3TVVA

Structure of the tandem ph domains of rtt106 (residues 68-315)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
244
structure length
233
Chain Sequence
b'MSETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRKQMKDKSMSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 50
structure length 233
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tvvA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tvvA01
2MFQA 5D3YA 1RJ2A 4MT7A 2CODA 1Q67A 3U7DA 4WVFB 3TFMA 1W1HA 1FHWA 1LB1A 2LKOA 4NY0A 2J59M 3ODOA 4K2OA 3CIKA 1U5GA 1AQCA 2Z0QA 2L1CA 5C5BA 1RRPB 3MPXA 2DA0A 1X1FA 4EJNA 5DI9B 2EMTA 3KY9A 1U5DA 1U5FA 1J19A 1P6SA 2YT0A 4A5KA 2H7DA 2UVMA 5C16A 4DXAB 3FM8C 1XX0A 1SHCA 4HHVA 2XQNM 3TCAA 4BBKA 2N0YA 4A6HA 2RVBB 5JLJB 5D27A 2J0JA 1DDWA 3ULBA 2M38A 1WGUA 2GCLA 2HTHB 2MDXA 5KCVA 2DLWA 1MAIA 3GYOA 3MDBC 1KZ7A 1X1GA 2Z0OA 3WYFB 1WJ1A 2UZRA 4KAXB 1MPHA 1BTKA 3ODWA 4KVGB 3X23A 5HE2A 3ZDTA 2I5CA 2ELAA 2DFKA 2D11A 3F5RA 1DYNA 1DBHA 1ZC4B 2EJ8A 4WJ7A 5LOPB 1EF1A 5L81A 2DTCA 4D0NB 3OANA 1H10A 1MIXA 3M1IB 3TW1A 2W2WA 2K00A 2DHJA 2VKIA 4HB0B 1UNPA 3HK0A 3D8DA 2ELBA 2G35A 5J3YA 2NMBA 2MWNB 4KHOA 4DBBA 2D9WA 2RSGA 2K2JA 5CLLB 2Q13A 1XD4A 4Y94A 2AEHA 3PG7A 3SYXA 4ZRIA 1N3HA 1EGXA 4K17A 1UPRA 5D3VA 1WGQA 2NZ8B 3PSCA 2D9VA 2YSZA 2COCA 2IFSA 2OQBA 4MK0A 3TO1A 4YONA 4HB4B 4IFSA 4NSWA 2D2QA 4HDQA 4GN1A 3V5WA 4Z2MB 3DXDA 2D9YA 1PMSA 3RCPA 2EMSA 2YT1A 1NTYA 2YS1A 1Y5OA 2K2UA 3O96A 3ML4A 3NSUA 4PQ0A 2DHIA 3PEGA 2W2XD 3BINA 2VRWB 1KZGA 2I5FA 4HB3B 2P0DA 2D9XA 3QIJA 4HDOA 2YRYA 1W1DA 4CHMA 1GC6A 3F0WA 4B6HA 2RNRB 1I7AA 1XCGA 1B55A 2D4QA 2R09A 4MY6A 1NI2A 1FGZA 1MK9B 1V61A 4HAZB 3VIAA 3GYPA 1MKEA 2GS0A 3IVFA 1ZVRA 2LG1A 3AU5A 4HAWB 2DX1A 4GPTB 2QKLA 2LYDA 1U27A 1GC7A 3KRWA 1UNQA 4C0AA 1EVHA 3U8ZA 2H7EA 2RGNB 3UZTA 3ULCA 1XR0B 1UNRA 1IRSA 2W2XC 1KI1B 1V5UA 2RUKB 2DKPA 1U29A 1BTNA 2LOZA 2P0FA 1EAZA 1X86A 1W1GA 3PP2A 3D8FA 5HE3A 2CRFA 1V5MA 1X05A 1BAKA 2X18A 2DYQA 3SNHA 1MK7B 1DDMA 4GZUA 4XWXA 1XKEA 4TYZA 1I2HA 2UZSA 2MKRA 2YVCA 4K2PA 1TXDA 4L6EA 1FAOA 2OTXA 2DYNA 1MIZB 3HW2B 2HE7A 3PVUA 2KGXB 2P8VA 1V89A 3KZ1A 1Z87A 1LW3A 3SV1A 1DROA 5LONB 2COAA 2RLOA 3A8QA 4DX90 4F7UP 2CY5A 2PZ1A 5DHFB 2BCJA 1TJ6A 4GXBA 3VOQA 3KSYA 3AJ4A 3QBVB 2IYBA 5DH9B 1BWNA 2ROZB 1FHXA 1SGHA 2EC1A 2FJLA 2R0DA 1U2BA 3DXCA 5KQ4A 2ADZA 5C79A 5EFXA 4EMOA 3WA0A 2COFA 4HB2B 3HQCA 3P6AA 2N23A 2L2IA 3PVLA 2ROVA 2LULA 4HAUB 1FOEA 1PLSA 2YS5A 3G9WA 4IAPA 4HATB 3QWMA 2DN6A 4GMVA 1QQGA 1NU2A 3N7CA 1UPQA 1E5WA 1WG7A 1H4RA 3LJUX 5JP4A 4F7HA 2AL6A 4KHAA 5HE1A 2Z0PA 2GCJA 2Y8FA 1ISNA 3PVWA 5DIFB 2E2XA 1OY2A 4DX8A 2Y8GA 4F7GA 4Z2NA 5JHHA 4WSFA 3A98B 1X11A 5J3QA 4HAXB 5FI1A 5DHAB 1QC6A 4A6FA 2D10A 3ODXA 2JP2A 5JHGA 5FI0A 3BJIA 2KUPA 2J0KA 5J3TA 1FB8A 2D9ZA 5C5BB 2VSZA 5C6RA 1K5GB 3AU4A 3TVVA 3T06A 4CHJA 1ZSQA 5GOWB 2M14A 4ZRJA 2I1KA 1FGYA 2DHKA 3CXBB 4KHBB 2KCJA 4YL8A 1AWEA 3SO6A 2DKQA 4K81A 3ZVRA 3PZDA 1FHOA 4A6FB 4CYEA 1PFJA 4IOYX 1DDVA 1P5TA 3D8EA 1GG3A 3P7ZA 1NTVA 3SUZA 2LOXA 1U5EA 2Y7BA 1XODA 4H8SA 5KQ1A 3DXEA 1OQNA 5HE0A 2ZPYA 2YF0A 1ZM0A 4ZRKA 1WVHA 1V88A 2CY4A 1P3RA 2YS3A 5D3WA 1M7RA 3KRXA 2CAYA 4P7IA 2GJYA 1TQZA 2J0MA 2P0HA 1WJMA 1J0WA 5D3XA 3A8PA 1Y19B 1K5DB 3FSSA 4A6KA 3FEHA 4PNKA 1ZC3B 4GMXB 1UEFA 2I1JA 4HAVB 4EKUA 2QKMA 2V76A 1OMWA 2DX5A 4TKNA 5CLQB 1WI1A 4HAYB 1M7EA 1V5PA
chains in the Genus database with same CATH superfamily
2MFQA 5D3YA 1RJ2A 4MT7A 2CODA 1Q67A 3U7DA 2GUMA 4WVFB 3TFMA 1W1HA 1FHWA 1LB1A 2LKOA 4NY0A 2J59M 3ODOA 4K2OA 3CIKA 1U5GA 1AQCA 2Z0QA 2L1CA 5C5BA 1RRPB 3MPXA 2DA0A 1X1FA 4EJNA 5DI9B 2EMTA 3KY9A 4GNKB 1U5DA 1U5FA 1J19A 1P6SA 2YT0A 4A5KA 2H7DA 2UVMA 3DCXA 5C16A 4DXAB 3FM8C 1XX0A 1SHCA 4HHVA 2XQNM 3TCAA 4BBKA 2N0YA 4A6HA 2RVBB 5JLJB 5D27A 2J0JA 1DDWA 3ULBA 2M38A 1WGUA 2GCLA 2HTHB 2MDXA 5KCVA 2DLWA 1MAIA 3GYOA 3MDBC 1KZ7A 1X1GA 2Z0OA 3U12A 3WYFB 1WJ1A 2UZRA 4KAXB 1MPHA 1BTKA 3ODWA 4KVGB 3X23A 5HE2A 3ZDTA 2I5CA 2ELAA 2DFKA 2D11A 3F5RA 1DYNA 1DBHA 2R2YA 1ZC4B 2EJ8A 4WJ7A 5LOPB 1EF1A 5L81A 2DTCA 4D0NB 3OANA 1H10A 1MIXA 3M1IB 3TW1A 2W2WA 2K00A 5M4YB 2DHJA 2VKIA 3OHMB 4HB0B 1UNPA 3HK0A 3D8DA 2ELBA 2G35A 5I2MA 5J3YA 2NMBA 2Z59A 2MWNB 4KHOA 4DBBA 2D9WA 2FJUB 2RSGA 2K2JA 5CLLB 2Q13A 1XD4A 4Y94A 2AEHA 3PG7A 3SYXA 4ZRIA 1N3HA 1EGXA 4K17A 1UPRA 5D3VA 1WGQA 2NZ8B 3PSCA 3HIEA 2D9VA 2YSZA 2COCA 2IFSA 2OQBA 4MK0A 3TO1A 4YONA 5IRSA 4HB4B 4IFSA 3NWFA 4NSWA 2D2QA 4HDQA 4GN1A 3V5WA 2RRFA 4Z2MB 3DXDA 2D9YA 1PMSA 3RCPA 2EMSA 2YT1A 1NTYA 2YS1A 1Y5OA 2K2UA 3O96A 3ML4A 2YT2A 3NSUA 4QJ4B 4PQ0A 2DHIA 3PEGA 2W2XD 3BINA 2VRWB 1KZGA 2I5FA 4HB3B 1MI1A 2P0DA 2D9XA 3QIJA 4HDOA 2YRYA 1W1DA 4CHMA 1GC6A 3F0WA 4B6HA 4HSIA 2RNRB 1I7AA 1XCGA 5I2SA 1B55A 2D4QA 2R09A 4MY6A 5LG4B 1NI2A 1FGZA 1MK9B 1V61A 4HAZB 3VIAA 3GYPA 1MKEA 2GS0A 4CSQA 3IVFA 1ZVRA 2K8EA 2LG1A 3AU5A 4HAWB 2DX1A 4GPTB 2QKLA 2LYDA 1U27A 1GC7A 3KRWA 4GOUA 1UNQA 4C0AA 1EVHA 2KUQA 3U8ZA 2H7EA 2RGNB 3UZTA 3ULCA 1XR0B 1UNRA 3NWDA 1IRSA 2W2XC 1KI1B 1V5UA 2RUKB 2DKPA 1U29A 1BTNA 2LOZA 2P0FA 1EAZA 2Z4DA 1X86A 1W1GA 3PP2A 3D8FA 2KR0A 5HE3A 2CRFA 4QJ3B 1V5MA 1X05A 1BAKA 2X18A 2DYQA 3SNHA 1MK7B 1DDMA 4GZUA 4XWXA 1XKEA 4TYZA 1I2HA 2UZSA 2MKRA 2YVCA 4K2PA 1TXDA 4L6EA 1FAOA 2OTXA 2DYNA 1MIZB 4QJ5B 2Z13A 3HW2B 2HE7A 3PVUA 2KGXB 2P8VA 1V89A 3KZ1A 1Z87A 1LW3A 3SV1A 1DROA 5LONB 2COAA 2RLOA 3A8QA 4DX90 4F7UP 2CY5A 2PZ1A 5DHFB 2NBVA 1T77A 4OSNA 2BCJA 1TJ6A 4GXBA 3VOQA 3KSYA 3AJ4A 3QBVB 2IYBA 5DH9B 1BWNA 2ROZB 1FHXA 1SGHA 2EC1A 2FJLA 2R0DA 1U2BA 3DXCA 5KQ4A 2ADZA 5C79A 5EFXA 4DIXA 4EMOA 3WA0A 2COFA 4HB2B 3HQCA 3P6AA 2N23A 2L2IA 3PVLA 2ROVA 2LULA 4HAUB 1FOEA 1PLSA 2KIEA 2YS5A 3G9WA 4IAPA 4HATB 3HSAA 3QWMA 2DN6A 2ZKMX 4GMVA 1QQGA 1NU2A 3N7CA 1UPQA 1E5WA 1WG7A 1H4RA 3LJUX 5JP4A 4F7HA 2AL6A 4KHAA 5HE1A 2Z0PA 2GCJA 2Y8FA 1ISNA 3FVCA 3PVWA 5DIFB 2E2XA 1OY2A 4DX8A 3NWAA 2Y8GA 2Z14A 4F7GA 4Z2NA 5JHHA 4WSFA 3A98B 3NW8A 1X11A 4KHBA 5J3QA 4HAXB 2KIGA 5FI1A 5DHAB 1QC6A 4A6FA 2D10A 3ODXA 2JP2A 5JHGA 5FI0A 3BJIA 2KUPA 2J0KA 3A58A 5J3TA 1FB8A 2D9ZA 5C5BB 2VSZA 5C6RA 4QXAB 1K5GB 3AU4A 3TVVA 3T06A 4CHJA 1ZSQA 5GOWB 2M14A 4ZRJA 2I1KA 1FGYA 2DHKA 3CXBB 4KHBB 2KCJA 4YL8A 1AWEA 3SO6A 2DKQA 4K81A 3ZVRA 3PZDA 1FHOA 4A6FB 4CYEA 1PFJA 4IOYX 1DDVA 1P5TA 3B77A 3D8EA 1GG3A 1ZYIA 3P7ZA 1NTVA 3SUZA 2LOXA 1U5EA 2Y7BA 1XODA 4H8SA 5KQ1A 3DXEA 1OQNA 5HE0A 2ZPYA 2YF0A 1ZM0A 4ZRKA 1WVHA 1V88A 4L1RA 2CY4A 1P3RA 2YS3A 5D3WA 1M7RA 3KRXA 2CAYA 4P7IA 2GJYA 1TQZA 2J0MA 2P0HA 1WJMA 1J0WA 5D3XA 4D6WA 3A8PA 4OT1A 1Y19B 1K5DB 3FSSA 4A6KA 3FEHA 4PNKA 1ZC3B 4GMXB 1UEFA 2K49A 2I1JA 4HAVB 4EKUA 2QKMA 2V76A 1OMWA 2DX5A 4TKNA 5CLQB 1WI1A 4HAYB 1M7EA 1V5PA
chains in the Genus database with same CATH topology
2MFQA 5D3YA 1RJ2A 4MT7A 2CODA 1Q67A 3U7DA 2GUMA 4WVFB 3TFMA 1W1HA 1FHWA 1LB1A 2LKOA 4NY0A 2J59M 3ODOA 4K2OA 3CIKA 1U5GA 1AQCA 2Z0QA 2L1CA 5C5BA 1RRPB 3MPXA 2DA0A 1X1FA 4EJNA 5DI9B 2EMTA 3KY9A 4GNKB 1U5DA 1U5FA 1J19A 1P6SA 2YT0A 4A5KA 2H7DA 2UVMA 5C16A 4DXAB 3FM8C 1XX0A 1SHCA 4HHVA 2XQNM 3TCAA 4BBKA 2N0YA 4A6HA 2RVBB 5JLJB 5D27A 2J0JA 1DDWA 3ULBA 2M38A 1WGUA 2GCLA 2HTHB 2MDXA 5KCVA 2DLWA 1MAIA 3GYOA 3MDBC 1KZ7A 1X1GA 2Z0OA 3U12A 3WYFB 1WJ1A 2UZRA 4KAXB 1MPHA 1BTKA 3ODWA 4KVGB 3X23A 5HE2A 3ZDTA 2I5CA 2ELAA 2DFKA 2D11A 3F5RA 1DYNA 1DBHA 2R2YA 1ZC4B 2EJ8A 4WJ7A 5LOPB 1EF1A 5L81A 2DTCA 4D0NB 3OANA 1H10A 1MIXA 3M1IB 3TW1A 2W2WA 2K00A 5M4YB 2DHJA 2VKIA 3OHMB 4HB0B 1UNPA 3HK0A 3D8DA 2ELBA 2G35A 5I2MA 5J3YA 2NMBA 2Z59A 2MWNB 4KHOA 4DBBA 2D9WA 2FJUB 2RSGA 2K2JA 5CLLB 2Q13A 1XD4A 4Y94A 2AEHA 3PG7A 3SYXA 4ZRIA 1N3HA 1EGXA 4K17A 1UPRA 5D3VA 1WGQA 2NZ8B 3PSCA 3HIEA 2D9VA 2YSZA 2COCA 2IFSA 2OQBA 4MK0A 3TO1A 4YONA 5IRSA 4HB4B 4IFSA 3NWFA 4NSWA 2D2QA 4HDQA 4GN1A 3V5WA 2RRFA 4Z2MB 3DXDA 2D9YA 1PMSA 3RCPA 2EMSA 2YT1A 1NTYA 2YS1A 1Y5OA 2K2UA 3O96A 3ML4A 2YT2A 3NSUA 4QJ4B 4PQ0A 2DHIA 3PEGA 2W2XD 3BINA 2VRWB 1KZGA 2I5FA 4HB3B 2P0DA 2D9XA 3QIJA 4HDOA 2YRYA 1W1DA 4CHMA 1GC6A 3F0WA 4B6HA 4HSIA 2RNRB 1I7AA 1XCGA 5I2SA 1B55A 2D4QA 2R09A 4MY6A 5LG4B 1NI2A 1FGZA 1MK9B 1V61A 4HAZB 3VIAA 3GYPA 1MKEA 2GS0A 4CSQA 3IVFA 1ZVRA 2K8EA 2LG1A 3AU5A 4HAWB 2DX1A 4GPTB 2QKLA 2LYDA 1U27A 1GC7A 3KRWA 4GOUA 1UNQA 4C0AA 1EVHA 2KUQA 3U8ZA 2H7EA 2RGNB 3UZTA 3ULCA 1XR0B 1UNRA 3NWDA 1IRSA 2W2XC 1KI1B 1V5UA 2RUKB 2DKPA 1U29A 1BTNA 2LOZA 2P0FA 1EAZA 2Z4DA 1X86A 1W1GA 3PP2A 3D8FA 5HE3A 2KR0A 2CRFA 4QJ3B 1V5MA 1X05A 1BAKA 2X18A 2DYQA 3SNHA 1MK7B 1DDMA 4GZUA 4XWXA 1XKEA 4TYZA 1I2HA 2UZSA 2MKRA 2YVCA 4K2PA 1TXDA 4L6EA 1FAOA 2OTXA 2DYNA 1MIZB 4QJ5B 2Z13A 3HW2B 2HE7A 3PVUA 2KGXB 2P8VA 1V89A 3KZ1A 1Z87A 1LW3A 3SV1A 1DROA 5LONB 2COAA 2RLOA 3A8QA 4DX90 4F7UP 2CY5A 2PZ1A 5DHFB 2NBVA 4OSNA 2BCJA 1TJ6A 4GXBA 3VOQA 3KSYA 3AJ4A 3QBVB 2IYBA 5DH9B 1BWNA 2ROZB 1FHXA 1SGHA 2EC1A 2FJLA 2R0DA 1U2BA 3DXCA 5KQ4A 2ADZA 5C79A 5EFXA 4DIXA 4EMOA 3WA0A 2COFA 4HB2B 3HQCA 3P6AA 2N23A 2L2IA 3PVLA 2ROVA 2LULA 4HAUB 1FOEA 1PLSA 2KIEA 2YS5A 3G9WA 4IAPA 4HATB 3QWMA 2DN6A 2ZKMX 4GMVA 1QQGA 1NU2A 3N7CA 1UPQA 1E5WA 1WG7A 1H4RA 3LJUX 5JP4A 4F7HA 2AL6A 4KHAA 5HE1A 2Z0PA 2GCJA 2Y8FA 1ISNA 3FVCA 3PVWA 5DIFB 2E2XA 1OY2A 4DX8A 3NWAA 2Y8GA 2Z14A 4F7GA 4Z2NA 5JHHA 4WSFA 3A98B 3NW8A 1X11A 5J3QA 4KHBA 4HAXB 2KIGA 5FI1A 5DHAB 1QC6A 4A6FA 2D10A 3ODXA 2JP2A 5JHGA 5FI0A 3BJIA 2KUPA 2J0KA 5J3TA 3A58A 1FB8A 2D9ZA 5C5BB 2VSZA 5C6RA 4QXAB 1K5GB 3AU4A 3TVVA 3T06A 4CHJA 1ZSQA 5GOWB 2M14A 4ZRJA 2I1KA 1FGYA 2DHKA 3CXBB 4KHBB 2KCJA 4YL8A 1AWEA 3SO6A 2DKQA 4K81A 3ZVRA 3PZDA 1FHOA 4A6FB 4CYEA 1PFJA 4IOYX 1DDVA 1P5TA 3D8EA 1GG3A 1ZYIA 3P7ZA 1NTVA 3SUZA 2LOXA 1U5EA 2Y7BA 1XODA 4H8SA 5KQ1A 3DXEA 1OQNA 5HE0A 2ZPYA 2YF0A 1ZM0A 4ZRKA 1WVHA 1V88A 4L1RA 2CY4A 1P3RA 2YS3A 5D3WA 1M7RA 3KRXA 2CAYA 4P7IA 2GJYA 1TQZA 2J0MA 2P0HA 1WJMA 1J0WA 5D3XA 4D6WA 3A8PA 4OT1A 1Y19B 1K5DB 3FSSA 4A6KA 3FEHA 4PNKA 1ZC3B 4GMXB 1UEFA 2K49A 2I1JA 4HAVB 4EKUA 2QKMA 2V76A 1OMWA 2DX5A 4TKNA 5CLQB 1WI1A 4HAYB 1M7EA 1V5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFQ A;  5D3Y A;  1RJ2 A;  4MT7 A;  2COD A;  1Q67 A;  3U7D A;  4WVF B;  3TFM A;  1W1H A;  1FHW A;  1LB1 A;  2LKO A;  4NY0 A;  2J59 M;  3ODO A;  4K2O A;  3CIK A;  1U5G A;  1AQC A;  2Z0Q A;  2L1C A;  5C5B A;  1RRP B;  3MPX A;  2DA0 A;  1X1F A;  4EJN A;  5DI9 B;  2EMT A;  3KY9 A;  1U5D A;  1U5F A;  1J19 A;  1P6S A;  2YT0 A;  4A5K A;  2H7D A;  2UVM A;  5C16 A;  4DXA B;  3FM8 C;  1XX0 A;  1SHC A;  4HHV A;  2XQN M;  3TCA A;  4BBK A;  2N0Y A;  4A6H A;  2RVB B;  5JLJ B;  5D27 A;  2J0J A;  1DDW A;  3ULB A;  2M38 A;  1WGU A;  2GCL A;  2HTH B;  2MDX A;  5KCV A;  2DLW A;  1MAI A;  3GYO A;  3MDB C;  1KZ7 A;  1X1G A;  2Z0O A;  3WYF B;  1WJ1 A;  2UZR A;  4KAX B;  1MPH A;  1BTK A;  3ODW A;  4KVG B;  3X23 A;  5HE2 A;  3ZDT A;  2I5C A;  2ELA A;  2DFK A;  2D11 A;  3F5R A;  1DYN A;  1DBH A;  1ZC4 B;  2EJ8 A;  4WJ7 A;  5LOP B;  1EF1 A;  5L81 A;  2DTC A;  4D0N B;  3OAN A;  1H10 A;  1MIX A;  3M1I B;  3TW1 A;  2W2W A;  2K00 A;  2DHJ A;  2VKI A;  4HB0 B;  1UNP A;  3HK0 A;  3D8D A;  2ELB A;  2G35 A;  5J3Y A;  2NMB A;  2MWN B;  4KHO A;  4DBB A;  2D9W A;  2RSG A;  2K2J A;  5CLL B;  2Q13 A;  1XD4 A;  4Y94 A;  2AEH A;  3PG7 A;  3SYX A;  4ZRI A;  1N3H A;  1EGX A;  4K17 A;  1UPR A;  5D3V A;  1WGQ A;  2NZ8 B;  3PSC A;  2D9V A;  2YSZ A;  2COC A;  2IFS A;  2OQB A;  4MK0 A;  3TO1 A;  4YON A;  4HB4 B;  4IFS A;  4NSW A;  2D2Q A;  4HDQ A;  4GN1 A;  3V5W A;  4Z2M B;  3DXD A;  2D9Y A;  1PMS A;  3RCP A;  2EMS A;  2YT1 A;  1NTY A;  2YS1 A;  1Y5O A;  2K2U A;  3O96 A;  3ML4 A;  3NSU A;  4PQ0 A;  2DHI A;  3PEG A;  2W2X D;  3BIN A;  2VRW B;  1KZG A;  2I5F A;  4HB3 B;  2P0D A;  2D9X A;  3QIJ A;  4HDO A;  2YRY A;  1W1D A;  4CHM A;  1GC6 A;  3F0W A;  4B6H A;  2RNR B;  1I7A A;  1XCG A;  1B55 A;  2D4Q A;  2R09 A;  4MY6 A;  1NI2 A;  1FGZ A;  1MK9 B;  1V61 A;  4HAZ B;  3VIA A;  3GYP A;  1MKE A;  2GS0 A;  3IVF A;  1ZVR A;  2LG1 A;  3AU5 A;  4HAW B;  2DX1 A;  4GPT B;  2QKL A;  2LYD A;  1U27 A;  1GC7 A;  3KRW A;  1UNQ A;  4C0A A;  1EVH A;  3U8Z A;  2H7E A;  2RGN B;  3UZT A;  3ULC A;  1XR0 B;  1UNR A;  1IRS A;  2W2X C;  1KI1 B;  1V5U A;  2RUK B;  2DKP A;  1U29 A;  1BTN A;  2LOZ A;  2P0F A;  1EAZ A;  1X86 A;  1W1G A;  3PP2 A;  3D8F A;  5HE3 A;  2CRF A;  1V5M A;  1X05 A;  1BAK A;  2X18 A;  2DYQ A;  3SNH A;  1MK7 B;  1DDM A;  4GZU A;  4XWX A;  1XKE A;  4TYZ A;  1I2H A;  2UZS A;  2MKR A;  2YVC A;  4K2P A;  1TXD A;  4L6E A;  1FAO A;  2OTX A;  2DYN A;  1MIZ B;  3HW2 B;  2HE7 A;  3PVU A;  2KGX B;  2P8V A;  1V89 A;  3KZ1 A;  1Z87 A;  1LW3 A;  3SV1 A;  1DRO A;  5LON B;  2COA A;  2RLO A;  3A8Q A;  4DX9 0;  4F7U P;  2CY5 A;  2PZ1 A;  5DHF B;  2BCJ A;  1TJ6 A;  4GXB A;  3VOQ A;  3KSY A;  3AJ4 A;  3QBV B;  2IYB A;  5DH9 B;  1BWN A;  2ROZ B;  1FHX A;  1SGH A;  2EC1 A;  2FJL A;  2R0D A;  1U2B A;  3DXC A;  5KQ4 A;  2ADZ A;  5C79 A;  5EFX A;  4EMO A;  3WA0 A;  2COF A;  4HB2 B;  3HQC A;  3P6A A;  2N23 A;  2L2I A;  3PVL A;  2ROV A;  2LUL A;  4HAU B;  1FOE A;  1PLS A;  2YS5 A;  3G9W A;  4IAP A;  4HAT B;  3QWM A;  2DN6 A;  4GMV A;  1QQG A;  1NU2 A;  3N7C A;  1UPQ A;  1E5W A;  1WG7 A;  1H4R A;  3LJU X;  5JP4 A;  4F7H A;  2AL6 A;  4KHA A;  5HE1 A;  2Z0P A;  2GCJ A;  2Y8F A;  1ISN A;  3PVW A;  5DIF B;  2E2X A;  1OY2 A;  4DX8 A;  2Y8G A;  4F7G A;  4Z2N A;  5JHH A;  4WSF A;  3A98 B;  1X11 A;  5J3Q A;  4HAX B;  5FI1 A;  5DHA B;  1QC6 A;  4A6F A;  2D10 A;  3ODX A;  2JP2 A;  5JHG A;  5FI0 A;  3BJI A;  2KUP A;  2J0K A;  5J3T A;  1FB8 A;  2D9Z A;  5C5B B;  2VSZ A;  5C6R A;  1K5G B;  3AU4 A;  3TVV A;  3T06 A;  4CHJ A;  1ZSQ A;  5GOW B;  2M14 A;  4ZRJ A;  2I1K A;  1FGY A;  2DHK A;  3CXB B;  4KHB B;  2KCJ A;  4YL8 A;  1AWE A;  3SO6 A;  2DKQ A;  4K81 A;  3ZVR A;  3PZD A;  1FHO A;  4A6F B;  4CYE A;  1PFJ A;  4IOY X;  1DDV A;  1P5T A;  3D8E A;  1GG3 A;  3P7Z A;  1NTV A;  3SUZ A;  2LOX A;  1U5E A;  2Y7B A;  1XOD A;  4H8S A;  5KQ1 A;  3DXE A;  1OQN A;  5HE0 A;  2ZPY A;  2YF0 A;  1ZM0 A;  4ZRK A;  1WVH A;  1V88 A;  2CY4 A;  1P3R A;  2YS3 A;  5D3W A;  1M7R A;  3KRX A;  2CAY A;  4P7I A;  2GJY A;  1TQZ A;  2J0M A;  2P0H A;  1WJM A;  1J0W A;  5D3X A;  3A8P A;  1Y19 B;  1K5D B;  3FSS A;  4A6K A;  3FEH A;  4PNK A;  1ZC3 B;  4GMX B;  1UEF A;  2I1J A;  4HAV B;  4EKU A;  2QKM A;  2V76 A;  1OMW A;  2DX5 A;  4TKN A;  5CLQ B;  1WI1 A;  4HAY B;  1M7E A;  1V5P A; 
#chains in the Genus database with same CATH topology
 2MFQ A;  5D3Y A;  1RJ2 A;  4MT7 A;  2COD A;  1Q67 A;  3U7D A;  2GUM A;  4WVF B;  3TFM A;  1W1H A;  1FHW A;  1LB1 A;  2LKO A;  4NY0 A;  2J59 M;  3ODO A;  4K2O A;  3CIK A;  1U5G A;  1AQC A;  2Z0Q A;  2L1C A;  5C5B A;  1RRP B;  3MPX A;  2DA0 A;  1X1F A;  4EJN A;  5DI9 B;  2EMT A;  3KY9 A;  4GNK B;  1U5D A;  1U5F A;  1J19 A;  1P6S A;  2YT0 A;  4A5K A;  2H7D A;  2UVM A;  3DCX A;  5C16 A;  4DXA B;  3FM8 C;  1XX0 A;  1SHC A;  4HHV A;  2XQN M;  3TCA A;  4BBK A;  2N0Y A;  4A6H A;  2RVB B;  5JLJ B;  5D27 A;  2J0J A;  1DDW A;  3ULB A;  2M38 A;  1WGU A;  2GCL A;  2HTH B;  2MDX A;  5KCV A;  2DLW A;  1MAI A;  3GYO A;  3MDB C;  1KZ7 A;  1X1G A;  2Z0O A;  3U12 A;  3WYF B;  1WJ1 A;  2UZR A;  4KAX B;  1MPH A;  1BTK A;  3ODW A;  4KVG B;  3X23 A;  5HE2 A;  3ZDT A;  2I5C A;  2ELA A;  2DFK A;  2D11 A;  3F5R A;  1DYN A;  1DBH A;  2R2Y A;  1ZC4 B;  2EJ8 A;  4WJ7 A;  5LOP B;  1EF1 A;  5L81 A;  2DTC A;  4D0N B;  3OAN A;  1H10 A;  1MIX A;  3M1I B;  3TW1 A;  2W2W A;  2K00 A;  5M4Y B;  2DHJ A;  2VKI A;  3OHM B;  4HB0 B;  1UNP A;  3HK0 A;  3D8D A;  2ELB A;  2G35 A;  5I2M A;  5J3Y A;  2NMB A;  2Z59 A;  2MWN B;  4KHO A;  4DBB A;  2D9W A;  2FJU B;  2RSG A;  2K2J A;  5CLL B;  2Q13 A;  1XD4 A;  4Y94 A;  2AEH A;  3PG7 A;  3SYX A;  4ZRI A;  1N3H A;  1EGX A;  4K17 A;  1UPR A;  5D3V A;  1WGQ A;  2NZ8 B;  3PSC A;  3HIE A;  2D9V A;  2YSZ A;  2COC A;  2IFS A;  2OQB A;  4MK0 A;  3TO1 A;  4YON A;  5IRS A;  4HB4 B;  4IFS A;  3NWF A;  4NSW A;  2D2Q A;  4HDQ A;  4GN1 A;  3V5W A;  2RRF A;  4Z2M B;  3DXD A;  2D9Y A;  1PMS A;  3RCP A;  2EMS A;  2YT1 A;  1NTY A;  2YS1 A;  1Y5O A;  2K2U A;  3O96 A;  3ML4 A;  2YT2 A;  3NSU A;  4QJ4 B;  4PQ0 A;  2DHI A;  3PEG A;  2W2X D;  3BIN A;  2VRW B;  1KZG A;  2I5F A;  4HB3 B;  1MI1 A;  2P0D A;  2D9X A;  3QIJ A;  4HDO A;  2YRY A;  1W1D A;  4CHM A;  1GC6 A;  3F0W A;  4B6H A;  4HSI A;  2RNR B;  1I7A A;  1XCG A;  5I2S A;  1B55 A;  2D4Q A;  2R09 A;  4MY6 A;  5LG4 B;  1NI2 A;  1FGZ A;  1MK9 B;  1V61 A;  4HAZ B;  3VIA A;  3GYP A;  1MKE A;  2GS0 A;  4CSQ A;  3IVF A;  1ZVR A;  2K8E A;  2LG1 A;  3AU5 A;  4HAW B;  2DX1 A;  4GPT B;  2QKL A;  2LYD A;  1U27 A;  1GC7 A;  3KRW A;  4GOU A;  1UNQ A;  4C0A A;  1EVH A;  2KUQ A;  3U8Z A;  2H7E A;  2RGN B;  3UZT A;  3ULC A;  1XR0 B;  1UNR A;  3NWD A;  1IRS A;  2W2X C;  1KI1 B;  1V5U A;  2RUK B;  2DKP A;  1U29 A;  1BTN A;  2LOZ A;  2P0F A;  1EAZ A;  2Z4D A;  1X86 A;  1W1G A;  3PP2 A;  3D8F A;  2KR0 A;  5HE3 A;  2CRF A;  4QJ3 B;  1V5M A;  1X05 A;  1BAK A;  2X18 A;  2DYQ A;  3SNH A;  1MK7 B;  1DDM A;  4GZU A;  4XWX A;  1XKE A;  4TYZ A;  1I2H A;  2UZS A;  2MKR A;  2YVC A;  4K2P A;  1TXD A;  4L6E A;  1FAO A;  2OTX A;  2DYN A;  1MIZ B;  4QJ5 B;  2Z13 A;  3HW2 B;  2HE7 A;  3PVU A;  2KGX B;  2P8V A;  1V89 A;  3KZ1 A;  1Z87 A;  1LW3 A;  3SV1 A;  1DRO A;  5LON B;  2COA A;  2RLO A;  3A8Q A;  4DX9 0;  4F7U P;  2CY5 A;  2PZ1 A;  5DHF B;  2NBV A;  1T77 A;  4OSN A;  2BCJ A;  1TJ6 A;  4GXB A;  3VOQ A;  3KSY A;  3AJ4 A;  3QBV B;  2IYB A;  5DH9 B;  1BWN A;  2ROZ B;  1FHX A;  1SGH A;  2EC1 A;  2FJL A;  2R0D A;  1U2B A;  3DXC A;  5KQ4 A;  2ADZ A;  5C79 A;  5EFX A;  4DIX A;  4EMO A;  3WA0 A;  2COF A;  4HB2 B;  3HQC A;  3P6A A;  2N23 A;  2L2I A;  3PVL A;  2ROV A;  2LUL A;  4HAU B;  1FOE A;  1PLS A;  2KIE A;  2YS5 A;  3G9W A;  4IAP A;  4HAT B;  3HSA A;  3QWM A;  2DN6 A;  2ZKM X;  4GMV A;  1QQG A;  1NU2 A;  3N7C A;  1UPQ A;  1E5W A;  1WG7 A;  1H4R A;  3LJU X;  5JP4 A;  4F7H A;  2AL6 A;  4KHA A;  5HE1 A;  2Z0P A;  2GCJ A;  2Y8F A;  1ISN A;  3FVC A;  3PVW A;  5DIF B;  2E2X A;  1OY2 A;  4DX8 A;  3NWA A;  2Y8G A;  2Z14 A;  4F7G A;  4Z2N A;  5JHH A;  4WSF A;  3A98 B;  3NW8 A;  1X11 A;  4KHB A;  5J3Q A;  4HAX B;  2KIG A;  5FI1 A;  5DHA B;  1QC6 A;  4A6F A;  2D10 A;  3ODX A;  2JP2 A;  5JHG A;  5FI0 A;  3BJI A;  2KUP A;  2J0K A;  3A58 A;  5J3T A;  1FB8 A;  2D9Z A;  5C5B B;  2VSZ A;  5C6R A;  4QXA B;  1K5G B;  3AU4 A;  3TVV A;  3T06 A;  4CHJ A;  1ZSQ A;  5GOW B;  2M14 A;  4ZRJ A;  2I1K A;  1FGY A;  2DHK A;  3CXB B;  4KHB B;  2KCJ A;  4YL8 A;  1AWE A;  3SO6 A;  2DKQ A;  4K81 A;  3ZVR A;  3PZD A;  1FHO A;  4A6F B;  4CYE A;  1PFJ A;  4IOY X;  1DDV A;  1P5T A;  3B77 A;  3D8E A;  1GG3 A;  1ZYI A;  3P7Z A;  1NTV A;  3SUZ A;  2LOX A;  1U5E A;  2Y7B A;  1XOD A;  4H8S A;  5KQ1 A;  3DXE A;  1OQN A;  5HE0 A;  2ZPY A;  2YF0 A;  1ZM0 A;  4ZRK A;  1WVH A;  1V88 A;  4L1R A;  2CY4 A;  1P3R A;  2YS3 A;  5D3W A;  1M7R A;  3KRX A;  2CAY A;  4P7I A;  2GJY A;  1TQZ A;  2J0M A;  2P0H A;  1WJM A;  1J0W A;  5D3X A;  4D6W A;  3A8P A;  4OT1 A;  1Y19 B;  1K5D B;  3FSS A;  4A6K A;  3FEH A;  4PNK A;  1ZC3 B;  4GMX B;  1UEF A;  2K49 A;  2I1J A;  4HAV B;  4EKU A;  2QKM A;  2V76 A;  1OMW A;  2DX5 A;  4TKN A;  5CLQ B;  1WI1 A;  4HAY B;  1M7E A;  1V5P A; 
#chains in the Genus database with same CATH homology
 2MFQ A;  5D3Y A;  1RJ2 A;  4MT7 A;  2COD A;  1Q67 A;  3U7D A;  2GUM A;  4WVF B;  3TFM A;  1W1H A;  1FHW A;  1LB1 A;  2LKO A;  4NY0 A;  2J59 M;  3ODO A;  4K2O A;  3CIK A;  1U5G A;  1AQC A;  2Z0Q A;  2L1C A;  5C5B A;  1RRP B;  3MPX A;  2DA0 A;  1X1F A;  4EJN A;  5DI9 B;  2EMT A;  3KY9 A;  4GNK B;  1U5D A;  1U5F A;  1J19 A;  1P6S A;  2YT0 A;  4A5K A;  2H7D A;  2UVM A;  5C16 A;  4DXA B;  3FM8 C;  1XX0 A;  1SHC A;  4HHV A;  2XQN M;  3TCA A;  4BBK A;  2N0Y A;  4A6H A;  2RVB B;  5JLJ B;  5D27 A;  2J0J A;  1DDW A;  3ULB A;  2M38 A;  1WGU A;  2GCL A;  2HTH B;  2MDX A;  5KCV A;  2DLW A;  1MAI A;  3GYO A;  3MDB C;  1KZ7 A;  1X1G A;  2Z0O A;  3U12 A;  3WYF B;  1WJ1 A;  2UZR A;  4KAX B;  1MPH A;  1BTK A;  3ODW A;  4KVG B;  3X23 A;  5HE2 A;  3ZDT A;  2I5C A;  2ELA A;  2DFK A;  2D11 A;  3F5R A;  1DYN A;  1DBH A;  2R2Y A;  1ZC4 B;  2EJ8 A;  4WJ7 A;  5LOP B;  1EF1 A;  5L81 A;  2DTC A;  4D0N B;  3OAN A;  1H10 A;  1MIX A;  3M1I B;  3TW1 A;  2W2W A;  2K00 A;  5M4Y B;  2DHJ A;  2VKI A;  3OHM B;  4HB0 B;  1UNP A;  3HK0 A;  3D8D A;  2ELB A;  2G35 A;  5I2M A;  5J3Y A;  2NMB A;  2Z59 A;  2MWN B;  4KHO A;  4DBB A;  2D9W A;  2FJU B;  2RSG A;  2K2J A;  5CLL B;  2Q13 A;  1XD4 A;  4Y94 A;  2AEH A;  3PG7 A;  3SYX A;  4ZRI A;  1N3H A;  1EGX A;  4K17 A;  1UPR A;  5D3V A;  1WGQ A;  2NZ8 B;  3PSC A;  3HIE A;  2D9V A;  2YSZ A;  2COC A;  2IFS A;  2OQB A;  4MK0 A;  3TO1 A;  4YON A;  5IRS A;  4HB4 B;  4IFS A;  3NWF A;  4NSW A;  2D2Q A;  4HDQ A;  4GN1 A;  3V5W A;  2RRF A;  4Z2M B;  3DXD A;  2D9Y A;  1PMS A;  3RCP A;  2EMS A;  2YT1 A;  1NTY A;  2YS1 A;  1Y5O A;  2K2U A;  3O96 A;  3ML4 A;  2YT2 A;  3NSU A;  4QJ4 B;  4PQ0 A;  2DHI A;  3PEG A;  2W2X D;  3BIN A;  2VRW B;  1KZG A;  2I5F A;  4HB3 B;  2P0D A;  2D9X A;  3QIJ A;  4HDO A;  2YRY A;  1W1D A;  4CHM A;  1GC6 A;  3F0W A;  4B6H A;  4HSI A;  2RNR B;  1I7A A;  1XCG A;  5I2S A;  1B55 A;  2D4Q A;  2R09 A;  4MY6 A;  5LG4 B;  1NI2 A;  1FGZ A;  1MK9 B;  1V61 A;  4HAZ B;  3VIA A;  3GYP A;  1MKE A;  2GS0 A;  4CSQ A;  3IVF A;  1ZVR A;  2K8E A;  2LG1 A;  3AU5 A;  4HAW B;  2DX1 A;  4GPT B;  2QKL A;  2LYD A;  1U27 A;  1GC7 A;  3KRW A;  4GOU A;  1UNQ A;  4C0A A;  1EVH A;  2KUQ A;  3U8Z A;  2H7E A;  2RGN B;  3UZT A;  3ULC A;  1XR0 B;  1UNR A;  3NWD A;  1IRS A;  2W2X C;  1KI1 B;  1V5U A;  2RUK B;  2DKP A;  1U29 A;  1BTN A;  2LOZ A;  2P0F A;  1EAZ A;  2Z4D A;  1X86 A;  1W1G A;  3PP2 A;  3D8F A;  5HE3 A;  2KR0 A;  2CRF A;  4QJ3 B;  1V5M A;  1X05 A;  1BAK A;  2X18 A;  2DYQ A;  3SNH A;  1MK7 B;  1DDM A;  4GZU A;  4XWX A;  1XKE A;  4TYZ A;  1I2H A;  2UZS A;  2MKR A;  2YVC A;  4K2P A;  1TXD A;  4L6E A;  1FAO A;  2OTX A;  2DYN A;  1MIZ B;  4QJ5 B;  2Z13 A;  3HW2 B;  2HE7 A;  3PVU A;  2KGX B;  2P8V A;  1V89 A;  3KZ1 A;  1Z87 A;  1LW3 A;  3SV1 A;  1DRO A;  5LON B;  2COA A;  2RLO A;  3A8Q A;  4DX9 0;  4F7U P;  2CY5 A;  2PZ1 A;  5DHF B;  2NBV A;  4OSN A;  2BCJ A;  1TJ6 A;  4GXB A;  3VOQ A;  3KSY A;  3AJ4 A;  3QBV B;  2IYB A;  5DH9 B;  1BWN A;  2ROZ B;  1FHX A;  1SGH A;  2EC1 A;  2FJL A;  2R0D A;  1U2B A;  3DXC A;  5KQ4 A;  2ADZ A;  5C79 A;  5EFX A;  4DIX A;  4EMO A;  3WA0 A;  2COF A;  4HB2 B;  3HQC A;  3P6A A;  2N23 A;  2L2I A;  3PVL A;  2ROV A;  2LUL A;  4HAU B;  1FOE A;  1PLS A;  2KIE A;  2YS5 A;  3G9W A;  4IAP A;  4HAT B;  3QWM A;  2DN6 A;  2ZKM X;  4GMV A;  1QQG A;  1NU2 A;  3N7C A;  1UPQ A;  1E5W A;  1WG7 A;  1H4R A;  3LJU X;  5JP4 A;  4F7H A;  2AL6 A;  4KHA A;  5HE1 A;  2Z0P A;  2GCJ A;  2Y8F A;  1ISN A;  3FVC A;  3PVW A;  5DIF B;  2E2X A;  1OY2 A;  4DX8 A;  3NWA A;  2Y8G A;  2Z14 A;  4F7G A;  4Z2N A;  5JHH A;  4WSF A;  3A98 B;  3NW8 A;  1X11 A;  5J3Q A;  4KHB A;  4HAX B;  2KIG A;  5FI1 A;  5DHA B;  1QC6 A;  4A6F A;  2D10 A;  3ODX A;  2JP2 A;  5JHG A;  5FI0 A;  3BJI A;  2KUP A;  2J0K A;  5J3T A;  3A58 A;  1FB8 A;  2D9Z A;  5C5B B;  2VSZ A;  5C6R A;  4QXA B;  1K5G B;  3AU4 A;  3TVV A;  3T06 A;  4CHJ A;  1ZSQ A;  5GOW B;  2M14 A;  4ZRJ A;  2I1K A;  1FGY A;  2DHK A;  3CXB B;  4KHB B;  2KCJ A;  4YL8 A;  1AWE A;  3SO6 A;  2DKQ A;  4K81 A;  3ZVR A;  3PZD A;  1FHO A;  4A6F B;  4CYE A;  1PFJ A;  4IOY X;  1DDV A;  1P5T A;  3D8E A;  1GG3 A;  1ZYI A;  3P7Z A;  1NTV A;  3SUZ A;  2LOX A;  1U5E A;  2Y7B A;  1XOD A;  4H8S A;  5KQ1 A;  3DXE A;  1OQN A;  5HE0 A;  2ZPY A;  2YF0 A;  1ZM0 A;  4ZRK A;  1WVH A;  1V88 A;  4L1R A;  2CY4 A;  1P3R A;  2YS3 A;  5D3W A;  1M7R A;  3KRX A;  2CAY A;  4P7I A;  2GJY A;  1TQZ A;  2J0M A;  2P0H A;  1WJM A;  1J0W A;  5D3X A;  4D6W A;  3A8P A;  4OT1 A;  1Y19 B;  1K5D B;  3FSS A;  4A6K A;  3FEH A;  4PNK A;  1ZC3 B;  4GMX B;  1UEF A;  2K49 A;  2I1J A;  4HAV B;  4EKU A;  2QKM A;  2V76 A;  1OMW A;  2DX5 A;  4TKN A;  5CLQ B;  1WI1 A;  4HAY B;  1M7E A;  1V5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...