B;  3AB5 A;  1HXY D;  3BVZ A;  2HTM E;  1YJJ A;  2I38 A;  4YTM B;  1N61 A;  1WYG A;  4HRO A;  4TQ0 A;  1E9M A;  2BS2 B;  3LB8 C;  4WH4 A;  1IGC A;  3IXS A;  4KX6 B;  4C80 A;  1YQ4 B;  2TSS A;  2YEP F;  3URY A;  2LFI A;  3NVY A;  2WDQ B;  4C56 C;  1UWM A;  1RWS A;  2NTS A;  4OHJ A;  2LHD A;  2RDH A;  5BMI A;  1D4B A;  1JRP A;  2PVG C;  1PGB A;  1ET6 A;  4XDD A;  4XWW A;  3VRB B;  1JRO A;  1AWD A;  1NEK B;  2PIA A;  2D5G A;  4L23 A;  1K52 A;  2MJ3 A;  3J9C A;  4RNA A;  1EM7 A;  1TKE A;  4JWS C;  1FNU A;  3V05 A;  2H88 B;  4L1B A;  4RGT A;  1BXT A;  1WXQ A;  3LYY A;  1TYG B;  3AE7 B;  2J52 A;  3FC4 A;  1KH0 A;  1JW9 D;  2QSD A;  1FFU A;  1AYF A;  1A70 A;  2GI9 A;  3DWG C;  3ZJV A;  2DYO A;  1ZUD 2;  4UDU C;  1NI3 A;  2WXG A;  1SE3 A;  1MVK A;  3FIL B;  1YMH E;  1B9R A;  4KKI A;  1L4Z B;  4B0E A;  5MPO A;  1E10 A;  3AE6 B;  4HRS A;  4NJC A;  1EWY C;  3EGR A;  5HI1 A;  2GB1 A;  1DOY A;  4CQN A;  1ACC A;  1NYR A;  2N7J A;  4GDL B;  1QIL A;  2SAK A;  3C8Y A;  1NEN B;  1L6U A;  1XLQ A;  2BYT A;  1T3Q A;  2IDY A;  5BYR A;  1F2R I;  3AE4 B;  3AEF B;  3P1M A;  2QJL A;  2GRI A;  3Q69 A;  3SFE B;  2BW2 A;  1UUP A;  3TEW A;  3W1S A;  1T6B X;  1HZ6 A;  2MEK A;  1GOZ A;  1FO4 A;  5D3D A;  4YSZ B;  5TSS A;  1RFK A;  4J3O D;  2W55 A;  1C78 A;  2R61 A;  4HEA 1;  3TEX A;  2Q5W D;  4ARC A;  1HEZ E;  1V1O A;  2WXO A;  2M0A A;  3R2T A;  1HZ5 A;  1L5P A;  1DOI A;  4ITK A;  1E0Z A;  1C4P A;  1KF6 B;  4IDI A;  4WWM A;  4LK0 M;  3TSS A;  3Q8F A;  1YN4 A;  2EKI A;  3RPF C;  1SBB B;  5H8Y E;  1EU3 A;  4NAW B;  2QMT A;  4YT0 B;  4JPS A;  3PZ7 A;  2K5P A;  2RMM A;  5EE3 A;  5BMH A;  1EWC A;  3B2G A;  3TUO A;  4AS1 A;  5C3J B;  3AE3 B;  2WDR B;  3P4R B;  4FXC A;  2KQ4 X;  3PO0 A;  3AN1 A;  1ZE3 D;  4D2K A;  5HFY A;  2BT6 A;  2WLB A;  1N62 A;  3I9V 1;  3N9Y C;  4ZOH C;  1DOX A;  4A55 A;  3O13 A;  4GDK B;  4KKJ A;  1I4P A;  5GXG B;  3BZD B;  2J53 A;  1PGA A;  1MI0 A;  1UGJ A;  2JSV X;  3FIL A;  1JQ4 A;  4MM3 B;  1SE4 A;  1VZ6 A;  2WXI A;  1I4R A;  3MFG A;  5G5H A;  1FMA D;  2LHE A;  2WU5 B;  3AE5 B;  5G5G A;  3BII D;  4MAC A;  4DXF A;  3GS2 A;  2E6X A;  2KMM A;  5T8I A;  3VR8 B;  2Y5P A;  1QOF A;  4JE3 B;  2LMC A;  3BWU D;  1TS4 A;  1CQV A;  3ZGZ A;  2PW9 A;  1CK1 A;  3NZ3 A;  4A6Q A;  2PTL A;  1BUI C;  1VJK A;  4P16 A;  3U4E G;  2G1E A;  2DYM A;  4RGO S;  2WS3 B;  2L32 A;  2BTE A;  3BYY B;  4ZRQ A;  3ZJT A;  4REZ A;  2RDG A;  4LLG M;  3GP7 A;  1XLP A;  2J4X A;  1VDV A;  4AQ7 A;  4OVZ A;  3P42 A;  3KWL A;  4NZL B;  3AH7 A;  4R3D A;  1EU4 A;  1FNW A;  1WWT A;  2BB5 A;  2IGD A;  1VZ7 A;  1T5X D;  3ABV B;  3P4S B;  5D7G A;  1E6E B;  5BYQ A;  3SEB A;  4N59 A;  2VZK D;  2W3S A;  1P7E A;  1HQR D;  3AMZ A;  4A90 A;  1ZDX A;  2E3T A;  2MJD A;  1NYQ A;  3EUB 2;  3AEG B;  5FR3 A;  1V1P B;  3PZ8 A;  2X38 A;  4PT5 A;  3KWV A;  1FEH A;  3P4Q B;  1TY0 A;  3VRA B;  1LO5 D;  3HVD A;  2DLB A;  4ZYS A;  2V3P A;  2WXL A;  4EE2 A;  4US9 A;  4JWU C;  1TS3 A;  4TSS A;  3CWI A;  1YJI A;  3Q8A A;  3SFD B;  1F77 A;  3R2I A;  2KN4 A;  3OWE B;  1IGD A;  1YN5 A;  1J7C A;  2BB6 A;  4DXG A;  2ICI A;  1WSP A;  2N0S B;  1C76 A;  2AQ3 B;  3HVZ A;  1SF0 A;  1CJE A;  1JAL A;  1RM6 C;  2PKO A;  3MHZ A;  1FNV A;  1N60 A;  4ZHP A;  2BS4 B;  2CU3 A;  1C4A A;  2WXQ A;  1K50 A;  3WCQ A;  2WNM A;  1XCQ L;  1DGJ A;  1I4Q A;  1QLB B;  1BML C;  3AE8 B;  1L0Y B;  2AQ2 B;  2G9H D;  1JWU D;  2KWD A;  3Q8E A;  2MJE A;  4B0M A;  2QEJ C;  2ZW1 A;  1VRA B;  1FXA A;  2I2Y A;  2CJN A;  1QOB A;  2JYT A;  2JXT A;  4RGM A;  4ZHO A;  2N9L A;  5HHD G;  5H92 C;  1R7S A;  4YSX B;  3R8B A;  4ARI A;  1KTK A;  4M0W A;  1SJE D;  3CIR B;  4NAM A;  1FIQ A;  3BK2 A;  2Z8L A;  2FBW B;  2INP E;  1QOG A;  2WXH A;  5E6J A;  5I4D A;  5FK9 C;  2ACZ B;  3BYT B;  1PFD A;  2IGG A;  4MH8 A;  3LXF A;  4RGN A;  3W5U B;  2ZW0 A;  1D5X C;  1Q10 A;  3AEB B;  3BVM A;  2VZK B;  3IAS 1;  2K22 A;  4KGR A;  4N58 A;  3VQI A;  3P63 A;  2BS3 B;  1KLG D;  2DWQ A;  1L0X B;  4XE0 A;  1JCK B;  1FM0 D;  1XCT L;  2RPV A;  4WUR A;  1YQ3 B;  2JX5 A;  1SE2 A;  2KAC A;  1OFF A;  3NUH B;  2Y5C A;  4YTP B;  1ZOY B;  4LTU A;  1F2R C;  1FRR A;  4Q2J A;  1V1P A;  4WQM A;  1XLO A;  1K53 A;  4H2A A;  4RFB A;  5BMG A;  1GB1 A;  4RH6 A;  5AUI A;  2V0G A;  2WXF A;  1L6V A;  3IAM 1;  4P6V F;  2BBC A;  2IPK D;  3Q8B A;  1K51 A;  3W5V B;  3TEZ A;  1OQR A;  3KLS X;  1DYQ A;  2L52 A;  4WIP A;  1N5W A;  3B9J A;  1AW7 A;  1L4D B;  1XO3 A;  2IGH A;  1N5X A;  2V4I B;  3NVW A;  1ZDV A;  3W9C B;  1GPX A;  2QIE B;  1TJE A;  3B2F A;  3V3X A;  3U2S C;  2WXJ A;  5EE1 A;  1ROE A;  2WXP A;  1P7F A;  4IKG A;  1D5Z C;  1I4X A;  2LJI A;  1IUE A;  1ENF A;  1TY2 A;  1VZ8 A;  1XF5 L;  2PLP A;  2WXK A;  4TQ1 A;  4USA A;  4YTN B;  3W2D A;  4OZC A;  3IT6 B;  4IOI E;  1MHX A;  2WDV B;  2PMV A;  1TS5 A;  1NVI D;  2K0P A;  2QIL A;  1WGK A;  2B76 B;  3HUI A;  3ZYY X;  1KLU D;  1SB3 C;  3U7Z A;  1V8C A;  3NRZ A;  2IJ0 A;  2M56 B;  1UWX A;  2JU6 X;  3AV8 A;  5C2T B;  2AQ1 B;  4US8 A;  1SJH D;  2CJO A;  1PDX A;  2NMQ A;  2L1A A;  3KQ4 A;  4YSY B;  4JX1 C;  3SR6 A;  2LEK A;  1FXI A;  2V3N A;  1OQQ A;  1TKG A;  2J42 A;  5HG2 A;  1SXT A;  3AE2 B;  1I7H A;  3RFZ B;  1TS2 A;  3NS1 A;  2DBY A;  4XWT A;  4YXD B;  2KDM A;  1Y56 A;  1FFV A;  3Q8C A;  2AX5 A;  2OED A;  3NVZ A;  1PGX A;  1B1Z A;  3EA6 A;  1IBX B;  2WXR A;  2Y3A A;  1QQR A;  5EE0 A;  4GLS C;  4KGS A;  1WRI A;  2W82 A;  3AE1 B;  1CZP A;  1SSN A;  1GAQ B;  2H89 B;  1D5M C;  1YNT E;  2XNA C;  1MHH E;  5D3I B;  3T3O A;  2KAJ A;  5LNK 1;  4ZRP A;  3AEE B;  4RF1 A;  2LGI A;  4XDC A;  3P4P B;  3H8H A;  1C77 A;  1SEB D;  2JWU A;  1C9F A;  4MT5 A;  4DQO C;  4YWG G;  1ZXH A;  5AUK A;  1QOA A;  3AED B;  1KFY B;  4A9A A;  2HDE A;  3TEY A;  1JWB D;  3E56 A;  3L4P A;  2WP9 B;  3NVV A;  3MP9 A;  2JZP A;  2INN E;  1ESF A;  2YEP B;  4C7Z A;  1GB4 A;  1JML A;  1J7A A;  1RYJ A;  2LUM A;  4HKZ E;  1JWS D;  1F0Z A;  1AN8 A;  3HRD D;  1MPE A;  1FCC C;  3AEA B;  1FCL A;  1D6E C;  3T3N A;  4KGT A;  4O1N A;  1HA5 A;  2XN9 C;  3BVG A;  3GB1 A;  1C4C A;  2MH7 A;  3UI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...