3TVVA

Structure of the tandem ph domains of rtt106 (residues 68-315)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
244
structure length
233
Chain Sequence
MSETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRKQMKDKSMSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 50
structure length 233
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tvvA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tvvA01
1GC7A 1I2HA 5C5BA 2K2UA 5LONB 5CLQB 1UNQA 1M7RA 1DYNA 2XQNM 3RCPA 1V5UA 3D8EA 2D11A 4Z2NA 2ELBA 4GXBA 2YSZA 2X18A 3PVLA 4TKNA 4Y94A 2ELAA 1TXDA 3AU5A 4EMOA 1XODA 3TFMA 1LB1A 3F0WA 4H8SA 1N3HA 1KI1B 3V5WA 3FM8C 3SO6A 1NU2A 1DDVA 3PVUA 1M7EA 5J3QA 3PSCA 5HE3A 3ZDTA 5KQ1A 2K2JA 5CLLB 2UZRA 3ZVRA 1FB8A 4A6FA 1E5WA 4DX8A 2QKMA 5L81A 2D9ZA 1TJ6A 5LOPB 2DA0A 2RNRB 4DBBA 2LULA 2W2XC 1W1DA 2KCJA 2RLOA 5HE0A 2J59M 4F7GA 3PZDA 4MT7A 4MK0A 2COAA 5J3YA 2IFSA 2N23A 1W1HA 2CODA 3SV1A 5C6RA 1WGQA 2GCJA 1K5GB 2J0KA 1X86A 2COCA 1FHWA 4HB3B 1ZM0A 3ULBA 1UNPA 2LOXA 4F7HA 4KAXB 4HAZB 2LG1A 2DHIA 3G9WA 1PFJA 2CY4A 2ROVA 3TO1A 1MPHA 3N7CA 1UPRA 4A6HA 2I1JA 2M38A 2I5CA 1DDMA 4NY0A 2MKRA 5HE2A 1V5PA 2UVMA 1J0WA 4CYEA 5DH9B 2Z0OA 4A5KA 3GYPA 1FGZA 3ODXA 1KZ7A 3ODWA 3AU4A 1X05A 1MK7B 2I5FA 4GMVA 2YT0A 1SHCA 2PZ1A 5DIFB 2D4QA 5FI1A 1WVHA 1MK9B 5C16A 1XR0B 1X1FA 2LYDA 1I7AA 2AEHA 3VIAA 2Y8GA 4K2PA 1TQZA 2EC1A 4B6HA 1UPQA 2DYNA 2DFKA 2OTXA 3TCAA 3QIJA 1V89A 1H4RA 1XKEA 2RUKB 1GG3A 4WVFB 3SUZA 1AWEA 2CRFA 2P0HA 1DDWA 4IFSA 3WYFB 4BBKA 1FAOA 3QWMA 3P7ZA 2D9XA 1V88A 4HATB 1RRPB 1U2BA 2EJ8A 2HE7A 2RVBB 5DI9B 2Y7BA 1SGHA 2Q13A 4IAPA 5C5BB 4DXAB 1X1GA 2RGNB 2VRWB 2GCLA 3MDBC 1WG7A 1V5MA 4HAWB 4K17A 3D8FA 1UEFA 4PNKA 1XD4A 1EAZA 4XWXA 4HAYB 2K00A 5HE1A 1OQNA 3BINA 4EJNA 5D27A 1AQCA 3GYOA 3KY9A 3NSUA 1Y19B 3QBVB 5JHHA 2V76A 1XCGA 1P6SA 5D3WA 1P5TA 1ZC3B 3D8DA 1ZC4B 1RJ2A 4ZRJA 2P0DA 4A6FB 1ZSQA 4K81A 2AL6A 4HAVB 1U27A 2Z0QA 3KRXA 4NSWA 2DLWA 2D9VA 4GPTB 5D3VA 2QKLA 2KUPA 1V61A 1K5DB 2YT1A 3IVFA 1U5EA 2DKQA 4KVGB 3P6AA 4F7UP 2YF0A 1Y5OA 3OANA 1MAIA 5KCVA 3VOQA 2I1KA 2H7DA 2D10A 1FHOA 2YS1A 3KZ1A 1WGUA 3F5RA 4YONA 4Z2MB 1IRSA 5FI0A 4IOYX 3HQCA 3T06A 1PLSA 3SNHA 2DN6A 1WJMA 3MPXA 3AJ4A 3TW1A 5EFXA 2H7EA 2YRYA 5JLJB 2KGXB 3CXBB 2G35A 4GMXB 1NTYA 4YL8A 3PP2A 5GOWB 4C0AA 3FEHA 2DHJA 2OQBA 2ROZB 1J19A 3SYXA 4HHVA 4EKUA 4CHMA 1FOEA 1WI1A 3PVWA 5JHGA 2IYBA 2JP2A 2NZ8B 4GZUA 4WSFA 1NI2A 3A98B 3ULCA 4HB0B 1UNRA 2P8VA 1BTNA 3A8QA 1ZVRA 3KSYA 2MWNB 4CHJA 4TYZA 5D3YA 4HB4B 1W1GA 4KHBB 2GS0A 2R0DA 1QQGA 2DTCA 2DX1A 3A8PA 5J3TA 1EVHA 1Z87A 2ZPYA 3WA0A 3O96A 2YS5A 1NTVA 3DXEA 5JP4A 1BAKA 2EMSA 2Z0PA 4MY6A 3HW2B 2L2IA 4PQ0A 2LKOA 2FJLA 3CIKA 2LOZA 2DX5A 3U7DA 4A6KA 1U5DA 2N0YA 2DHKA 3X23A 1BTKA 2W2WA 2HTHB 3ODOA 2MDXA 3HK0A 4KHAA 1EGXA 5DHFB 1U5FA 1MIZB 4WJ7A 2R09A 3DXDA 2DKPA 1GC6A 1FGYA 4HAXB 4D0NB 3U8ZA 1B55A 3LJUX 1U29A 2D9WA 2L1CA 4ZRKA 1PMSA 2ADZA 2J0MA 3FSSA 4ZRIA 2W2XD 2D9YA 2E2XA 3BJIA 4GN1A 5DHAB 1H10A 2J0JA 4HAUB 2YVCA 1WJ1A 2DYQA 2VKIA 2NMBA 1EF1A 3TVVA 1MIXA 2M14A 1BWNA 1X11A 3DXCA 1QC6A 4L6EA 2VSZA 5C79A 3PEGA 3UZTA 1KZGA 1DROA 3PG7A 5KQ4A 2MFQA 2D2QA 2RSGA 1U5GA 3ML4A 1Q67A 2EMTA 1OMWA 2P0FA 4KHOA 1ISNA 1XX0A 1OY2A 3M1IB 4HDOA 1FHXA 2GJYA 4HB2B 5D3XA 4DX90 2CAYA 2UZSA 4P7IA 1DBHA 4K2OA 2BCJA 2COFA 2Y8FA 2YS3A 1LW3A 1MKEA 3KRWA 4HDQA 2CY5A 1P3RA
chains in the Genus database with same CATH superfamily
1GC7A 1I2HA 5C5BA 2FJUB 2K2UA 5LONB 5CLQB 1UNQA 1M7RA 1DYNA 2XQNM 3RCPA 1V5UA 3D8EA 2D11A 4Z2NA 2ELBA 4GXBA 2YSZA 3A58A 2X18A 3PVLA 4TKNA 4Y94A 2ELAA 1TXDA 3AU5A 4EMOA 3NWFA 1XODA 3TFMA 1LB1A 3F0WA 4H8SA 1N3HA 1KI1B 3V5WA 3FM8C 3SO6A 1NU2A 1DDVA 3PVUA 1M7EA 5J3QA 3PSCA 5HE3A 3ZDTA 5KQ1A 2K49A 2K2JA 5CLLB 2UZRA 3ZVRA 2K8EA 1FB8A 4A6FA 1E5WA 4DX8A 2QKMA 5L81A 2D9ZA 1TJ6A 5LOPB 2DA0A 2RNRB 4DBBA 2LULA 2W2XC 1W1DA 2KCJA 2RLOA 5HE0A 2J59M 4F7GA 3U12A 3PZDA 4MT7A 4MK0A 2COAA 5J3YA 2IFSA 2N23A 1W1HA 2CODA 3SV1A 5C6RA 1WGQA 2GCJA 1K5GB 2J0KA 2ZKMX 1X86A 2YT2A 2COCA 1FHWA 4HB3B 1ZM0A 4CSQA 3FVCA 3ULBA 1UNPA 2LOXA 4F7HA 4KAXB 2RRFA 4D6WA 4HAZB 2LG1A 2DHIA 3G9WA 1PFJA 2CY4A 2ROVA 3TO1A 1MPHA 3N7CA 1UPRA 4A6HA 4DIXA 2I1JA 2M38A 2I5CA 4OSNA 1DDMA 4NY0A 2MKRA 1T77A 2KIGA 5HE2A 1V5PA 2UVMA 1J0WA 4CYEA 5DH9B 2Z0OA 4A5KA 3GYPA 1FGZA 3ODXA 1KZ7A 3ODWA 3AU4A 1X05A 1MK7B 4QJ5B 2KUQA 2I5FA 4GMVA 2YT0A 1SHCA 2PZ1A 5DIFB 2D4QA 2NBVA 5FI1A 1WVHA 1MK9B 5C16A 1XR0B 1X1FA 2LYDA 1I7AA 2AEHA 3VIAA 2Y8GA 4L1RA 4K2PA 1TQZA 2EC1A 4B6HA 1UPQA 4KHBA 2DYNA 2DFKA 2OTXA 3TCAA 3QIJA 1V89A 1H4RA 1XKEA 5I2MA 2RUKB 1GG3A 4WVFB 3SUZA 2Z13A 3B77A 1AWEA 2CRFA 2P0HA 1DDWA 4IFSA 3WYFB 4BBKA 1FAOA 3QWMA 3P7ZA 2D9XA 1V88A 4HATB 1RRPB 1U2BA 2EJ8A 2HE7A 2RVBB 5DI9B 2Y7BA 1SGHA 2Q13A 4IAPA 5C5BB 4DXAB 1X1GA 2RGNB 2VRWB 2GCLA 2Z59A 3MDBC 1WG7A 1V5MA 4HAWB 4K17A 3D8FA 1UEFA 1MI1A 4PNKA 1XD4A 1EAZA 4XWXA 4HAYB 2K00A 2Z14A 5HE1A 1OQNA 3BINA 4EJNA 5D27A 5M4YB 1AQCA 3GYOA 3KY9A 3NSUA 1Y19B 3QBVB 5JHHA 2V76A 1XCGA 1P6SA 5D3WA 1P5TA 4HSIA 1ZC3B 4GNKB 3D8DA 1ZC4B 1RJ2A 4ZRJA 2P0DA 4A6FB 1ZSQA 4K81A 2AL6A 4HAVB 1U27A 2Z0QA 3KRXA 4NSWA 2DLWA 2D9VA 4GPTB 5D3VA 2QKLA 2KUPA 1V61A 2KR0A 1K5DB 2YT1A 3IVFA 1U5EA 2DKQA 4KVGB 4QJ3B 3P6AA 4F7UP 2YF0A 1Y5OA 3OANA 1MAIA 5KCVA 3VOQA 2I1KA 2H7DA 2D10A 1FHOA 2YS1A 3KZ1A 1WGUA 3F5RA 4YONA 4Z2MB 1IRSA 5FI0A 4IOYX 3HQCA 3T06A 1PLSA 3SNHA 2DN6A 1WJMA 3MPXA 3AJ4A 3TW1A 5EFXA 2H7EA 2YRYA 4QJ4B 5JLJB 2KGXB 3CXBB 2G35A 4OT1A 4GMXB 1NTYA 4YL8A 3PP2A 5GOWB 4C0AA 3FEHA 2DHJA 2OQBA 5I2SA 2ROZB 1J19A 3HSAA 3SYXA 4HHVA 4EKUA 4CHMA 1FOEA 1WI1A 3PVWA 5JHGA 2IYBA 2JP2A 2NZ8B 2R2YA 5IRSA 4GZUA 4WSFA 1NI2A 3A98B 3ULCA 2GUMA 4HB0B 1UNRA 2P8VA 1BTNA 3A8QA 1ZVRA 3KSYA 2MWNB 4CHJA 4TYZA 5D3YA 4HB4B 1W1GA 4KHBB 2GS0A 2R0DA 1QQGA 2DTCA 2Z4DA 2DX1A 3A8PA 5J3TA 1ZYIA 1EVHA 1Z87A 2ZPYA 5LG4B 3WA0A 3O96A 2YS5A 1NTVA 3DXEA 5JP4A 1BAKA 2EMSA 2Z0PA 4MY6A 3HW2B 2L2IA 4PQ0A 2LKOA 2FJLA 3CIKA 2LOZA 2DX5A 3U7DA 4A6KA 1U5DA 2N0YA 2DHKA 3X23A 1BTKA 2W2WA 2HTHB 3NWDA 3ODOA 2MDXA 3HK0A 4KHAA 1EGXA 5DHFB 1U5FA 1MIZB 4WJ7A 3NWAA 2R09A 3DXDA 4QXAB 2DKPA 1GC6A 1FGYA 4HAXB 4D0NB 3U8ZA 1B55A 3LJUX 1U29A 2D9WA 2L1CA 4ZRKA 2KIEA 1PMSA 2ADZA 2J0MA 3FSSA 3DCXA 4ZRIA 2W2XD 2D9YA 2E2XA 3BJIA 4GN1A 5DHAB 1H10A 2J0JA 4HAUB 2YVCA 1WJ1A 2DYQA 2VKIA 2NMBA 1EF1A 3TVVA 1MIXA 2M14A 1BWNA 1X11A 3DXCA 1QC6A 4L6EA 2VSZA 5C79A 3PEGA 4GOUA 3UZTA 1KZGA 1DROA 3PG7A 5KQ4A 3NW8A 2MFQA 2D2QA 2RSGA 1U5GA 3ML4A 1Q67A 2EMTA 1OMWA 3OHMB 2P0FA 4KHOA 1ISNA 1XX0A 1OY2A 3M1IB 4HDOA 1FHXA 2GJYA 4HB2B 5D3XA 4DX90 2CAYA 2UZSA 4P7IA 1DBHA 4K2OA 2BCJA 2COFA 2Y8FA 2YS3A 1LW3A 1MKEA 3KRWA 4HDQA 2CY5A 3HIEA 1P3RA
chains in the Genus database with same CATH topology
1GC7A 1I2HA 5C5BA 2K2UA 2FJUB 5LONB 5CLQB 1UNQA 1M7RA 1DYNA 2XQNM 3RCPA 1V5UA 3D8EA 2D11A 4Z2NA 2ELBA 4GXBA 2YSZA 3A58A 2X18A 3PVLA 4TKNA 4Y94A 2ELAA 1TXDA 3AU5A 4EMOA 3NWFA 1XODA 3TFMA 1LB1A 3F0WA 4H8SA 1N3HA 1KI1B 3V5WA 3FM8C 3SO6A 1NU2A 1DDVA 3PVUA 1M7EA 5J3QA 3PSCA 5HE3A 3ZDTA 5KQ1A 2K49A 2K2JA 5CLLB 2UZRA 3ZVRA 2K8EA 1FB8A 4A6FA 1E5WA 4DX8A 2QKMA 5L81A 2D9ZA 1TJ6A 5LOPB 2DA0A 2RNRB 4DBBA 2LULA 2W2XC 1W1DA 2KCJA 2RLOA 5HE0A 2J59M 4F7GA 3U12A 3PZDA 4MT7A 4MK0A 2COAA 5J3YA 2IFSA 2N23A 1W1HA 2CODA 3SV1A 5C6RA 1WGQA 2GCJA 1K5GB 2J0KA 2ZKMX 1X86A 2YT2A 2COCA 1FHWA 4HB3B 1ZM0A 4CSQA 3FVCA 3ULBA 1UNPA 2LOXA 4F7HA 4KAXB 2RRFA 4D6WA 4HAZB 2LG1A 2DHIA 3G9WA 1PFJA 2CY4A 2ROVA 3TO1A 1MPHA 3N7CA 1UPRA 4A6HA 4DIXA 2I1JA 2M38A 2I5CA 1DDMA 4OSNA 4NY0A 2MKRA 2KIGA 5HE2A 1V5PA 2UVMA 1J0WA 4CYEA 5DH9B 2Z0OA 4A5KA 3GYPA 1FGZA 3ODXA 1KZ7A 3ODWA 3AU4A 1X05A 1MK7B 4QJ5B 2KUQA 2I5FA 4GMVA 2YT0A 1SHCA 2PZ1A 5DIFB 2D4QA 2NBVA 5FI1A 1WVHA 1MK9B 5C16A 1XR0B 1X1FA 2LYDA 1I7AA 2AEHA 3VIAA 2Y8GA 4L1RA 4K2PA 1TQZA 2EC1A 4B6HA 1UPQA 4KHBA 2DYNA 2DFKA 2OTXA 3TCAA 3QIJA 1V89A 1H4RA 1XKEA 5I2MA 2RUKB 1GG3A 4WVFB 3SUZA 1AWEA 2Z13A 2CRFA 2P0HA 1DDWA 4IFSA 3WYFB 4BBKA 1FAOA 3QWMA 3P7ZA 2D9XA 1V88A 4HATB 1RRPB 1U2BA 2EJ8A 2HE7A 2RVBB 5DI9B 2Y7BA 1SGHA 2Q13A 4IAPA 5C5BB 4DXAB 1X1GA 2RGNB 2VRWB 2GCLA 2Z59A 3MDBC 1WG7A 1V5MA 4HAWB 4K17A 3D8FA 1UEFA 4PNKA 1XD4A 1EAZA 4XWXA 4HAYB 2K00A 2Z14A 5HE1A 1OQNA 3BINA 4EJNA 5D27A 5M4YB 1AQCA 3GYOA 3KY9A 3NSUA 1Y19B 3QBVB 5JHHA 2V76A 1XCGA 1P6SA 5D3WA 1P5TA 4HSIA 1ZC3B 4GNKB 3D8DA 1ZC4B 1RJ2A 4ZRJA 2P0DA 4A6FB 1ZSQA 4K81A 2AL6A 4HAVB 1U27A 2Z0QA 3KRXA 4NSWA 2DLWA 2D9VA 4GPTB 5D3VA 2QKLA 2KUPA 1V61A 2KR0A 1K5DB 2YT1A 3IVFA 1U5EA 2DKQA 4KVGB 4QJ3B 3P6AA 4F7UP 2YF0A 1Y5OA 3OANA 1MAIA 5KCVA 3VOQA 2I1KA 2H7DA 2D10A 1FHOA 2YS1A 3KZ1A 1WGUA 3F5RA 4YONA 4Z2MB 1IRSA 5FI0A 4IOYX 3HQCA 3T06A 1PLSA 3SNHA 2DN6A 1WJMA 3MPXA 3AJ4A 3TW1A 5EFXA 2H7EA 2YRYA 4QJ4B 5JLJB 2KGXB 3CXBB 2G35A 4OT1A 4GMXB 1NTYA 4YL8A 3PP2A 5GOWB 4C0AA 3FEHA 2DHJA 2OQBA 5I2SA 2ROZB 1J19A 3SYXA 4HHVA 4EKUA 4CHMA 1FOEA 1WI1A 3PVWA 5JHGA 2IYBA 2JP2A 2NZ8B 2R2YA 5IRSA 4GZUA 4WSFA 1NI2A 3A98B 3ULCA 2GUMA 4HB0B 1UNRA 2P8VA 1BTNA 3A8QA 1ZVRA 3KSYA 2MWNB 4CHJA 4TYZA 5D3YA 4HB4B 1W1GA 4KHBB 2GS0A 2R0DA 1QQGA 2DTCA 2Z4DA 2DX1A 3A8PA 5J3TA 1ZYIA 1EVHA 1Z87A 2ZPYA 5LG4B 3WA0A 3O96A 2YS5A 1NTVA 3DXEA 5JP4A 1BAKA 2EMSA 2Z0PA 4MY6A 3HW2B 2L2IA 4PQ0A 2LKOA 2FJLA 3CIKA 2LOZA 2DX5A 3U7DA 4A6KA 1U5DA 2N0YA 2DHKA 3X23A 1BTKA 2W2WA 2HTHB 3NWDA 3ODOA 2MDXA 3HK0A 4KHAA 1EGXA 5DHFB 1U5FA 1MIZB 4WJ7A 3NWAA 2R09A 3DXDA 4QXAB 2DKPA 1GC6A 1FGYA 4HAXB 4D0NB 3U8ZA 1B55A 3LJUX 1U29A 2D9WA 2L1CA 4ZRKA 2KIEA 1PMSA 2ADZA 2J0MA 3FSSA 4ZRIA 2W2XD 2D9YA 2E2XA 3BJIA 4GN1A 5DHAB 1H10A 2J0JA 4HAUB 2YVCA 1WJ1A 2DYQA 2VKIA 2NMBA 1EF1A 3TVVA 1MIXA 2M14A 1BWNA 1X11A 3DXCA 1QC6A 4L6EA 2VSZA 5C79A 3PEGA 3UZTA 4GOUA 1KZGA 1DROA 3PG7A 5KQ4A 3NW8A 2MFQA 2D2QA 2RSGA 1U5GA 3ML4A 1Q67A 2EMTA 1OMWA 3OHMB 2P0FA 4KHOA 1ISNA 1XX0A 1OY2A 3M1IB 4HDOA 1FHXA 2GJYA 4HB2B 5D3XA 4DX90 2CAYA 2UZSA 4P7IA 1DBHA 4K2OA 2BCJA 2COFA 2Y8FA 2YS3A 1LW3A 1MKEA 3KRWA 4HDQA 2CY5A 3HIEA 1P3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  1I2H A;  5C5B A;  2K2U A;  5LON B;  5CLQ B;  1UNQ A;  1M7R A;  1DYN A;  2XQN M;  3RCP A;  1V5U A;  3D8E A;  2D11 A;  4Z2N A;  2ELB A;  4GXB A;  2YSZ A;  2X18 A;  3PVL A;  4TKN A;  4Y94 A;  2ELA A;  1TXD A;  3AU5 A;  4EMO A;  1XOD A;  3TFM A;  1LB1 A;  3F0W A;  4H8S A;  1N3H A;  1KI1 B;  3V5W A;  3FM8 C;  3SO6 A;  1NU2 A;  1DDV A;  3PVU A;  1M7E A;  5J3Q A;  3PSC A;  5HE3 A;  3ZDT A;  5KQ1 A;  2K2J A;  5CLL B;  2UZR A;  3ZVR A;  1FB8 A;  4A6F A;  1E5W A;  4DX8 A;  2QKM A;  5L81 A;  2D9Z A;  1TJ6 A;  5LOP B;  2DA0 A;  2RNR B;  4DBB A;  2LUL A;  2W2X C;  1W1D A;  2KCJ A;  2RLO A;  5HE0 A;  2J59 M;  4F7G A;  3PZD A;  4MT7 A;  4MK0 A;  2COA A;  5J3Y A;  2IFS A;  2N23 A;  1W1H A;  2COD A;  3SV1 A;  5C6R A;  1WGQ A;  2GCJ A;  1K5G B;  2J0K A;  1X86 A;  2COC A;  1FHW A;  4HB3 B;  1ZM0 A;  3ULB A;  1UNP A;  2LOX A;  4F7H A;  4KAX B;  4HAZ B;  2LG1 A;  2DHI A;  3G9W A;  1PFJ A;  2CY4 A;  2ROV A;  3TO1 A;  1MPH A;  3N7C A;  1UPR A;  4A6H A;  2I1J A;  2M38 A;  2I5C A;  1DDM A;  4NY0 A;  2MKR A;  5HE2 A;  1V5P A;  2UVM A;  1J0W A;  4CYE A;  5DH9 B;  2Z0O A;  4A5K A;  3GYP A;  1FGZ A;  3ODX A;  1KZ7 A;  3ODW A;  3AU4 A;  1X05 A;  1MK7 B;  2I5F A;  4GMV A;  2YT0 A;  1SHC A;  2PZ1 A;  5DIF B;  2D4Q A;  5FI1 A;  1WVH A;  1MK9 B;  5C16 A;  1XR0 B;  1X1F A;  2LYD A;  1I7A A;  2AEH A;  3VIA A;  2Y8G A;  4K2P A;  1TQZ A;  2EC1 A;  4B6H A;  1UPQ A;  2DYN A;  2DFK A;  2OTX A;  3TCA A;  3QIJ A;  1V89 A;  1H4R A;  1XKE A;  2RUK B;  1GG3 A;  4WVF B;  3SUZ A;  1AWE A;  2CRF A;  2P0H A;  1DDW A;  4IFS A;  3WYF B;  4BBK A;  1FAO A;  3QWM A;  3P7Z A;  2D9X A;  1V88 A;  4HAT B;  1RRP B;  1U2B A;  2EJ8 A;  2HE7 A;  2RVB B;  5DI9 B;  2Y7B A;  1SGH A;  2Q13 A;  4IAP A;  5C5B B;  4DXA B;  1X1G A;  2RGN B;  2VRW B;  2GCL A;  3MDB C;  1WG7 A;  1V5M A;  4HAW B;  4K17 A;  3D8F A;  1UEF A;  4PNK A;  1XD4 A;  1EAZ A;  4XWX A;  4HAY B;  2K00 A;  5HE1 A;  1OQN A;  3BIN A;  4EJN A;  5D27 A;  1AQC A;  3GYO A;  3KY9 A;  3NSU A;  1Y19 B;  3QBV B;  5JHH A;  2V76 A;  1XCG A;  1P6S A;  5D3W A;  1P5T A;  1ZC3 B;  3D8D A;  1ZC4 B;  1RJ2 A;  4ZRJ A;  2P0D A;  4A6F B;  1ZSQ A;  4K81 A;  2AL6 A;  4HAV B;  1U27 A;  2Z0Q A;  3KRX A;  4NSW A;  2DLW A;  2D9V A;  4GPT B;  5D3V A;  2QKL A;  2KUP A;  1V61 A;  1K5D B;  2YT1 A;  3IVF A;  1U5E A;  2DKQ A;  4KVG B;  3P6A A;  4F7U P;  2YF0 A;  1Y5O A;  3OAN A;  1MAI A;  5KCV A;  3VOQ A;  2I1K A;  2H7D A;  2D10 A;  1FHO A;  2YS1 A;  3KZ1 A;  1WGU A;  3F5R A;  4YON A;  4Z2M B;  1IRS A;  5FI0 A;  4IOY X;  3HQC A;  3T06 A;  1PLS A;  3SNH A;  2DN6 A;  1WJM A;  3MPX A;  3AJ4 A;  3TW1 A;  5EFX A;  2H7E A;  2YRY A;  5JLJ B;  2KGX B;  3CXB B;  2G35 A;  4GMX B;  1NTY A;  4YL8 A;  3PP2 A;  5GOW B;  4C0A A;  3FEH A;  2DHJ A;  2OQB A;  2ROZ B;  1J19 A;  3SYX A;  4HHV A;  4EKU A;  4CHM A;  1FOE A;  1WI1 A;  3PVW A;  5JHG A;  2IYB A;  2JP2 A;  2NZ8 B;  4GZU A;  4WSF A;  1NI2 A;  3A98 B;  3ULC A;  4HB0 B;  1UNR A;  2P8V A;  1BTN A;  3A8Q A;  1ZVR A;  3KSY A;  2MWN B;  4CHJ A;  4TYZ A;  5D3Y A;  4HB4 B;  1W1G A;  4KHB B;  2GS0 A;  2R0D A;  1QQG A;  2DTC A;  2DX1 A;  3A8P A;  5J3T A;  1EVH A;  1Z87 A;  2ZPY A;  3WA0 A;  3O96 A;  2YS5 A;  1NTV A;  3DXE A;  5JP4 A;  1BAK A;  2EMS A;  2Z0P A;  4MY6 A;  3HW2 B;  2L2I A;  4PQ0 A;  2LKO A;  2FJL A;  3CIK A;  2LOZ A;  2DX5 A;  3U7D A;  4A6K A;  1U5D A;  2N0Y A;  2DHK A;  3X23 A;  1BTK A;  2W2W A;  2HTH B;  3ODO A;  2MDX A;  3HK0 A;  4KHA A;  1EGX A;  5DHF B;  1U5F A;  1MIZ B;  4WJ7 A;  2R09 A;  3DXD A;  2DKP A;  1GC6 A;  1FGY A;  4HAX B;  4D0N B;  3U8Z A;  1B55 A;  3LJU X;  1U29 A;  2D9W A;  2L1C A;  4ZRK A;  1PMS A;  2ADZ A;  2J0M A;  3FSS A;  4ZRI A;  2W2X D;  2D9Y A;  2E2X A;  3BJI A;  4GN1 A;  5DHA B;  1H10 A;  2J0J A;  4HAU B;  2YVC A;  1WJ1 A;  2DYQ A;  2VKI A;  2NMB A;  1EF1 A;  3TVV A;  1MIX A;  2M14 A;  1BWN A;  1X11 A;  3DXC A;  1QC6 A;  4L6E A;  2VSZ A;  5C79 A;  3PEG A;  3UZT A;  1KZG A;  1DRO A;  3PG7 A;  5KQ4 A;  2MFQ A;  2D2Q A;  2RSG A;  1U5G A;  3ML4 A;  1Q67 A;  2EMT A;  1OMW A;  2P0F A;  4KHO A;  1ISN A;  1XX0 A;  1OY2 A;  3M1I B;  4HDO A;  1FHX A;  2GJY A;  4HB2 B;  5D3X A;  4DX9 0;  2CAY A;  2UZS A;  4P7I A;  1DBH A;  4K2O A;  2BCJ A;  2COF A;  2Y8F A;  2YS3 A;  1LW3 A;  1MKE A;  3KRW A;  4HDQ A;  2CY5 A;  1P3R A; 
#chains in the Genus database with same CATH topology
 1GC7 A;  1I2H A;  5C5B A;  2FJU B;  2K2U A;  5LON B;  5CLQ B;  1UNQ A;  1M7R A;  1DYN A;  2XQN M;  3RCP A;  1V5U A;  3D8E A;  2D11 A;  4Z2N A;  2ELB A;  4GXB A;  2YSZ A;  3A58 A;  2X18 A;  3PVL A;  4TKN A;  4Y94 A;  2ELA A;  1TXD A;  3AU5 A;  4EMO A;  3NWF A;  1XOD A;  3TFM A;  1LB1 A;  3F0W A;  4H8S A;  1N3H A;  1KI1 B;  3V5W A;  3FM8 C;  3SO6 A;  1NU2 A;  1DDV A;  3PVU A;  1M7E A;  5J3Q A;  3PSC A;  5HE3 A;  3ZDT A;  5KQ1 A;  2K49 A;  2K2J A;  5CLL B;  2UZR A;  3ZVR A;  2K8E A;  1FB8 A;  4A6F A;  1E5W A;  4DX8 A;  2QKM A;  5L81 A;  2D9Z A;  1TJ6 A;  5LOP B;  2DA0 A;  2RNR B;  4DBB A;  2LUL A;  2W2X C;  1W1D A;  2KCJ A;  2RLO A;  5HE0 A;  2J59 M;  4F7G A;  3U12 A;  3PZD A;  4MT7 A;  4MK0 A;  2COA A;  5J3Y A;  2IFS A;  2N23 A;  1W1H A;  2COD A;  3SV1 A;  5C6R A;  1WGQ A;  2GCJ A;  1K5G B;  2J0K A;  2ZKM X;  1X86 A;  2YT2 A;  2COC A;  1FHW A;  4HB3 B;  1ZM0 A;  4CSQ A;  3FVC A;  3ULB A;  1UNP A;  2LOX A;  4F7H A;  4KAX B;  2RRF A;  4D6W A;  4HAZ B;  2LG1 A;  2DHI A;  3G9W A;  1PFJ A;  2CY4 A;  2ROV A;  3TO1 A;  1MPH A;  3N7C A;  1UPR A;  4A6H A;  4DIX A;  2I1J A;  2M38 A;  2I5C A;  4OSN A;  1DDM A;  4NY0 A;  2MKR A;  1T77 A;  2KIG A;  5HE2 A;  1V5P A;  2UVM A;  1J0W A;  4CYE A;  5DH9 B;  2Z0O A;  4A5K A;  3GYP A;  1FGZ A;  3ODX A;  1KZ7 A;  3ODW A;  3AU4 A;  1X05 A;  1MK7 B;  4QJ5 B;  2KUQ A;  2I5F A;  4GMV A;  2YT0 A;  1SHC A;  2PZ1 A;  5DIF B;  2D4Q A;  2NBV A;  5FI1 A;  1WVH A;  1MK9 B;  5C16 A;  1XR0 B;  1X1F A;  2LYD A;  1I7A A;  2AEH A;  3VIA A;  2Y8G A;  4L1R A;  4K2P A;  1TQZ A;  2EC1 A;  4B6H A;  1UPQ A;  4KHB A;  2DYN A;  2DFK A;  2OTX A;  3TCA A;  3QIJ A;  1V89 A;  1H4R A;  1XKE A;  5I2M A;  2RUK B;  1GG3 A;  4WVF B;  3SUZ A;  2Z13 A;  3B77 A;  1AWE A;  2CRF A;  2P0H A;  1DDW A;  4IFS A;  3WYF B;  4BBK A;  1FAO A;  3QWM A;  3P7Z A;  2D9X A;  1V88 A;  4HAT B;  1RRP B;  1U2B A;  2EJ8 A;  2HE7 A;  2RVB B;  5DI9 B;  2Y7B A;  1SGH A;  2Q13 A;  4IAP A;  5C5B B;  4DXA B;  1X1G A;  2RGN B;  2VRW B;  2GCL A;  2Z59 A;  3MDB C;  1WG7 A;  1V5M A;  4HAW B;  4K17 A;  3D8F A;  1UEF A;  1MI1 A;  4PNK A;  1XD4 A;  1EAZ A;  4XWX A;  4HAY B;  2K00 A;  2Z14 A;  5HE1 A;  1OQN A;  3BIN A;  4EJN A;  5D27 A;  5M4Y B;  1AQC A;  3GYO A;  3KY9 A;  3NSU A;  1Y19 B;  3QBV B;  5JHH A;  2V76 A;  1XCG A;  1P6S A;  5D3W A;  1P5T A;  4HSI A;  1ZC3 B;  4GNK B;  3D8D A;  1ZC4 B;  1RJ2 A;  4ZRJ A;  2P0D A;  4A6F B;  1ZSQ A;  4K81 A;  2AL6 A;  4HAV B;  1U27 A;  2Z0Q A;  3KRX A;  4NSW A;  2DLW A;  2D9V A;  4GPT B;  5D3V A;  2QKL A;  2KUP A;  1V61 A;  2KR0 A;  1K5D B;  2YT1 A;  3IVF A;  1U5E A;  2DKQ A;  4KVG B;  4QJ3 B;  3P6A A;  4F7U P;  2YF0 A;  1Y5O A;  3OAN A;  1MAI A;  5KCV A;  3VOQ A;  2I1K A;  2H7D A;  2D10 A;  1FHO A;  2YS1 A;  3KZ1 A;  1WGU A;  3F5R A;  4YON A;  4Z2M B;  1IRS A;  5FI0 A;  4IOY X;  3HQC A;  3T06 A;  1PLS A;  3SNH A;  2DN6 A;  1WJM A;  3MPX A;  3AJ4 A;  3TW1 A;  5EFX A;  2H7E A;  2YRY A;  4QJ4 B;  5JLJ B;  2KGX B;  3CXB B;  2G35 A;  4OT1 A;  4GMX B;  1NTY A;  4YL8 A;  3PP2 A;  5GOW B;  4C0A A;  3FEH A;  2DHJ A;  2OQB A;  5I2S A;  2ROZ B;  1J19 A;  3HSA A;  3SYX A;  4HHV A;  4EKU A;  4CHM A;  1FOE A;  1WI1 A;  3PVW A;  5JHG A;  2IYB A;  2JP2 A;  2NZ8 B;  2R2Y A;  5IRS A;  4GZU A;  4WSF A;  1NI2 A;  3A98 B;  3ULC A;  2GUM A;  4HB0 B;  1UNR A;  2P8V A;  1BTN A;  3A8Q A;  1ZVR A;  3KSY A;  2MWN B;  4CHJ A;  4TYZ A;  5D3Y A;  4HB4 B;  1W1G A;  4KHB B;  2GS0 A;  2R0D A;  1QQG A;  2DTC A;  2Z4D A;  2DX1 A;  3A8P A;  5J3T A;  1ZYI A;  1EVH A;  1Z87 A;  2ZPY A;  5LG4 B;  3WA0 A;  3O96 A;  2YS5 A;  1NTV A;  3DXE A;  5JP4 A;  1BAK A;  2EMS A;  2Z0P A;  4MY6 A;  3HW2 B;  2L2I A;  4PQ0 A;  2LKO A;  2FJL A;  3CIK A;  2LOZ A;  2DX5 A;  3U7D A;  4A6K A;  1U5D A;  2N0Y A;  2DHK A;  3X23 A;  1BTK A;  2W2W A;  2HTH B;  3NWD A;  3ODO A;  2MDX A;  3HK0 A;  4KHA A;  1EGX A;  5DHF B;  1U5F A;  1MIZ B;  4WJ7 A;  3NWA A;  2R09 A;  3DXD A;  4QXA B;  2DKP A;  1GC6 A;  1FGY A;  4HAX B;  4D0N B;  3U8Z A;  1B55 A;  3LJU X;  1U29 A;  2D9W A;  2L1C A;  4ZRK A;  2KIE A;  1PMS A;  2ADZ A;  2J0M A;  3FSS A;  3DCX A;  4ZRI A;  2W2X D;  2D9Y A;  2E2X A;  3BJI A;  4GN1 A;  5DHA B;  1H10 A;  2J0J A;  4HAU B;  2YVC A;  1WJ1 A;  2DYQ A;  2VKI A;  2NMB A;  1EF1 A;  3TVV A;  1MIX A;  2M14 A;  1BWN A;  1X11 A;  3DXC A;  1QC6 A;  4L6E A;  2VSZ A;  5C79 A;  3PEG A;  4GOU A;  3UZT A;  1KZG A;  1DRO A;  3PG7 A;  5KQ4 A;  3NW8 A;  2MFQ A;  2D2Q A;  2RSG A;  1U5G A;  3ML4 A;  1Q67 A;  2EMT A;  1OMW A;  3OHM B;  2P0F A;  4KHO A;  1ISN A;  1XX0 A;  1OY2 A;  3M1I B;  4HDO A;  1FHX A;  2GJY A;  4HB2 B;  5D3X A;  4DX9 0;  2CAY A;  2UZS A;  4P7I A;  1DBH A;  4K2O A;  2BCJ A;  2COF A;  2Y8F A;  2YS3 A;  1LW3 A;  1MKE A;  3KRW A;  4HDQ A;  2CY5 A;  3HIE A;  1P3R A; 
#chains in the Genus database with same CATH homology
 1GC7 A;  1I2H A;  5C5B A;  2K2U A;  2FJU B;  5LON B;  5CLQ B;  1UNQ A;  1M7R A;  1DYN A;  2XQN M;  3RCP A;  1V5U A;  3D8E A;  2D11 A;  4Z2N A;  2ELB A;  4GXB A;  2YSZ A;  3A58 A;  2X18 A;  3PVL A;  4TKN A;  4Y94 A;  2ELA A;  1TXD A;  3AU5 A;  4EMO A;  3NWF A;  1XOD A;  3TFM A;  1LB1 A;  3F0W A;  4H8S A;  1N3H A;  1KI1 B;  3V5W A;  3FM8 C;  3SO6 A;  1NU2 A;  1DDV A;  3PVU A;  1M7E A;  5J3Q A;  3PSC A;  5HE3 A;  3ZDT A;  5KQ1 A;  2K49 A;  2K2J A;  5CLL B;  2UZR A;  3ZVR A;  2K8E A;  1FB8 A;  4A6F A;  1E5W A;  4DX8 A;  2QKM A;  5L81 A;  2D9Z A;  1TJ6 A;  5LOP B;  2DA0 A;  2RNR B;  4DBB A;  2LUL A;  2W2X C;  1W1D A;  2KCJ A;  2RLO A;  5HE0 A;  2J59 M;  4F7G A;  3U12 A;  3PZD A;  4MT7 A;  4MK0 A;  2COA A;  5J3Y A;  2IFS A;  2N23 A;  1W1H A;  2COD A;  3SV1 A;  5C6R A;  1WGQ A;  2GCJ A;  1K5G B;  2J0K A;  2ZKM X;  1X86 A;  2YT2 A;  2COC A;  1FHW A;  4HB3 B;  1ZM0 A;  4CSQ A;  3FVC A;  3ULB A;  1UNP A;  2LOX A;  4F7H A;  4KAX B;  2RRF A;  4D6W A;  4HAZ B;  2LG1 A;  2DHI A;  3G9W A;  1PFJ A;  2CY4 A;  2ROV A;  3TO1 A;  1MPH A;  3N7C A;  1UPR A;  4A6H A;  4DIX A;  2I1J A;  2M38 A;  2I5C A;  1DDM A;  4OSN A;  4NY0 A;  2MKR A;  2KIG A;  5HE2 A;  1V5P A;  2UVM A;  1J0W A;  4CYE A;  5DH9 B;  2Z0O A;  4A5K A;  3GYP A;  1FGZ A;  3ODX A;  1KZ7 A;  3ODW A;  3AU4 A;  1X05 A;  1MK7 B;  4QJ5 B;  2KUQ A;  2I5F A;  4GMV A;  2YT0 A;  1SHC A;  2PZ1 A;  5DIF B;  2D4Q A;  2NBV A;  5FI1 A;  1WVH A;  1MK9 B;  5C16 A;  1XR0 B;  1X1F A;  2LYD A;  1I7A A;  2AEH A;  3VIA A;  2Y8G A;  4L1R A;  4K2P A;  1TQZ A;  2EC1 A;  4B6H A;  1UPQ A;  4KHB A;  2DYN A;  2DFK A;  2OTX A;  3TCA A;  3QIJ A;  1V89 A;  1H4R A;  1XKE A;  5I2M A;  2RUK B;  1GG3 A;  4WVF B;  3SUZ A;  1AWE A;  2Z13 A;  2CRF A;  2P0H A;  1DDW A;  4IFS A;  3WYF B;  4BBK A;  1FAO A;  3QWM A;  3P7Z A;  2D9X A;  1V88 A;  4HAT B;  1RRP B;  1U2B A;  2EJ8 A;  2HE7 A;  2RVB B;  5DI9 B;  2Y7B A;  1SGH A;  2Q13 A;  4IAP A;  5C5B B;  4DXA B;  1X1G A;  2RGN B;  2VRW B;  2GCL A;  2Z59 A;  3MDB C;  1WG7 A;  1V5M A;  4HAW B;  4K17 A;  3D8F A;  1UEF A;  4PNK A;  1XD4 A;  1EAZ A;  4XWX A;  4HAY B;  2K00 A;  2Z14 A;  5HE1 A;  1OQN A;  3BIN A;  4EJN A;  5D27 A;  5M4Y B;  1AQC A;  3GYO A;  3KY9 A;  3NSU A;  1Y19 B;  3QBV B;  5JHH A;  2V76 A;  1XCG A;  1P6S A;  5D3W A;  1P5T A;  4HSI A;  1ZC3 B;  4GNK B;  3D8D A;  1ZC4 B;  1RJ2 A;  4ZRJ A;  2P0D A;  4A6F B;  1ZSQ A;  4K81 A;  2AL6 A;  4HAV B;  1U27 A;  2Z0Q A;  3KRX A;  4NSW A;  2DLW A;  2D9V A;  4GPT B;  5D3V A;  2QKL A;  2KUP A;  1V61 A;  2KR0 A;  1K5D B;  2YT1 A;  3IVF A;  1U5E A;  2DKQ A;  4KVG B;  4QJ3 B;  3P6A A;  4F7U P;  2YF0 A;  1Y5O A;  3OAN A;  1MAI A;  5KCV A;  3VOQ A;  2I1K A;  2H7D A;  2D10 A;  1FHO A;  2YS1 A;  3KZ1 A;  1WGU A;  3F5R A;  4YON A;  4Z2M B;  1IRS A;  5FI0 A;  4IOY X;  3HQC A;  3T06 A;  1PLS A;  3SNH A;  2DN6 A;  1WJM A;  3MPX A;  3AJ4 A;  3TW1 A;  5EFX A;  2H7E A;  2YRY A;  4QJ4 B;  5JLJ B;  2KGX B;  3CXB B;  2G35 A;  4OT1 A;  4GMX B;  1NTY A;  4YL8 A;  3PP2 A;  5GOW B;  4C0A A;  3FEH A;  2DHJ A;  2OQB A;  5I2S A;  2ROZ B;  1J19 A;  3SYX A;  4HHV A;  4EKU A;  4CHM A;  1FOE A;  1WI1 A;  3PVW A;  5JHG A;  2IYB A;  2JP2 A;  2NZ8 B;  2R2Y A;  5IRS A;  4GZU A;  4WSF A;  1NI2 A;  3A98 B;  3ULC A;  2GUM A;  4HB0 B;  1UNR A;  2P8V A;  1BTN A;  3A8Q A;  1ZVR A;  3KSY A;  2MWN B;  4CHJ A;  4TYZ A;  5D3Y A;  4HB4 B;  1W1G A;  4KHB B;  2GS0 A;  2R0D A;  1QQG A;  2DTC A;  2Z4D A;  2DX1 A;  3A8P A;  5J3T A;  1ZYI A;  1EVH A;  1Z87 A;  2ZPY A;  5LG4 B;  3WA0 A;  3O96 A;  2YS5 A;  1NTV A;  3DXE A;  5JP4 A;  1BAK A;  2EMS A;  2Z0P A;  4MY6 A;  3HW2 B;  2L2I A;  4PQ0 A;  2LKO A;  2FJL A;  3CIK A;  2LOZ A;  2DX5 A;  3U7D A;  4A6K A;  1U5D A;  2N0Y A;  2DHK A;  3X23 A;  1BTK A;  2W2W A;  2HTH B;  3NWD A;  3ODO A;  2MDX A;  3HK0 A;  4KHA A;  1EGX A;  5DHF B;  1U5F A;  1MIZ B;  4WJ7 A;  3NWA A;  2R09 A;  3DXD A;  4QXA B;  2DKP A;  1GC6 A;  1FGY A;  4HAX B;  4D0N B;  3U8Z A;  1B55 A;  3LJU X;  1U29 A;  2D9W A;  2L1C A;  4ZRK A;  2KIE A;  1PMS A;  2ADZ A;  2J0M A;  3FSS A;  4ZRI A;  2W2X D;  2D9Y A;  2E2X A;  3BJI A;  4GN1 A;  5DHA B;  1H10 A;  2J0J A;  4HAU B;  2YVC A;  1WJ1 A;  2DYQ A;  2VKI A;  2NMB A;  1EF1 A;  3TVV A;  1MIX A;  2M14 A;  1BWN A;  1X11 A;  3DXC A;  1QC6 A;  4L6E A;  2VSZ A;  5C79 A;  3PEG A;  3UZT A;  4GOU A;  1KZG A;  1DRO A;  3PG7 A;  5KQ4 A;  3NW8 A;  2MFQ A;  2D2Q A;  2RSG A;  1U5G A;  3ML4 A;  1Q67 A;  2EMT A;  1OMW A;  3OHM B;  2P0F A;  4KHO A;  1ISN A;  1XX0 A;  1OY2 A;  3M1I B;  4HDO A;  1FHX A;  2GJY A;  4HB2 B;  5D3X A;  4DX9 0;  2CAY A;  2UZS A;  4P7I A;  1DBH A;  4K2O A;  2BCJ A;  2COF A;  2Y8F A;  2YS3 A;  1LW3 A;  1MKE A;  3KRW A;  4HDQ A;  2CY5 A;  3HIE A;  1P3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...