3TVJA

Catalytic fragment of masp-2 in complex with its specific inhibitor developed by directed evolution on sgci scaffold
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
TIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCDADGFWTSSKGEKSLPVCEPVCGLSARTTGGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan-binding lectin serine protease 2 A chain
publication title Monospecific Inhibitors Show That Both Mannan-binding Lectin-associated Serine Protease-1 (MASP-1) and -2 Are Essential for Lectin Pathway Activation and Reveal Structural Plasticity of MASP-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 83
sequence length 83
ec nomenclature ec 3.4.21.104: Mannan-binding lectin-associated serine protease-2.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3tvjA01
3IU3I 2V8EA 2RKYA 4IGDA 1O9AA 4PZ5A 4FXGG 2JGWA 2EHFA 2XRDA 4JHSA 1OJWA 1QUBA 4AYIA 2LOJA 3CALA 3EJHA 4F4OC 2EC3A 1QO6A 2KRIA 3ERBA 3RJ3D 1VVCA 1E8BA 3L89M 1Q3XA 1G4GA 3KXVA 3M7PA 2A55A 1HFHA 3OP8A 1TPGA 1H04P 2CKUA 5HYTB 3KZJA 2QY0A 2XQWC 2JRAA 1VVDA 5HYUB 1PPQA 2RLPA 1H2PP 2MCYA 2RL0A 2XWJI 4AYDA 5FO8C 2O39C 3T5OA 1OK2A 1MD7A 3OXUD 1HCCA 4MUCA 4DJZA 3MQLA 4WJG2 2IZ4A 2YRAA 3GOVA 4AYMA 1CKLA 2RKZA 2RLQA 1C1ZA 2CG6A 4CSYA 5HYPA 2W80A 5JPMG 1HFIA 2UWNA 4AYEA 1U5MA 3TVJA 3SW0X 1E88A 2G7IA 3NFPI 4C16A 1H03P 1H2QP 1LY2A 3OEDC 1QGBA 4A5WB 4ZH1D 3IX0A 2JGXA 1NWVA 1TPNA 1ZJKA 3GXEA 4LOSA 1OK1A 5HZPB 4KKDA 2W81A 1GPZA 4YNXA 4ONTD 1G4FA 1GKGA 3R62A 1UOTP 1Z92B 2B5ID 2XRBA 3ZD1A 5I0QB 3INBC 2CG7A 1TPMA 2IZ3A 1ELVA 3O8EB 4K12A 1OJYA 2BZMA 4B2RA 1MD8A 1OK9A 1FBRA 1SS2A 1OJVA 3ZD2A 2KMSA 1OK3A 2MCZA 3ZRZA 2XWBF 4B2SA 1GHQB 1E5GA 2YBYA 1GKNA 2ERJA 4J38B 2WIIC 4LOTA 1SRZA
chains in the Genus database with same CATH superfamily
3IU3I 2V8EA 2RKYA 4IGDA 1O9AA 4PZ5A 4FXGG 2JGWA 2EHFA 2XRDA 4JHSA 3K3TA 1OJWA 1QUBA 4AYIA 2LOJA 3CALA 3EJHA 4F4OC 2EC3A 1QO6A 2KRIA 3ERBA 3RJ3D 1VVCA 1E8BA 3NJAA 3L89M 1Q3XA 4N7EA 1G4GA 3KXVA 3M7PA 2A55A 1HFHA 3OP8A 1TPGA 1H04P 2CKUA 3FGRA 5HYTB 3KZJA 2QY0A 2XQWC 2JRAA 1VVDA 5HYUB 1PPQA 2RLPA 5DN4A 2Y8SA 1H2PP 2MCYA 2RL0A 2XWJI 4AYDA 5FO8C 2O39C 3FGTA 3T5OA 3WSXA 1OK2A 1MD7A 3OXUD 1HCCA 2X2ZA 4MUCA 4DJZA 3MQLA 4WJG2 2IZ4A 2YRAA 3GOVA 1RLHA 3ZLEA 4AYMA 1CKLA 2RKZA 2RLQA 1C1ZA 2CG6A 3F6KA 4CSYA 5HYPA 4APLA 2W80A 5JPMG 3WSYA 1HFIA 2UWNA 4AYEA 1U5MA 3TVJA 3SW0X 1E88A 2G7IA 3NFPI 4C16A 1H03P 3VWOA 1H2QP 1LY2A 3OEDC 1QGBA 4A5WB 4ZH1D 3IX0A 2ZYCA 2JGXA 1NWVA 1TPNA 1ZJKA 3GXEA 3ZLDA 4LOSA 1OK1A 3CI0J 5HZPB 4KKDA 4BWCA 2W81A 1GPZA 4YNXA 4ONTD 1G4FA 1GKGA 3R62A 1UOTP 2Y8TA 1Z92B 2B5ID 2XRBA 3ZD1A 5I0QB 3INBC 2CG7A 4PO7A 4YIZA 1TPMA 2IZ3A 1ELVA 3O8EB 4K12A 1OJYA 2BZMA 4B2RA 1MD8A 1OK9A 1FBRA 1SS2A 1OJVA 3ZD2A 2KMSA 1OK3A 2MCZA 4MSLA 3ZRZA 5DN5A 2XWBF 2Y8RA 4B2SA 1GHQB 1E5GA 2YBYA 1GKNA 2ERJA 2I2LA 4J38B 2WIIC 4LOTA 1SRZA
chains in the Genus database with same CATH topology
3IU3I 2V8EA 2RKYA 4IGDA 1O9AA 4PZ5A 4FXGG 2JGWA 2EHFA 2XRDA 4JHSA 1OJWA 1QUBA 4AYIA 2LOJA 3CALA 3EJHA 4F4OC 2EC3A 1QO6A 2KRIA 3ERBA 3RJ3D 1VVCA 1E8BA 3L89M 1Q3XA 1G4GA 3KXVA 3M7PA 2A55A 1HFHA 3OP8A 1TPGA 1H04P 2CKUA 5HYTB 3KZJA 2QY0A 2XQWC 2JRAA 1VVDA 5HYUB 1PPQA 2RLPA 1H2PP 2MCYA 2RL0A 2XWJI 4AYDA 5FO8C 2O39C 3T5OA 1OK2A 1MD7A 3OXUD 1HCCA 4MUCA 4DJZA 3MQLA 4WJG2 2IZ4A 2YRAA 3GOVA 4AYMA 1CKLA 2RKZA 2RLQA 1C1ZA 2CG6A 4CSYA 5HYPA 2W80A 5JPMG 1HFIA 2UWNA 4AYEA 1U5MA 3TVJA 3SW0X 1E88A 2G7IA 3NFPI 4C16A 1H03P 1H2QP 1LY2A 3OEDC 1QGBA 4A5WB 4ZH1D 3IX0A 2JGXA 1NWVA 1TPNA 1ZJKA 3GXEA 4LOSA 1OK1A 5HZPB 4KKDA 2W81A 1GPZA 4YNXA 4ONTD 1G4FA 1GKGA 3R62A 1UOTP 1Z92B 2B5ID 2XRBA 3ZD1A 5I0QB 3INBC 2CG7A 1TPMA 2IZ3A 1ELVA 3O8EB 4K12A 1OJYA 2BZMA 4B2RA 1MD8A 1OK9A 1FBRA 1SS2A 1OJVA 3ZD2A 2KMSA 1OK3A 2MCZA 3ZRZA 2XWBF 4B2SA 1GHQB 1E5GA 2YBYA 1GKNA 2ERJA 4J38B 2WIIC 4LOTA 1SRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU3 I;  2V8E A;  2RKY A;  4IGD A;  1O9A A;  4PZ5 A;  4FXG G;  2JGW A;  2EHF A;  2XRD A;  4JHS A;  1OJW A;  1QUB A;  4AYI A;  2LOJ A;  3CAL A;  3EJH A;  4F4O C;  2EC3 A;  1QO6 A;  2KRI A;  3ERB A;  3RJ3 D;  1VVC A;  1E8B A;  3L89 M;  1Q3X A;  1G4G A;  3KXV A;  3M7P A;  2A55 A;  1HFH A;  3OP8 A;  1TPG A;  1H04 P;  2CKU A;  5HYT B;  3KZJ A;  2QY0 A;  2XQW C;  2JRA A;  1VVD A;  5HYU B;  1PPQ A;  2RLP A;  1H2P P;  2MCY A;  2RL0 A;  2XWJ I;  4AYD A;  5FO8 C;  2O39 C;  3T5O A;  1OK2 A;  1MD7 A;  3OXU D;  1HCC A;  4MUC A;  4DJZ A;  3MQL A;  4WJG 2;  2IZ4 A;  2YRA A;  3GOV A;  4AYM A;  1CKL A;  2RKZ A;  2RLQ A;  1C1Z A;  2CG6 A;  4CSY A;  5HYP A;  2W80 A;  5JPM G;  1HFI A;  2UWN A;  4AYE A;  1U5M A;  3TVJ A;  3SW0 X;  1E88 A;  2G7I A;  3NFP I;  4C16 A;  1H03 P;  1H2Q P;  1LY2 A;  3OED C;  1QGB A;  4A5W B;  4ZH1 D;  3IX0 A;  2JGX A;  1NWV A;  1TPN A;  1ZJK A;  3GXE A;  4LOS A;  1OK1 A;  5HZP B;  4KKD A;  2W81 A;  1GPZ A;  4YNX A;  4ONT D;  1G4F A;  1GKG A;  3R62 A;  1UOT P;  1Z92 B;  2B5I D;  2XRB A;  3ZD1 A;  5I0Q B;  3INB C;  2CG7 A;  1TPM A;  2IZ3 A;  1ELV A;  3O8E B;  4K12 A;  1OJY A;  2BZM A;  4B2R A;  1MD8 A;  1OK9 A;  1FBR A;  1SS2 A;  1OJV A;  3ZD2 A;  2KMS A;  1OK3 A;  2MCZ A;  3ZRZ A;  2XWB F;  4B2S A;  1GHQ B;  1E5G A;  2YBY A;  1GKN A;  2ERJ A;  4J38 B;  2WII C;  4LOT A;  1SRZ A; 
#chains in the Genus database with same CATH topology
 3IU3 I;  2V8E A;  2RKY A;  4IGD A;  1O9A A;  4PZ5 A;  4FXG G;  2JGW A;  2EHF A;  2XRD A;  4JHS A;  3K3T A;  1OJW A;  1QUB A;  4AYI A;  2LOJ A;  3CAL A;  3EJH A;  4F4O C;  2EC3 A;  1QO6 A;  2KRI A;  3ERB A;  3RJ3 D;  1VVC A;  1E8B A;  3NJA A;  3L89 M;  1Q3X A;  4N7E A;  1G4G A;  3KXV A;  3M7P A;  2A55 A;  1HFH A;  3OP8 A;  1TPG A;  1H04 P;  2CKU A;  3FGR A;  5HYT B;  3KZJ A;  2QY0 A;  2XQW C;  2JRA A;  1VVD A;  5HYU B;  1PPQ A;  2RLP A;  5DN4 A;  2Y8S A;  1H2P P;  2MCY A;  2RL0 A;  2XWJ I;  4AYD A;  5FO8 C;  2O39 C;  3FGT A;  3T5O A;  3WSX A;  1OK2 A;  1MD7 A;  3OXU D;  1HCC A;  2X2Z A;  4MUC A;  4DJZ A;  3MQL A;  4WJG 2;  2IZ4 A;  2YRA A;  3GOV A;  1RLH A;  3ZLE A;  4AYM A;  1CKL A;  2RKZ A;  2RLQ A;  1C1Z A;  2CG6 A;  3F6K A;  4CSY A;  5HYP A;  4APL A;  2W80 A;  5JPM G;  3WSY A;  1HFI A;  2UWN A;  4AYE A;  1U5M A;  3TVJ A;  3SW0 X;  1E88 A;  2G7I A;  3NFP I;  4C16 A;  1H03 P;  3VWO A;  1H2Q P;  1LY2 A;  3OED C;  1QGB A;  4A5W B;  4ZH1 D;  3IX0 A;  2ZYC A;  2JGX A;  1NWV A;  1TPN A;  1ZJK A;  3GXE A;  3ZLD A;  4LOS A;  1OK1 A;  3CI0 J;  5HZP B;  4KKD A;  4BWC A;  2W81 A;  1GPZ A;  4YNX A;  4ONT D;  1G4F A;  1GKG A;  3R62 A;  1UOT P;  2Y8T A;  1Z92 B;  2B5I D;  2XRB A;  3ZD1 A;  5I0Q B;  3INB C;  2CG7 A;  4PO7 A;  4YIZ A;  1TPM A;  2IZ3 A;  1ELV A;  3O8E B;  4K12 A;  1OJY A;  2BZM A;  4B2R A;  1MD8 A;  1OK9 A;  1FBR A;  1SS2 A;  1OJV A;  3ZD2 A;  2KMS A;  1OK3 A;  2MCZ A;  4MSL A;  3ZRZ A;  5DN5 A;  2XWB F;  2Y8R A;  4B2S A;  1GHQ B;  1E5G A;  2YBY A;  1GKN A;  2ERJ A;  2I2L A;  4J38 B;  2WII C;  4LOT A;  1SRZ A; 
#chains in the Genus database with same CATH homology
 3IU3 I;  2V8E A;  2RKY A;  4IGD A;  1O9A A;  4PZ5 A;  4FXG G;  2JGW A;  2EHF A;  2XRD A;  4JHS A;  1OJW A;  1QUB A;  4AYI A;  2LOJ A;  3CAL A;  3EJH A;  4F4O C;  2EC3 A;  1QO6 A;  2KRI A;  3ERB A;  3RJ3 D;  1VVC A;  1E8B A;  3L89 M;  1Q3X A;  1G4G A;  3KXV A;  3M7P A;  2A55 A;  1HFH A;  3OP8 A;  1TPG A;  1H04 P;  2CKU A;  5HYT B;  3KZJ A;  2QY0 A;  2XQW C;  2JRA A;  1VVD A;  5HYU B;  1PPQ A;  2RLP A;  1H2P P;  2MCY A;  2RL0 A;  2XWJ I;  4AYD A;  5FO8 C;  2O39 C;  3T5O A;  1OK2 A;  1MD7 A;  3OXU D;  1HCC A;  4MUC A;  4DJZ A;  3MQL A;  4WJG 2;  2IZ4 A;  2YRA A;  3GOV A;  4AYM A;  1CKL A;  2RKZ A;  2RLQ A;  1C1Z A;  2CG6 A;  4CSY A;  5HYP A;  2W80 A;  5JPM G;  1HFI A;  2UWN A;  4AYE A;  1U5M A;  3TVJ A;  3SW0 X;  1E88 A;  2G7I A;  3NFP I;  4C16 A;  1H03 P;  1H2Q P;  1LY2 A;  3OED C;  1QGB A;  4A5W B;  4ZH1 D;  3IX0 A;  2JGX A;  1NWV A;  1TPN A;  1ZJK A;  3GXE A;  4LOS A;  1OK1 A;  5HZP B;  4KKD A;  2W81 A;  1GPZ A;  4YNX A;  4ONT D;  1G4F A;  1GKG A;  3R62 A;  1UOT P;  1Z92 B;  2B5I D;  2XRB A;  3ZD1 A;  5I0Q B;  3INB C;  2CG7 A;  1TPM A;  2IZ3 A;  1ELV A;  3O8E B;  4K12 A;  1OJY A;  2BZM A;  4B2R A;  1MD8 A;  1OK9 A;  1FBR A;  1SS2 A;  1OJV A;  3ZD2 A;  2KMS A;  1OK3 A;  2MCZ A;  3ZRZ A;  2XWB F;  4B2S A;  1GHQ B;  1E5G A;  2YBY A;  1GKN A;  2ERJ A;  4J38 B;  2WII C;  4LOT A;  1SRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...