3TUOA

Crystal structure of n-terminal domain of dna-binding protein satb1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PGSGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the oligomerization of the N-terminal domain of SATB1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA-binding protein SATB1
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tuoA00
3TUOA 4Q2JA
chains in the Genus database with same CATH superfamily
3TBLD 1UBIA 4JPSA 3APFA 3P63A 4YSZB 2KJHB 4US9A 2N7JA 2KMCA 5EE9A 2KT7A 4G50A 1LM8B 3W1SC 1SXTA 1LO5D 4KIKB 2FBWB 3ZJTA 4HJKA 4B6WA 3PRMB 2N9XA 4IW0A 3MC0B 1P0RA 5KHOA 3CIRB 1TKGA 1YX6B 1SE4A 3E56A 3M3JA 2MJ3A 4ZHOA 3I9V1 2VRRB 4DHJB 3K9PB 2NVUI 1V1PA 2GBJA 3LXFA 1XEEA 4FULA 1YJ1A 4EZLA 3GZNI 3AEFB 3CMMB 2WNMA 3HM6X 4A3OA 3U7DA 1NVID 4ITKA 1ACCA 1WXQA 1UF0A 3LJ3A 2DZIA 3JSVA 4LJOB 1V86A 2HE7A 4J6IA 2RPVA 2D5GA 2C7HA 2WDRB 3T3OA 4HLEA 1AW7A 5IAAC 4HXDA 4RNAA 2BYVE 3Q8FA 1P7FA 2Q5WD 1FO4A 2TSSA 5IP4D 3QA8A 4HK2A 3ZDTA 1WMHA 3VH4B 3J9CA 2WXRA 3EC8A 3I63C 3M95A 4A9AA 1XCTL 4DXFA 3EFCA 2NS5A 1E8WA 2LJIA 1YX5B 4HPPA 3L08A 1AYFA 1RFAA 3L13A 1TS5A 2KAJA 1JWSD 1FD6A 1FRRA 3KUZA 4AP4C 2A4ZA 4FXCA 3P4QB 2A5UA 2LUMA 1TZOA 4JQWC 1PGAA 2DNFA 2D3CA 2LVQA 2LRUA 2WYQA 2M56B 1J19A 4MSQB 4FHKA 1BMLC 2CHZA 2KWUB 1YD8U 2J53A 2SEBD 1YNTE 4KSKC 2I1JA 2QC8A 1E7PB 4LNIA 4WJPA 1UBQA 2KHWB 3OLMD 1ZE3D 2IO2B 4AJYB 1MI0A 2GBKA 3R7RA 2INPE 2KXJA 5D2MB 2WLBA 1NDDA 3A1QA 3DVGY 3EHVA 5FKAC 2BB5A 2KC1A 1H4RA 3HRDD 2V0GA 3DWMA 1V2YA 1ET6A 4AWJA 4GMVA 1XXGA 2EELA 2D3GA 3Q2AC 2OOBB 3RCZA 4PS8A 1FXAA 1L5PA 2FAZA 2JRIB 3SFEB 4FHJA 4ANXA 1C3TA 4L1BA 2L76A 1XQQA 1N62A 1XCQL 3B08A 2KC2A 2WXNA 3TUOA 2JVCA 2K8HA 4YWGG 1Q1OA 3BVZA 2QDFA 1WJ4A 1B9RA 1IUEA 1ISNA 2NMQA 5E6JA 2DYOA 3ALBA 1OTRB 2JUOA 1OQYA 1VCBA 1WE7A 3BINA 3I5JC 3TEWA 2PVGC 4WURA 2ZPYA 3BZDB 1D5XC 4PS3A 1KH0A 3S2AA 1JMLA 4A20A 3H9DA 1G6JA 1MHHE 2DBYA 2BKFA 2O2VB 1WJNA 1IGCA 4MGYE 3P4SB 1ZXHA 3OAWA 3ECIA 3A4RA 4PT5A 3ZIMA 5T8IA 2WHIA 5IKCM 1F1HA 4MELA 1L6VA 3APDA 5CHWA 3ZQ4A 4K7WA 2D11A 2IY1B 2G3QB 1ZDXA 2G45B 3TCAA 1MG8A 1FFUA 4RGOS 1FIQA 4DDGD 2KFKB 3FAHA 4W9HA 1FCLA 3VAWA 3H7SA 5HFYA 2WXIA 1V6EA 4LDTD 4EUTA 4GXBA 2EKIA 3WAPA 2AQ1B 2IGGA 2KK8A 3RZWC 2M1MA 4G11A 2KTRA 2C60A 1GC6A 3HM3A 1HE8A 1A70A 4FJZA 2KO3A 2O6VA 3AECB 1VDVA 2NBUA 1NBFC 3DBSA 3U7ZA 4XC2A 2BS2B 4C56C 1N60A 4BKSD 3BYTB 3VUYA 2G4SA 3QCAA 2JSVX 1YOVB 2X38A 2AEHA 2KWDA 2JPHA 3H6NA 3ZUNA 4RMAA 3QAQA 3ZTCA 1FNVA 3AE1B 3IAM1 4K81A 3AEBB 1T6BX 4JGHB 4ZHPA 5IO9A 1KFYB 1LFDA 4JE3B 1WX7A 2L52A 4A3PA 1ZOYB 4ARCA 1XLQA 3VR8B 3KWVA 2O6VD 4JWSC 2PE9A 2FCMA 2PTLA 3JSVB 2KTRB 4B95A 3QIJA 2IGHA 4D2KA 5JHAA 3H8HA 3TEXA 2LFIA 1GAQB 1IPGA 2ON8A 2RPQA 2W55A 2ZJDA 1WSPA 1XF5L 1E90A 4KGRA 1CMXB 3T3NA 1EF5A 2K5PA 2JYTA 2KMMA 2WWZA 1XLNA 4RM8A 3V3XA 4TSSA 3N32A 3ZRFA 4PK1A 1TZ1A 3PGEA 3R66C 2JWZA 2REXA 3KYDD 2AQ3B 3HUIA 1A5RA 2Z59B 2ZW0A 1WH3A 2WX0A 1ZKHA 1D6EC 4XWTA 2IZVB 3ONSA 4HWIB 3IAS1 4MGZE 3O65B 3MTNB 3AE9B 3DWGC 1I4XA 2WXPA 1E5WA 1EM7A 1KLUD 1DOXA 3RNBC 1E7UA 4IOIE 2WP9B 4KKJA 1Z5SB 4TUUA 3V6CB 1JROA 2UYZB 1GJZA 1X1MA 1KRHA 4FBJB 1CZPA 3DBHB 1E8ZA 4AS1A 2C7NB 2NPTB 1C76A 1HZ5A 1UWXA 1I42A 1TBEA 1L0VB 1J7BA 4NNJB 3QARA 3HIZA 2NBWB 1GC7A 4DDID 2N1WA 2KQSA 5BMHA 3X23A 2FIDA 1WWTA 2DHZA 2UU7A 1WZ3A 4UDUC 3RD2A 4HCPB 3NG0A 4MEMA 1SJHD 1N6ZA 3GOEA 2W9NA 3NVZA 1I4QA 1TKYA 3R8BA 3DVGX 3NZUA 3AV8A 2XK5B 1Y56A 2JQRB 2G1EA 2PEAA 2LI5A 3B2FA 2KANA 2BYEA 3GS2A 1K52A 1YQ3B 3ABVB 1I7HA 3ML9A 2MX2A 4OZAA 1I4HA 2PW9A 2IBIB 4YTPB 4J3OD 3P2BA 2J42A 2LXAA 4IDIA 2OHFA 1DOIA 2KDEB 5AEKB 5MPOA 4W9CA 2J0MA 4MM3A 1DOYA 3AH7A 4RF1A 4OVVA 2K39A 3DBRI 4HEA1 1AN8A 2D07B 4REZA 1KF6B 1C4AA 4OZBA 2MCNB 3IHPC 4XE0A 4YTNB 4Q2JA 1M4VA 2AQ2B 3WAMA 1UELA 1GNUA 1WYGA 2MA9B 2YLMA 2R2QA 1VJKA 3RN9C 1YJIA 3U8ZA 3KW5B 1BXTA 1VD2A 2BF8B 2KACA 2N1VA 4LCDE 4JIOU 4R3DA 2CHWA 4MT5A 3QK0A 4M0WB 2LXCA 3AE6B 3IT6B 1HA5A 3V62A 4X57B 1AARA 5C2TB 4WAAA 1SE9A 1C79A 1WE6A 4ZDVA 1NENB 5J18A 2N7DA 3AI5A 1PYWD 3L54A 3KVFB 3WAOA 3MC8A 2K9XA 2PIAA 3RNAC 4ANWA 3BVMA 2ICIA 2CKHB 1JQ4A 1F9JA 3RNFC 5HHDG 3VTVA 3ZLZA 2QCZA 3A9KA 2IPKD 4BKTA 3PO0A 4HCNB 2FUG1 2MW5A 4IM3A 5E6OA 1MJDA 1T3QA 4P16A 1RYJA 1F77A 1WJ6A 4M8MA 3TSSA 1P1AA 1V8CA 1J0GA 1FMAD 3UF8A 2DZKA 1R4NI 2KKCA 3NS1A 2PVOD 4US8A 3AEDB 2JZZA 1L4ZB 2V3NA 4G3XB 3PV1A 4MGIE 5AUIA 1D3ZA 2BT6A 2GLSA 4M8NA 4WWMA 1PUTA 3QWZB 4LDTB 3AE7B 4NQLB 4C7YA 4YL8A 4MDKE 3EA6A 1OGWA 4RGMA 1IYFA 2WXMA 4HKQA 4AJWA 2KX3A 1WR1A 4JWUC 2M19A 4ICUA 1XO3A 5D3IB 4CO7A 4EOYA 1SJED 2I2YA 4B0MA 4WWOA 3PZ8A 3RI7C 3P42A 5FR6A 2WDTB 1F2RI 2L3ZA 3GE8C 1L6UA 4W9DA 4TQ0A 1KJTA 2MBEA 5D94A 3DBLI 4XYCA 5IN7A 1IGDA 1QOBA 1JWMD 3AE2B 4WJNA 2DX5B 2D2QA 4HDQA 3ZYYX 1KTKA 2JY6A 4GU2A 2DYBA 3N9YC 3NOBA 3SFDB 4LK0M 1WF9A 1XT9B 2PMVA 1PGXA 1J8CA 2JU6X 5D3DA 2L00B 3EUB2 2WS3B 4HKZE 4EEWA 4BZAA 1WGYA 4OVZA 3L0WB 1PFDA 5AZGA 1FFVA 1Q10A 3DHHC 2K8BA 3VQIA 2BVCA 1S1QB 3NJTA 5I4DA 1TY2A 2WXGA 1WGRA 1BT0A 2MH7A 1WXAA 4GN1A 2QSDA 2CJNA 2M4NA 2LVPA 2BTEA 2EKEC 3R7QA 2VZKB 2IDYA 1V1PB 4TQ1A 5AUKA 5L83A 4QAYA 2NCNA 2INDC 3B0AA 2N4FA 4TKNA 5AZFA 4B0EA 4C00A 1WMHB 4RFBA 2K25A 4LTUA 2YEPF 2W3RA 3N1ZC 2LGXA 4JLCA 4FJVB 3ZDMC 5D7GA 4EE2A 3HHMA 2WU2B 1FXIA 4MH0E 4IWPA 3VDZA 2G9HD 4NQKE 3SDLC 2R61A 2VH1A 3VVWB 4FADA 2LRWA 5D6JB 1YIWA 1TYGB 2ZVOA 2NR2A 2BS3B 4GSWA 4OW0A 2WQYB 1QT9A 2GB1A 2UWQA 3RFZB 3UQBA 1CK1A 1TJEA 3V6EB 1WI0A 2LGDA 3GE3C 1UWMA 2L0TA 2MJDA 4C4VA 5CTRC 3AE5B 4NAWB 1YN5A 2ZPNA 3U2SC 4LNKA 1EWYC 1PDXA 2M0XA 3SU8X 1QZEA 2IO1B 3N3KB 2G4DB 1ZGUB 2KVRA 4NAMA 3KUCB 4GGQA 2O2VA 1SIJA 4KVGB 2KQ4X 2JYEA 3P4RB 4H2AA 1VZ8A 2GOWA 1IBXA 3PZ7A 4S0RA 4RCOA 2KFJA 2I1KA 3AMZA 1C1YB 3CWIA 2N7EA 5FK9C 2DZMA 5DPTA 1JWAD 2QILA 4DHZB 1FRDA 2INNE 3QC8B 1L0YB 1TT5B 3OG5A 1TS4A 4FA6A 1WGKA 4WWPA 3BK1A 2K0PA 5J2RA 2FNJB 2BPSA 3ZXVA 2X8XX 3N20C 2ZZPB 4GB9A 1ZPSA 4XGAB 3QJZA 3WALA 1RM6C 3DHGC 2KWCA 4LJPB 1V49A 2EMTA 3Q6BA 2DLBA 4A6QA 3PSEB 4AOFA 2OEDA 3ENEA 2RR9A 3AM9A 2AL3A 4WJQA 1WRIA 4A90A 3AE8B 4KIKA 2MWSB 5DPRA 3L10B 4GDLB 2ACZB 1FPYA 2MQJA 1E10A 4II2B 1UNSA 4M01A 1VLBA 3DBLB 3ZW3A 2HTME 3NY5A 2JRHA 2KZRA 3L17A 1N5XA 2V3SA 3N30A 4W9GA 3ZKJC 2MSED 2H88B 2RDGA 3WIMA 3RZFA 3DHIC 3T8MA 2I38A 5IA7A 4ICVA 2D3BA 3BYYB 4RGTA 3U4EG 1I4GA 2KN4A 3HVZA 4AUQC 2V4IB 4KDLB 4IWQA 3VH3B 2LHDA 5EE1A 2D3AA 2KOXA 2KJRA 3IBEA 2GBNA 1B1ZA 2V1YA 1ZUD2 3Q3MC 2JZ3B 3RT3B 3M63B 4N59A 2KTFA 3A1QB 1SGHA 3SD5A 4MGKE 1C77A 3N1YC 3RNEC 2BGFA 4O1NA 4ANVA 1LGRA 4YXDB 1E0ZA 1V9JA 4XWWA 3ML8A 3E9SA 2V4LA 3ZNGC 1C4PA 2K6QA 3VXWA 2IJ0A 2Z0DB 3IFWB 1F0ZA 2WXOA 4HVBA 1L0XB 4ZRPA 1R4NB 4HRSA 4P1BC 3KUDB 3ZNID 2JXXA 2BWFA 2C7MB 3V60A 4MJSA 1HTQA 1QOFA 3SR6A 1GPXA 1FCCC 2C5LC 2W82A 2L83A 2ZNVB 1EO6A 3ZVVA 3BIID 4LNFA 2LHEA 3WCQA 1ZDVA 2ASQA 4WWNA 3MJWA 1STEA 2KQ7A 1SSNA 3VTWA 1UD7A 1TGZB 2J4XA 4TMAB 4ANUA 1WZ0A 2L32A 2OJWA 1E8XA 2IY0B 5JZEB 1KOTA 3TMPB 2GBMA 4HROA 1ZW7A 4FLHA 3CSFA 2E6XA 4KDIC 1N5WA 3NVYA 1EWCA 1H8CA 3LDZE 4CHKA 2KDFB 1TTNA 3LB8C 2KLCA 4C7ZA 3Q8BA 1S3SG 1F2RC 2L1AA 4N58A 1WGDA 4W9LA 3ZNHB 3BWUD 4DHZE 1SE2A 2KD0A 1QF6A 2JT4B 4KZ0A 5L95C 2KLGA 1WXSA 3H1UA 3IG3A 3AEGB 1XLPA 4LNNA 1L2NA 4M00A 2INCC 1F52A 2BB6A 5JH5C 2EMSA 1R7SA 3ZJVA 1M94A 2XNAC 4YSYB 3VRAB 2YEPB 3VR9B 5FR3A 5JXVA 2HDEA 3EGRA 3R2TA 2LASA 1WR6E 3C8YA 1YMHE 3W9CB 4WQOB 4IKGA 1K51A 2QIEB 5JHBA 4IM0A 1Y8RC 3QHTA 4HPLB 3PT2B 4KGSA 1WXMA 3MP9A 2M8SA 3K9OB 4YTMB 2YVCA 3RNCC 2MHJA 4P1CC 3RYTA 1FEHA 2ZW1A 2WGSA 4BVUC 2N0SB 3PHWB 2WX1A 3NVWA 4KZCA 5GXGB 4K3CA 1WJUA 1UGMA 2BQQA 3I3TB 1RRBA 3Q14C 3TIXA 1TKEA 4FN2A 3TL5A 1TIFA 2IYDB 3MHSD 1MVKA 2QJLA 2AWTA 4BOZB 4JX1C 4DXGA 1SBBB 3B2GA 5EE0A 3AULA 1WGHA 2MLBA 4GIVA 3OJ3A 2VH2A 4KGTA 3VUWA 1DYQA 3PRZA 3AXCA 2RMMA 4NJCA 3AEEB 3VTUA 2LWPA 4RF0A 3NZSA 2DENB 1OQRA 1V5OA 2ZVNA 4GDKB 3I57A 4M0WA 5IOIA 3RPFC 3OWEB 4ACFA 4W9FA 4ZOHC 4BFRA 2AYOB 1K8RB 2QEJC 2JF5A 3A4SC 1WFYA 3P1MA 3RMKC 1NEKB 2NTTA 3JYUA 2ONQA 1AWDA 3UIOB 3A33B 1SEBD 3X0WA 3U30A 2WXLA 5LXIB 3M62B 3MFGA 4NZLB 1BUIC 2C9WB 4LLGM 1T5XD 3W5VB 2GBRA 2HD5B 2FE8A 1T0YA 1T0RC 5C1ZA 2J0KA 2WU5B 2KDBA 2RD0A 2HJ1A 1UUPA 2J0JA 4MACA 3UIPB 3AE4B 2HTHA 1N61A 3AB5A 5H92C 1WM2A 1TY0A 4C4VB 1T0QC 4BOSC 2O6VB 1MFWA 3V61A 3C19A 1EU3A 2L0FA 3PLUA 1FNWA 1JALA 2DYMA 3AU4A 1QLBB 3TJPA 3Q69A 2SAKA 1VZ7A 2NTSA 3EFUA 2FCSA 3AE3B 3BVGA 3KH0A 3N1XC 2ZEQA 3NVVA 3DQVA 3DBRB 2KX0A 1E6EB 2KFKA 2XK5A 1C9FA 4I6PA 3BY4B 4E71A 5CHFA 2KWVB 1R4MB 2CS4A 3VFKA 3TEZA 1RFKA 1YJJA 3D32A 2DAFA 1XD3B 3DOWA 3L4PA 3ZO5B 3O13A 3AN1A 4USAA 2JWUA 5BYRA 2KYWA 4NAWA 3KQ4A 4LNOA 4A55A 1J7AA 3APCA 1SF0A 2Y5CA 5E6NA 4BAXA 4E3CA 3NZ3A 2WXQA 4MH8A 1UGJA 3KWLA 3ZRCA 2L05A 3HK0A 3Q3OC 1VRAB 2AL6A 3URYA 2NPTA 4BKSA 2ZCBA 2QHOA 2CU1A 2MBOA 1P3QU 1T0SC 4EZKA 1OEYJ 3PHXB 4FJYA 4W9IA 3CF6E 1I35A 2BBCA 1HZ6A 4ZRQA 4KKIA 1FNUA 1YN4A 1LQBA 1QQRA 2Y5BB 1I4PA 2K8CA 2KNBA 1MHXA 2JZPA 4PYUA 5TR5A 3DDCB 2JX5A 1QKZA 1NYRA 1D5MC 3W5UB 3W2DA 2KVZA 2KMAA 1VR9A 2ZCCA 4ARIA 1YQBA 3KLSX 3UGBB 4RGNA 1HQRD 1RWSA 3SHQA 2WXHA 3FC4A 4M02A 2LMCA 2MEKA 2N9EB 3PRPB 4GOCA 3RUIB 4W9KA 4K7SA 3AU5A 4MJSB 4KSLC 4MSMB 2LUEA 1E8YA 3KYCD 1YN3A 1EF1A 4WIPA 1ESFA 2KDMA 3FKYA 4HPMB 3IT4B 3GZNB 4F1SA 3R3MA 3A9JA 2AX5A 4NPNA 4BBNC 4DK5A 4AQ7A 5BMIA 1QOGA 2Z8LA 2B3AA 2LGYA 1HTOA 3FILB 3PS6A 4WH4A 3GB1A 2QMTA 1LXDA 2FCNA 1IBXB 1ET9A 3DPDA 3DCGA 4EKUA 3RNGC 1JRPA 4JL9A 4KX6B 1WIAA 2BKRB 1WM3A 5BO4B 5EE3A 1GUAB 1OFFA 2WXFA 4MM3B 5KHQA 1SE3A 2MRPA 2MJEA 3GP7A 3HVDA 4BBNF 2L8JA 2CR5A 4ZRKA 3PZDA 3AEAB 4WQMA 1I4RA 2BYFA 4DQOC 1D5ZC 4K3BA 1OQQA 1D4BA 2K1FA 2IO0B 1ZP0B 2BS4B 2CJOA 1UH6A 5AZHA 1SB3C 3DBHI 3UINB 1ENFA 4IC7B 1GOZA 1FM0D 1JWUD 5C23A 4F7ZA 3VUXA 4GDLA 3B9JA 1E9MA 3RULA 2XBBC 3JW0X 3JVZX 1V1OA 4I6LB 2WDQB 2LGIA 1Q0WB 2IO3B 4ZYSA 3OJ4B 1TS2A 3ZTDA 3B1LX 3H7PA 4S17A 3ZXRA 2HJ8A 2BWES 2Z0EB 2N9KA 3A9KB 4ASWC 4IG7B 4DBGA 1V5TA 4L2YA 2RDBC 4WJOA 3ZNZB 4BKGA 2CHXA 1PQSA 4N9F4 4IUMB 2DWQA 2CU3A 1ZXIA 1V97A 4E74A 5DCNA 4WAFA 1P7EA 2XEWA 3IXSA 3WANA 2H89B 2K22A 2FIFA 1K50A 2M0AA 2V9HA 4RH6A 3UI3A 2Y5PA 3ETRA 1GB1A 3MJ5A 1JW9D 1NYQA 2LVOA 3LYYA 3H7PB 1YQ4B 4P6VF 5J17A 4EZJA 4ZRIA 5CX3A 2RDHA 3Q3FA 4K1RB 3PREA 1FXTB 3Q8CA 4YT0B 1NI2A 2K3UA 1WGGA 2FUHB 3Q3JA 2MP2B 2PJHA 3MC9A 1WX8A 4P7IA 3Q8AA 1TS3A 2J7QB 1V80A 5DPWA 4W9EA 1DGJA 1WYWB 1EUVB 4XX5A 2D10A 2E3TA 4PYZA 3A9JB 3SEBA 5G5HA 1JRUA 4N6EB 1PGBA 2J52A 4KV2A 5HG2A 2LJ5A 2PPHA 2VZKD 4IM2A 4B9KA 1E7VA 4II3B 4URKA 3U52E 3DVNU 3VRBB 2MBQA 1GG3A 5LLIA 1GB4A 4HDOA 2OJRA 1VZ6A 3NS8A 1UZXB 2LGSA 5HI1A 4OHJA 2DAJA 2ZNVC 3P4PB 4CYEA 3T9LA 2MBHA 5H8YE 3C0RB 2GMIC 3ZJUA 1Q5WB 1MG4A 4RM9A 1WXVA 1C4CA 1QILA 2LEKA 4C80A 1HXYD 1L4DB 1QOAA 1IP9A 1SIFA 3CSTA 1R4MI 2RSUA 4OVUA 3ZGZA 4HJGE 2PKOA 3NRZA 2RGFA 3PTFC 5GMVA 2V3PA 5EDSA 3VHTC 3DVNV 2WXJA 4IWOA 2W3SA 1V81A 4W9JA 4GDKA 2FCQA 3NHEB 4ZRJA 3Q8EA 2MP2A 2KJ6A 2JXTA 3V05A 2BW2A 2WDVB 1N63A 4XDDA 2W54A 2GI9A 3BK2A 3PVLA 1L7YA 4EFOA 5LNK1 5C3JB 3PLVA 5BYQA 4OZCA 2PLPA 2N9PC 1U4AA 3EECA 4A8XC 3W1YA 2PE6B 1J7CA 1MPEA 2L7RA 3L16A 1RLFA 4PS7A 3QQ8B 4XZ4A 4NJ6A 3Q3NC 5DPSA 1RAXA 4CQNA 1WRDB 3R2IA 4YSXB 2LD9A 2XN9C 3QX1A 1NI3A 1P98A 2KN5A 3FILA 1WY8A 2IGDA 1KLGD 2WXKA 3IVFA 4ZYNA 1HEZE 1P9DU 1KM7A 4DXAB 3WA0A 5E6PA 1C78A 4K7UA 4NJ7A 1CJEA 1WX9A 4I6NB 2K6DB 5G5GA 1XLOA 2BYTA 1K53A 3PPAA 1JCKB 1JWBD 3MHZA 5CHVC 4G0NB 4XDCA 4GLSC 4DHJD 2M17A 2B76B 5G2NA 4NY0A 5TSSA 2DZJA 2NBVB 5G55A 2KDIA 1CQVA 2Y3AA 5BMGA 4DWFA 5BYSA 1OEYA 2MBBB 4TV3A 1EU4A 3W1SA 1Z2MA 1ROEA 4F8CB 2R2OA 5HKHA 3TEYA 2GRIA 3UQAA 1KLVA 4L23A 5LXHA 3NUHB 2N9LA 2LZ6A
chains in the Genus database with same CATH topology
1RWSA 2WXHA 1SJHD 3FC4A 4JPSA 2LMCA 2I38A 3NVZA 1I4QA 3P63A 2MEKA 1TKYA 3R8BA 4YSZB 4US9A 2N7JA 3BYYB 4RGTA 3U4EG 1I4GA 2KN4A 5EE9A 3AV8A 1Y56A 2JQRB 1SXTA 3HVZA 1LO5D 2G1EA 2FBWB 2V4IB 3ZJTA 1YN3A 4WIPA 3MC0B 1ESFA 2KDMA 2LHDA 3B2FA 5EE1A 3IT4B 3CIRB 1TKGA 2AX5A 1SE4A 1B1ZA 3E56A 3GS2A 1K52A 1YQ3B 2MJ3A 4AQ7A 1ZUD2 3ABVB 5BMIA 1QOGA 2Z8LA 1I7HA 4N59A 4ZHOA 4OZAA 3FILB 3I9V1 1I4HA 2PW9A 1C77A 4WH4A 4YTPB 3GB1A 4J3OD 1V1PA 2QMTA 2J42A 3LXFA 1XEEA 4O1NA 4YXDB 1E0ZA 1IBXB 4IDIA 1ET9A 2OHFA 3AEFB 4XWWA 1DOIA 2WNMA 5MPOA 1DOYA 3E9SA 1JRPA 3AH7A 4RF1A 4KX6B 1C4PA 4HEA1 1NVID 1AN8A 2IJ0A 4REZA 4ITKA 1ACCA 1WXQA 1KF6B 1C4AA 4OZBA 1F0ZA 2WXOA 5EE3A 1L0XB 1OFFA 4XE0A 4ZRPA 2WXFA 4YTNB 4Q2JA 1M4VA 4HRSA 2AQ2B 4MM3B 2RPVA 2D5GA 1SE3A 2MJEA 2WDRB 3GP7A 3T3OA 1AW7A 3HVDA 1WYGA 4RNAA 1VJKA 1YJIA 3Q8FA 1P7FA 1BXTA 1QOFA 2Q5WD 3SR6A 1FO4A 2TSSA 1GPXA 3AEAB 1FCCC 2KACA 1I4RA 2L83A 2W82A 4WQMA 3BIID 4R3DA 4MT5A 2LHEA 3WCQA 1ZDVA 2WXRA 3J9CA 3AE6B 3IT6B 1HA5A 4DQOC 1D5ZC 4A9AA 1XCTL 1OQQA 1STEA 4DXFA 1D4BA 5C2TB 1SSNA 1C79A 1NENB 2LJIA 1PYWD 2J4XA 4TMAB 2K9XA 1ZP0B 2PIAA 2BS4B 2L32A 1AYFA 2CJOA 3BVMA 1TS5A 1SB3C 2ICIA 2KAJA 1JQ4A 1JWSD 1FD6A 1FRRA 1ENFA 4FXCA 5HHDG 3P4QB 1GOZA 1FM0D 1JWUD 2LUMA 4HROA 1TZOA 2IPKD 1PGAA 3PO0A 2E6XA 1N5WA 1E9MA 3B9JA 3NVYA 1EWCA 2M56B 2FUG1 1BMLC 2J53A 2SEBD 1T3QA 4P16A 1RYJA 1F77A 3LB8C 1V1OA 3TSSA 4C7ZA 3Q8BA 1V8CA 1YNTE 2WDQB 2LGIA 4ZYSA 1E7PB 1F2RC 1TS2A 2L1AA 4N58A 1FMAD 3NS1A 2PVOD 4US8A 1ZE3D 1MI0A 3AEDB 3BWUD 1L4ZB 2V3NA 2N9KA 1SE2A 1QF6A 2INPE 2WLBA 5AUIA 4L2YA 2BT6A 5FKAC 2BB5A 4WWMA 1GB1A 3HRDD 1PUTA 2V0GA 3AEGB 3DWMA 1ET6A 1XLPA 2DWQA 2CU3A 1ZXIA 1V97A 3AE7B 1XXGA 2EELA 4WAFA 2BB6A 4C7YA 1FXAA 1L5PA 1P7EA 3SFEB 3EA6A 4RGMA 1R7SA 2WXMA 3ZJVA 4HKQA 3IXSA 2H89B 2K22A 2XNAC 3VRAB 4YSYB 3VR9B 2YEPB 5FR3A 1K50A 2M0AA 4JWUC 4L1BA 5JXVA 1N62A 1XCQL 2HDEA 3EGRA 3R2TA 2M19A 4RH6A 1XO3A 5D3IB 3UI3A 1SJED 2I2YA 2WXNA 1YMHE 2Y5PA 3C8YA 3ETRA 1JW9D 1NYQA 3LYYA 3MJ5A 3TUOA 3W9CB 4B0MA 4IKGA 4YWGG 1K51A 2QIEB 3PZ8A 1YQ4B 4P6VF 3P42A 3BVZA 1F2RI 1L6UA 4TQ0A 2RDHA 4KGSA 1B9RA 3MP9A 1IUEA 2NMQA 5E6JA 2DYOA 1IGDA 4YTMB 1QOBA 1JWMD 3Q8CA 3AE2B 4YT0B 3ZYYX 1KTKA 2K3UA 1FEHA 2ZW1A 3TEWA 3N9YC 3SFDB 4LK0M 2PMVA 1PGXA 2PVGC 4WURA 3BZDB 1D5XC 1KH0A 2N0SB 1JMLA 2JU6X 5D3DA 3NVWA 3Q8AA 1TS3A 3EUB2 2WS3B 1MHHE 2DBYA 4HKZE 1IGCA 5GXGB 1DGJA 3P4SB 1ZXHA 4OVZA 1PFDA 4PT5A 2E3TA 5T8IA 1FFVA 1Q10A 3SEBA 1L6VA 3VQIA 1TKEA 5G5HA 4N6EB 1PGBA 3ZQ4A 5I4DA 2J52A 1TY2A 2WXGA 1MVKA 2QJLA 5HG2A 2MH7A 1ZDXA 4JX1C 4DXGA 1SBBB 3B2GA 5EE0A 2VZKD 2QSDA 2CJNA 1FFUA 3U52E 4RGOS 3VRBB 2BTEA 4KGTA 1FIQA 1GB4A 1DYQA 3FAHA 2VZKB 2IDYA 1FCLA 2RMMA 4NJCA 3AEEB 1VZ6A 1V1PB 4RF0A 5HFYA 2WXIA 4TQ1A 5AUKA 5HI1A 1OQRA 2EKIA 4GDKB 4OHJA 2AQ1B 3P4PB 2IGGA 3I57A 4M0WA 5H8YE 3RPFC 3OWEB 4ZOHC 4B0EA 2QEJC 3ZJUA 4RFBA 4C80A 1A70A 1C4CA 1QILA 2LEKA 4LTUA 1HXYD 2YEPF 1L4DB 1QOAA 2W3RA 3P1MA 1NEKB 2NTTA 2ONQA 1AWDA 4EE2A 5D7GA 1SEBD 2WU2B 1FXIA 3AECB 1VDVA 3U7ZA 2G9HD 3ZGZA 2BS2B 4HJGE 4C56C 2WXLA 1N60A 3MFGA 2PKOA 4NZLB 1BUIC 3NRZA 4LLGM 2R61A 1T5XD 3W5VB 3BYTB 2V3PA 2JSVX 2FE8A 2X38A 2KWDA 1TYGB 2WXJA 2BS3B 2W3SA 1FNVA 3AE1B 3IAM1 2WQYB 2WU5B 3AEBB 4OW0A 1QT9A 2GB1A 1T6BX 3RFZB 1UUPA 1CK1A 1TJEA 4MACA 4ZHPA 3Q8EA 3AE4B 3AB5A 1N61A 1UWMA 1KFYB 1TY0A 5H92C 4JE3B 2JXTA 3V05A 2L52A 2BW2A 2WDVB 1ZOYB 4ARCA 1XLQA 1N63A 4XDDA 2MJDA 2W54A 2GI9A 3BK2A 5LNK1 1EU3A 3AE5B 3VR8B 3KWVA 4NAWB 1FNWA 5C3JB 1JALA 1YN5A 4JWSC 2PTLA 2DYMA 5BYQA 4OZCA 3U2SC 1QLBB 2PLPA 2IGHA 4D2KA 3Q69A 1EWYC 1PDXA 2SAKA 1VZ7A 4A8XC 2NTSA 1J7CA 3H8HA 1MPEA 3AE3B 3BVGA 3TEXA 2LFIA 1GAQB 2ON8A 2W55A 4NAMA 1WSPA 3NVVA 1XF5L 4KGRA 1SIJA 3T3NA 2KQ4X 2K5PA 2JYEA 2JYTA 3P4RB 4H2AA 1E6EB 4CQNA 2KMMA 3R2IA 1VZ8A 1C9FA 4YSXB 1XLNA 3V3XA 3PZ7A 1IBXA 2XN9C 4RCOA 4TSSA 1NI3A 3CWIA 3AMZA 5FK9C 3FILA 2IGDA 2WXKA 1KLGD 1JWAD 2QILA 1HEZE 3TEZA 1FRDA 1RFKA 2INNE 1YJJA 1C78A 1L0YB 3L4PA 3O13A 3AN1A 2AQ3B 4USAA 1CJEA 1TS4A 2JWUA 3HUIA 2ZW0A 5BYRA 1D6EC 4XWTA 5G5GA 1WGKA 3KQ4A 1XLOA 3BK1A 4A55A 3IAS1 2K0PA 2BYTA 1J7AA 1K53A 1JCKB 1SF0A 1JWBD 2Y5CA 3AE9B 3DWGC 3MHZA 1I4XA 4XDCA 2WXPA 1ZPSA 1EM7A 3NZ3A 1KLUD 4GLSC 2WXQA 1DOXA 4MH8A 1RM6C 1UGJA 3KWLA 2B76B 4IOIE 2WP9B 4KKJA 5TSSA 2DLBA 4A6QA 1VRAB 3URYA 2OEDA 1JROA 3AM9A 1KRHA 1CQVA 2Y3AA 5BMGA 5BYSA 1CZPA 4AS1A 1WRIA 4A90A 3AE8B 1C76A 1HZ5A 1UWXA 2BBCA 1HZ6A 4ZRQA 1EU4A 4KKIA 4GDLB 1FNUA 1YN4A 1L0VB 2ACZB 3W1SA 1J7BA 1ROEA 1QQRA 1I4PA 1E10A 1UNSA 3TEYA 2JZPA 1MHXA 1VLBA 2GRIA 2HTME 2JX5A 1QKZA 4L23A 5BMHA 1NYRA 1D5MC 1N5XA 3W5UB 3NUHB 3W2DA 1WWTA 2N9LA 1VR9A 2H88B 2RDGA 4ARIA 3KLSX 4UDUC 4RGNA 1HQRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUO A;  4Q2J A; 
#chains in the Genus database with same CATH topology
 3TBL D;  1UBI A;  4JPS A;  3APF A;  3P63 A;  4YSZ B;  2KJH B;  4US9 A;  2N7J A;  2KMC A;  5EE9 A;  2KT7 A;  4G50 A;  1LM8 B;  3W1S C;  1SXT A;  1LO5 D;  4KIK B;  2FBW B;  3ZJT A;  4HJK A;  4B6W A;  3PRM B;  2N9X A;  4IW0 A;  3MC0 B;  1P0R A;  5KHO A;  3CIR B;  1TKG A;  1YX6 B;  1SE4 A;  3E56 A;  3M3J A;  2MJ3 A;  4ZHO A;  3I9V 1;  2VRR B;  4DHJ B;  3K9P B;  2NVU I;  1V1P A;  2GBJ A;  3LXF A;  1XEE A;  4FUL A;  1YJ1 A;  4EZL A;  3GZN I;  3AEF B;  3CMM B;  2WNM A;  3HM6 X;  4A3O A;  3U7D A;  1NVI D;  4ITK A;  1ACC A;  1WXQ A;  1UF0 A;  3LJ3 A;  2DZI A;  3JSV A;  4LJO B;  1V86 A;  2HE7 A;  4J6I A;  2RPV A;  2D5G A;  2C7H A;  2WDR B;  3T3O A;  4HLE A;  1AW7 A;  5IAA C;  4HXD A;  4RNA A;  2BYV E;  3Q8F A;  1P7F A;  2Q5W D;  1FO4 A;  2TSS A;  5IP4 D;  3QA8 A;  4HK2 A;  3ZDT A;  1WMH A;  3VH4 B;  3J9C A;  2WXR A;  3EC8 A;  3I63 C;  3M95 A;  4A9A A;  1XCT L;  4DXF A;  3EFC A;  2NS5 A;  1E8W A;  2LJI A;  1YX5 B;  4HPP A;  3L08 A;  1AYF A;  1RFA A;  3L13 A;  1TS5 A;  2KAJ A;  1JWS D;  1FD6 A;  1FRR A;  3KUZ A;  4AP4 C;  2A4Z A;  4FXC A;  3P4Q B;  2A5U A;  2LUM A;  1TZO A;  4JQW C;  1PGA A;  2DNF A;  2D3C A;  2LVQ A;  2LRU A;  2WYQ A;  2M56 B;  1J19 A;  4MSQ B;  4FHK A;  1BML C;  2CHZ A;  2KWU B;  1YD8 U;  2J53 A;  2SEB D;  1YNT E;  4KSK C;  2I1J A;  2QC8 A;  1E7P B;  4LNI A;  4WJP A;  1UBQ A;  2KHW B;  3OLM D;  1ZE3 D;  2IO2 B;  4AJY B;  1MI0 A;  2GBK A;  3R7R A;  2INP E;  2KXJ A;  5D2M B;  2WLB A;  1NDD A;  3A1Q A;  3DVG Y;  3EHV A;  5FKA C;  2BB5 A;  2KC1 A;  1H4R A;  3HRD D;  2V0G A;  3DWM A;  1V2Y A;  1ET6 A;  4AWJ A;  4GMV A;  1XXG A;  2EEL A;  2D3G A;  3Q2A C;  2OOB B;  3RCZ A;  4PS8 A;  1FXA A;  1L5P A;  2FAZ A;  2JRI B;  3SFE B;  4FHJ A;  4ANX A;  1C3T A;  4L1B A;  2L76 A;  1XQQ A;  1N62 A;  1XCQ L;  3B08 A;  2KC2 A;  2WXN A;  3TUO A;  2JVC A;  2K8H A;  4YWG G;  1Q1O A;  3BVZ A;  2QDF A;  1WJ4 A;  1B9R A;  1IUE A;  1ISN A;  2NMQ A;  5E6J A;  2DYO A;  3ALB A;  1OTR B;  2JUO A;  1OQY A;  1VCB A;  1WE7 A;  3BIN A;  3I5J C;  3TEW A;  2PVG C;  4WUR A;  2ZPY A;  3BZD B;  1D5X C;  4PS3 A;  1KH0 A;  3S2A A;  1JML A;  4A20 A;  3H9D A;  1G6J A;  1MHH E;  2DBY A;  2BKF A;  2O2V B;  1WJN A;  1IGC A;  4MGY E;  3P4S B;  1ZXH A;  3OAW A;  3ECI A;  3A4R A;  4PT5 A;  3ZIM A;  5T8I A;  2WHI A;  5IKC M;  1F1H A;  4MEL A;  1L6V A;  3APD A;  5CHW A;  3ZQ4 A;  4K7W A;  2D11 A;  2IY1 B;  2G3Q B;  1ZDX A;  2G45 B;  3TCA A;  1MG8 A;  1FFU A;  4RGO S;  1FIQ A;  4DDG D;  2KFK B;  3FAH A;  4W9H A;  1FCL A;  3VAW A;  3H7S A;  5HFY A;  2WXI A;  1V6E A;  4LDT D;  4EUT A;  4GXB A;  2EKI A;  3WAP A;  2AQ1 B;  2IGG A;  2KK8 A;  3RZW C;  2M1M A;  4G11 A;  2KTR A;  2C60 A;  1GC6 A;  3HM3 A;  1HE8 A;  1A70 A;  4FJZ A;  2KO3 A;  2O6V A;  3AEC B;  1VDV A;  2NBU A;  1NBF C;  3DBS A;  3U7Z A;  4XC2 A;  2BS2 B;  4C56 C;  1N60 A;  4BKS D;  3BYT B;  3VUY A;  2G4S A;  3QCA A;  2JSV X;  1YOV B;  2X38 A;  2AEH A;  2KWD A;  2JPH A;  3H6N A;  3ZUN A;  4RMA A;  3QAQ A;  3ZTC A;  1FNV A;  3AE1 B;  3IAM 1;  4K81 A;  3AEB B;  1T6B X;  4JGH B;  4ZHP A;  5IO9 A;  1KFY B;  1LFD A;  4JE3 B;  1WX7 A;  2L52 A;  4A3P A;  1ZOY B;  4ARC A;  1XLQ A;  3VR8 B;  3KWV A;  2O6V D;  4JWS C;  2PE9 A;  2FCM A;  2PTL A;  3JSV B;  2KTR B;  4B95 A;  3QIJ A;  2IGH A;  4D2K A;  5JHA A;  3H8H A;  3TEX A;  2LFI A;  1GAQ B;  1IPG A;  2ON8 A;  2RPQ A;  2W55 A;  2ZJD A;  1WSP A;  1XF5 L;  1E90 A;  4KGR A;  1CMX B;  3T3N A;  1EF5 A;  2K5P A;  2JYT A;  2KMM A;  2WWZ A;  1XLN A;  4RM8 A;  3V3X A;  4TSS A;  3N32 A;  3ZRF A;  4PK1 A;  1TZ1 A;  3PGE A;  3R66 C;  2JWZ A;  2REX A;  3KYD D;  2AQ3 B;  3HUI A;  1A5R A;  2Z59 B;  2ZW0 A;  1WH3 A;  2WX0 A;  1ZKH A;  1D6E C;  4XWT A;  2IZV B;  3ONS A;  4HWI B;  3IAS 1;  4MGZ E;  3O65 B;  3MTN B;  3AE9 B;  3DWG C;  1I4X A;  2WXP A;  1E5W A;  1EM7 A;  1KLU D;  1DOX A;  3RNB C;  1E7U A;  4IOI E;  2WP9 B;  4KKJ A;  1Z5S B;  4TUU A;  3V6C B;  1JRO A;  2UYZ B;  1GJZ A;  1X1M A;  1KRH A;  4FBJ B;  1CZP A;  3DBH B;  1E8Z A;  4AS1 A;  2C7N B;  2NPT B;  1C76 A;  1HZ5 A;  1UWX A;  1I42 A;  1TBE A;  1L0V B;  1J7B A;  4NNJ B;  3QAR A;  3HIZ A;  2NBW B;  1GC7 A;  4DDI D;  2N1W A;  2KQS A;  5BMH A;  3X23 A;  2FID A;  1WWT A;  2DHZ A;  2UU7 A;  1WZ3 A;  4UDU C;  3RD2 A;  4HCP B;  3NG0 A;  4MEM A;  1SJH D;  1N6Z A;  3GOE A;  2W9N A;  3NVZ A;  1I4Q A;  1TKY A;  3R8B A;  3DVG X;  3NZU A;  3AV8 A;  2XK5 B;  1Y56 A;  2JQR B;  2G1E A;  2PEA A;  2LI5 A;  3B2F A;  2KAN A;  2BYE A;  3GS2 A;  1K52 A;  1YQ3 B;  3ABV B;  1I7H A;  3ML9 A;  2MX2 A;  4OZA A;  1I4H A;  2PW9 A;  2IBI B;  4YTP B;  4J3O D;  3P2B A;  2J42 A;  2LXA A;  4IDI A;  2OHF A;  1DOI A;  2KDE B;  5AEK B;  5MPO A;  4W9C A;  2J0M A;  4MM3 A;  1DOY A;  3AH7 A;  4RF1 A;  4OVV A;  2K39 A;  3DBR I;  4HEA 1;  1AN8 A;  2D07 B;  4REZ A;  1KF6 B;  1C4A A;  4OZB A;  2MCN B;  3IHP C;  4XE0 A;  4YTN B;  4Q2J A;  1M4V A;  2AQ2 B;  3WAM A;  1UEL A;  1GNU A;  1WYG A;  2MA9 B;  2YLM A;  2R2Q A;  1VJK A;  3RN9 C;  1YJI A;  3U8Z A;  3KW5 B;  1BXT A;  1VD2 A;  2BF8 B;  2KAC A;  2N1V A;  4LCD E;  4JIO U;  4R3D A;  2CHW A;  4MT5 A;  3QK0 A;  4M0W B;  2LXC A;  3AE6 B;  3IT6 B;  1HA5 A;  3V62 A;  4X57 B;  1AAR A;  5C2T B;  4WAA A;  1SE9 A;  1C79 A;  1WE6 A;  4ZDV A;  1NEN B;  5J18 A;  2N7D A;  3AI5 A;  1PYW D;  3L54 A;  3KVF B;  3WAO A;  3MC8 A;  2K9X A;  2PIA A;  3RNA C;  4ANW A;  3BVM A;  2ICI A;  2CKH B;  1JQ4 A;  1F9J A;  3RNF C;  5HHD G;  3VTV A;  3ZLZ A;  2QCZ A;  3A9K A;  2IPK D;  4BKT A;  3PO0 A;  4HCN B;  2FUG 1;  2MW5 A;  4IM3 A;  5E6O A;  1MJD A;  1T3Q A;  4P16 A;  1RYJ A;  1F77 A;  1WJ6 A;  4M8M A;  3TSS A;  1P1A A;  1V8C A;  1J0G A;  1FMA D;  3UF8 A;  2DZK A;  1R4N I;  2KKC A;  3NS1 A;  2PVO D;  4US8 A;  3AED B;  2JZZ A;  1L4Z B;  2V3N A;  4G3X B;  3PV1 A;  4MGI E;  5AUI A;  1D3Z A;  2BT6 A;  2GLS A;  4M8N A;  4WWM A;  1PUT A;  3QWZ B;  4LDT B;  3AE7 B;  4NQL B;  4C7Y A;  4YL8 A;  4MDK E;  3EA6 A;  1OGW A;  4RGM A;  1IYF A;  2WXM A;  4HKQ A;  4AJW A;  2KX3 A;  1WR1 A;  4JWU C;  2M19 A;  4ICU A;  1XO3 A;  5D3I B;  4CO7 A;  4EOY A;  1SJE D;  2I2Y A;  4B0M A;  4WWO A;  3PZ8 A;  3RI7 C;  3P42 A;  5FR6 A;  2WDT B;  1F2R I;  2L3Z A;  3GE8 C;  1L6U A;  4W9D A;  4TQ0 A;  1KJT A;  2MBE A;  5D94 A;  3DBL I;  4XYC A;  5IN7 A;  1IGD A;  1QOB A;  1JWM D;  3AE2 B;  4WJN A;  2DX5 B;  2D2Q A;  4HDQ A;  3ZYY X;  1KTK A;  2JY6 A;  4GU2 A;  2DYB A;  3N9Y C;  3NOB A;  3SFD B;  4LK0 M;  1WF9 A;  1XT9 B;  2PMV A;  1PGX A;  1J8C A;  2JU6 X;  5D3D A;  2L00 B;  3EUB 2;  2WS3 B;  4HKZ E;  4EEW A;  4BZA A;  1WGY A;  4OVZ A;  3L0W B;  1PFD A;  5AZG A;  1FFV A;  1Q10 A;  3DHH C;  2K8B A;  3VQI A;  2BVC A;  1S1Q B;  3NJT A;  5I4D A;  1TY2 A;  2WXG A;  1WGR A;  1BT0 A;  2MH7 A;  1WXA A;  4GN1 A;  2QSD A;  2CJN A;  2M4N A;  2LVP A;  2BTE A;  2EKE C;  3R7Q A;  2VZK B;  2IDY A;  1V1P B;  4TQ1 A;  5AUK A;  5L83 A;  4QAY A;  2NCN A;  2IND C;  3B0A A;  2N4F A;  4TKN A;  5AZF A;  4B0E A;  4C00 A;  1WMH B;  4RFB A;  2K25 A;  4LTU A;  2YEP F;  2W3R A;  3N1Z C;  2LGX A;  4JLC A;  4FJV B;  3ZDM C;  5D7G A;  4EE2 A;  3HHM A;  2WU2 B;  1FXI A;  4MH0 E;  4IWP A;  3VDZ A;  2G9H D;  4NQK E;  3SDL C;  2R61 A;  2VH1 A;  3VVW B;  4FAD A;  2LRW A;  5D6J B;  1YIW A;  1TYG B;  2ZVO A;  2NR2 A;  2BS3 B;  4GSW A;  4OW0 A;  2WQY B;  1QT9 A;  2GB1 A;  2UWQ A;  3RFZ B;  3UQB A;  1CK1 A;  1TJE A;  3V6E B;  1WI0 A;  2LGD A;  3GE3 C;  1UWM A;  2L0T A;  2MJD A;  4C4V A;  5CTR C;  3AE5 B;  4NAW B;  1YN5 A;  2ZPN A;  3U2S C;  4LNK A;  1EWY C;  1PDX A;  2M0X A;  3SU8 X;  1QZE A;  2IO1 B;  3N3K B;  2G4D B;  1ZGU B;  2KVR A;  4NAM A;  3KUC B;  4GGQ A;  2O2V A;  1SIJ A;  4KVG B;  2KQ4 X;  2JYE A;  3P4R B;  4H2A A;  1VZ8 A;  2GOW A;  1IBX A;  3PZ7 A;  4S0R A;  4RCO A;  2KFJ A;  2I1K A;  3AMZ A;  1C1Y B;  3CWI A;  2N7E A;  5FK9 C;  2DZM A;  5DPT A;  1JWA D;  2QIL A;  4DHZ B;  1FRD A;  2INN E;  3QC8 B;  1L0Y B;  1TT5 B;  3OG5 A;  1TS4 A;  4FA6 A;  1WGK A;  4WWP A;  3BK1 A;  2K0P A;  5J2R A;  2FNJ B;  2BPS A;  3ZXV A;  2X8X X;  3N20 C;  2ZZP B;  4GB9 A;  1ZPS A;  4XGA B;  3QJZ A;  3WAL A;  1RM6 C;  3DHG C;  2KWC A;  4LJP B;  1V49 A;  2EMT A;  3Q6B A;  2DLB A;  4A6Q A;  3PSE B;  4AOF A;  2OED A;  3ENE A;  2RR9 A;  3AM9 A;  2AL3 A;  4WJQ A;  1WRI A;  4A90 A;  3AE8 B;  4KIK A;  2MWS B;  5DPR A;  3L10 B;  4GDL B;  2ACZ B;  1FPY A;  2MQJ A;  1E10 A;  4II2 B;  1UNS A;  4M01 A;  1VLB A;  3DBL B;  3ZW3 A;  2HTM E;  3NY5 A;  2JRH A;  2KZR A;  3L17 A;  1N5X A;  2V3S A;  3N30 A;  4W9G A;  3ZKJ C;  2MSE D;  2H88 B;  2RDG A;  3WIM A;  3RZF A;  3DHI C;  3T8M A;  2I38 A;  5IA7 A;  4ICV A;  2D3B A;  3BYY B;  4RGT A;  3U4E G;  1I4G A;  2KN4 A;  3HVZ A;  4AUQ C;  2V4I B;  4KDL B;  4IWQ A;  3VH3 B;  2LHD A;  5EE1 A;  2D3A A;  2KOX A;  2KJR A;  3IBE A;  2GBN A;  1B1Z A;  2V1Y A;  1ZUD 2;  3Q3M C;  2JZ3 B;  3RT3 B;  3M63 B;  4N59 A;  2KTF A;  3A1Q B;  1SGH A;  3SD5 A;  4MGK E;  1C77 A;  3N1Y C;  3RNE C;  2BGF A;  4O1N A;  4ANV A;  1LGR A;  4YXD B;  1E0Z A;  1V9J A;  4XWW A;  3ML8 A;  3E9S A;  2V4L A;  3ZNG C;  1C4P A;  2K6Q A;  3VXW A;  2IJ0 A;  2Z0D B;  3IFW B;  1F0Z A;  2WXO A;  4HVB A;  1L0X B;  4ZRP A;  1R4N B;  4HRS A;  4P1B C;  3KUD B;  3ZNI D;  2JXX A;  2BWF A;  2C7M B;  3V60 A;  4MJS A;  1HTQ A;  1QOF A;  3SR6 A;  1GPX A;  1FCC C;  2C5L C;  2W82 A;  2L83 A;  2ZNV B;  1EO6 A;  3ZVV A;  3BII D;  4LNF A;  2LHE A;  3WCQ A;  1ZDV A;  2ASQ A;  4WWN A;  3MJW A;  1STE A;  2KQ7 A;  1SSN A;  3VTW A;  1UD7 A;  1TGZ B;  2J4X A;  4TMA B;  4ANU A;  1WZ0 A;  2L32 A;  2OJW A;  1E8X A;  2IY0 B;  5JZE B;  1KOT A;  3TMP B;  2GBM A;  4HRO A;  1ZW7 A;  4FLH A;  3CSF A;  2E6X A;  4KDI C;  1N5W A;  3NVY A;  1EWC A;  1H8C A;  3LDZ E;  4CHK A;  2KDF B;  1TTN A;  3LB8 C;  2KLC A;  4C7Z A;  3Q8B A;  1S3S G;  1F2R C;  2L1A A;  4N58 A;  1WGD A;  4W9L A;  3ZNH B;  3BWU D;  4DHZ E;  1SE2 A;  2KD0 A;  1QF6 A;  2JT4 B;  4KZ0 A;  5L95 C;  2KLG A;  1WXS A;  3H1U A;  3IG3 A;  3AEG B;  1XLP A;  4LNN A;  1L2N A;  4M00 A;  2INC C;  1F52 A;  2BB6 A;  5JH5 C;  2EMS A;  1R7S A;  3ZJV A;  1M94 A;  2XNA C;  4YSY B;  3VRA B;  2YEP B;  3VR9 B;  5FR3 A;  5JXV A;  2HDE A;  3EGR A;  3R2T A;  2LAS A;  1WR6 E;  3C8Y A;  1YMH E;  3W9C B;  4WQO B;  4IKG A;  1K51 A;  2QIE B;  5JHB A;  4IM0 A;  1Y8R C;  3QHT A;  4HPL B;  3PT2 B;  4KGS A;  1WXM A;  3MP9 A;  2M8S A;  3K9O B;  4YTM B;  2YVC A;  3RNC C;  2MHJ A;  4P1C C;  3RYT A;  1FEH A;  2ZW1 A;  2WGS A;  4BVU C;  2N0S B;  3PHW B;  2WX1 A;  3NVW A;  4KZC A;  5GXG B;  4K3C A;  1WJU A;  1UGM A;  2BQQ A;  3I3T B;  1RRB A;  3Q14 C;  3TIX A;  1TKE A;  4FN2 A;  3TL5 A;  1TIF A;  2IYD B;  3MHS D;  1MVK A;  2QJL A;  2AWT A;  4BOZ B;  4JX1 C;  4DXG A;  1SBB B;  3B2G A;  5EE0 A;  3AUL A;  1WGH A;  2MLB A;  4GIV A;  3OJ3 A;  2VH2 A;  4KGT A;  3VUW A;  1DYQ A;  3PRZ A;  3AXC A;  2RMM A;  4NJC A;  3AEE B;  3VTU A;  2LWP A;  4RF0 A;  3NZS A;  2DEN B;  1OQR A;  1V5O A;  2ZVN A;  4GDK B;  3I57 A;  4M0W A;  5IOI A;  3RPF C;  3OWE B;  4ACF A;  4W9F A;  4ZOH C;  4BFR A;  2AYO B;  1K8R B;  2QEJ C;  2JF5 A;  3A4S C;  1WFY A;  3P1M A;  3RMK C;  1NEK B;  2NTT A;  3JYU A;  2ONQ A;  1AWD A;  3UIO B;  3A33 B;  1SEB D;  3X0W A;  3U30 A;  2WXL A;  5LXI B;  3M62 B;  3MFG A;  4NZL B;  1BUI C;  2C9W B;  4LLG M;  1T5X D;  3W5V B;  2GBR A;  2HD5 B;  2FE8 A;  1T0Y A;  1T0R C;  5C1Z A;  2J0K A;  2WU5 B;  2KDB A;  2RD0 A;  2HJ1 A;  1UUP A;  2J0J A;  4MAC A;  3UIP B;  3AE4 B;  2HTH A;  1N61 A;  3AB5 A;  5H92 C;  1WM2 A;  1TY0 A;  4C4V B;  1T0Q C;  4BOS C;  2O6V B;  1MFW A;  3V61 A;  3C19 A;  1EU3 A;  2L0F A;  3PLU A;  1FNW A;  1JAL A;  2DYM A;  3AU4 A;  1QLB B;  3TJP A;  3Q69 A;  2SAK A;  1VZ7 A;  2NTS A;  3EFU A;  2FCS A;  3AE3 B;  3BVG A;  3KH0 A;  3N1X C;  2ZEQ A;  3NVV A;  3DQV A;  3DBR B;  2KX0 A;  1E6E B;  2KFK A;  2XK5 A;  1C9F A;  4I6P A;  3BY4 B;  4E71 A;  5CHF A;  2KWV B;  1R4M B;  2CS4 A;  3VFK A;  3TEZ A;  1RFK A;  1YJJ A;  3D32 A;  2DAF A;  1XD3 B;  3DOW A;  3L4P A;  3ZO5 B;  3O13 A;  3AN1 A;  4USA A;  2JWU A;  5BYR A;  2KYW A;  4NAW A;  3KQ4 A;  4LNO A;  4A55 A;  1J7A A;  3APC A;  1SF0 A;  2Y5C A;  5E6N A;  4BAX A;  4E3C A;  3NZ3 A;  2WXQ A;  4MH8 A;  1UGJ A;  3KWL A;  3ZRC A;  2L05 A;  3HK0 A;  3Q3O C;  1VRA B;  2AL6 A;  3URY A;  2NPT A;  4BKS A;  2ZCB A;  2QHO A;  2CU1 A;  2MBO A;  1P3Q U;  1T0S C;  4EZK A;  1OEY J;  3PHX B;  4FJY A;  4W9I A;  3CF6 E;  1I35 A;  2BBC A;  1HZ6 A;  4ZRQ A;  4KKI A;  1FNU A;  1YN4 A;  1LQB A;  1QQR A;  2Y5B B;  1I4P A;  2K8C A;  2KNB A;  1MHX A;  2JZP A;  4PYU A;  5TR5 A;  3DDC B;  2JX5 A;  1QKZ A;  1NYR A;  1D5M C;  3W5U B;  3W2D A;  2KVZ A;  2KMA A;  1VR9 A;  2ZCC A;  4ARI A;  1YQB A;  3KLS X;  3UGB B;  4RGN A;  1HQR D;  1RWS A;  3SHQ A;  2WXH A;  3FC4 A;  4M02 A;  2LMC A;  2MEK A;  2N9E B;  3PRP B;  4GOC A;  3RUI B;  4W9K A;  4K7S A;  3AU5 A;  4MJS B;  4KSL C;  4MSM B;  2LUE A;  1E8Y A;  3KYC D;  1YN3 A;  1EF1 A;  4WIP A;  1ESF A;  2KDM A;  3FKY A;  4HPM B;  3IT4 B;  3GZN B;  4F1S A;  3R3M A;  3A9J A;  2AX5 A;  4NPN A;  4BBN C;  4DK5 A;  4AQ7 A;  5BMI A;  1QOG A;  2Z8L A;  2B3A A;  2LGY A;  1HTO A;  3FIL B;  3PS6 A;  4WH4 A;  3GB1 A;  2QMT A;  1LXD A;  2FCN A;  1IBX B;  1ET9 A;  3DPD A;  3DCG A;  4EKU A;  3RNG C;  1JRP A;  4JL9 A;  4KX6 B;  1WIA A;  2BKR B;  1WM3 A;  5BO4 B;  5EE3 A;  1GUA B;  1OFF A;  2WXF A;  4MM3 B;  5KHQ A;  1SE3 A;  2MRP A;  2MJE A;  3GP7 A;  3HVD A;  4BBN F;  2L8J A;  2CR5 A;  4ZRK A;  3PZD A;  3AEA B;  4WQM A;  1I4R A;  2BYF A;  4DQO C;  1D5Z C;  4K3B A;  1OQQ A;  1D4B A;  2K1F A;  2IO0 B;  1ZP0 B;  2BS4 B;  2CJO A;  1UH6 A;  5AZH A;  1SB3 C;  3DBH I;  3UIN B;  1ENF A;  4IC7 B;  1GOZ A;  1FM0 D;  1JWU D;  5C23 A;  4F7Z A;  3VUX A;  4GDL A;  3B9J A;  1E9M A;  3RUL A;  2XBB C;  3JW0 X;  3JVZ X;  1V1O A;  4I6L B;  2WDQ B;  2LGI A;  1Q0W B;  2IO3 B;  4ZYS A;  3OJ4 B;  1TS2 A;  3ZTD A;  3B1L X;  3H7P A;  4S17 A;  3ZXR A;  2HJ8 A;  2BWE S;  2Z0E B;  2N9K A;  3A9K B;  4ASW C;  4IG7 B;  4DBG A;  1V5T A;  4L2Y A;  2RDB C;  4WJO A;  3ZNZ B;  4BKG A;  2CHX A;  1PQS A;  4N9F 4;  4IUM B;  2DWQ A;  2CU3 A;  1ZXI A;  1V97 A;  4E74 A;  5DCN A;  4WAF A;  1P7E A;  2XEW A;  3IXS A;  3WAN A;  2H89 B;  2K22 A;  2FIF A;  1K50 A;  2M0A A;  2V9H A;  4RH6 A;  3UI3 A;  2Y5P A;  3ETR A;  1GB1 A;  3MJ5 A;  1JW9 D;  1NYQ A;  2LVO A;  3LYY A;  3H7P B;  1YQ4 B;  4P6V F;  5J17 A;  4EZJ A;  4ZRI A;  5CX3 A;  2RDH A;  3Q3F A;  4K1R B;  3PRE A;  1FXT B;  3Q8C A;  4YT0 B;  1NI2 A;  2K3U A;  1WGG A;  2FUH B;  3Q3J A;  2MP2 B;  2PJH A;  3MC9 A;  1WX8 A;  4P7I A;  3Q8A A;  1TS3 A;  2J7Q B;  1V80 A;  5DPW A;  4W9E A;  1DGJ A;  1WYW B;  1EUV B;  4XX5 A;  2D10 A;  2E3T A;  4PYZ A;  3A9J B;  3SEB A;  5G5H A;  1JRU A;  4N6E B;  1PGB A;  2J52 A;  4KV2 A;  5HG2 A;  2LJ5 A;  2PPH A;  2VZK D;  4IM2 A;  4B9K A;  1E7V A;  4II3 B;  4URK A;  3U52 E;  3DVN U;  3VRB B;  2MBQ A;  1GG3 A;  5LLI A;  1GB4 A;  4HDO A;  2OJR A;  1VZ6 A;  3NS8 A;  1UZX B;  2LGS A;  5HI1 A;  4OHJ A;  2DAJ A;  2ZNV C;  3P4P B;  4CYE A;  3T9L A;  2MBH A;  5H8Y E;  3C0R B;  2GMI C;  3ZJU A;  1Q5W B;  1MG4 A;  4RM9 A;  1WXV A;  1C4C A;  1QIL A;  2LEK A;  4C80 A;  1HXY D;  1L4D B;  1QOA A;  1IP9 A;  1SIF A;  3CST A;  1R4M I;  2RSU A;  4OVU A;  3ZGZ A;  4HJG E;  2PKO A;  3NRZ A;  2RGF A;  3PTF C;  5GMV A;  2V3P A;  5EDS A;  3VHT C;  3DVN V;  2WXJ A;  4IWO A;  2W3S A;  1V81 A;  4W9J A;  4GDK A;  2FCQ A;  3NHE B;  4ZRJ A;  3Q8E A;  2MP2 A;  2KJ6 A;  2JXT A;  3V05 A;  2BW2 A;  2WDV B;  1N63 A;  4XDD A;  2W54 A;  2GI9 A;  3BK2 A;  3PVL A;  1L7Y A;  4EFO A;  5LNK 1;  5C3J B;  3PLV A;  5BYQ A;  4OZC A;  2PLP A;  2N9P C;  1U4A A;  3EEC A;  4A8X C;  3W1Y A;  2PE6 B;  1J7C A;  1MPE A;  2L7R A;  3L16 A;  1RLF A;  4PS7 A;  3QQ8 B;  4XZ4 A;  4NJ6 A;  3Q3N C;  5DPS A;  1RAX A;  4CQN A;  1WRD B;  3R2I A;  4YSX B;  2LD9 A;  2XN9 C;  3QX1 A;  1NI3 A;  1P98 A;  2KN5 A;  3FIL A;  1WY8 A;  2IGD A;  1KLG D;  2WXK A;  3IVF A;  4ZYN A;  1HEZ E;  1P9D U;  1KM7 A;  4DXA B;  3WA0 A;  5E6P A;  1C78 A;  4K7U A;  4NJ7 A;  1CJE A;  1WX9 A;  4I6N B;  2K6D B;  5G5G A;  1XLO A;  2BYT A;  1K53 A;  3PPA A;  1JCK B;  1JWB D;  3MHZ A;  5CHV C;  4G0N B;  4XDC A;  4GLS C;  4DHJ D;  2M17 A;  2B76 B;  5G2N A;  4NY0 A;  5TSS A;  2DZJ A;  2NBV B;  5G55 A;  2KDI A;  1CQV A;  2Y3A A;  5BMG A;  4DWF A;  5BYS A;  1OEY A;  2MBB B;  4TV3 A;  1EU4 A;  3W1S A;  1Z2M A;  1ROE A;  4F8C B;  2R2O A;  5HKH A;  3TEY A;  2GRI A;  3UQA A;  1KLV A;  4L23 A;  5LXH A;  3NUH B;  2N9L A;  2LZ6 A; 
#chains in the Genus database with same CATH homology
 1RWS A;  2WXH A;  1SJH D;  3FC4 A;  4JPS A;  2LMC A;  2I38 A;  3NVZ A;  1I4Q A;  3P63 A;  2MEK A;  1TKY A;  3R8B A;  4YSZ B;  4US9 A;  2N7J A;  3BYY B;  4RGT A;  3U4E G;  1I4G A;  2KN4 A;  5EE9 A;  3AV8 A;  1Y56 A;  2JQR B;  1SXT A;  3HVZ A;  1LO5 D;  2G1E A;  2FBW B;  2V4I B;  3ZJT A;  1YN3 A;  4WIP A;  3MC0 B;  1ESF A;  2KDM A;  2LHD A;  3B2F A;  5EE1 A;  3IT4 B;  3CIR B;  1TKG A;  2AX5 A;  1SE4 A;  1B1Z A;  3E56 A;  3GS2 A;  1K52 A;  1YQ3 B;  2MJ3 A;  4AQ7 A;  1ZUD 2;  3ABV B;  5BMI A;  1QOG A;  2Z8L A;  1I7H A;  4N59 A;  4ZHO A;  4OZA A;  3FIL B;  3I9V 1;  1I4H A;  2PW9 A;  1C77 A;  4WH4 A;  4YTP B;  3GB1 A;  4J3O D;  1V1P A;  2QMT A;  2J42 A;  3LXF A;  1XEE A;  4O1N A;  4YXD B;  1E0Z A;  1IBX B;  4IDI A;  1ET9 A;  2OHF A;  3AEF B;  4XWW A;  1DOI A;  2WNM A;  5MPO A;  1DOY A;  3E9S A;  1JRP A;  3AH7 A;  4RF1 A;  4KX6 B;  1C4P A;  4HEA 1;  1NVI D;  1AN8 A;  2IJ0 A;  4REZ A;  4ITK A;  1ACC A;  1WXQ A;  1KF6 B;  1C4A A;  4OZB A;  1F0Z A;  2WXO A;  5EE3 A;  1L0X B;  1OFF A;  4XE0 A;  4ZRP A;  2WXF A;  4YTN B;  4Q2J A;  1M4V A;  4HRS A;  2AQ2 B;  4MM3 B;  2RPV A;  2D5G A;  1SE3 A;  2MJE A;  2WDR B;  3GP7 A;  3T3O A;  1AW7 A;  3HVD A;  1WYG A;  4RNA A;  1VJK A;  1YJI A;  3Q8F A;  1P7F A;  1BXT A;  1QOF A;  2Q5W D;  3SR6 A;  1FO4 A;  2TSS A;  1GPX A;  3AEA B;  1FCC C;  2KAC A;  1I4R A;  2L83 A;  2W82 A;  4WQM A;  3BII D;  4R3D A;  4MT5 A;  2LHE A;  3WCQ A;  1ZDV A;  2WXR A;  3J9C A;  3AE6 B;  3IT6 B;  1HA5 A;  4DQO C;  1D5Z C;  4A9A A;  1XCT L;  1OQQ A;  1STE A;  4DXF A;  1D4B A;  5C2T B;  1SSN A;  1C79 A;  1NEN B;  2LJI A;  1PYW D;  2J4X A;  4TMA B;  2K9X A;  1ZP0 B;  2PIA A;  2BS4 B;  2L32 A;  1AYF A;  2CJO A;  3BVM A;  1TS5 A;  1SB3 C;  2ICI A;  2KAJ A;  1JQ4 A;  1JWS D;  1FD6 A;  1FRR A;  1ENF A;  4FXC A;  5HHD G;  3P4Q B;  1GOZ A;  1FM0 D;  1JWU D;  2LUM A;  4HRO A;  1TZO A;  2IPK D;  1PGA A;  3PO0 A;  2E6X A;  1N5W A;  1E9M A;  3B9J A;  3NVY A;  1EWC A;  2M56 B;  2FUG 1;  1BML C;  2J53 A;  2SEB D;  1T3Q A;  4P16 A;  1RYJ A;  1F77 A;  3LB8 C;  1V1O A;  3TSS A;  4C7Z A;  3Q8B A;  1V8C A;  1YNT E;  2WDQ B;  2LGI A;  4ZYS A;  1E7P B;  1F2R C;  1TS2 A;  2L1A A;  4N58 A;  1FMA D;  3NS1 A;  2PVO D;  4US8 A;  1ZE3 D;  1MI0 A;  3AED B;  3BWU D;  1L4Z B;  2V3N A;  2N9K A;  1SE2 A;  1QF6 A;  2INP E;  2WLB A;  5AUI A;  4L2Y A;  2BT6 A;  5FKA C;  2BB5 A;  4WWM A;  1GB1 A;  3HRD D;  1PUT A;  2V0G A;  3AEG B;  3DWM A;  1ET6 A;  1XLP A;  2DWQ A;  2CU3 A;  1ZXI A;  1V97 A;  3AE7 B;  1XXG A;  2EEL A;  4WAF A;  2BB6 A;  4C7Y A;  1FXA A;  1L5P A;  1P7E A;  3SFE B;  3EA6 A;  4RGM A;  1R7S A;  2WXM A;  3ZJV A;  4HKQ A;  3IXS A;  2H89 B;  2K22 A;  2XNA C;  3VRA B;  4YSY B;  3VR9 B;  2YEP B;  5FR3 A;  1K50 A;  2M0A A;  4JWU C;  4L1B A;  5JXV A;  1N62 A;  1XCQ L;  2HDE A;  3EGR A;  3R2T A;  2M19 A;  4RH6 A;  1XO3 A;  5D3I B;  3UI3 A;  1SJE D;  2I2Y A;  2WXN A;  1YMH E;  2Y5P A;  3C8Y A;  3ETR A;  1JW9 D;  1NYQ A;  3LYY A;  3MJ5 A;  3TUO A;  3W9C B;  4B0M A;  4IKG A;  4YWG G;  1K51 A;  2QIE B;  3PZ8 A;  1YQ4 B;  4P6V F;  3P42 A;  3BVZ A;  1F2R I;  1L6U A;  4TQ0 A;  2RDH A;  4KGS A;  1B9R A;  3MP9 A;  1IUE A;  2NMQ A;  5E6J A;  2DYO A;  1IGD A;  4YTM B;  1QOB A;  1JWM D;  3Q8C A;  3AE2 B;  4YT0 B;  3ZYY X;  1KTK A;  2K3U A;  1FEH A;  2ZW1 A;  3TEW A;  3N9Y C;  3SFD B;  4LK0 M;  2PMV A;  1PGX A;  2PVG C;  4WUR A;  3BZD B;  1D5X C;  1KH0 A;  2N0S B;  1JML A;  2JU6 X;  5D3D A;  3NVW A;  3Q8A A;  1TS3 A;  3EUB 2;  2WS3 B;  1MHH E;  2DBY A;  4HKZ E;  1IGC A;  5GXG B;  1DGJ A;  3P4S B;  1ZXH A;  4OVZ A;  1PFD A;  4PT5 A;  2E3T A;  5T8I A;  1FFV A;  1Q10 A;  3SEB A;  1L6V A;  3VQI A;  1TKE A;  5G5H A;  4N6E B;  1PGB A;  3ZQ4 A;  5I4D A;  2J52 A;  1TY2 A;  2WXG A;  1MVK A;  2QJL A;  5HG2 A;  2MH7 A;  1ZDX A;  4JX1 C;  4DXG A;  1SBB B;  3B2G A;  5EE0 A;  2VZK D;  2QSD A;  2CJN A;  1FFU A;  3U52 E;  4RGO S;  3VRB B;  2BTE A;  4KGT A;  1FIQ A;  1GB4 A;  1DYQ A;  3FAH A;  2VZK B;  2IDY A;  1FCL A;  2RMM A;  4NJC A;  3AEE B;  1VZ6 A;  1V1P B;  4RF0 A;  5HFY A;  2WXI A;  4TQ1 A;  5AUK A;  5HI1 A;  1OQR A;  2EKI A;  4GDK B;  4OHJ A;  2AQ1 B;  3P4P B;  2IGG A;  3I57 A;  4M0W A;  5H8Y E;  3RPF C;  3OWE B;  4ZOH C;  4B0E A;  2QEJ C;  3ZJU A;  4RFB A;  4C80 A;  1A70 A;  1C4C A;  1QIL A;  2LEK A;  4LTU A;  1HXY D;  2YEP F;  1L4D B;  1QOA A;  2W3R A;  3P1M A;  1NEK B;  2NTT A;  2ONQ A;  1AWD A;  4EE2 A;  5D7G A;  1SEB D;  2WU2 B;  1FXI A;  3AEC B;  1VDV A;  3U7Z A;  2G9H D;  3ZGZ A;  2BS2 B;  4HJG E;  4C56 C;  2WXL A;  1N60 A;  3MFG A;  2PKO A;  4NZL B;  1BUI C;  3NRZ A;  4LLG M;  2R61 A;  1T5X D;  3W5V B;  3BYT B;  2V3P A;  2JSV X;  2FE8 A;  2X38 A;  2KWD A;  1TYG B;  2WXJ A;  2BS3 B;  2W3S A;  1FNV A;  3AE1 B;  3IAM 1;  2WQY B;  2WU5 B;  3AEB B;  4OW0 A;  1QT9 A;  2GB1 A;  1T6B X;  3RFZ B;  1UUP A;  1CK1 A;  1TJE A;  4MAC A;  4ZHP A;  3Q8E A;  3AE4 B;  3AB5 A;  1N61 A;  1UWM A;  1KFY B;  1TY0 A;  5H92 C;  4JE3 B;  2JXT A;  3V05 A;  2L52 A;  2BW2 A;  2WDV B;  1ZOY B;  4ARC A;  1XLQ A;  1N63 A;  4XDD A;  2MJD A;  2W54 A;  2GI9 A;  3BK2 A;  5LNK 1;  1EU3 A;  3AE5 B;  3VR8 B;  3KWV A;  4NAW B;  1FNW A;  5C3J B;  1JAL A;  1YN5 A;  4JWS C;  2PTL A;  2DYM A;  5BYQ A;  4OZC A;  3U2S C;  1QLB B;  2PLP A;  2IGH A;  4D2K A;  3Q69 A;  1EWY C;  1PDX A;  2SAK A;  1VZ7 A;  4A8X C;  2NTS A;  1J7C A;  3H8H A;  1MPE A;  3AE3 B;  3BVG A;  3TEX A;  2LFI A;  1GAQ B;  2ON8 A;  2W55 A;  4NAM A;  1WSP A;  3NVV A;  1XF5 L;  4KGR A;  1SIJ A;  3T3N A;  2KQ4 X;  2K5P A;  2JYE A;  2JYT A;  3P4R B;  4H2A A;  1E6E B;  4CQN A;  2KMM A;  3R2I A;  1VZ8 A;  1C9F A;  4YSX B;  1XLN A;  3V3X A;  3PZ7 A;  1IBX A;  2XN9 C;  4RCO A;  4TSS A;  1NI3 A;  3CWI A;  3AMZ A;  5FK9 C;  3FIL A;  2IGD A;  2WXK A;  1KLG D;  1JWA D;  2QIL A;  1HEZ E;  3TEZ A;  1FRD A;  1RFK A;  2INN E;  1YJJ A;  1C78 A;  1L0Y B;  3L4P A;  3O13 A;  3AN1 A;  2AQ3 B;  4USA A;  1CJE A;  1TS4 A;  2JWU A;  3HUI A;  2ZW0 A;  5BYR A;  1D6E C;  4XWT A;  5G5G A;  1WGK A;  3KQ4 A;  1XLO A;  3BK1 A;  4A55 A;  3IAS 1;  2K0P A;  2BYT A;  1J7A A;  1K53 A;  1JCK B;  1SF0 A;  1JWB D;  2Y5C A;  3AE9 B;  3DWG C;  3MHZ A;  1I4X A;  4XDC A;  2WXP A;  1ZPS A;  1EM7 A;  3NZ3 A;  1KLU D;  4GLS C;  2WXQ A;  1DOX A;  4MH8 A;  1RM6 C;  1UGJ A;  3KWL A;  2B76 B;  4IOI E;  2WP9 B;  4KKJ A;  5TSS A;  2DLB A;  4A6Q A;  1VRA B;  3URY A;  2OED A;  1JRO A;  3AM9 A;  1KRH A;  1CQV A;  2Y3A A;  5BMG A;  5BYS A;  1CZP A;  4AS1 A;  1WRI A;  4A90 A;  3AE8 B;  1C76 A;  1HZ5 A;  1UWX A;  2BBC A;  1HZ6 A;  4ZRQ A;  1EU4 A;  4KKI A;  4GDL B;  1FNU A;  1YN4 A;  1L0V B;  2ACZ B;  3W1S A;  1J7B A;  1ROE A;  1QQR A;  1I4P A;  1E10 A;  1UNS A;  3TEY A;  2JZP A;  1MHX A;  1VLB A;  2GRI A;  2HTM E;  2JX5 A;  1QKZ A;  4L23 A;  5BMH A;  1NYR A;  1D5M C;  1N5X A;  3W5U B;  3NUH B;  3W2D A;  1WWT A;  2N9L A;  1VR9 A;  2H88 B;  2RDG A;  4ARI A;  3KLS X;  4UDU C;  4RGN A;  1HQR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...