3TVJA

Catalytic fragment of masp-2 in complex with its specific inhibitor developed by directed evolution on sgci scaffold
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
TIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCDADGFWTSSKGEKSLPVCEPVCGLSARTTGGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan-binding lectin serine protease 2 A chain
publication title Monospecific Inhibitors Show That Both Mannan-binding Lectin-associated Serine Protease-1 (MASP-1) and -2 Are Essential for Lectin Pathway Activation and Reveal Structural Plasticity of MASP-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 83
sequence length 83
ec nomenclature ec 3.4.21.104: Mannan-binding lectin-associated serine protease-2.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3tvjA01
1HFIA 2EHFA 1GKNA 2ERJA 3OXUD 3MQLA 1LY2A 1QUBA 1CKLA 2QY0A 2XWJI 3M7PA 3EJHA 1Q3XA 2RLPA 5FO8C 2MCYA 2LOJA 5HZPB 1OJYA 2BZMA 2G7IA 4J38B 4K12A 4AYMA 2XWBF 1SS2A 5HYPA 1FBRA 4PZ5A 1HCCA 1H2QP 4AYEA 1E5GA 2V8EA 4IGDA 1HFHA 2B5ID 2RL0A 4JHSA 4ZH1D 3KZJA 2RKZA 1H2PP 1MD8A 1E88A 3CALA 3KXVA 1NWVA 1GPZA 3ZRZA 4KKDA 1Z92B 4C16A 4B2RA 4MUCA 2XQWC 4FXGG 1OK2A 1MD7A 1GHQB 3RJ3D 1OK1A 3ZD2A 2W80A 4AYIA 4F4OC 3OEDC 2MCZA 5HYUB 5I0QB 4DJZA 2EC3A 2UWNA 3ERBA 1VVDA 1QO6A 1ZJKA 1C1ZA 3OP8A 3GOVA 1GKGA 1G4GA 2CKUA 4YNXA 2IZ3A 4AYDA 2XRDA 2A55A 3GXEA 2CG7A 2KMSA 3IX0A 3L89M 1G4FA 1H04P 1ELVA 2JGWA 1OJVA 2YRAA 3R62A 1O9AA 5JPMG 1QGBA 1UOTP 1H03P 2IZ4A 1OJWA 3T5OA 2JRAA 3SW0X 2XRBA 1OK9A 1TPGA 3IU3I 4CSYA 3NFPI 2KRIA 2JGXA 2CG6A 3ZD1A 4WJG2 4LOTA 2YBYA 2O39C 1TPMA 2W81A 2RLQA 4LOSA 1E8BA 5HYTB 1VVCA 3INBC 4A5WB 1SRZA 4ONTD 1OK3A 1PPQA 2WIIC 1U5MA 4B2SA 3O8EB 1TPNA 2RKYA 3TVJA
chains in the Genus database with same CATH superfamily
1HFIA 2EHFA 1GKNA 2ERJA 3OXUD 3MQLA 4YIZA 1LY2A 1QUBA 1CKLA 3ZLDA 2QY0A 2XWJI 3M7PA 3EJHA 1Q3XA 3ZLEA 1RLHA 2RLPA 5FO8C 2MCYA 2Y8SA 2LOJA 4BWCA 1OJYA 2BZMA 2G7IA 4J38B 4K12A 4AYMA 2XWBF 1SS2A 5HYPA 1FBRA 5DN4A 4PZ5A 1HCCA 1H2QP 4MSLA 4AYEA 2X2ZA 2Y8RA 1E5GA 2V8EA 4IGDA 3VWOA 1HFHA 2B5ID 2RL0A 4JHSA 4ZH1D 3KZJA 2RKZA 3F6KA 1H2PP 1MD8A 4PO7A 5HZPB 1E88A 3CALA 3KXVA 1NWVA 1GPZA 3ZRZA 4KKDA 1Z92B 4C16A 4B2RA 4MUCA 2XQWC 4FXGG 1OK2A 1MD7A 1GHQB 3RJ3D 1OK1A 3ZD2A 2W80A 4AYIA 4F4OC 3OEDC 3WSXA 2ZYCA 2MCZA 3WSYA 5HYUB 5I0QB 4DJZA 2EC3A 2UWNA 3ERBA 1VVDA 1QO6A 1ZJKA 1C1ZA 3OP8A 3GOVA 1GKGA 1G4GA 2CKUA 4YNXA 2IZ3A 4AYDA 2XRDA 2A55A 3GXEA 2CG7A 2KMSA 3FGTA 3IX0A 3L89M 1H04P 1G4FA 1ELVA 2JGWA 5DN5A 1OJVA 2YRAA 3R62A 1O9AA 5JPMG 1QGBA 1UOTP 1H03P 2IZ4A 1OJWA 3T5OA 2JRAA 3SW0X 2XRBA 1OK9A 1TPGA 3IU3I 4CSYA 3NFPI 2Y8TA 2KRIA 2JGXA 3K3TA 2CG6A 3ZD1A 4WJG2 4LOTA 3CI0J 2YBYA 2O39C 1TPMA 4N7EA 2W81A 2RLQA 4LOSA 1E8BA 3NJAA 2I2LA 3FGRA 5HYTB 1VVCA 3INBC 4A5WB 1SRZA 4ONTD 1OK3A 1PPQA 2WIIC 1U5MA 4B2SA 3O8EB 4APLA 1TPNA 2RKYA 3TVJA
chains in the Genus database with same CATH topology
1HFIA 2EHFA 1GKNA 2ERJA 3OXUD 3MQLA 1LY2A 1QUBA 1CKLA 2QY0A 2XWJI 3M7PA 3EJHA 1Q3XA 2RLPA 5FO8C 2MCYA 2LOJA 5HZPB 1OJYA 2BZMA 2G7IA 4J38B 4K12A 4AYMA 2XWBF 1SS2A 5HYPA 1FBRA 4PZ5A 1HCCA 1H2QP 4AYEA 1E5GA 2V8EA 4IGDA 1HFHA 2B5ID 2RL0A 4JHSA 4ZH1D 3KZJA 2RKZA 1H2PP 1MD8A 1E88A 3CALA 3KXVA 1NWVA 1GPZA 3ZRZA 4KKDA 1Z92B 4C16A 4B2RA 4MUCA 2XQWC 4FXGG 1OK2A 1MD7A 1GHQB 3RJ3D 1OK1A 3ZD2A 2W80A 4AYIA 4F4OC 3OEDC 2MCZA 5HYUB 5I0QB 4DJZA 2EC3A 2UWNA 3ERBA 1VVDA 1QO6A 1ZJKA 1C1ZA 3OP8A 3GOVA 1GKGA 1G4GA 2CKUA 4YNXA 2IZ3A 4AYDA 2XRDA 2A55A 3GXEA 2CG7A 2KMSA 3IX0A 3L89M 1G4FA 1H04P 1ELVA 2JGWA 1OJVA 2YRAA 3R62A 1O9AA 5JPMG 1QGBA 1UOTP 1H03P 2IZ4A 1OJWA 3T5OA 2JRAA 3SW0X 2XRBA 1OK9A 1TPGA 3IU3I 4CSYA 3NFPI 2KRIA 2JGXA 2CG6A 3ZD1A 4WJG2 4LOTA 2YBYA 2O39C 1TPMA 2W81A 2RLQA 4LOSA 1E8BA 5HYTB 1VVCA 3INBC 4A5WB 1SRZA 4ONTD 1OK3A 1PPQA 2WIIC 1U5MA 4B2SA 3O8EB 1TPNA 2RKYA 3TVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFI A;  2EHF A;  1GKN A;  2ERJ A;  3OXU D;  3MQL A;  1LY2 A;  1QUB A;  1CKL A;  2QY0 A;  2XWJ I;  3M7P A;  3EJH A;  1Q3X A;  2RLP A;  5FO8 C;  2MCY A;  2LOJ A;  5HZP B;  1OJY A;  2BZM A;  2G7I A;  4J38 B;  4K12 A;  4AYM A;  2XWB F;  1SS2 A;  5HYP A;  1FBR A;  4PZ5 A;  1HCC A;  1H2Q P;  4AYE A;  1E5G A;  2V8E A;  4IGD A;  1HFH A;  2B5I D;  2RL0 A;  4JHS A;  4ZH1 D;  3KZJ A;  2RKZ A;  1H2P P;  1MD8 A;  1E88 A;  3CAL A;  3KXV A;  1NWV A;  1GPZ A;  3ZRZ A;  4KKD A;  1Z92 B;  4C16 A;  4B2R A;  4MUC A;  2XQW C;  4FXG G;  1OK2 A;  1MD7 A;  1GHQ B;  3RJ3 D;  1OK1 A;  3ZD2 A;  2W80 A;  4AYI A;  4F4O C;  3OED C;  2MCZ A;  5HYU B;  5I0Q B;  4DJZ A;  2EC3 A;  2UWN A;  3ERB A;  1VVD A;  1QO6 A;  1ZJK A;  1C1Z A;  3OP8 A;  3GOV A;  1GKG A;  1G4G A;  2CKU A;  4YNX A;  2IZ3 A;  4AYD A;  2XRD A;  2A55 A;  3GXE A;  2CG7 A;  2KMS A;  3IX0 A;  3L89 M;  1G4F A;  1H04 P;  1ELV A;  2JGW A;  1OJV A;  2YRA A;  3R62 A;  1O9A A;  5JPM G;  1QGB A;  1UOT P;  1H03 P;  2IZ4 A;  1OJW A;  3T5O A;  2JRA A;  3SW0 X;  2XRB A;  1OK9 A;  1TPG A;  3IU3 I;  4CSY A;  3NFP I;  2KRI A;  2JGX A;  2CG6 A;  3ZD1 A;  4WJG 2;  4LOT A;  2YBY A;  2O39 C;  1TPM A;  2W81 A;  2RLQ A;  4LOS A;  1E8B A;  5HYT B;  1VVC A;  3INB C;  4A5W B;  1SRZ A;  4ONT D;  1OK3 A;  1PPQ A;  2WII C;  1U5M A;  4B2S A;  3O8E B;  1TPN A;  2RKY A;  3TVJ A; 
#chains in the Genus database with same CATH topology
 1HFI A;  2EHF A;  1GKN A;  2ERJ A;  3OXU D;  3MQL A;  4YIZ A;  1LY2 A;  1QUB A;  1CKL A;  3ZLD A;  2QY0 A;  2XWJ I;  3M7P A;  3EJH A;  1Q3X A;  3ZLE A;  1RLH A;  2RLP A;  5FO8 C;  2MCY A;  2Y8S A;  2LOJ A;  4BWC A;  1OJY A;  2BZM A;  2G7I A;  4J38 B;  4K12 A;  4AYM A;  2XWB F;  1SS2 A;  5HYP A;  1FBR A;  5DN4 A;  4PZ5 A;  1HCC A;  1H2Q P;  4MSL A;  4AYE A;  2X2Z A;  2Y8R A;  1E5G A;  2V8E A;  4IGD A;  3VWO A;  1HFH A;  2B5I D;  2RL0 A;  4JHS A;  4ZH1 D;  3KZJ A;  2RKZ A;  3F6K A;  1H2P P;  1MD8 A;  4PO7 A;  5HZP B;  1E88 A;  3CAL A;  3KXV A;  1NWV A;  1GPZ A;  3ZRZ A;  4KKD A;  1Z92 B;  4C16 A;  4B2R A;  4MUC A;  2XQW C;  4FXG G;  1OK2 A;  1MD7 A;  1GHQ B;  3RJ3 D;  1OK1 A;  3ZD2 A;  2W80 A;  4AYI A;  4F4O C;  3OED C;  3WSX A;  2ZYC A;  2MCZ A;  3WSY A;  5HYU B;  5I0Q B;  4DJZ A;  2EC3 A;  2UWN A;  3ERB A;  1VVD A;  1QO6 A;  1ZJK A;  1C1Z A;  3OP8 A;  3GOV A;  1GKG A;  1G4G A;  2CKU A;  4YNX A;  2IZ3 A;  4AYD A;  2XRD A;  2A55 A;  3GXE A;  2CG7 A;  2KMS A;  3FGT A;  3IX0 A;  3L89 M;  1H04 P;  1G4F A;  1ELV A;  2JGW A;  5DN5 A;  1OJV A;  2YRA A;  3R62 A;  1O9A A;  5JPM G;  1QGB A;  1UOT P;  1H03 P;  2IZ4 A;  1OJW A;  3T5O A;  2JRA A;  3SW0 X;  2XRB A;  1OK9 A;  1TPG A;  3IU3 I;  4CSY A;  3NFP I;  2Y8T A;  2KRI A;  2JGX A;  3K3T A;  2CG6 A;  3ZD1 A;  4WJG 2;  4LOT A;  3CI0 J;  2YBY A;  2O39 C;  1TPM A;  4N7E A;  2W81 A;  2RLQ A;  4LOS A;  1E8B A;  3NJA A;  2I2L A;  3FGR A;  5HYT B;  1VVC A;  3INB C;  4A5W B;  1SRZ A;  4ONT D;  1OK3 A;  1PPQ A;  2WII C;  1U5M A;  4B2S A;  3O8E B;  4APL A;  1TPN A;  2RKY A;  3TVJ A; 
#chains in the Genus database with same CATH homology
 1HFI A;  2EHF A;  1GKN A;  2ERJ A;  3OXU D;  3MQL A;  1LY2 A;  1QUB A;  1CKL A;  2QY0 A;  2XWJ I;  3M7P A;  3EJH A;  1Q3X A;  2RLP A;  5FO8 C;  2MCY A;  2LOJ A;  5HZP B;  1OJY A;  2BZM A;  2G7I A;  4J38 B;  4K12 A;  4AYM A;  2XWB F;  1SS2 A;  5HYP A;  1FBR A;  4PZ5 A;  1HCC A;  1H2Q P;  4AYE A;  1E5G A;  2V8E A;  4IGD A;  1HFH A;  2B5I D;  2RL0 A;  4JHS A;  4ZH1 D;  3KZJ A;  2RKZ A;  1H2P P;  1MD8 A;  1E88 A;  3CAL A;  3KXV A;  1NWV A;  1GPZ A;  3ZRZ A;  4KKD A;  1Z92 B;  4C16 A;  4B2R A;  4MUC A;  2XQW C;  4FXG G;  1OK2 A;  1MD7 A;  1GHQ B;  3RJ3 D;  1OK1 A;  3ZD2 A;  2W80 A;  4AYI A;  4F4O C;  3OED C;  2MCZ A;  5HYU B;  5I0Q B;  4DJZ A;  2EC3 A;  2UWN A;  3ERB A;  1VVD A;  1QO6 A;  1ZJK A;  1C1Z A;  3OP8 A;  3GOV A;  1GKG A;  1G4G A;  2CKU A;  4YNX A;  2IZ3 A;  4AYD A;  2XRD A;  2A55 A;  3GXE A;  2CG7 A;  2KMS A;  3IX0 A;  3L89 M;  1G4F A;  1H04 P;  1ELV A;  2JGW A;  1OJV A;  2YRA A;  3R62 A;  1O9A A;  5JPM G;  1QGB A;  1UOT P;  1H03 P;  2IZ4 A;  1OJW A;  3T5O A;  2JRA A;  3SW0 X;  2XRB A;  1OK9 A;  1TPG A;  3IU3 I;  4CSY A;  3NFP I;  2KRI A;  2JGX A;  2CG6 A;  3ZD1 A;  4WJG 2;  4LOT A;  2YBY A;  2O39 C;  1TPM A;  2W81 A;  2RLQ A;  4LOS A;  1E8B A;  5HYT B;  1VVC A;  3INB C;  4A5W B;  1SRZ A;  4ONT D;  1OK3 A;  1PPQ A;  2WII C;  1U5M A;  4B2S A;  3O8E B;  1TPN A;  2RKY A;  3TVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...