3TVVA

Structure of the tandem ph domains of rtt106 (residues 68-315)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
244
structure length
233
Chain Sequence
MSETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRKQMKDKSMSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
total genus 50
structure length 233
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tvvA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tvvA01
2J0MA 4Z2NA 1DYNA 2R0DA 1U27A 4IAPA 2COAA 3SV1A 2D2QA 4K2OA 3M1IB 2JP2A 1FGYA 3HQCA 1U29A 3CXBB 3P7ZA 4DBBA 1EGXA 2D9ZA 1J0WA 4WVFB 2L1CA 3DXEA 1GG3A 1OMWA 3A98B 1V88A 3ULBA 1QQGA 3D8DA 4B6HA 4NY0A 1UPRA 4PNKA 2ELAA 4TYZA 4XWXA 1M7EA 2I1JA 2LG1A 2LKOA 3SO6A 1WJMA 2J59M 5D3YA 4GMXB 2M14A 4CHJA 4HAXB 1Z87A 4IOYX 2AL6A 1V89A 2CAYA 4L6EA 1OQNA 1UNQA 4HAYB 1EVHA 1FOEA 2Y8FA 1H4RA 5C79A 2DLWA 2MFQA 2K00A 4HB4B 4DX8A 1DDWA 5DI9B 2NMBA 2N23A 4HDQA 1KZ7A 2QKMA 2EC1A 1ISNA 4WSFA 3X23A 1N3HA 3D8EA 4HB0B 1MPHA 1PFJA 3QWMA 1J19A 2CY4A 5CLLB 1WJ1A 2N0YA 3TW1A 1UNRA 2DFKA 1V5UA 2LYDA 1Y19B 2P0FA 2P0HA 3O96A 5FI0A 1ZC4B 2MDXA 3ULCA 3MDBC 5LONB 3ZVRA 2OQBA 3LJUX 5HE0A 4HATB 1EAZA 5JHGA 1K5DB 2UZRA 3TCAA 4HHVA 2YRYA 1P3RA 3MPXA 4BBKA 4KHAA 1KI1B 2DHJA 5C5BA 5KQ1A 5C16A 1H10A 4F7HA 3ODWA 5D27A 1BWNA 2YS5A 1DDMA 1M7RA 2YT1A 4F7GA 3IVFA 2CRFA 2UZSA 3U7DA 2MKRA 4PQ0A 2CODA 3CIKA 1I2HA 4HAWB 1MKEA 1LB1A 3TVVA 1ZVRA 4ZRKA 4GPTB 2K2UA 4GZUA 1K5GB 1SHCA 2L2IA 3G9WA 3PG7A 3TO1A 2HTHB 3U8ZA 3KY9A 4Y94A 2LOXA 2ROZB 1XR0B 1V5PA 1RJ2A 1RRPB 2H7EA 4EKUA 1E5WA 2ELBA 1MAIA 2G35A 3F5RA 4IFSA 2KUPA 1XX0A 2YVCA 3T06A 4C0AA 3KRXA 1GC6A 2LOZA 5JP4A 5FI1A 2RUKB 5D3WA 4YL8A 1FHOA 3FM8C 1WGQA 5J3YA 2YS3A 1BAKA 4TKNA 2J0KA 3ODOA 1U2BA 4HB2B 2DHKA 1ZSQA 1BTKA 1FAOA 1XKEA 1NTVA 2H7DA 2LULA 4WJ7A 2GS0A 1V61A 2DN6A 5DH9B 2ADZA 4H8SA 1UNPA 2XQNM 1FHWA 1FHXA 2HE7A 2V76A 4KAXB 2D9XA 3DXDA 3KZ1A 1W1DA 3RCPA 1NI2A 1NU2A 1XCGA 3A8QA 5GOWB 3GYPA 2W2WA 1TXDA 3PZDA 5C5BB 1LW3A 2GJYA 2P8VA 3A8PA 4MK0A 4DX90 3D8FA 2RLOA 4ZRIA 2I1KA 3PEGA 2GCLA 3PSCA 1MK9B 1P5TA 2E2XA 1XD4A 2VSZA 2DTCA 1AWEA 2PZ1A 2ROVA 2I5FA 2RNRB 2D9VA 1TJ6A 2R09A 1IRSA 4CHMA 1GC7A 2W2XD 5KQ4A 2DKQA 1U5DA 2AEHA 1XODA 1MIZB 2UVMA 3PVWA 3KSYA 4KVGB 1FGZA 2W2XC 4NSWA 1EF1A 4YONA 1DDVA 3VIAA 1W1GA 2IYBA 3OANA 4DXAB 4Z2MB 3AU4A 3TFMA 2EMSA 2Z0PA 2DHIA 4HAZB 3AJ4A 2D9YA 4MT7A 1U5FA 1DROA 3QIJA 4CYEA 4A5KA 5D3VA 2YS1A 5HE2A 1BTNA 2P0DA 3VOQA 3KRWA 2DA0A 2D4QA 4HAUB 5L81A 3ODXA 5CLQB 3PVLA 2YT0A 2YSZA 1ZC3B 3WA0A 2DYQA 5D3XA 2EMTA 1TQZA 1X05A 4F7UP 5EFXA 3GYOA 3PVUA 4HB3B 1I7AA 1X1GA 2OTXA 2BCJA 5JLJB 2Z0OA 3NSUA 2RSGA 2RGNB 1W1HA 5C6RA 1U5EA 4A6FA 3DXCA 1P6SA 3V5WA 1AQCA 3PP2A 1NTYA 3UZTA 2VKIA 5LOPB 2GCJA 1X86A 2D10A 2I5CA 1U5GA 2KGXB 5KCVA 2X18A 1WI1A 3SUZA 1FB8A 1WVHA 2Y7BA 3AU5A 3HW2B 5DHAB 2DX1A 3BJIA 2K2JA 3P6AA 2D11A 2QKLA 5J3QA 4EMOA 4K17A 1UEFA 4D0NB 1Y5OA 4A6HA 1B55A 1V5MA 3ZDTA 4KHBB 4A6KA 1OY2A 3FEHA 3QBVB 1X1FA 5JHHA 4EJNA 3F0WA 4HDOA 2DX5A 1PLSA 5J3TA 1PMSA 3WYFB 2M38A 2J0JA 1MIXA 4KHOA 4P7IA 4HAVB 4K2PA 1UPQA 1QC6A 1WGUA 5HE1A 3ML4A 4GN1A 1ZM0A 2ZPYA 2VRWB 2IFSA 3SNHA 2MWNB 4K81A 1Q67A 1MK7B 1SGHA 4ZRJA 4MY6A 2COCA 2DYNA 1X11A 2DKPA 1DBHA 2FJLA 4GMVA 2NZ8B 1KZGA 2COFA 3HK0A 2Q13A 2EJ8A 3SYXA 5HE3A 2Z0QA 2RVBB 3FSSA 1WG7A 3BINA 5DIFB 4GXBA 4A6FB 2CY5A 2D9WA 2Y8GA 3N7CA 5DHFB 2KCJA 2YF0A
chains in the Genus database with same CATH superfamily
2J0MA 4Z2NA 1DYNA 3HSAA 2R0DA 1U27A 4IAPA 2COAA 3SV1A 1T77A 2D2QA 4K2OA 4KHBA 3M1IB 2JP2A 1FGYA 3HQCA 1U29A 4CSQA 3CXBB 3P7ZA 4DBBA 1EGXA 3FVCA 2D9ZA 3NW8A 1J0WA 4WVFB 2L1CA 3DXEA 1GG3A 1OMWA 3A98B 1V88A 3ULBA 1QQGA 2FJUB 3D8DA 4B6HA 4NY0A 1UPRA 4L1RA 4PNKA 2ELAA 4TYZA 4XWXA 1M7EA 2I1JA 2LG1A 2LKOA 3SO6A 1WJMA 2J59M 4OT1A 4GMXB 5D3YA 5LG4B 2M14A 4CHJA 4HAXB 1Z87A 4IOYX 2AL6A 1V89A 2CAYA 4DIXA 4L6EA 1OQNA 1UNQA 4HAYB 1EVHA 1FOEA 2Y8FA 1H4RA 5C79A 2DLWA 2MFQA 2K00A 3B77A 4HB4B 4DX8A 2KUQA 1DDWA 5DI9B 2NMBA 2N23A 4HDQA 1KZ7A 3OHMB 2Z14A 2QKMA 2EC1A 1ISNA 4WSFA 3X23A 1N3HA 3D8EA 4HB0B 1MPHA 1PFJA 2YT2A 3QWMA 1J19A 2CY4A 5CLLB 1WJ1A 2N0YA 3TW1A 1UNRA 2DFKA 1V5UA 2LYDA 1Y19B 2P0FA 2P0HA 3O96A 5FI0A 1ZC4B 2MDXA 3ULCA 3MDBC 5LONB 3ZVRA 2OQBA 3LJUX 5HE0A 4QJ3B 4HATB 1EAZA 5JHGA 1K5DB 2UZRA 3A58A 3TCAA 2YRYA 4HHVA 1P3RA 3MPXA 4BBKA 4KHAA 1KI1B 2DHJA 5C5BA 5KQ1A 5C16A 1H10A 4F7HA 3ODWA 5D27A 1BWNA 2YS5A 1DDMA 1M7RA 2YT1A 3NWDA 4F7GA 3IVFA 2CRFA 2R2YA 2UZSA 3U7DA 2MKRA 4PQ0A 2CODA 3CIKA 1I2HA 4HAWB 1MKEA 1LB1A 3TVVA 1ZVRA 4ZRKA 4GPTB 2K2UA 3U12A 4GZUA 1K5GB 1SHCA 2L2IA 3G9WA 3PG7A 3TO1A 2HTHB 3U8ZA 3KY9A 4Y94A 2LOXA 2ROZB 1XR0B 3NWFA 1V5PA 1RJ2A 1RRPB 2H7EA 2Z4DA 4EKUA 1E5WA 2ELBA 1MAIA 2K49A 2G35A 3F5RA 4IFSA 2KUPA 1XX0A 2YVCA 5M4YB 3T06A 4C0AA 3KRXA 1GC6A 2LOZA 5JP4A 5FI1A 2RUKB 5D3WA 4YL8A 1FHOA 3FM8C 1WGQA 5J3YA 2YS3A 1BAKA 4TKNA 2J0KA 4GNKB 3ODOA 1U2BA 4HB2B 2DHKA 1ZSQA 1BTKA 1FAOA 1XKEA 1NTVA 2H7DA 2LULA 4WJ7A 2GS0A 1V61A 2DN6A 5DH9B 2ADZA 4H8SA 1UNPA 2XQNM 1FHWA 1FHXA 2HE7A 2V76A 4KAXB 2D9XA 4QXAB 3DXDA 3KZ1A 1W1DA 3RCPA 1NI2A 1NU2A 1XCGA 3A8QA 5GOWB 3GYPA 1MI1A 2W2WA 1TXDA 3PZDA 2KIGA 5C5BB 1LW3A 2GJYA 2P8VA 3A8PA 4MK0A 4DX90 3D8FA 2RLOA 4ZRIA 2I1KA 3PEGA 3NWAA 2GCLA 2Z13A 3PSCA 1MK9B 1P5TA 2E2XA 1XD4A 2VSZA 2DTCA 1AWEA 2PZ1A 2ROVA 2I5FA 1ZYIA 2RNRB 2D9VA 1TJ6A 5I2MA 2R09A 1IRSA 4CHMA 1GC7A 4QJ4B 2W2XD 5KQ4A 2DKQA 1U5DA 2AEHA 1XODA 1MIZB 2UVMA 3PVWA 3DCXA 3KSYA 4KVGB 1FGZA 2W2XC 4NSWA 1EF1A 4YONA 1DDVA 3VIAA 1W1GA 2IYBA 3OANA 4DXAB 4Z2MB 3AU4A 3TFMA 2EMSA 2Z0PA 2DHIA 2K8EA 4HAZB 3AJ4A 2D9YA 4MT7A 2KR0A 1U5FA 1DROA 3QIJA 4CYEA 4A5KA 5D3VA 2YS1A 5HE2A 1BTNA 2P0DA 3VOQA 3KRWA 2DA0A 2D4QA 4HAUB 5L81A 3ODXA 5CLQB 3PVLA 2YT0A 2YSZA 1ZC3B 4D6WA 2KIEA 3WA0A 2DYQA 4QJ5B 5D3XA 2EMTA 1TQZA 4GOUA 2Z59A 1X05A 4F7UP 3HIEA 5EFXA 3PVUA 3GYOA 4HB3B 1I7AA 1X1GA 2OTXA 2BCJA 5JLJB 2Z0OA 3NSUA 4HSIA 2RSGA 2RGNB 1W1HA 5C6RA 1U5EA 4A6FA 3DXCA 1P6SA 3V5WA 1AQCA 3PP2A 1NTYA 3UZTA 2VKIA 5LOPB 2GCJA 1X86A 2RRFA 2D10A 2I5CA 1U5GA 2KGXB 5KCVA 2X18A 1WI1A 3SUZA 1FB8A 1WVHA 2Y7BA 3AU5A 3HW2B 5DHAB 2DX1A 3BJIA 2K2JA 3P6AA 2D11A 2QKLA 5J3QA 4EMOA 4K17A 1UEFA 4D0NB 1Y5OA 4A6HA 1B55A 1V5MA 3ZDTA 4KHBB 4A6KA 1OY2A 3FEHA 3QBVB 1X1FA 2NBVA 4EJNA 3F0WA 5JHHA 4HDOA 2DX5A 1PLSA 5J3TA 1PMSA 3WYFB 2M38A 2J0JA 1MIXA 4KHOA 4P7IA 4HAVB 1UPQA 1QC6A 4K2PA 1WGUA 5HE1A 3ML4A 4GN1A 1ZM0A 2ZPYA 2VRWB 2IFSA 3SNHA 2MWNB 4K81A 1Q67A 1MK7B 1SGHA 4ZRJA 4MY6A 2COCA 2DYNA 1X11A 2DKPA 1DBHA 5IRSA 2FJLA 4GMVA 5I2SA 2NZ8B 1KZGA 2COFA 3HK0A 2Q13A 2EJ8A 3SYXA 5HE3A 2Z0QA 2RVBB 3FSSA 1WG7A 2ZKMX 4OSNA 3BINA 5DIFB 4GXBA 4A6FB 2CY5A 2D9WA 2GUMA 2Y8GA 3N7CA 5DHFB 2KCJA 2YF0A
chains in the Genus database with same CATH topology
2J0MA 4Z2NA 1DYNA 2R0DA 1U27A 4IAPA 2COAA 3SV1A 2D2QA 4K2OA 4KHBA 3M1IB 2JP2A 1FGYA 3HQCA 1U29A 4CSQA 3CXBB 3P7ZA 4DBBA 1EGXA 3FVCA 2D9ZA 3NW8A 1J0WA 4WVFB 2L1CA 3DXEA 1GG3A 1OMWA 3A98B 1V88A 3ULBA 1QQGA 2FJUB 3D8DA 4B6HA 4NY0A 1UPRA 4L1RA 4PNKA 2ELAA 4TYZA 4XWXA 1M7EA 2I1JA 2LG1A 2LKOA 3SO6A 1WJMA 2J59M 5D3YA 4GMXB 4OT1A 5LG4B 2M14A 4CHJA 4HAXB 1Z87A 4IOYX 2AL6A 1V89A 2CAYA 4DIXA 4L6EA 1OQNA 1UNQA 4HAYB 1EVHA 1FOEA 2Y8FA 1H4RA 5C79A 2DLWA 2MFQA 2K00A 4HB4B 4DX8A 2KUQA 1DDWA 5DI9B 2NMBA 2N23A 4HDQA 1KZ7A 3OHMB 2Z14A 2QKMA 2EC1A 1ISNA 4WSFA 3X23A 1N3HA 3D8EA 4HB0B 1MPHA 1PFJA 2YT2A 3QWMA 1J19A 2CY4A 5CLLB 1WJ1A 2N0YA 3TW1A 1UNRA 2DFKA 1V5UA 2LYDA 1Y19B 2P0FA 2P0HA 3O96A 5FI0A 1ZC4B 2MDXA 3ULCA 3MDBC 5LONB 3ZVRA 2OQBA 3LJUX 5HE0A 4QJ3B 4HATB 1EAZA 5JHGA 1K5DB 2UZRA 3TCAA 3A58A 4HHVA 2YRYA 1P3RA 3MPXA 4BBKA 4KHAA 1KI1B 2DHJA 5C5BA 5KQ1A 5C16A 1H10A 4F7HA 3ODWA 5D27A 1BWNA 2YS5A 1DDMA 1M7RA 2YT1A 3NWDA 4F7GA 3IVFA 2CRFA 2R2YA 2UZSA 3U7DA 2MKRA 4PQ0A 2CODA 3CIKA 1I2HA 4HAWB 1MKEA 1LB1A 3TVVA 1ZVRA 4ZRKA 4GPTB 2K2UA 3U12A 4GZUA 1K5GB 1SHCA 2L2IA 3G9WA 3PG7A 3TO1A 2HTHB 3U8ZA 3KY9A 4Y94A 2LOXA 2ROZB 1XR0B 3NWFA 1V5PA 1RJ2A 1RRPB 2H7EA 4EKUA 2Z4DA 1E5WA 2ELBA 1MAIA 2K49A 2G35A 3F5RA 4IFSA 2KUPA 1XX0A 2YVCA 5M4YB 3T06A 4C0AA 3KRXA 1GC6A 2LOZA 5JP4A 5FI1A 2RUKB 5D3WA 4YL8A 1FHOA 3FM8C 1WGQA 5J3YA 2YS3A 1BAKA 4TKNA 2J0KA 4GNKB 3ODOA 1U2BA 4HB2B 2DHKA 1ZSQA 1BTKA 1FAOA 1XKEA 1NTVA 2H7DA 2LULA 4WJ7A 2GS0A 1V61A 2DN6A 5DH9B 2ADZA 4H8SA 1UNPA 2XQNM 1FHWA 1FHXA 2HE7A 2V76A 4KAXB 2D9XA 4QXAB 3DXDA 3KZ1A 1W1DA 3RCPA 1NI2A 1NU2A 1XCGA 3A8QA 5GOWB 3GYPA 2W2WA 1TXDA 3PZDA 2KIGA 5C5BB 1LW3A 2GJYA 2P8VA 3A8PA 4MK0A 4DX90 3D8FA 2RLOA 4ZRIA 2I1KA 3PEGA 3NWAA 2GCLA 2Z13A 3PSCA 1MK9B 1P5TA 2E2XA 1XD4A 2VSZA 2DTCA 1AWEA 2PZ1A 2ROVA 2I5FA 1ZYIA 2RNRB 2D9VA 1TJ6A 5I2MA 2R09A 1IRSA 4CHMA 1GC7A 4QJ4B 2W2XD 5KQ4A 2DKQA 1U5DA 2AEHA 1XODA 1MIZB 2UVMA 3PVWA 3KSYA 4KVGB 1FGZA 2W2XC 4NSWA 1EF1A 4YONA 1DDVA 3VIAA 1W1GA 2IYBA 3OANA 4DXAB 4Z2MB 3AU4A 3TFMA 2EMSA 2Z0PA 2DHIA 2K8EA 4HAZB 3AJ4A 2D9YA 4MT7A 2KR0A 1U5FA 1DROA 3QIJA 4CYEA 4A5KA 5D3VA 2YS1A 5HE2A 1BTNA 2P0DA 3VOQA 3KRWA 2DA0A 2D4QA 4HAUB 5L81A 3ODXA 5CLQB 3PVLA 2YT0A 2YSZA 1ZC3B 4D6WA 2KIEA 3WA0A 2DYQA 4QJ5B 5D3XA 2EMTA 1TQZA 4GOUA 2Z59A 1X05A 4F7UP 3HIEA 5EFXA 3GYOA 3PVUA 4HB3B 1I7AA 1X1GA 2OTXA 2BCJA 5JLJB 2Z0OA 3NSUA 4HSIA 2RSGA 2RGNB 1W1HA 5C6RA 1U5EA 4A6FA 3DXCA 1P6SA 3V5WA 1AQCA 3PP2A 1NTYA 3UZTA 2VKIA 5LOPB 2GCJA 1X86A 2RRFA 2D10A 2I5CA 1U5GA 2KGXB 5KCVA 2X18A 1WI1A 3SUZA 1FB8A 1WVHA 2Y7BA 3AU5A 3HW2B 5DHAB 2DX1A 3BJIA 2K2JA 3P6AA 2D11A 2QKLA 5J3QA 4EMOA 4K17A 1UEFA 4D0NB 1Y5OA 4A6HA 1B55A 1V5MA 3ZDTA 4KHBB 4A6KA 1OY2A 3FEHA 3QBVB 1X1FA 5JHHA 4EJNA 3F0WA 2NBVA 4HDOA 2DX5A 1PLSA 5J3TA 1PMSA 3WYFB 2M38A 2J0JA 1MIXA 4KHOA 4P7IA 4HAVB 4K2PA 1UPQA 1QC6A 1WGUA 5HE1A 3ML4A 4GN1A 1ZM0A 2ZPYA 2VRWB 2IFSA 3SNHA 2MWNB 4K81A 1Q67A 1MK7B 1SGHA 4ZRJA 4MY6A 2COCA 2DYNA 1X11A 2DKPA 1DBHA 5IRSA 2FJLA 4GMVA 5I2SA 2NZ8B 1KZGA 2COFA 3HK0A 2Q13A 2EJ8A 3SYXA 5HE3A 2Z0QA 2RVBB 3FSSA 1WG7A 2ZKMX 4OSNA 3BINA 5DIFB 4GXBA 4A6FB 2CY5A 2D9WA 2Y8GA 2GUMA 3N7CA 5DHFB 2KCJA 2YF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0M A;  4Z2N A;  1DYN A;  2R0D A;  1U27 A;  4IAP A;  2COA A;  3SV1 A;  2D2Q A;  4K2O A;  3M1I B;  2JP2 A;  1FGY A;  3HQC A;  1U29 A;  3CXB B;  3P7Z A;  4DBB A;  1EGX A;  2D9Z A;  1J0W A;  4WVF B;  2L1C A;  3DXE A;  1GG3 A;  1OMW A;  3A98 B;  1V88 A;  3ULB A;  1QQG A;  3D8D A;  4B6H A;  4NY0 A;  1UPR A;  4PNK A;  2ELA A;  4TYZ A;  4XWX A;  1M7E A;  2I1J A;  2LG1 A;  2LKO A;  3SO6 A;  1WJM A;  2J59 M;  5D3Y A;  4GMX B;  2M14 A;  4CHJ A;  4HAX B;  1Z87 A;  4IOY X;  2AL6 A;  1V89 A;  2CAY A;  4L6E A;  1OQN A;  1UNQ A;  4HAY B;  1EVH A;  1FOE A;  2Y8F A;  1H4R A;  5C79 A;  2DLW A;  2MFQ A;  2K00 A;  4HB4 B;  4DX8 A;  1DDW A;  5DI9 B;  2NMB A;  2N23 A;  4HDQ A;  1KZ7 A;  2QKM A;  2EC1 A;  1ISN A;  4WSF A;  3X23 A;  1N3H A;  3D8E A;  4HB0 B;  1MPH A;  1PFJ A;  3QWM A;  1J19 A;  2CY4 A;  5CLL B;  1WJ1 A;  2N0Y A;  3TW1 A;  1UNR A;  2DFK A;  1V5U A;  2LYD A;  1Y19 B;  2P0F A;  2P0H A;  3O96 A;  5FI0 A;  1ZC4 B;  2MDX A;  3ULC A;  3MDB C;  5LON B;  3ZVR A;  2OQB A;  3LJU X;  5HE0 A;  4HAT B;  1EAZ A;  5JHG A;  1K5D B;  2UZR A;  3TCA A;  4HHV A;  2YRY A;  1P3R A;  3MPX A;  4BBK A;  4KHA A;  1KI1 B;  2DHJ A;  5C5B A;  5KQ1 A;  5C16 A;  1H10 A;  4F7H A;  3ODW A;  5D27 A;  1BWN A;  2YS5 A;  1DDM A;  1M7R A;  2YT1 A;  4F7G A;  3IVF A;  2CRF A;  2UZS A;  3U7D A;  2MKR A;  4PQ0 A;  2COD A;  3CIK A;  1I2H A;  4HAW B;  1MKE A;  1LB1 A;  3TVV A;  1ZVR A;  4ZRK A;  4GPT B;  2K2U A;  4GZU A;  1K5G B;  1SHC A;  2L2I A;  3G9W A;  3PG7 A;  3TO1 A;  2HTH B;  3U8Z A;  3KY9 A;  4Y94 A;  2LOX A;  2ROZ B;  1XR0 B;  1V5P A;  1RJ2 A;  1RRP B;  2H7E A;  4EKU A;  1E5W A;  2ELB A;  1MAI A;  2G35 A;  3F5R A;  4IFS A;  2KUP A;  1XX0 A;  2YVC A;  3T06 A;  4C0A A;  3KRX A;  1GC6 A;  2LOZ A;  5JP4 A;  5FI1 A;  2RUK B;  5D3W A;  4YL8 A;  1FHO A;  3FM8 C;  1WGQ A;  5J3Y A;  2YS3 A;  1BAK A;  4TKN A;  2J0K A;  3ODO A;  1U2B A;  4HB2 B;  2DHK A;  1ZSQ A;  1BTK A;  1FAO A;  1XKE A;  1NTV A;  2H7D A;  2LUL A;  4WJ7 A;  2GS0 A;  1V61 A;  2DN6 A;  5DH9 B;  2ADZ A;  4H8S A;  1UNP A;  2XQN M;  1FHW A;  1FHX A;  2HE7 A;  2V76 A;  4KAX B;  2D9X A;  3DXD A;  3KZ1 A;  1W1D A;  3RCP A;  1NI2 A;  1NU2 A;  1XCG A;  3A8Q A;  5GOW B;  3GYP A;  2W2W A;  1TXD A;  3PZD A;  5C5B B;  1LW3 A;  2GJY A;  2P8V A;  3A8P A;  4MK0 A;  4DX9 0;  3D8F A;  2RLO A;  4ZRI A;  2I1K A;  3PEG A;  2GCL A;  3PSC A;  1MK9 B;  1P5T A;  2E2X A;  1XD4 A;  2VSZ A;  2DTC A;  1AWE A;  2PZ1 A;  2ROV A;  2I5F A;  2RNR B;  2D9V A;  1TJ6 A;  2R09 A;  1IRS A;  4CHM A;  1GC7 A;  2W2X D;  5KQ4 A;  2DKQ A;  1U5D A;  2AEH A;  1XOD A;  1MIZ B;  2UVM A;  3PVW A;  3KSY A;  4KVG B;  1FGZ A;  2W2X C;  4NSW A;  1EF1 A;  4YON A;  1DDV A;  3VIA A;  1W1G A;  2IYB A;  3OAN A;  4DXA B;  4Z2M B;  3AU4 A;  3TFM A;  2EMS A;  2Z0P A;  2DHI A;  4HAZ B;  3AJ4 A;  2D9Y A;  4MT7 A;  1U5F A;  1DRO A;  3QIJ A;  4CYE A;  4A5K A;  5D3V A;  2YS1 A;  5HE2 A;  1BTN A;  2P0D A;  3VOQ A;  3KRW A;  2DA0 A;  2D4Q A;  4HAU B;  5L81 A;  3ODX A;  5CLQ B;  3PVL A;  2YT0 A;  2YSZ A;  1ZC3 B;  3WA0 A;  2DYQ A;  5D3X A;  2EMT A;  1TQZ A;  1X05 A;  4F7U P;  5EFX A;  3GYO A;  3PVU A;  4HB3 B;  1I7A A;  1X1G A;  2OTX A;  2BCJ A;  5JLJ B;  2Z0O A;  3NSU A;  2RSG A;  2RGN B;  1W1H A;  5C6R A;  1U5E A;  4A6F A;  3DXC A;  1P6S A;  3V5W A;  1AQC A;  3PP2 A;  1NTY A;  3UZT A;  2VKI A;  5LOP B;  2GCJ A;  1X86 A;  2D10 A;  2I5C A;  1U5G A;  2KGX B;  5KCV A;  2X18 A;  1WI1 A;  3SUZ A;  1FB8 A;  1WVH A;  2Y7B A;  3AU5 A;  3HW2 B;  5DHA B;  2DX1 A;  3BJI A;  2K2J A;  3P6A A;  2D11 A;  2QKL A;  5J3Q A;  4EMO A;  4K17 A;  1UEF A;  4D0N B;  1Y5O A;  4A6H A;  1B55 A;  1V5M A;  3ZDT A;  4KHB B;  4A6K A;  1OY2 A;  3FEH A;  3QBV B;  1X1F A;  5JHH A;  4EJN A;  3F0W A;  4HDO A;  2DX5 A;  1PLS A;  5J3T A;  1PMS A;  3WYF B;  2M38 A;  2J0J A;  1MIX A;  4KHO A;  4P7I A;  4HAV B;  4K2P A;  1UPQ A;  1QC6 A;  1WGU A;  5HE1 A;  3ML4 A;  4GN1 A;  1ZM0 A;  2ZPY A;  2VRW B;  2IFS A;  3SNH A;  2MWN B;  4K81 A;  1Q67 A;  1MK7 B;  1SGH A;  4ZRJ A;  4MY6 A;  2COC A;  2DYN A;  1X11 A;  2DKP A;  1DBH A;  2FJL A;  4GMV A;  2NZ8 B;  1KZG A;  2COF A;  3HK0 A;  2Q13 A;  2EJ8 A;  3SYX A;  5HE3 A;  2Z0Q A;  2RVB B;  3FSS A;  1WG7 A;  3BIN A;  5DIF B;  4GXB A;  4A6F B;  2CY5 A;  2D9W A;  2Y8G A;  3N7C A;  5DHF B;  2KCJ A;  2YF0 A; 
#chains in the Genus database with same CATH topology
 2J0M A;  4Z2N A;  1DYN A;  3HSA A;  2R0D A;  1U27 A;  4IAP A;  2COA A;  3SV1 A;  1T77 A;  2D2Q A;  4K2O A;  4KHB A;  3M1I B;  2JP2 A;  1FGY A;  3HQC A;  1U29 A;  4CSQ A;  3CXB B;  3P7Z A;  4DBB A;  1EGX A;  3FVC A;  2D9Z A;  3NW8 A;  1J0W A;  4WVF B;  2L1C A;  3DXE A;  1GG3 A;  1OMW A;  3A98 B;  1V88 A;  3ULB A;  1QQG A;  2FJU B;  3D8D A;  4B6H A;  4NY0 A;  1UPR A;  4L1R A;  4PNK A;  2ELA A;  4TYZ A;  4XWX A;  1M7E A;  2I1J A;  2LG1 A;  2LKO A;  3SO6 A;  1WJM A;  2J59 M;  4OT1 A;  4GMX B;  5D3Y A;  5LG4 B;  2M14 A;  4CHJ A;  4HAX B;  1Z87 A;  4IOY X;  2AL6 A;  1V89 A;  2CAY A;  4DIX A;  4L6E A;  1OQN A;  1UNQ A;  4HAY B;  1EVH A;  1FOE A;  2Y8F A;  1H4R A;  5C79 A;  2DLW A;  2MFQ A;  2K00 A;  3B77 A;  4HB4 B;  4DX8 A;  2KUQ A;  1DDW A;  5DI9 B;  2NMB A;  2N23 A;  4HDQ A;  1KZ7 A;  3OHM B;  2Z14 A;  2QKM A;  2EC1 A;  1ISN A;  4WSF A;  3X23 A;  1N3H A;  3D8E A;  4HB0 B;  1MPH A;  1PFJ A;  2YT2 A;  3QWM A;  1J19 A;  2CY4 A;  5CLL B;  1WJ1 A;  2N0Y A;  3TW1 A;  1UNR A;  2DFK A;  1V5U A;  2LYD A;  1Y19 B;  2P0F A;  2P0H A;  3O96 A;  5FI0 A;  1ZC4 B;  2MDX A;  3ULC A;  3MDB C;  5LON B;  3ZVR A;  2OQB A;  3LJU X;  5HE0 A;  4QJ3 B;  4HAT B;  1EAZ A;  5JHG A;  1K5D B;  2UZR A;  3A58 A;  3TCA A;  2YRY A;  4HHV A;  1P3R A;  3MPX A;  4BBK A;  4KHA A;  1KI1 B;  2DHJ A;  5C5B A;  5KQ1 A;  5C16 A;  1H10 A;  4F7H A;  3ODW A;  5D27 A;  1BWN A;  2YS5 A;  1DDM A;  1M7R A;  2YT1 A;  3NWD A;  4F7G A;  3IVF A;  2CRF A;  2R2Y A;  2UZS A;  3U7D A;  2MKR A;  4PQ0 A;  2COD A;  3CIK A;  1I2H A;  4HAW B;  1MKE A;  1LB1 A;  3TVV A;  1ZVR A;  4ZRK A;  4GPT B;  2K2U A;  3U12 A;  4GZU A;  1K5G B;  1SHC A;  2L2I A;  3G9W A;  3PG7 A;  3TO1 A;  2HTH B;  3U8Z A;  3KY9 A;  4Y94 A;  2LOX A;  2ROZ B;  1XR0 B;  3NWF A;  1V5P A;  1RJ2 A;  1RRP B;  2H7E A;  2Z4D A;  4EKU A;  1E5W A;  2ELB A;  1MAI A;  2K49 A;  2G35 A;  3F5R A;  4IFS A;  2KUP A;  1XX0 A;  2YVC A;  5M4Y B;  3T06 A;  4C0A A;  3KRX A;  1GC6 A;  2LOZ A;  5JP4 A;  5FI1 A;  2RUK B;  5D3W A;  4YL8 A;  1FHO A;  3FM8 C;  1WGQ A;  5J3Y A;  2YS3 A;  1BAK A;  4TKN A;  2J0K A;  4GNK B;  3ODO A;  1U2B A;  4HB2 B;  2DHK A;  1ZSQ A;  1BTK A;  1FAO A;  1XKE A;  1NTV A;  2H7D A;  2LUL A;  4WJ7 A;  2GS0 A;  1V61 A;  2DN6 A;  5DH9 B;  2ADZ A;  4H8S A;  1UNP A;  2XQN M;  1FHW A;  1FHX A;  2HE7 A;  2V76 A;  4KAX B;  2D9X A;  4QXA B;  3DXD A;  3KZ1 A;  1W1D A;  3RCP A;  1NI2 A;  1NU2 A;  1XCG A;  3A8Q A;  5GOW B;  3GYP A;  1MI1 A;  2W2W A;  1TXD A;  3PZD A;  2KIG A;  5C5B B;  1LW3 A;  2GJY A;  2P8V A;  3A8P A;  4MK0 A;  4DX9 0;  3D8F A;  2RLO A;  4ZRI A;  2I1K A;  3PEG A;  3NWA A;  2GCL A;  2Z13 A;  3PSC A;  1MK9 B;  1P5T A;  2E2X A;  1XD4 A;  2VSZ A;  2DTC A;  1AWE A;  2PZ1 A;  2ROV A;  2I5F A;  1ZYI A;  2RNR B;  2D9V A;  1TJ6 A;  5I2M A;  2R09 A;  1IRS A;  4CHM A;  1GC7 A;  4QJ4 B;  2W2X D;  5KQ4 A;  2DKQ A;  1U5D A;  2AEH A;  1XOD A;  1MIZ B;  2UVM A;  3PVW A;  3DCX A;  3KSY A;  4KVG B;  1FGZ A;  2W2X C;  4NSW A;  1EF1 A;  4YON A;  1DDV A;  3VIA A;  1W1G A;  2IYB A;  3OAN A;  4DXA B;  4Z2M B;  3AU4 A;  3TFM A;  2EMS A;  2Z0P A;  2DHI A;  2K8E A;  4HAZ B;  3AJ4 A;  2D9Y A;  4MT7 A;  2KR0 A;  1U5F A;  1DRO A;  3QIJ A;  4CYE A;  4A5K A;  5D3V A;  2YS1 A;  5HE2 A;  1BTN A;  2P0D A;  3VOQ A;  3KRW A;  2DA0 A;  2D4Q A;  4HAU B;  5L81 A;  3ODX A;  5CLQ B;  3PVL A;  2YT0 A;  2YSZ A;  1ZC3 B;  4D6W A;  2KIE A;  3WA0 A;  2DYQ A;  4QJ5 B;  5D3X A;  2EMT A;  1TQZ A;  4GOU A;  2Z59 A;  1X05 A;  4F7U P;  3HIE A;  5EFX A;  3PVU A;  3GYO A;  4HB3 B;  1I7A A;  1X1G A;  2OTX A;  2BCJ A;  5JLJ B;  2Z0O A;  3NSU A;  4HSI A;  2RSG A;  2RGN B;  1W1H A;  5C6R A;  1U5E A;  4A6F A;  3DXC A;  1P6S A;  3V5W A;  1AQC A;  3PP2 A;  1NTY A;  3UZT A;  2VKI A;  5LOP B;  2GCJ A;  1X86 A;  2RRF A;  2D10 A;  2I5C A;  1U5G A;  2KGX B;  5KCV A;  2X18 A;  1WI1 A;  3SUZ A;  1FB8 A;  1WVH A;  2Y7B A;  3AU5 A;  3HW2 B;  5DHA B;  2DX1 A;  3BJI A;  2K2J A;  3P6A A;  2D11 A;  2QKL A;  5J3Q A;  4EMO A;  4K17 A;  1UEF A;  4D0N B;  1Y5O A;  4A6H A;  1B55 A;  1V5M A;  3ZDT A;  4KHB B;  4A6K A;  1OY2 A;  3FEH A;  3QBV B;  1X1F A;  2NBV A;  4EJN A;  3F0W A;  5JHH A;  4HDO A;  2DX5 A;  1PLS A;  5J3T A;  1PMS A;  3WYF B;  2M38 A;  2J0J A;  1MIX A;  4KHO A;  4P7I A;  4HAV B;  1UPQ A;  1QC6 A;  4K2P A;  1WGU A;  5HE1 A;  3ML4 A;  4GN1 A;  1ZM0 A;  2ZPY A;  2VRW B;  2IFS A;  3SNH A;  2MWN B;  4K81 A;  1Q67 A;  1MK7 B;  1SGH A;  4ZRJ A;  4MY6 A;  2COC A;  2DYN A;  1X11 A;  2DKP A;  1DBH A;  5IRS A;  2FJL A;  4GMV A;  5I2S A;  2NZ8 B;  1KZG A;  2COF A;  3HK0 A;  2Q13 A;  2EJ8 A;  3SYX A;  5HE3 A;  2Z0Q A;  2RVB B;  3FSS A;  1WG7 A;  2ZKM X;  4OSN A;  3BIN A;  5DIF B;  4GXB A;  4A6F B;  2CY5 A;  2D9W A;  2GUM A;  2Y8G A;  3N7C A;  5DHF B;  2KCJ A;  2YF0 A; 
#chains in the Genus database with same CATH homology
 2J0M A;  4Z2N A;  1DYN A;  2R0D A;  1U27 A;  4IAP A;  2COA A;  3SV1 A;  2D2Q A;  4K2O A;  4KHB A;  3M1I B;  2JP2 A;  1FGY A;  3HQC A;  1U29 A;  4CSQ A;  3CXB B;  3P7Z A;  4DBB A;  1EGX A;  3FVC A;  2D9Z A;  3NW8 A;  1J0W A;  4WVF B;  2L1C A;  3DXE A;  1GG3 A;  1OMW A;  3A98 B;  1V88 A;  3ULB A;  1QQG A;  2FJU B;  3D8D A;  4B6H A;  4NY0 A;  1UPR A;  4L1R A;  4PNK A;  2ELA A;  4TYZ A;  4XWX A;  1M7E A;  2I1J A;  2LG1 A;  2LKO A;  3SO6 A;  1WJM A;  2J59 M;  5D3Y A;  4GMX B;  4OT1 A;  5LG4 B;  2M14 A;  4CHJ A;  4HAX B;  1Z87 A;  4IOY X;  2AL6 A;  1V89 A;  2CAY A;  4DIX A;  4L6E A;  1OQN A;  1UNQ A;  4HAY B;  1EVH A;  1FOE A;  2Y8F A;  1H4R A;  5C79 A;  2DLW A;  2MFQ A;  2K00 A;  4HB4 B;  4DX8 A;  2KUQ A;  1DDW A;  5DI9 B;  2NMB A;  2N23 A;  4HDQ A;  1KZ7 A;  3OHM B;  2Z14 A;  2QKM A;  2EC1 A;  1ISN A;  4WSF A;  3X23 A;  1N3H A;  3D8E A;  4HB0 B;  1MPH A;  1PFJ A;  2YT2 A;  3QWM A;  1J19 A;  2CY4 A;  5CLL B;  1WJ1 A;  2N0Y A;  3TW1 A;  1UNR A;  2DFK A;  1V5U A;  2LYD A;  1Y19 B;  2P0F A;  2P0H A;  3O96 A;  5FI0 A;  1ZC4 B;  2MDX A;  3ULC A;  3MDB C;  5LON B;  3ZVR A;  2OQB A;  3LJU X;  5HE0 A;  4QJ3 B;  4HAT B;  1EAZ A;  5JHG A;  1K5D B;  2UZR A;  3TCA A;  3A58 A;  4HHV A;  2YRY A;  1P3R A;  3MPX A;  4BBK A;  4KHA A;  1KI1 B;  2DHJ A;  5C5B A;  5KQ1 A;  5C16 A;  1H10 A;  4F7H A;  3ODW A;  5D27 A;  1BWN A;  2YS5 A;  1DDM A;  1M7R A;  2YT1 A;  3NWD A;  4F7G A;  3IVF A;  2CRF A;  2R2Y A;  2UZS A;  3U7D A;  2MKR A;  4PQ0 A;  2COD A;  3CIK A;  1I2H A;  4HAW B;  1MKE A;  1LB1 A;  3TVV A;  1ZVR A;  4ZRK A;  4GPT B;  2K2U A;  3U12 A;  4GZU A;  1K5G B;  1SHC A;  2L2I A;  3G9W A;  3PG7 A;  3TO1 A;  2HTH B;  3U8Z A;  3KY9 A;  4Y94 A;  2LOX A;  2ROZ B;  1XR0 B;  3NWF A;  1V5P A;  1RJ2 A;  1RRP B;  2H7E A;  4EKU A;  2Z4D A;  1E5W A;  2ELB A;  1MAI A;  2K49 A;  2G35 A;  3F5R A;  4IFS A;  2KUP A;  1XX0 A;  2YVC A;  5M4Y B;  3T06 A;  4C0A A;  3KRX A;  1GC6 A;  2LOZ A;  5JP4 A;  5FI1 A;  2RUK B;  5D3W A;  4YL8 A;  1FHO A;  3FM8 C;  1WGQ A;  5J3Y A;  2YS3 A;  1BAK A;  4TKN A;  2J0K A;  4GNK B;  3ODO A;  1U2B A;  4HB2 B;  2DHK A;  1ZSQ A;  1BTK A;  1FAO A;  1XKE A;  1NTV A;  2H7D A;  2LUL A;  4WJ7 A;  2GS0 A;  1V61 A;  2DN6 A;  5DH9 B;  2ADZ A;  4H8S A;  1UNP A;  2XQN M;  1FHW A;  1FHX A;  2HE7 A;  2V76 A;  4KAX B;  2D9X A;  4QXA B;  3DXD A;  3KZ1 A;  1W1D A;  3RCP A;  1NI2 A;  1NU2 A;  1XCG A;  3A8Q A;  5GOW B;  3GYP A;  2W2W A;  1TXD A;  3PZD A;  2KIG A;  5C5B B;  1LW3 A;  2GJY A;  2P8V A;  3A8P A;  4MK0 A;  4DX9 0;  3D8F A;  2RLO A;  4ZRI A;  2I1K A;  3PEG A;  3NWA A;  2GCL A;  2Z13 A;  3PSC A;  1MK9 B;  1P5T A;  2E2X A;  1XD4 A;  2VSZ A;  2DTC A;  1AWE A;  2PZ1 A;  2ROV A;  2I5F A;  1ZYI A;  2RNR B;  2D9V A;  1TJ6 A;  5I2M A;  2R09 A;  1IRS A;  4CHM A;  1GC7 A;  4QJ4 B;  2W2X D;  5KQ4 A;  2DKQ A;  1U5D A;  2AEH A;  1XOD A;  1MIZ B;  2UVM A;  3PVW A;  3KSY A;  4KVG B;  1FGZ A;  2W2X C;  4NSW A;  1EF1 A;  4YON A;  1DDV A;  3VIA A;  1W1G A;  2IYB A;  3OAN A;  4DXA B;  4Z2M B;  3AU4 A;  3TFM A;  2EMS A;  2Z0P A;  2DHI A;  2K8E A;  4HAZ B;  3AJ4 A;  2D9Y A;  4MT7 A;  2KR0 A;  1U5F A;  1DRO A;  3QIJ A;  4CYE A;  4A5K A;  5D3V A;  2YS1 A;  5HE2 A;  1BTN A;  2P0D A;  3VOQ A;  3KRW A;  2DA0 A;  2D4Q A;  4HAU B;  5L81 A;  3ODX A;  5CLQ B;  3PVL A;  2YT0 A;  2YSZ A;  1ZC3 B;  4D6W A;  2KIE A;  3WA0 A;  2DYQ A;  4QJ5 B;  5D3X A;  2EMT A;  1TQZ A;  4GOU A;  2Z59 A;  1X05 A;  4F7U P;  3HIE A;  5EFX A;  3GYO A;  3PVU A;  4HB3 B;  1I7A A;  1X1G A;  2OTX A;  2BCJ A;  5JLJ B;  2Z0O A;  3NSU A;  4HSI A;  2RSG A;  2RGN B;  1W1H A;  5C6R A;  1U5E A;  4A6F A;  3DXC A;  1P6S A;  3V5W A;  1AQC A;  3PP2 A;  1NTY A;  3UZT A;  2VKI A;  5LOP B;  2GCJ A;  1X86 A;  2RRF A;  2D10 A;  2I5C A;  1U5G A;  2KGX B;  5KCV A;  2X18 A;  1WI1 A;  3SUZ A;  1FB8 A;  1WVH A;  2Y7B A;  3AU5 A;  3HW2 B;  5DHA B;  2DX1 A;  3BJI A;  2K2J A;  3P6A A;  2D11 A;  2QKL A;  5J3Q A;  4EMO A;  4K17 A;  1UEF A;  4D0N B;  1Y5O A;  4A6H A;  1B55 A;  1V5M A;  3ZDT A;  4KHB B;  4A6K A;  1OY2 A;  3FEH A;  3QBV B;  1X1F A;  5JHH A;  4EJN A;  3F0W A;  2NBV A;  4HDO A;  2DX5 A;  1PLS A;  5J3T A;  1PMS A;  3WYF B;  2M38 A;  2J0J A;  1MIX A;  4KHO A;  4P7I A;  4HAV B;  4K2P A;  1UPQ A;  1QC6 A;  1WGU A;  5HE1 A;  3ML4 A;  4GN1 A;  1ZM0 A;  2ZPY A;  2VRW B;  2IFS A;  3SNH A;  2MWN B;  4K81 A;  1Q67 A;  1MK7 B;  1SGH A;  4ZRJ A;  4MY6 A;  2COC A;  2DYN A;  1X11 A;  2DKP A;  1DBH A;  5IRS A;  2FJL A;  4GMV A;  5I2S A;  2NZ8 B;  1KZG A;  2COF A;  3HK0 A;  2Q13 A;  2EJ8 A;  3SYX A;  5HE3 A;  2Z0Q A;  2RVB B;  3FSS A;  1WG7 A;  2ZKM X;  4OSN A;  3BIN A;  5DIF B;  4GXB A;  4A6F B;  2CY5 A;  2D9W A;  2Y8G A;  2GUM A;  3N7C A;  5DHF B;  2KCJ A;  2YF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...