3TUOA

Crystal structure of n-terminal domain of dna-binding protein satb1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'PGSGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein SATB1
publication title The structural basis for the oligomerization of the N-terminal domain of SATB1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3tuoA00
3TUOA 4Q2JA
chains in the Genus database with same CATH superfamily
1SSNA 1IYFA 1SB3C 1MVKA 4NAWB 2GI9A 4A3OA 2L0FA 2KX3A 5EE1A 3DCGA 3VR9B 4HCPB 3NVWA 1IBXB 1FPYA 3QAQA 5MPOA 2LEKA 2A5UA 4MGIE 4A20A 4II3B 4NJ6A 1PUTA 3MTNB 5I4DA 1L6VA 2DX5B 3LDZE 4IM0A 2KZRA 4S0RA 1VJKA 2W3SA 1I4RA 3L13A 4FJVB 2MP2B 4HJKA 3EHVA 2QJLA 4W9EA 1QT9A 3H8HA 1PGBA 1YJ1A 1M4VA 5FR3A 2GBRA 1EWYC 1R7SA 4N58A 4P16A 2RSUA 3IAM1 4KVGB 4MELA 4M02A 5CHVC 2M0AA 1QOBA 5FK9C 3U7ZA 4TQ0A 2LJIA 2JT4B 4F8CB 4ASWC 1RFAA 1D6EC 2I38A 4R3DA 3UGBB 3ZDMC 3DBHB 1WGKA 3MP9A 3R8BA 4FA6A 2QDFA 2LJ5A 2FCSA 1SJED 4IWOA 1WH3A 4JIOU 1L0YB 1WJ4A 2LRUA 2DYOA 4OW0A 2Z0EB 2FCNA 3VHTC 5IOIA 1UGMA 2YEPF 2QHOA 4K3CA 2DHZA 1TBEA 2LGYA 3DHGC 1FD6A 1KFYB 2C60A 1FM0D 4HEA1 4P1BC 2WLBA 2KDMA 1JMLA 3KUZA 2WXIA 3R2IA 4XYCA 2QILA 2RDGA 2KLGA 4YWGG 1XCTL 1KF6B 2V3NA 2WP9B 4WJOA 5IN7A 3W5VB 4HDOA 5HHDG 4AQ7A 1YN3A 1I7HA 1K52A 4JQWC 3H1UA 3TJPA 3ZIMA 4L23A 4E3CA 4K7UA 3JYUA 3PTFC 3VH3B 3ZQ4A 3T3OA 3B08A 3VQIA 3UIPB 4LJPB 4JLCA 1E5WA 2HE7A 1UF0A 4DHJB 1UBIA 1RLFA 4YTPB 4ICUA 2UYZB 5BMHA 2J42A 1YMHE 3DBLI 3L54A 2ONQA 2L76A 3NS8A 3L10B 2KDFB 4RFBA 3P42A 1E7VA 5E6NA 2JX5A 1ZPSA 3TEXA 2HDEA 3A9KB 3VUYA 4XE0A 2BQQA 2KJRA 1D5XC 2JZPA 4XWWA 2X8XX 1SXTA 2A4ZA 2LXAA 2NTSA 4TKNA 2JYTA 1L0VB 2N9EB 2X38A 2PPHA 1YX6B 2Q5WD 4AS1A 4IDIA 3A1QB 3DVNV 3WA0A 5CX3A 1WJUA 1AN8A 1SIFA 1FEHA 5BYRA 3H7SA 4KV2A 3PZ7A 1V1PA 3NUHB 5DPRA 3RUIB 1JWAD 3V3XA 2CS4A 3DBRB 3Q8BA 1TKEA 2DENB 4NZLB 2LVQA 2YLMA 1KLGD 4MM3B 5DCNA 5LXIB 4N6EB 4ACFA 3IHPC 2ICIA 3A4RA 2REXA 1WSPA 3A4SC 5AEKB 1ESFA 3QQ8B 3WAMA 2KWVB 1D3ZA 3I9V1 3SR6A 2KANA 4JPSA 2V1YA 2W82A 5BYQA 3T3NA 1UD7A 3L16A 3APDA 2JRHA 1L7YA 3P1MA 3MC8A 4GGQA 4NAMA 2JXTA 2AEHA 2LGXA 3CSTA 2LFIA 3T8MA 2WXNA 4LNOA 2DBYA 3VRAB 2IO2B 2W3RA 4B9KA 4JX1C 1UBQA 2BTEA 1Q10A 3AE6B 5BYSA 3ZTDA 3BIID 2ZCBA 4FJZA 5J18A 3L0WB 1XLQA 3KW5B 4AWJA 3RT3B 2EELA 3R3MA 3TIXA 1OEYJ 3GP7A 2D2QA 4L2YA 1HQRD 2Y5CA 3AEEB 3RNFC 1HZ5A 4M0WB 2M56B 4Q2JA 4C7YA 4KZ0A 4OVZA 5DPSA 3U2SC 2JZ3B 3L08A 4EUTA 2I2YA 2FCQA 2MJEA 1FFVA 1WXQA 4KKIA 2IJ0A 2CHWA 5D6JB 1OQRA 3DOWA 4KSLC 4PK1A 1V81A 3QX1A 1WGHA 4J6IA 1P3QU 4GIVA 3HK0A 2RDHA 3VAWA 4K81A 1WRDB 2INPE 2NCNA 2NS5A 4KX6B 4MT5A 2VH2A 2WXGA 1PFDA 3OWEB 1XLOA 4W9KA 1XO3A 4ZRPA 3RN9C 4WH4A 5DPTA 5C23A 2O6VD 2PVGC 2BS4B 3PHXB 3ZNZB 4E74A 2PW9A 4MJSB 3PLUA 2M0XA 3ZW3A 5G55A 3WANA 4RMAA 5KHQA 1WYWB 2ZNVB 1MG4A 2CU3A 2BF8B 1V80A 5EE0A 2JF5A 3GS2A 3H6NA 4WAFA 1TZ1A 4DWFA 3TSSA 3CSFA 1H4RA 1JWBD 4XX5A 3N1YC 5IO9A 2RPQA 3RNBC 1E8XA 4TQ1A 3I5JC 1MFWA 1WRIA 4EOYA 4FXCA 3AEAB 4MGZE 3TBLD 1WE6A 2KDEB 3RD2A 1V9JA 1IPGA 4PT5A 4BZAA 2MRPA 3R2TA 3ZTCA 4AJWA 3X23A 4FULA 3ZNID 4DBGA 1Z2MA 3I63C 3ZDTA 4GSWA 2VZKD 1DYQA 1M94A 1S1QB 3EA6A 1V2YA 1UZXB 3U7DA 3QJZA 1TKYA 4XDDA 3AE9B 2WQYB 2MQJA 3AE2B 2LUEA 1HE8A 1N63A 1XLPA 1GB1A 2RR9A 2LD9A 2K1FA 2M19A 2M4NA 2ZJDA 1OEYA 4TSSA 1NENB 4ZRIA 4FADA 4GOCA 2LMCA 1L2NA 2J4XA 3ML8A 4IC7B 4LNNA 2GBMA 2N4FA 2NBVB 1TYGB 4N9F4 2MBEA 3P4SB 1V1OA 2V3PA 2TSSA 3PRMB 1FXAA 4LNFA 2GB1A 3DBHI 2WDTB 3EUB2 1OQYA 3W2DA 1VRAB 2PE9A 1WM3A 2KVZA 2L83A 4GLSC 3IG3A 1K51A 4XDCA 1WWTA 2Y5PA 3P2BA 2L00B 5D3IB 3V61A 1YN4A 3W1YA 2D3BA 2OJRA 3HM6X 1FNUA 3AI5A 3PZDA 3AE4B 2W55A 4GDKA 2K8CA 4KGRA 2C7HA 4GDLA 2ZVOA 3URYA 1TKGA 4AP4C 4I6PA 3LB8C 5G2NA 4BFRA 1ISNA 4RCOA 1WYGA 3AEDB 1LXDA 2BS2B 1A5RA 1ZGUB 4WWNA 1I4XA 4W9HA 1NI2A 2NTTA 1DOIA 1VDVA 3SDLC 1E8WA 2SEBD 4LJOB 1P98A 2AX5A 1YN5A 2XEWA 1RFKA 3V62A 3RNCC 2ZNVC 4MSMB 4FN2A 1I4GA 2KJ6A 2HJ8A 4OHJA 3KWVA 3BVGA 4DXGA 1ENFA 1VZ8A 5JHBA 1HTOA 1RAXA 2WWZA 2DZJA 2BYFA 3BZDB 3CF6E 1TJEA 4S17A 3AE1B 4W9IA 5AUIA 4G11A 3IAS1 4BAXA 2RMMA 1V97A 3RPFC 4JWUC 3K9PB 3ZUNA 3V6EB 3NVYA 3PGEA 3RI7C 4ARCA 3TEWA 2I1KA 2V9HA 1SGHA 3V60A 1F77A 1N5XA 4WJQA 1BUIC 3IFWB 2MJDA 1L4DB 4DDGD 2KFKA 3QA8A 1GC7A 3O65B 2M8SA 3AECB 3KUCB 1QZEA 3PO0A 3U4EG 1ZDVA 3WIMA 4X57B 2QIEB 1EWCA 4IKGA 2ZPYA 1EU3A 1ZE3D 1C4CA 4UDUC 3ZXRA 1FMAD 1J7BA 2GBNA 1RRBA 3GZNB 4FHJA 1T3QA 2FIFA 2N1WA 4O1NA 2KC1A 4ZOHC 3BK2A 3IXSA 4DDID 3DBRI 2ZZPB 3RNEC 4A55A 1CQVA 1RM6C 3A33B 2V0GA 4A6QA 2BB6A 1SE9A 1GNUA 1V1PB 2IO0B 3BK1A 4GMVA 2LGSA 3ZYYX 3MFGA 2Z0DB 3VDZA 5AZGA 3Q8FA 4M8NA 2LI5A 4YL8A 4EZJA 3Q3JA 3IT4B 2FNJB 2KHWB 2CU1A 4ZRJA 1CMXB 1WZ3A 1GOZA 2MEKA 3R66C 4US8A 1OFFA 1XLNA 2V3SA 3FILA 3HUIA 1RYJA 3ZJTA 1J0GA 2MX2A 1YIWA 2GOWA 2N7JA 3DWGC 3RNGC 2LUMA 2LRWA 1ZDXA 2LWPA 4NNJB 5AZFA 4HKZE 4RF1A 2WXPA 3SEBA 3ZJVA 2N9PC 1WJNA 2ZW0A 2FCMA 4KGTA 3S2AA 2CHXA 1C4PA 1KRHA 3HIZA 2N9XA 1GPXA 3IBEA 3NZSA 2QEJC 1AARA 1K50A 4CO7A 1FO4A 3K9OB 1FCCC 4RF0A 1X1MA 3VTVA 2RD0A 4KZCA 4M01A 1C77A 3PV1A 5KHOA 2FIDA 4F1SA 4KGSA 4II2B 5EE9A 1WX8A 1WZ0A 1TS3A 2KD0A 3QCAA 1E7UA 3AE5B 2PTLA 1XQQA 4CQNA 4WJNA 3RNAC 3NY5A 1WXAA 4RGNA 1KLVA 5D7GA 2HTHA 2LASA 1ET9A 3AE7B 1MHXA 2QC8A 1YX5B 2L32A 2KX0A 2ASQA 3OJ3A 3B0AA 2Z8LA 2KTRA 1ZOYB 3JW0X 2WX1A 1FCLA 1UH6A 2BT6A 4IOIE 3C0RB 4HPPA 2KYWA 4DHZB 2JQRB 4BOZB 5C2TB 5J17A 1NYRA 5JHAA 1GAQB 3DVNU 1LGRA 2QCZA 3PSEB 1TY2A 2WX0A 2O2VA 1I4PA 3PPAA 4K3BA 4REZA 2FUG1 1GG3A 4OZCA 2EMTA 1PGAA 1WX7A 1WF9A 3PZ8A 3TL5A 2J52A 3SFEB 3RULA 2PEAA 2NPTA 3BWUD 1NDDA 2MCNB 2WS3B 2K5PA 2INDC 3BY4B 5CHFA 3DVGY 2AQ3B 3AXCA 3QIJA 3N1XC 4MSQB 5JH5C 4US9A 4JL9A 1J8CA 4WURA 1YJJA 2MLBA 3OLMD 2H89B 2WXOA 5LXHA 4YSYB 1QF6A 3H7PA 2WDRB 1P9DU 2DYBA 4YXDB 2NBUA 3PREA 1KH0A 4C80A 2KMCA 4IM3A 2JUOA 2Y5BB 2WXKA 3D32A 1UWMA 1QQRA 1Y56A 5H8YE 5HFYA 3KH0A 2BYEA 1IGCA 1WXSA 3NVVA 5LNK1 4YTMB 4OZAA 1KLUD 3KUDB 2MHJA 4B0EA 1VLBA 5TR5A 1E8ZA 2MBBB 4ITKA 2PE6B 4WWOA 2J7QB 4ANWA 2E6XA 3E9SA 1B1ZA 3JSVA 2BB5A 1E9MA 2K0PA 3P4QB 4GU2A 3QK0A 2BKRB 2IPKD 5IP4D 2PJHA 1FXIA 2AYOB 1WMHA 5D94A 4ZDVA 3ZNGC 2N1VA 1WR6E 4WQMA 4RH6A 1FRRA 1EF5A 3DHIC 5C1ZA 1FNWA 3AM9A 1PGXA 2NMQA 2KQSA 2JY6A 1PDXA 1IUEA 5HG2A 1C9FA 2PVOD 2MJ3A 2O6VA 1C78A 1STEA 1IGDA 1K8RB 4KDLB 5GXGB 3TMPB 3NG0A 3AEGB 5EDSA 3KVFB 4BKGA 4GDKB 1NVID 2K8HA 3DHHC 3EECA 2N0SB 4GDLB 3BVMA 2FBWB 2VH1A 2K39A 1TGZB 1JWUD 1QOFA 2B76B 4M00A 1WGDA 4W9GA 1S3SG 3CMMB 3NS1A 3W1SC 2M17A 1ROEA 1T0YA 4P7IA 2EKIA 2MWSB 3Q3MC 4IM2A 2V4LA 2C7NB 1T0QC 1F52A 2IZVB 5E6PA 2PLPA 1OTRB 1F2RI 3PRZA 2EMSA 1VR9A 2AL6A 4FJYA 1NBFC 4DQOC 4AJYB 1VZ7A 4I6LB 4ANVA 3ECIA 3KWLA 2KAJA 4LLGM 2BBCA 4AUQC 1V86A 1U4AA 2LXCA 3I57A 1LFDA 5HKHA 1SE3A 1MG8A 5GMVA 5L83A 1WGYA 4G3XB 1A70A 2C5LC 2J0JA 4WJPA 1SEBD 1I35A 2KLCA 2KDBA 4G50A 4I6NB 4P1CC 2IO1B 4URKA 2LVOA 4C4VA 4GN1A 2CHZA 2NBWB 2JXXA 1ACCA 3ZRFA 2N9LA 1WXVA 3FKYA 2IO3B 2PIAA 3M95A 3NHEB 2CKHB 3ZNHB 2DAJA 1ZXHA 1WY8A 2KFKB 2K6DB 4OVVA 3RMKC 1EO6A 1RWSA 1TY0A 3N9YC 2ON8A 1VCBA 3GZNI 4IWPA 4ICVA 3R7QA 4MACA 3WALA 2KN5A 4LCDE 3AN1A 4EZKA 4IUMB 5LLIA 1YOVB 2G45B 3M3JA 2SAKA 4TV3A 4LK0M 2ZEQA 3RZWC 2L7RA 3AE3B 3NRZA 4H2AA 3BYYB 4QAYA 1HXYD 2GMIC 2GBKA 3Q8EA 5T8IA 2D3AA 1MHHE 4IW0A 3ONSA 2KWDA 4MGYE 4EKUA 4P6VF 2FAZA 2OEDA 1B9RA 3UIOB 3NZ3A 1R4MB 3TCAA 2WNMA 3SHQA 5AUKA 4F7ZA 2JPHA 4HWIB 1DGJA 4K7WA 2XK5A 4YSZB 3DVGX 2C9WB 4KIKA 1ZXIA 1CZPA 2RGFA 3IVFA 2OOBB 2B3AA 1V5TA 1UNSA 3EC8A 5BO4B 4HXDA 2BWFA 1F1HA 3LJ3A 3TEYA 1JWSD 3FILB 4C00A 3PRPB 3SU8X 3E56A 1ZW7A 3UQAA 4LNIA 3PS6A 3B2FA 4CHKA 5DPWA 3AU5A 3QC8B 3ETRA 2Y3AA 1YQBA 3OG5A 1OGWA 3ZGZA 3U8ZA 4AOFA 3ZXVA 1T5XD 1UGJA 1FIQA 1GB4A 1QILA 2BWES 2KO3A 3PVLA 2K9XA 1WE7A 1XD3B 4K7SA 2CR5A 3HM3A 4LDTD 2LVPA 3AULA 3P4PB 3VTUA 5H92C 2DZIA 5AZHA 1J19A 5G5GA 1FNVA 4NJ7A 2WDVB 2KT7A 2LHEA 3UQBA 2BYVE 1SBBB 4YSXB 1BMLC 2N7DA 3NJTA 3X0WA 4WAAA 2L0TA 2NVUI 4E71A 3LYYA 4PS3A 2Z59B 1YQ3B 2KVRA 4FHKA 3Q8CA 2JVCA 2GLSA 5L95C 2AL3A 2KTRB 3AU4A 4OZBA 3GE3C 2MA9B 2PMVA 4RGMA 1P7FA 1EUVB 5FR6A 4ANXA 2WHIA 3VUWA 1AW7A 1UUPA 2YVCA 2O2VB 4ZYSA 1KOTA 1SE4A 1C4AA 1C3TA 2DWQA 2IGHA 1E8YA 4RGTA 1XXGA 2AWTA 3N20C 3VTWA 3NOBA 1BT0A 4HDQA 1BXTA 3HHMA 3NZUA 1XCQL 2CJOA 1AYFA 1OQQA 2KNBA 2KC2A 1GC6A 3APCA 4EEWA 2BPSA 2NPTB 1P1AA 2K3UA 1FFUA 1AWDA 1R4NB 2C7MB 2DYMA 1YD8U 5IKCM 2KTFA 4NY0A 2WU2B 3C19A 1MPEA 2M1MA 4HROA 4BVUC 1KTKA 1N60A 3KYDD 2K22A 1N61A 3VH4B 5D3DA 2LHDA 2L8JA 4WQOB 5HI1A 3J9CA 1N6ZA 2RDBC 3ZO5B 4BKSA 4PS8A 1HTQA 4EE2A 1JCKB 3H7PB 3AEBB 4IWQA 2BYTA 3VR8B 4MDKE 2JWZA 4BKSD 4FBJB 2IY0B 1CJEA 3N32A 4A8XC 3AE8B 3A9JA 3AB5A 4B0MA 2HJ1A 3MJWA 1F2RC 4HLEA 2RPVA 4L1BA 2XBBC 3N1ZC 3Q8AA 4G0NB 1TS5A 1V8CA 4DHZE 4ARIA 2GBJA 1HEZE 5J2RA 3PHWB 4A90A 3L4PA 3MHSD 4RGOS 1V5OA 3BINA 1WIAA 5CHWA 2WGSA 2AQ1B 4YTNB 3ZLZA 3JSVB 4MEMA 2K25A 3ZKJC 1Y8RC 1J7AA 3RFZB 4LTUA 2G9HD 1D5ZC 1WI0A 3R7RA 2E3TA 2LGDA 4KDIC 3T9LA 3OJ4B 4NAWA 1WMHB 2D10A 2IBIB 3P4RB 1WXMA 3JVZX 3GE8C 2R61A 4OVUA 4LNKA 1IBXA 2J0KA 1ET6A 2LZ6A 2JU6X 3V6CB 4RNAA 2O6VB 4W9FA 1J7CA 4KSKC 1JRPA 3APFA 3Q2AC 2K6QA 4PS7A 3VXWA 3CWIA 3Q69A 2OHFA 2MP2A 1SF0A 1L6UA 2IDYA 2MW5A 3ENEA 1GUAB 1NYQA 4JE3B 2UWQA 1TT5B 4ZRQA 4ZYNA 3FAHA 4RM8A 2OJWA 2HD5B 2IY1B 1WX9A 4WWMA 1E6EB 2KJHB 2I1JA 2G3QB 3HRDD 2KK8A 3Q14C 1F0ZA 3ZVVA 4KKJA 2NR2A 2V4IB 2MBOA 1HA5A 1I42A 4WIPA 4TUUA 4NQKE 2KQ4X 4GB9A 2WXRA 2BVCA 2G4DB 1D5MC 2KQ7A 2JRIB 3ZJUA 4J3OD 3M62B 4RM9A 3VRBB 4EZLA 1Q0WB 4HPLB 1Q1OA 1GJZA 2VZKB 3W9CB 4C4VB 2JWUA 2DZKA 3KYCD 3IT6B 3U52E 1KM7A 1WR1A 1DOXA 3M63B 5G5HA 4YT0B 4B6WA 3DWMA 3GB1A 4BBNF 2H88B 4W9LA 1KJTA 3AEFB 2KXJA 2MSED 1E90A 1PQSA 2LGIA 3Q6BA 3B9JA 2ZPNA 4NJCA 1E0ZA 1C79A 3PLVA 4HK2A 3QARA 3BYTB 1WM2A 2WXQA 2N9KA 4BBNC 3W5UB 2KN4A 3UINB 1R4MI 3ABVB 1HZ6A 3RZFA 3WAOA 1EU4A 1UELA 1C76A 4DHJD 2KMAA 2INNE 1T0SC 2D3CA 2WXMA 3OAWA 3RYTA 3A9KA 1PYWD 3WCQA 1I4QA 2BW2A 1P7EA 3DDCB 2PKOA 5TSSA 3DBLB 1QOGA 1L0XB 2XN9C 3DQVA 2KDIA 2KFJA 4M8MA 3VFKA 3KQ4A 4DXFA 1G6JA 4XC2A 1JW9D 1SE2A 3H9DA 4NPNA 1DOYA 4WWPA 2G4SA 5BMGA 2DZMA 2XK5B 2KACA 1EF1A 2HTME 3A1QA 2W9NA 4KIKB 3O13A 3UI3A 4BOSC 4MH0E 1CK1A 1TIFA 1V6EA 1H8CA 4BKTA 1E10A 3ALBA 3P63A 3TUOA 1NEKB 3W1SA 4PYZA 2WXFA 5FKAC 1N62A 2ZCCA 3C8YA 2WXLA 4HCNB 5EE3A 3N3KB 3GOEA 3QHTA 4TMAB 2R2OA 1EM7A 3MHZA 1QKZA 1YQ4B 1WFYA 4MM3A 1K53A 2ZW1A 5IA7A 1XF5L 2J53A 1QLBB 1QOAA 3EGRA 1XEEA 5JZEB 4LDTB 4MH8A 3QWZB 4HRSA 3MC0B 3Q3FA 4DXAB 4HPMB 4GXBA 1JALA 4XWTA 4DK5A 3WAPA 1IP9A 4C7ZA 4JWSC 4W9JA 4ZHOA 3TEZA 3AMZA 2W54A 3N30A 1VZ6A 2KOXA 2AQ2B 3B1LX 2WYQA 1UWXA 1NI3A 2DAFA 3DPDA 3RCZA 2D5GA 5IAAC 3AV8A 4IG7B 3ZRCA 1JWMD 2KWUB 2WDQB 2J0MA 3BVZA 1N5WA 2BGFA 2WXHA 2BKFA 4A9AA 3SFDB 5CTRC 2JYEA 1L5PA 1MI0A 2JZZA 4HKQA 1ZUD2 1TZOA 2IYDB 1TS2A 2QMTA 1VD2A 2INCC 5E6OA 4ZRKA 5C3JB 1SJHD 3EFCA 1T0RC 4M0WA 1JQ4A 1LQBA 1T6BX 4A3PA 2EKEC 4EFOA 2XNAC 1E7PB 3VUXA 1TS4A 5E6JA 5BMIA 4JGHB 2R2QA 2ACZB 2WU5B 4HJGE 4W9CA 2KWCA 2MBQA 2D3GA 2CJNA 4XGAB 3B2GA 2FE8A 2KKCA 5JXVA 2D07B 4ZHPA 1R4NI 1WGRA 1XT9B 3FC4A 3KLSX 1L4ZB 4W9DA 1I4HA 5D2MB 4ANUA 3PT2B 2L1AA 3SD5A 2ZVNA 3CIRB 2IGGA 4B95A 2QSDA 1YJIA 2L05A 2KMMA 3UF8A 3HVZA 3Q3OC 1Q5WB 4XZ4A 4NQLB 1MJDA 2K8BA 3MJ5A 3Q3NC 1C1YB 1ZKHA 2L52A 2G1EA 2GRIA 1FXTB 1LM8B 4MJSA 2MH7A 1JROA 1SIJA 1JRUA 2DLBA 3AH7A 2L3ZA 1YNTE 2N7EA 1V49A 4N59A 1P0RA 2WXJA 1F9JA 1FRDA 1TTNA 1WGGA 3NVZA 3A9JB 3V05A 1Z5SB 2VRRB 4HVBA 1ZP0B 3LXFA 4USAA 3MC9A 2YEPB 4C56C 2DNFA 3U30A 4K1RB 1LO5D 4CYEA 1D4BA 2UU7A 3HVDA 4D2KA 4MGKE 4FLHA 4PYUA 3VVWB 3EFUA 3ML9A 2IGDA 3I3TB 3DBSA 2BS3B 2MBHA 2JSVX 3L17A 2D11A 2FUHB 1WJ6A
chains in the Genus database with same CATH topology
1SSNA 2E6XA 1J7AA 3RFZB 1TKYA 4LTUA 4XDDA 3E9SA 3AE9B 2WQYB 2G9HD 1D5ZC 3AE2B 1B1ZA 1N63A 1SB3C 1XLPA 1MVKA 2BB5A 2GI9A 4NAWB 1GB1A 1E9MA 2E3TA 2K0PA 2M19A 3P4QB 5EE1A 4TSSA 1NENB 3VR9B 3NVWA 1IBXB 2LMCA 3P4RB 2IPKD 2LEKA 5MPOA 1FXIA 2R61A 2J4XA 1PUTA 5I4DA 1IBXA 1ET6A 1L6VA 4WQMA 2JU6X 1TYGB 4RH6A 4RNAA 1FRRA 3P4SB 1V1OA 1FNWA 2V3PA 3AM9A 1PGXA 1VJKA 2NMQA 2TSSA 2W3SA 1FXAA 1PDXA 2GB1A 1IUEA 5HG2A 1C9FA 1I4RA 1J7CA 2MJ3A 2PVOD 3EUB2 3W2DA 1VRAB 1C78A 1JRPA 2L83A 4GLSC 1STEA 1IGDA 5GXGB 4XDCA 1K51A 1WWTA 2QJLA 2Y5PA 3AEGB 1QT9A 3H8HA 1PGBA 1M4VA 5D3IB 3CWIA 3Q69A 4GDKB 5FR3A 1NVID 1YN4A 2OHFA 1SF0A 1L6UA 1EWYC 1R7SA 2N0SB 4GDLB 4N58A 1FNUA 4P16A 2IDYA 3BVMA 3IAM1 2FBWB 5FK9C 4TQ0A 2M0AA 1QOBA 3AE4B 1NYQA 2W55A 4JE3B 3U7ZA 2LJIA 4KGRA 1JWUD 4ZRQA 1QOFA 3FAHA 2B76B 3URYA 1D6EC 1TKGA 2I38A 4R3DA 4WWMA 3LB8C 1E6EB 1WGKA 3NS1A 3MP9A 3R8BA 4RCOA 3HRDD 1WYGA 1ROEA 3AEDB 1SJED 2BS2B 1F0ZA 2EKIA 4KKJA 1L0YB 2V4IB 1HA5A 1I4XA 2PLPA 4WIPA 1F2RI 2DYOA 2NTTA 4OW0A 1DOIA 1VR9A 1VDVA 2KQ4X 2WXRA 4DQOC 1VZ7A 2YEPF 2SEBD 1D5MC 3ZJUA 4J3OD 2AX5A 1YN5A 1KFYB 1FD6A 1RFKA 3KWLA 1FM0D 2KAJA 4LLGM 4HEA1 2WLBA 2BBCA 2KDMA 1JMLA 3VRBB 1I4GA 2WXIA 3R2IA 3I57A 1SE3A 2QILA 2VZKB 4OHJA 2RDGA 3BVGA 3KWVA 4DXGA 1A70A 1ENFA 4YWGG 1VZ8A 3W9CB 1XCTL 1KF6B 1SEBD 2JWUA 2V3NA 2WP9B 3IT6B 3U52E 1DOXA 5G5HA 3W5VB 3BZDB 4YT0B 1TJEA 5HHDG 3AE1B 4AQ7A 1YN3A 5AUIA 1I7HA 1K52A 3IAS1 1ACCA 3DWMA 3GB1A 2H88B 4L23A 2RMMA 1V97A 3RPFC 4JWUC 3AEFB 3ZQ4A 3T3OA 2N9LA 3VQIA 3NVYA 2PIAA 4ARCA 3TEWA 1ZXHA 2LGIA 3B9JA 1RWSA 1F77A 1N5XA 1BUIC 4NJCA 1C79A 4YTPB 1E0ZA 2MJDA 1TY0A 3N9YC 1L4DB 2ON8A 5BMHA 3BYTB 4MACA 2J42A 1YMHE 2WXQA 2ONQA 3AN1A 2N9KA 3AECB 2SAKA 3W5UB 2KN4A 3P42A 4LK0M 4RFBA 3ABVB 1HZ6A 2JX5A 1EU4A 1ZPSA 3TEXA 2HDEA 3AE3B 3NRZA 3PO0A 1C76A 3U4EG 1ZDVA 4H2AA 4XE0A 2INNE 3BYYB 1HXYD 1D5XC 2QIEB 3Q8EA 1EWCA 4IKGA 5T8IA 2WXMA 1EU3A 1ZE3D 1MHHE 1C4CA 1PYWD 2JZPA 4UDUC 1I4QA 2BW2A 3WCQA 4XWWA 1SXTA 1FMAD 1J7BA 2KWDA 1P7EA 2NTSA 2PKOA 4P6VF 5TSSA 1T3QA 4O1NA 1QOGA 2JYTA 1L0XB 2XN9C 2OEDA 4ZOHC 1B9RA 3BK2A 3IXSA 1L0VB 2X38A 3KQ4A 3NZ3A 4DXFA 1JW9D 4A55A 1SE2A 1CQVA 2Q5WD 4AS1A 4IDIA 1RM6C 2WNMA 1DOYA 2V0GA 5BMGA 4A6QA 5AUKA 1AN8A 2KACA 2BB6A 2HTME 1FEHA 5BYRA 1DGJA 3O13A 3UI3A 1V1PB 4YSZB 1CK1A 3BK1A 3PZ7A 1ZXIA 3ZYYX 3MFGA 1V1PA 1CZPA 3NUHB 1JWAD 3V3XA 3Q8FA 3Q8BA 1E10A 3P63A 1TKEA 3TUOA 1NEKB 1UNSA 3W1SA 3IT4B 2WXFA 5FKAC 1N62A 4NZLB 3C8YA 1GOZA 2WXLA 1KLGD 5EE3A 4MM3B 2MEKA 3TEYA 1JWSD 3FILB 4TMAB 3E56A 1EM7A 3MHZA 4US8A 1OFFA 4N6EB 1XLNA 1QKZA 1YQ4B 2ICIA 1WSPA 1K53A 2ZW1A 3B2FA 3FILA 3HUIA 1RYJA 1ESFA 3ZJTA 3ETRA 1XF5L 2J53A 2Y3AA 3I9V1 1QLBB 1QOAA 3SR6A 3EGRA 2N7JA 1XEEA 3DWGC 4JPSA 2LUMA 2W82A 1ZDXA 4MH8A 5BYQA 4HRSA 3T3NA 3ZGZA 3MC0B 4HKZE 4RF1A 2WXPA 3SEBA 1T5XD 1UGJA 1FIQA 3P1MA 3ZJVA 4NAMA 2JXTA 2ZW0A 1GB4A 2LFIA 1QILA 4KGTA 1JALA 4XWTA 2WXNA 4C7ZA 1C4PA 1KRHA 4JWSC 2DBYA 4ZHOA 1GPXA 2K9XA 3TEZA 3VRAB 2QEJC 1K50A 3AMZA 2W54A 1VZ6A 1FO4A 2W3RA 1FCCC 2AQ2B 4RF0A 4JX1C 3P4PB 1UWXA 2BTEA 1Q10A 3AE6B 5BYSA 1NI3A 5H92C 1C77A 5G5GA 1FNVA 3BIID 2D5GA 3AV8A 2WDVB 1XLQA 2LHEA 1JWMD 4KGSA 5EE9A 1SBBB 2WDQB 2EELA 4YSXB 1BMLC 1TS3A 3BVZA 1N5WA 3GP7A 2WXHA 4A9AA 3AE5B 3LYYA 4L2YA 2PTLA 3SFDB 1HQRD 4CQNA 2JYEA 1L5PA 1MI0A 1YQ3B 2Y5CA 4RGNA 4HKQA 1ZUD2 5D7GA 1TZOA 3AEEB 1ET9A 3Q8CA 3AE7B 1MHXA 1HZ5A 1TS2A 2M56B 2QMTA 4Q2JA 4C7YA 4OVZA 2L32A 3U2SC 5C3JB 1SJHD 4OZBA 2PMVA 2I2YA 4RGMA 1P7FA 4M0WA 1JQ4A 1T6BX 2MJEA 1FFVA 2Z8LA 1WXQA 2XNAC 1E7PB 4KKIA 1TS4A 5E6JA 5BMIA 2IJ0A 1ZOYB 1AW7A 1FCLA 2ACZB 1UUPA 1OQRA 2BT6A 4IOIE 2WU5B 4HJGE 4ZYSA 1SE4A 2JQRB 2CJNA 5C2TB 1C4AA 1NYRA 3B2GA 1GAQB 2FE8A 2RDHA 2DWQA 2IGHA 5JXVA 1TY2A 4RGTA 4ZHPA 1XXGA 2INPE 1I4PA 3FC4A 4KX6B 3KLSX 4MT5A 1L4ZB 2WXGA 1BXTA 1PFDA 3OWEB 4REZA 1I4HA 1XLOA 2FUG1 1XO3A 4ZRPA 2L1AA 4WH4A 1XCQL 4OZCA 2CJOA 1AYFA 3CIRB 2IGGA 1OQQA 1PGAA 2QSDA 1YJIA 2KMMA 2PVGC 3HVZA 2BS4B 3PZ8A 2PW9A 2J52A 2K3UA 3MJ5A 1FFUA 1AWDA 2DYMA 3SFEB 2L52A 2G1EA 2WU2B 2GRIA 1MPEA 4HROA 2MH7A 3BWUD 1KTKA 1N60A 1JROA 1SIJA 2K22A 1N61A 2DLBA 2WS3B 3AH7A 2K5PA 5D3DA 1YNTE 2LHDA 2CU3A 4N59A 5HI1A 3J9CA 2AQ3B 5EE0A 2WXJA 3GS2A 1FRDA 4US9A 4WAFA 3NVZA 1YJJA 4WURA 4EE2A 2H89B 1JCKB 3TSSA 2WXOA 3AEBB 1JWBD 2BYTA 3V05A 3VR8B 4YSYB 1QF6A 1ZP0B 3LXFA 4USAA 4A8XC 1CJEA 2YEPB 2WDRB 4TQ1A 4C56C 3AE8B 1WRIA 3AB5A 1LO5D 4B0MA 4YXDB 4FXCA 3AEAB 1D4BA 3HVDA 4D2KA 1F2RC 1KH0A 2RPVA 4L1BA 3Q8AA 4C80A 1TS5A 1V8CA 4PT5A 2WXKA 4ARIA 1UWMA 1QQRA 1Y56A 2IGDA 3R2TA 1HEZE 5H8YE 4A90A 3L4PA 5HFYA 4RGOS 1IGCA 2BS3B 3NVVA 5LNK1 2JSVX 4YTMB 4OZAA 1KLUD 2VZKD 1VLBA 4B0EA 1DYQA 4ITKA 2AQ1B 3EA6A 4YTNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUO A;  4Q2J A; 
#chains in the Genus database with same CATH topology
 1SSN A;  1IYF A;  1SB3 C;  1MVK A;  4NAW B;  2GI9 A;  4A3O A;  2L0F A;  2KX3 A;  5EE1 A;  3DCG A;  3VR9 B;  4HCP B;  3NVW A;  1IBX B;  1FPY A;  3QAQ A;  5MPO A;  2LEK A;  2A5U A;  4MGI E;  4A20 A;  4II3 B;  4NJ6 A;  1PUT A;  3MTN B;  5I4D A;  1L6V A;  2DX5 B;  3LDZ E;  4IM0 A;  2KZR A;  4S0R A;  1VJK A;  2W3S A;  1I4R A;  3L13 A;  4FJV B;  2MP2 B;  4HJK A;  3EHV A;  2QJL A;  4W9E A;  1QT9 A;  3H8H A;  1PGB A;  1YJ1 A;  1M4V A;  5FR3 A;  2GBR A;  1EWY C;  1R7S A;  4N58 A;  4P16 A;  2RSU A;  3IAM 1;  4KVG B;  4MEL A;  4M02 A;  5CHV C;  2M0A A;  1QOB A;  5FK9 C;  3U7Z A;  4TQ0 A;  2LJI A;  2JT4 B;  4F8C B;  4ASW C;  1RFA A;  1D6E C;  2I38 A;  4R3D A;  3UGB B;  3ZDM C;  3DBH B;  1WGK A;  3MP9 A;  3R8B A;  4FA6 A;  2QDF A;  2LJ5 A;  2FCS A;  1SJE D;  4IWO A;  1WH3 A;  4JIO U;  1L0Y B;  1WJ4 A;  2LRU A;  2DYO A;  4OW0 A;  2Z0E B;  2FCN A;  3VHT C;  5IOI A;  1UGM A;  2YEP F;  2QHO A;  4K3C A;  2DHZ A;  1TBE A;  2LGY A;  3DHG C;  1FD6 A;  1KFY B;  2C60 A;  1FM0 D;  4HEA 1;  4P1B C;  2WLB A;  2KDM A;  1JML A;  3KUZ A;  2WXI A;  3R2I A;  4XYC A;  2QIL A;  2RDG A;  2KLG A;  4YWG G;  1XCT L;  1KF6 B;  2V3N A;  2WP9 B;  4WJO A;  5IN7 A;  3W5V B;  4HDO A;  5HHD G;  4AQ7 A;  1YN3 A;  1I7H A;  1K52 A;  4JQW C;  3H1U A;  3TJP A;  3ZIM A;  4L23 A;  4E3C A;  4K7U A;  3JYU A;  3PTF C;  3VH3 B;  3ZQ4 A;  3T3O A;  3B08 A;  3VQI A;  3UIP B;  4LJP B;  4JLC A;  1E5W A;  2HE7 A;  1UF0 A;  4DHJ B;  1UBI A;  1RLF A;  4YTP B;  4ICU A;  2UYZ B;  5BMH A;  2J42 A;  1YMH E;  3DBL I;  3L54 A;  2ONQ A;  2L76 A;  3NS8 A;  3L10 B;  2KDF B;  4RFB A;  3P42 A;  1E7V A;  5E6N A;  2JX5 A;  1ZPS A;  3TEX A;  2HDE A;  3A9K B;  3VUY A;  4XE0 A;  2BQQ A;  2KJR A;  1D5X C;  2JZP A;  4XWW A;  2X8X X;  1SXT A;  2A4Z A;  2LXA A;  2NTS A;  4TKN A;  2JYT A;  1L0V B;  2N9E B;  2X38 A;  2PPH A;  1YX6 B;  2Q5W D;  4AS1 A;  4IDI A;  3A1Q B;  3DVN V;  3WA0 A;  5CX3 A;  1WJU A;  1AN8 A;  1SIF A;  1FEH A;  5BYR A;  3H7S A;  4KV2 A;  3PZ7 A;  1V1P A;  3NUH B;  5DPR A;  3RUI B;  1JWA D;  3V3X A;  2CS4 A;  3DBR B;  3Q8B A;  1TKE A;  2DEN B;  4NZL B;  2LVQ A;  2YLM A;  1KLG D;  4MM3 B;  5DCN A;  5LXI B;  4N6E B;  4ACF A;  3IHP C;  2ICI A;  3A4R A;  2REX A;  1WSP A;  3A4S C;  5AEK B;  1ESF A;  3QQ8 B;  3WAM A;  2KWV B;  1D3Z A;  3I9V 1;  3SR6 A;  2KAN A;  4JPS A;  2V1Y A;  2W82 A;  5BYQ A;  3T3N A;  1UD7 A;  3L16 A;  3APD A;  2JRH A;  1L7Y A;  3P1M A;  3MC8 A;  4GGQ A;  4NAM A;  2JXT A;  2AEH A;  2LGX A;  3CST A;  2LFI A;  3T8M A;  2WXN A;  4LNO A;  2DBY A;  3VRA B;  2IO2 B;  2W3R A;  4B9K A;  4JX1 C;  1UBQ A;  2BTE A;  1Q10 A;  3AE6 B;  5BYS A;  3ZTD A;  3BII D;  2ZCB A;  4FJZ A;  5J18 A;  3L0W B;  1XLQ A;  3KW5 B;  4AWJ A;  3RT3 B;  2EEL A;  3R3M A;  3TIX A;  1OEY J;  3GP7 A;  2D2Q A;  4L2Y A;  1HQR D;  2Y5C A;  3AEE B;  3RNF C;  1HZ5 A;  4M0W B;  2M56 B;  4Q2J A;  4C7Y A;  4KZ0 A;  4OVZ A;  5DPS A;  3U2S C;  2JZ3 B;  3L08 A;  4EUT A;  2I2Y A;  2FCQ A;  2MJE A;  1FFV A;  1WXQ A;  4KKI A;  2IJ0 A;  2CHW A;  5D6J B;  1OQR A;  3DOW A;  4KSL C;  4PK1 A;  1V81 A;  3QX1 A;  1WGH A;  4J6I A;  1P3Q U;  4GIV A;  3HK0 A;  2RDH A;  3VAW A;  4K81 A;  1WRD B;  2INP E;  2NCN A;  2NS5 A;  4KX6 B;  4MT5 A;  2VH2 A;  2WXG A;  1PFD A;  3OWE B;  1XLO A;  4W9K A;  1XO3 A;  4ZRP A;  3RN9 C;  4WH4 A;  5DPT A;  5C23 A;  2O6V D;  2PVG C;  2BS4 B;  3PHX B;  3ZNZ B;  4E74 A;  2PW9 A;  4MJS B;  3PLU A;  2M0X A;  3ZW3 A;  5G55 A;  3WAN A;  4RMA A;  5KHQ A;  1WYW B;  2ZNV B;  1MG4 A;  2CU3 A;  2BF8 B;  1V80 A;  5EE0 A;  2JF5 A;  3GS2 A;  3H6N A;  4WAF A;  1TZ1 A;  4DWF A;  3TSS A;  3CSF A;  1H4R A;  1JWB D;  4XX5 A;  3N1Y C;  5IO9 A;  2RPQ A;  3RNB C;  1E8X A;  4TQ1 A;  3I5J C;  1MFW A;  1WRI A;  4EOY A;  4FXC A;  3AEA B;  4MGZ E;  3TBL D;  1WE6 A;  2KDE B;  3RD2 A;  1V9J A;  1IPG A;  4PT5 A;  4BZA A;  2MRP A;  3R2T A;  3ZTC A;  4AJW A;  3X23 A;  4FUL A;  3ZNI D;  4DBG A;  1Z2M A;  3I63 C;  3ZDT A;  4GSW A;  2VZK D;  1DYQ A;  1M94 A;  1S1Q B;  3EA6 A;  1V2Y A;  1UZX B;  3U7D A;  3QJZ A;  1TKY A;  4XDD A;  3AE9 B;  2WQY B;  2MQJ A;  3AE2 B;  2LUE A;  1HE8 A;  1N63 A;  1XLP A;  1GB1 A;  2RR9 A;  2LD9 A;  2K1F A;  2M19 A;  2M4N A;  2ZJD A;  1OEY A;  4TSS A;  1NEN B;  4ZRI A;  4FAD A;  4GOC A;  2LMC A;  1L2N A;  2J4X A;  3ML8 A;  4IC7 B;  4LNN A;  2GBM A;  2N4F A;  2NBV B;  1TYG B;  4N9F 4;  2MBE A;  3P4S B;  1V1O A;  2V3P A;  2TSS A;  3PRM B;  1FXA A;  4LNF A;  2GB1 A;  3DBH I;  2WDT B;  3EUB 2;  1OQY A;  3W2D A;  1VRA B;  2PE9 A;  1WM3 A;  2KVZ A;  2L83 A;  4GLS C;  3IG3 A;  1K51 A;  4XDC A;  1WWT A;  2Y5P A;  3P2B A;  2L00 B;  5D3I B;  3V61 A;  1YN4 A;  3W1Y A;  2D3B A;  2OJR A;  3HM6 X;  1FNU A;  3AI5 A;  3PZD A;  3AE4 B;  2W55 A;  4GDK A;  2K8C A;  4KGR A;  2C7H A;  4GDL A;  2ZVO A;  3URY A;  1TKG A;  4AP4 C;  4I6P A;  3LB8 C;  5G2N A;  4BFR A;  1ISN A;  4RCO A;  1WYG A;  3AED B;  1LXD A;  2BS2 B;  1A5R A;  1ZGU B;  4WWN A;  1I4X A;  4W9H A;  1NI2 A;  2NTT A;  1DOI A;  1VDV A;  3SDL C;  1E8W A;  2SEB D;  4LJO B;  1P98 A;  2AX5 A;  1YN5 A;  2XEW A;  1RFK A;  3V62 A;  3RNC C;  2ZNV C;  4MSM B;  4FN2 A;  1I4G A;  2KJ6 A;  2HJ8 A;  4OHJ A;  3KWV A;  3BVG A;  4DXG A;  1ENF A;  1VZ8 A;  5JHB A;  1HTO A;  1RAX A;  2WWZ A;  2DZJ A;  2BYF A;  3BZD B;  3CF6 E;  1TJE A;  4S17 A;  3AE1 B;  4W9I A;  5AUI A;  4G11 A;  3IAS 1;  4BAX A;  2RMM A;  1V97 A;  3RPF C;  4JWU C;  3K9P B;  3ZUN A;  3V6E B;  3NVY A;  3PGE A;  3RI7 C;  4ARC A;  3TEW A;  2I1K A;  2V9H A;  1SGH A;  3V60 A;  1F77 A;  1N5X A;  4WJQ A;  1BUI C;  3IFW B;  2MJD A;  1L4D B;  4DDG D;  2KFK A;  3QA8 A;  1GC7 A;  3O65 B;  2M8S A;  3AEC B;  3KUC B;  1QZE A;  3PO0 A;  3U4E G;  1ZDV A;  3WIM A;  4X57 B;  2QIE B;  1EWC A;  4IKG A;  2ZPY A;  1EU3 A;  1ZE3 D;  1C4C A;  4UDU C;  3ZXR A;  1FMA D;  1J7B A;  2GBN A;  1RRB A;  3GZN B;  4FHJ A;  1T3Q A;  2FIF A;  2N1W A;  4O1N A;  2KC1 A;  4ZOH C;  3BK2 A;  3IXS A;  4DDI D;  3DBR I;  2ZZP B;  3RNE C;  4A55 A;  1CQV A;  1RM6 C;  3A33 B;  2V0G A;  4A6Q A;  2BB6 A;  1SE9 A;  1GNU A;  1V1P B;  2IO0 B;  3BK1 A;  4GMV A;  2LGS A;  3ZYY X;  3MFG A;  2Z0D B;  3VDZ A;  5AZG A;  3Q8F A;  4M8N A;  2LI5 A;  4YL8 A;  4EZJ A;  3Q3J A;  3IT4 B;  2FNJ B;  2KHW B;  2CU1 A;  4ZRJ A;  1CMX B;  1WZ3 A;  1GOZ A;  2MEK A;  3R66 C;  4US8 A;  1OFF A;  1XLN A;  2V3S A;  3FIL A;  3HUI A;  1RYJ A;  3ZJT A;  1J0G A;  2MX2 A;  1YIW A;  2GOW A;  2N7J A;  3DWG C;  3RNG C;  2LUM A;  2LRW A;  1ZDX A;  2LWP A;  4NNJ B;  5AZF A;  4HKZ E;  4RF1 A;  2WXP A;  3SEB A;  3ZJV A;  2N9P C;  1WJN A;  2ZW0 A;  2FCM A;  4KGT A;  3S2A A;  2CHX A;  1C4P A;  1KRH A;  3HIZ A;  2N9X A;  1GPX A;  3IBE A;  3NZS A;  2QEJ C;  1AAR A;  1K50 A;  4CO7 A;  1FO4 A;  3K9O B;  1FCC C;  4RF0 A;  1X1M A;  3VTV A;  2RD0 A;  4KZC A;  4M01 A;  1C77 A;  3PV1 A;  5KHO A;  2FID A;  4F1S A;  4KGS A;  4II2 B;  5EE9 A;  1WX8 A;  1WZ0 A;  1TS3 A;  2KD0 A;  3QCA A;  1E7U A;  3AE5 B;  2PTL A;  1XQQ A;  4CQN A;  4WJN A;  3RNA C;  3NY5 A;  1WXA A;  4RGN A;  1KLV A;  5D7G A;  2HTH A;  2LAS A;  1ET9 A;  3AE7 B;  1MHX A;  2QC8 A;  1YX5 B;  2L32 A;  2KX0 A;  2ASQ A;  3OJ3 A;  3B0A A;  2Z8L A;  2KTR A;  1ZOY B;  3JW0 X;  2WX1 A;  1FCL A;  1UH6 A;  2BT6 A;  4IOI E;  3C0R B;  4HPP A;  2KYW A;  4DHZ B;  2JQR B;  4BOZ B;  5C2T B;  5J17 A;  1NYR A;  5JHA A;  1GAQ B;  3DVN U;  1LGR A;  2QCZ A;  3PSE B;  1TY2 A;  2WX0 A;  2O2V A;  1I4P A;  3PPA A;  4K3B A;  4REZ A;  2FUG 1;  1GG3 A;  4OZC A;  2EMT A;  1PGA A;  1WX7 A;  1WF9 A;  3PZ8 A;  3TL5 A;  2J52 A;  3SFE B;  3RUL A;  2PEA A;  2NPT A;  3BWU D;  1NDD A;  2MCN B;  2WS3 B;  2K5P A;  2IND C;  3BY4 B;  5CHF A;  3DVG Y;  2AQ3 B;  3AXC A;  3QIJ A;  3N1X C;  4MSQ B;  5JH5 C;  4US9 A;  4JL9 A;  1J8C A;  4WUR A;  1YJJ A;  2MLB A;  3OLM D;  2H89 B;  2WXO A;  5LXH A;  4YSY B;  1QF6 A;  3H7P A;  2WDR B;  1P9D U;  2DYB A;  4YXD B;  2NBU A;  3PRE A;  1KH0 A;  4C80 A;  2KMC A;  4IM3 A;  2JUO A;  2Y5B B;  2WXK A;  3D32 A;  1UWM A;  1QQR A;  1Y56 A;  5H8Y E;  5HFY A;  3KH0 A;  2BYE A;  1IGC A;  1WXS A;  3NVV A;  5LNK 1;  4YTM B;  4OZA A;  1KLU D;  3KUD B;  2MHJ A;  4B0E A;  1VLB A;  5TR5 A;  1E8Z A;  2MBB B;  4ITK A;  2PE6 B;  4WWO A;  2J7Q B;  4ANW A;  2E6X A;  3E9S A;  1B1Z A;  3JSV A;  2BB5 A;  1E9M A;  2K0P A;  3P4Q B;  4GU2 A;  3QK0 A;  2BKR B;  2IPK D;  5IP4 D;  2PJH A;  1FXI A;  2AYO B;  1WMH A;  5D94 A;  4ZDV A;  3ZNG C;  2N1V A;  1WR6 E;  4WQM A;  4RH6 A;  1FRR A;  1EF5 A;  3DHI C;  5C1Z A;  1FNW A;  3AM9 A;  1PGX A;  2NMQ A;  2KQS A;  2JY6 A;  1PDX A;  1IUE A;  5HG2 A;  1C9F A;  2PVO D;  2MJ3 A;  2O6V A;  1C78 A;  1STE A;  1IGD A;  1K8R B;  4KDL B;  5GXG B;  3TMP B;  3NG0 A;  3AEG B;  5EDS A;  3KVF B;  4BKG A;  4GDK B;  1NVI D;  2K8H A;  3DHH C;  3EEC A;  2N0S B;  4GDL B;  3BVM A;  2FBW B;  2VH1 A;  2K39 A;  1TGZ B;  1JWU D;  1QOF A;  2B76 B;  4M00 A;  1WGD A;  4W9G A;  1S3S G;  3CMM B;  3NS1 A;  3W1S C;  2M17 A;  1ROE A;  1T0Y A;  4P7I A;  2EKI A;  2MWS B;  3Q3M C;  4IM2 A;  2V4L A;  2C7N B;  1T0Q C;  1F52 A;  2IZV B;  5E6P A;  2PLP A;  1OTR B;  1F2R I;  3PRZ A;  2EMS A;  1VR9 A;  2AL6 A;  4FJY A;  1NBF C;  4DQO C;  4AJY B;  1VZ7 A;  4I6L B;  4ANV A;  3ECI A;  3KWL A;  2KAJ A;  4LLG M;  2BBC A;  4AUQ C;  1V86 A;  1U4A A;  2LXC A;  3I57 A;  1LFD A;  5HKH A;  1SE3 A;  1MG8 A;  5GMV A;  5L83 A;  1WGY A;  4G3X B;  1A70 A;  2C5L C;  2J0J A;  4WJP A;  1SEB D;  1I35 A;  2KLC A;  2KDB A;  4G50 A;  4I6N B;  4P1C C;  2IO1 B;  4URK A;  2LVO A;  4C4V A;  4GN1 A;  2CHZ A;  2NBW B;  2JXX A;  1ACC A;  3ZRF A;  2N9L A;  1WXV A;  3FKY A;  2IO3 B;  2PIA A;  3M95 A;  3NHE B;  2CKH B;  3ZNH B;  2DAJ A;  1ZXH A;  1WY8 A;  2KFK B;  2K6D B;  4OVV A;  3RMK C;  1EO6 A;  1RWS A;  1TY0 A;  3N9Y C;  2ON8 A;  1VCB A;  3GZN I;  4IWP A;  4ICV A;  3R7Q A;  4MAC A;  3WAL A;  2KN5 A;  4LCD E;  3AN1 A;  4EZK A;  4IUM B;  5LLI A;  1YOV B;  2G45 B;  3M3J A;  2SAK A;  4TV3 A;  4LK0 M;  2ZEQ A;  3RZW C;  2L7R A;  3AE3 B;  3NRZ A;  4H2A A;  3BYY B;  4QAY A;  1HXY D;  2GMI C;  2GBK A;  3Q8E A;  5T8I A;  2D3A A;  1MHH E;  4IW0 A;  3ONS A;  2KWD A;  4MGY E;  4EKU A;  4P6V F;  2FAZ A;  2OED A;  1B9R A;  3UIO B;  3NZ3 A;  1R4M B;  3TCA A;  2WNM A;  3SHQ A;  5AUK A;  4F7Z A;  2JPH A;  4HWI B;  1DGJ A;  4K7W A;  2XK5 A;  4YSZ B;  3DVG X;  2C9W B;  4KIK A;  1ZXI A;  1CZP A;  2RGF A;  3IVF A;  2OOB B;  2B3A A;  1V5T A;  1UNS A;  3EC8 A;  5BO4 B;  4HXD A;  2BWF A;  1F1H A;  3LJ3 A;  3TEY A;  1JWS D;  3FIL B;  4C00 A;  3PRP B;  3SU8 X;  3E56 A;  1ZW7 A;  3UQA A;  4LNI A;  3PS6 A;  3B2F A;  4CHK A;  5DPW A;  3AU5 A;  3QC8 B;  3ETR A;  2Y3A A;  1YQB A;  3OG5 A;  1OGW A;  3ZGZ A;  3U8Z A;  4AOF A;  3ZXV A;  1T5X D;  1UGJ A;  1FIQ A;  1GB4 A;  1QIL A;  2BWE S;  2KO3 A;  3PVL A;  2K9X A;  1WE7 A;  1XD3 B;  4K7S A;  2CR5 A;  3HM3 A;  4LDT D;  2LVP A;  3AUL A;  3P4P B;  3VTU A;  5H92 C;  2DZI A;  5AZH A;  1J19 A;  5G5G A;  1FNV A;  4NJ7 A;  2WDV B;  2KT7 A;  2LHE A;  3UQB A;  2BYV E;  1SBB B;  4YSX B;  1BML C;  2N7D A;  3NJT A;  3X0W A;  4WAA A;  2L0T A;  2NVU I;  4E71 A;  3LYY A;  4PS3 A;  2Z59 B;  1YQ3 B;  2KVR A;  4FHK A;  3Q8C A;  2JVC A;  2GLS A;  5L95 C;  2AL3 A;  2KTR B;  3AU4 A;  4OZB A;  3GE3 C;  2MA9 B;  2PMV A;  4RGM A;  1P7F A;  1EUV B;  5FR6 A;  4ANX A;  2WHI A;  3VUW A;  1AW7 A;  1UUP A;  2YVC A;  2O2V B;  4ZYS A;  1KOT A;  1SE4 A;  1C4A A;  1C3T A;  2DWQ A;  2IGH A;  1E8Y A;  4RGT A;  1XXG A;  2AWT A;  3N20 C;  3VTW A;  3NOB A;  1BT0 A;  4HDQ A;  1BXT A;  3HHM A;  3NZU A;  1XCQ L;  2CJO A;  1AYF A;  1OQQ A;  2KNB A;  2KC2 A;  1GC6 A;  3APC A;  4EEW A;  2BPS A;  2NPT B;  1P1A A;  2K3U A;  1FFU A;  1AWD A;  1R4N B;  2C7M B;  2DYM A;  1YD8 U;  5IKC M;  2KTF A;  4NY0 A;  2WU2 B;  3C19 A;  1MPE A;  2M1M A;  4HRO A;  4BVU C;  1KTK A;  1N60 A;  3KYD D;  2K22 A;  1N61 A;  3VH4 B;  5D3D A;  2LHD A;  2L8J A;  4WQO B;  5HI1 A;  3J9C A;  1N6Z A;  2RDB C;  3ZO5 B;  4BKS A;  4PS8 A;  1HTQ A;  4EE2 A;  1JCK B;  3H7P B;  3AEB B;  4IWQ A;  2BYT A;  3VR8 B;  4MDK E;  2JWZ A;  4BKS D;  4FBJ B;  2IY0 B;  1CJE A;  3N32 A;  4A8X C;  3AE8 B;  3A9J A;  3AB5 A;  4B0M A;  2HJ1 A;  3MJW A;  1F2R C;  4HLE A;  2RPV A;  4L1B A;  2XBB C;  3N1Z C;  3Q8A A;  4G0N B;  1TS5 A;  1V8C A;  4DHZ E;  4ARI A;  2GBJ A;  1HEZ E;  5J2R A;  3PHW B;  4A90 A;  3L4P A;  3MHS D;  4RGO S;  1V5O A;  3BIN A;  1WIA A;  5CHW A;  2WGS A;  2AQ1 B;  4YTN B;  3ZLZ A;  3JSV B;  4MEM A;  2K25 A;  3ZKJ C;  1Y8R C;  1J7A A;  3RFZ B;  4LTU A;  2G9H D;  1D5Z C;  1WI0 A;  3R7R A;  2E3T A;  2LGD A;  4KDI C;  3T9L A;  3OJ4 B;  4NAW A;  1WMH B;  2D10 A;  2IBI B;  3P4R B;  1WXM A;  3JVZ X;  3GE8 C;  2R61 A;  4OVU A;  4LNK A;  1IBX A;  2J0K A;  1ET6 A;  2LZ6 A;  2JU6 X;  3V6C B;  4RNA A;  2O6V B;  4W9F A;  1J7C A;  4KSK C;  1JRP A;  3APF A;  3Q2A C;  2K6Q A;  4PS7 A;  3VXW A;  3CWI A;  3Q69 A;  2OHF A;  2MP2 A;  1SF0 A;  1L6U A;  2IDY A;  2MW5 A;  3ENE A;  1GUA B;  1NYQ A;  4JE3 B;  2UWQ A;  1TT5 B;  4ZRQ A;  4ZYN A;  3FAH A;  4RM8 A;  2OJW A;  2HD5 B;  2IY1 B;  1WX9 A;  4WWM A;  1E6E B;  2KJH B;  2I1J A;  2G3Q B;  3HRD D;  2KK8 A;  3Q14 C;  1F0Z A;  3ZVV A;  4KKJ A;  2NR2 A;  2V4I B;  2MBO A;  1HA5 A;  1I42 A;  4WIP A;  4TUU A;  4NQK E;  2KQ4 X;  4GB9 A;  2WXR A;  2BVC A;  2G4D B;  1D5M C;  2KQ7 A;  2JRI B;  3ZJU A;  4J3O D;  3M62 B;  4RM9 A;  3VRB B;  4EZL A;  1Q0W B;  4HPL B;  1Q1O A;  1GJZ A;  2VZK B;  3W9C B;  4C4V B;  2JWU A;  2DZK A;  3KYC D;  3IT6 B;  3U52 E;  1KM7 A;  1WR1 A;  1DOX A;  3M63 B;  5G5H A;  4YT0 B;  4B6W A;  3DWM A;  3GB1 A;  4BBN F;  2H88 B;  4W9L A;  1KJT A;  3AEF B;  2KXJ A;  2MSE D;  1E90 A;  1PQS A;  2LGI A;  3Q6B A;  3B9J A;  2ZPN A;  4NJC A;  1E0Z A;  1C79 A;  3PLV A;  4HK2 A;  3QAR A;  3BYT B;  1WM2 A;  2WXQ A;  2N9K A;  4BBN C;  3W5U B;  2KN4 A;  3UIN B;  1R4M I;  3ABV B;  1HZ6 A;  3RZF A;  3WAO A;  1EU4 A;  1UEL A;  1C76 A;  4DHJ D;  2KMA A;  2INN E;  1T0S C;  2D3C A;  2WXM A;  3OAW A;  3RYT A;  3A9K A;  1PYW D;  3WCQ A;  1I4Q A;  2BW2 A;  1P7E A;  3DDC B;  2PKO A;  5TSS A;  3DBL B;  1QOG A;  1L0X B;  2XN9 C;  3DQV A;  2KDI A;  2KFJ A;  4M8M A;  3VFK A;  3KQ4 A;  4DXF A;  1G6J A;  4XC2 A;  1JW9 D;  1SE2 A;  3H9D A;  4NPN A;  1DOY A;  4WWP A;  2G4S A;  5BMG A;  2DZM A;  2XK5 B;  2KAC A;  1EF1 A;  2HTM E;  3A1Q A;  2W9N A;  4KIK B;  3O13 A;  3UI3 A;  4BOS C;  4MH0 E;  1CK1 A;  1TIF A;  1V6E A;  1H8C A;  4BKT A;  1E10 A;  3ALB A;  3P63 A;  3TUO A;  1NEK B;  3W1S A;  4PYZ A;  2WXF A;  5FKA C;  1N62 A;  2ZCC A;  3C8Y A;  2WXL A;  4HCN B;  5EE3 A;  3N3K B;  3GOE A;  3QHT A;  4TMA B;  2R2O A;  1EM7 A;  3MHZ A;  1QKZ A;  1YQ4 B;  1WFY A;  4MM3 A;  1K53 A;  2ZW1 A;  5IA7 A;  1XF5 L;  2J53 A;  1QLB B;  1QOA A;  3EGR A;  1XEE A;  5JZE B;  4LDT B;  4MH8 A;  3QWZ B;  4HRS A;  3MC0 B;  3Q3F A;  4DXA B;  4HPM B;  4GXB A;  1JAL A;  4XWT A;  4DK5 A;  3WAP A;  1IP9 A;  4C7Z A;  4JWS C;  4W9J A;  4ZHO A;  3TEZ A;  3AMZ A;  2W54 A;  3N30 A;  1VZ6 A;  2KOX A;  2AQ2 B;  3B1L X;  2WYQ A;  1UWX A;  1NI3 A;  2DAF A;  3DPD A;  3RCZ A;  2D5G A;  5IAA C;  3AV8 A;  4IG7 B;  3ZRC A;  1JWM D;  2KWU B;  2WDQ B;  2J0M A;  3BVZ A;  1N5W A;  2BGF A;  2WXH A;  2BKF A;  4A9A A;  3SFD B;  5CTR C;  2JYE A;  1L5P A;  1MI0 A;  2JZZ A;  4HKQ A;  1ZUD 2;  1TZO A;  2IYD B;  1TS2 A;  2QMT A;  1VD2 A;  2INC C;  5E6O A;  4ZRK A;  5C3J B;  1SJH D;  3EFC A;  1T0R C;  4M0W A;  1JQ4 A;  1LQB A;  1T6B X;  4A3P A;  2EKE C;  4EFO A;  2XNA C;  1E7P B;  3VUX A;  1TS4 A;  5E6J A;  5BMI A;  4JGH B;  2R2Q A;  2ACZ B;  2WU5 B;  4HJG E;  4W9C A;  2KWC A;  2MBQ A;  2D3G A;  2CJN A;  4XGA B;  3B2G A;  2FE8 A;  2KKC A;  5JXV A;  2D07 B;  4ZHP A;  1R4N I;  1WGR A;  1XT9 B;  3FC4 A;  3KLS X;  1L4Z B;  4W9D A;  1I4H A;  5D2M B;  4ANU A;  3PT2 B;  2L1A A;  3SD5 A;  2ZVN A;  3CIR B;  2IGG A;  4B95 A;  2QSD A;  1YJI A;  2L05 A;  2KMM A;  3UF8 A;  3HVZ A;  3Q3O C;  1Q5W B;  4XZ4 A;  4NQL B;  1MJD A;  2K8B A;  3MJ5 A;  3Q3N C;  1C1Y B;  1ZKH A;  2L52 A;  2G1E A;  2GRI A;  1FXT B;  1LM8 B;  4MJS A;  2MH7 A;  1JRO A;  1SIJ A;  1JRU A;  2DLB A;  3AH7 A;  2L3Z A;  1YNT E;  2N7E A;  1V49 A;  4N59 A;  1P0R A;  2WXJ A;  1F9J A;  1FRD A;  1TTN A;  1WGG A;  3NVZ A;  3A9J B;  3V05 A;  1Z5S B;  2VRR B;  4HVB A;  1ZP0 B;  3LXF A;  4USA A;  3MC9 A;  2YEP B;  4C56 C;  2DNF A;  3U30 A;  4K1R B;  1LO5 D;  4CYE A;  1D4B A;  2UU7 A;  3HVD A;  4D2K A;  4MGK E;  4FLH A;  4PYU A;  3VVW B;  3EFU A;  3ML9 A;  2IGD A;  3I3T B;  3DBS A;  2BS3 B;  2MBH A;  2JSV X;  3L17 A;  2D11 A;  2FUH B;  1WJ6 A; 
#chains in the Genus database with same CATH homology
 1SSN A;  2E6X A;  1J7A A;  3RFZ B;  1TKY A;  4LTU A;  4XDD A;  3E9S A;  3AE9 B;  2WQY B;  2G9H D;  1D5Z C;  3AE2 B;  1B1Z A;  1N63 A;  1SB3 C;  1XLP A;  1MVK A;  2BB5 A;  2GI9 A;  4NAW B;  1GB1 A;  1E9M A;  2E3T A;  2K0P A;  2M19 A;  3P4Q B;  5EE1 A;  4TSS A;  1NEN B;  3VR9 B;  3NVW A;  1IBX B;  2LMC A;  3P4R B;  2IPK D;  2LEK A;  5MPO A;  1FXI A;  2R61 A;  2J4X A;  1PUT A;  5I4D A;  1IBX A;  1ET6 A;  1L6V A;  4WQM A;  2JU6 X;  1TYG B;  4RH6 A;  4RNA A;  1FRR A;  3P4S B;  1V1O A;  1FNW A;  2V3P A;  3AM9 A;  1PGX A;  1VJK A;  2NMQ A;  2TSS A;  2W3S A;  1FXA A;  1PDX A;  2GB1 A;  1IUE A;  5HG2 A;  1C9F A;  1I4R A;  1J7C A;  2MJ3 A;  2PVO D;  3EUB 2;  3W2D A;  1VRA B;  1C78 A;  1JRP A;  2L83 A;  4GLS C;  1STE A;  1IGD A;  5GXG B;  4XDC A;  1K51 A;  1WWT A;  2QJL A;  2Y5P A;  3AEG B;  1QT9 A;  3H8H A;  1PGB A;  1M4V A;  5D3I B;  3CWI A;  3Q69 A;  4GDK B;  5FR3 A;  1NVI D;  1YN4 A;  2OHF A;  1SF0 A;  1L6U A;  1EWY C;  1R7S A;  2N0S B;  4GDL B;  4N58 A;  1FNU A;  4P16 A;  2IDY A;  3BVM A;  3IAM 1;  2FBW B;  5FK9 C;  4TQ0 A;  2M0A A;  1QOB A;  3AE4 B;  1NYQ A;  2W55 A;  4JE3 B;  3U7Z A;  2LJI A;  4KGR A;  1JWU D;  4ZRQ A;  1QOF A;  3FAH A;  2B76 B;  3URY A;  1D6E C;  1TKG A;  2I38 A;  4R3D A;  4WWM A;  3LB8 C;  1E6E B;  1WGK A;  3NS1 A;  3MP9 A;  3R8B A;  4RCO A;  3HRD D;  1WYG A;  1ROE A;  3AED B;  1SJE D;  2BS2 B;  1F0Z A;  2EKI A;  4KKJ A;  1L0Y B;  2V4I B;  1HA5 A;  1I4X A;  2PLP A;  4WIP A;  1F2R I;  2DYO A;  2NTT A;  4OW0 A;  1DOI A;  1VR9 A;  1VDV A;  2KQ4 X;  2WXR A;  4DQO C;  1VZ7 A;  2YEP F;  2SEB D;  1D5M C;  3ZJU A;  4J3O D;  2AX5 A;  1YN5 A;  1KFY B;  1FD6 A;  1RFK A;  3KWL A;  1FM0 D;  2KAJ A;  4LLG M;  4HEA 1;  2WLB A;  2BBC A;  2KDM A;  1JML A;  3VRB B;  1I4G A;  2WXI A;  3R2I A;  3I57 A;  1SE3 A;  2QIL A;  2VZK B;  4OHJ A;  2RDG A;  3BVG A;  3KWV A;  4DXG A;  1A70 A;  1ENF A;  4YWG G;  1VZ8 A;  3W9C B;  1XCT L;  1KF6 B;  1SEB D;  2JWU A;  2V3N A;  2WP9 B;  3IT6 B;  3U52 E;  1DOX A;  5G5H A;  3W5V B;  3BZD B;  4YT0 B;  1TJE A;  5HHD G;  3AE1 B;  4AQ7 A;  1YN3 A;  5AUI A;  1I7H A;  1K52 A;  3IAS 1;  1ACC A;  3DWM A;  3GB1 A;  2H88 B;  4L23 A;  2RMM A;  1V97 A;  3RPF C;  4JWU C;  3AEF B;  3ZQ4 A;  3T3O A;  2N9L A;  3VQI A;  3NVY A;  2PIA A;  4ARC A;  3TEW A;  1ZXH A;  2LGI A;  3B9J A;  1RWS A;  1F77 A;  1N5X A;  1BUI C;  4NJC A;  1C79 A;  4YTP B;  1E0Z A;  2MJD A;  1TY0 A;  3N9Y C;  1L4D B;  2ON8 A;  5BMH A;  3BYT B;  4MAC A;  2J42 A;  1YMH E;  2WXQ A;  2ONQ A;  3AN1 A;  2N9K A;  3AEC B;  2SAK A;  3W5U B;  2KN4 A;  3P42 A;  4LK0 M;  4RFB A;  3ABV B;  1HZ6 A;  2JX5 A;  1EU4 A;  1ZPS A;  3TEX A;  2HDE A;  3AE3 B;  3NRZ A;  3PO0 A;  1C76 A;  3U4E G;  1ZDV A;  4H2A A;  4XE0 A;  2INN E;  3BYY B;  1HXY D;  1D5X C;  2QIE B;  3Q8E A;  1EWC A;  4IKG A;  5T8I A;  2WXM A;  1EU3 A;  1ZE3 D;  1MHH E;  1C4C A;  1PYW D;  2JZP A;  4UDU C;  1I4Q A;  2BW2 A;  3WCQ A;  4XWW A;  1SXT A;  1FMA D;  1J7B A;  2KWD A;  1P7E A;  2NTS A;  2PKO A;  4P6V F;  5TSS A;  1T3Q A;  4O1N A;  1QOG A;  2JYT A;  1L0X B;  2XN9 C;  2OED A;  4ZOH C;  1B9R A;  3BK2 A;  3IXS A;  1L0V B;  2X38 A;  3KQ4 A;  3NZ3 A;  4DXF A;  1JW9 D;  4A55 A;  1SE2 A;  1CQV A;  2Q5W D;  4AS1 A;  4IDI A;  1RM6 C;  2WNM A;  1DOY A;  2V0G A;  5BMG A;  4A6Q A;  5AUK A;  1AN8 A;  2KAC A;  2BB6 A;  2HTM E;  1FEH A;  5BYR A;  1DGJ A;  3O13 A;  3UI3 A;  1V1P B;  4YSZ B;  1CK1 A;  3BK1 A;  3PZ7 A;  1ZXI A;  3ZYY X;  3MFG A;  1V1P A;  1CZP A;  3NUH B;  1JWA D;  3V3X A;  3Q8F A;  3Q8B A;  1E10 A;  3P63 A;  1TKE A;  3TUO A;  1NEK B;  1UNS A;  3W1S A;  3IT4 B;  2WXF A;  5FKA C;  1N62 A;  4NZL B;  3C8Y A;  1GOZ A;  2WXL A;  1KLG D;  5EE3 A;  4MM3 B;  2MEK A;  3TEY A;  1JWS D;  3FIL B;  4TMA B;  3E56 A;  1EM7 A;  3MHZ A;  4US8 A;  1OFF A;  4N6E B;  1XLN A;  1QKZ A;  1YQ4 B;  2ICI A;  1WSP A;  1K53 A;  2ZW1 A;  3B2F A;  3FIL A;  3HUI A;  1RYJ A;  1ESF A;  3ZJT A;  3ETR A;  1XF5 L;  2J53 A;  2Y3A A;  3I9V 1;  1QLB B;  1QOA A;  3SR6 A;  3EGR A;  2N7J A;  1XEE A;  3DWG C;  4JPS A;  2LUM A;  2W82 A;  1ZDX A;  4MH8 A;  5BYQ A;  4HRS A;  3T3N A;  3ZGZ A;  3MC0 B;  4HKZ E;  4RF1 A;  2WXP A;  3SEB A;  1T5X D;  1UGJ A;  1FIQ A;  3P1M A;  3ZJV A;  4NAM A;  2JXT A;  2ZW0 A;  1GB4 A;  2LFI A;  1QIL A;  4KGT A;  1JAL A;  4XWT A;  2WXN A;  4C7Z A;  1C4P A;  1KRH A;  4JWS C;  2DBY A;  4ZHO A;  1GPX A;  2K9X A;  3TEZ A;  3VRA B;  2QEJ C;  1K50 A;  3AMZ A;  2W54 A;  1VZ6 A;  1FO4 A;  2W3R A;  1FCC C;  2AQ2 B;  4RF0 A;  4JX1 C;  3P4P B;  1UWX A;  2BTE A;  1Q10 A;  3AE6 B;  5BYS A;  1NI3 A;  5H92 C;  1C77 A;  5G5G A;  1FNV A;  3BII D;  2D5G A;  3AV8 A;  2WDV B;  1XLQ A;  2LHE A;  1JWM D;  4KGS A;  5EE9 A;  1SBB B;  2WDQ B;  2EEL A;  4YSX B;  1BML C;  1TS3 A;  3BVZ A;  1N5W A;  3GP7 A;  2WXH A;  4A9A A;  3AE5 B;  3LYY A;  4L2Y A;  2PTL A;  3SFD B;  1HQR D;  4CQN A;  2JYE A;  1L5P A;  1MI0 A;  1YQ3 B;  2Y5C A;  4RGN A;  4HKQ A;  1ZUD 2;  5D7G A;  1TZO A;  3AEE B;  1ET9 A;  3Q8C A;  3AE7 B;  1MHX A;  1HZ5 A;  1TS2 A;  2M56 B;  2QMT A;  4Q2J A;  4C7Y A;  4OVZ A;  2L32 A;  3U2S C;  5C3J B;  1SJH D;  4OZB A;  2PMV A;  2I2Y A;  4RGM A;  1P7F A;  4M0W A;  1JQ4 A;  1T6B X;  2MJE A;  1FFV A;  2Z8L A;  1WXQ A;  2XNA C;  1E7P B;  4KKI A;  1TS4 A;  5E6J A;  5BMI A;  2IJ0 A;  1ZOY B;  1AW7 A;  1FCL A;  2ACZ B;  1UUP A;  1OQR A;  2BT6 A;  4IOI E;  2WU5 B;  4HJG E;  4ZYS A;  1SE4 A;  2JQR B;  2CJN A;  5C2T B;  1C4A A;  1NYR A;  3B2G A;  1GAQ B;  2FE8 A;  2RDH A;  2DWQ A;  2IGH A;  5JXV A;  1TY2 A;  4RGT A;  4ZHP A;  1XXG A;  2INP E;  1I4P A;  3FC4 A;  4KX6 B;  3KLS X;  4MT5 A;  1L4Z B;  2WXG A;  1BXT A;  1PFD A;  3OWE B;  4REZ A;  1I4H A;  1XLO A;  2FUG 1;  1XO3 A;  4ZRP A;  2L1A A;  4WH4 A;  1XCQ L;  4OZC A;  2CJO A;  1AYF A;  3CIR B;  2IGG A;  1OQQ A;  1PGA A;  2QSD A;  1YJI A;  2KMM A;  2PVG C;  3HVZ A;  2BS4 B;  3PZ8 A;  2PW9 A;  2J52 A;  2K3U A;  3MJ5 A;  1FFU A;  1AWD A;  2DYM A;  3SFE B;  2L52 A;  2G1E A;  2WU2 B;  2GRI A;  1MPE A;  4HRO A;  2MH7 A;  3BWU D;  1KTK A;  1N60 A;  1JRO A;  1SIJ A;  2K22 A;  1N61 A;  2DLB A;  2WS3 B;  3AH7 A;  2K5P A;  5D3D A;  1YNT E;  2LHD A;  2CU3 A;  4N59 A;  5HI1 A;  3J9C A;  2AQ3 B;  5EE0 A;  2WXJ A;  3GS2 A;  1FRD A;  4US9 A;  4WAF A;  3NVZ A;  1YJJ A;  4WUR A;  4EE2 A;  2H89 B;  1JCK B;  3TSS A;  2WXO A;  3AEB B;  1JWB D;  2BYT A;  3V05 A;  3VR8 B;  4YSY B;  1QF6 A;  1ZP0 B;  3LXF A;  4USA A;  4A8X C;  1CJE A;  2YEP B;  2WDR B;  4TQ1 A;  4C56 C;  3AE8 B;  1WRI A;  3AB5 A;  1LO5 D;  4B0M A;  4YXD B;  4FXC A;  3AEA B;  1D4B A;  3HVD A;  4D2K A;  1F2R C;  1KH0 A;  2RPV A;  4L1B A;  3Q8A A;  4C80 A;  1TS5 A;  1V8C A;  4PT5 A;  2WXK A;  4ARI A;  1UWM A;  1QQR A;  1Y56 A;  2IGD A;  3R2T A;  1HEZ E;  5H8Y E;  4A90 A;  3L4P A;  5HFY A;  4RGO S;  1IGC A;  2BS3 B;  3NVV A;  5LNK 1;  2JSV X;  4YTM B;  4OZA A;  1KLU D;  2VZK D;  1VLB A;  4B0E A;  1DYQ A;  4ITK A;  2AQ1 B;  3EA6 A;  4YTN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...