3TVVA

Structure of the tandem ph domains of rtt106 (residues 68-315)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
244
structure length
233
Chain Sequence
MSETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRKQMKDKSMSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
total genus 50
structure length 233
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tvvA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tvvA01
2QKMA 3NSUA 2UZSA 1GC6A 2E2XA 2UZRA 2D11A 3PZDA 3WA0A 1J19A 3IVFA 3ULCA 2ELBA 4HAYB 2AL6A 3M1IB 2NZ8B 1FGZA 4Y94A 4HAXB 2DYNA 1K5DB 5J3TA 1Q67A 4KAXB 4TYZA 5D3YA 1X11A 1BAKA 4EMOA 1RRPB 2D10A 2LKOA 1FOEA 3AU4A 1ZC4B 2DKQA 4GZUA 1V5UA 4B6HA 1BTNA 1FGYA 4KHOA 1ISNA 1GG3A 2CRFA 4YONA 4F7GA 2COAA 5HE0A 1W1DA 2KGXB 1UNRA 1Y19B 2DA0A 2BCJA 5LOPB 1W1HA 5J3QA 3DXEA 4A6FA 1V88A 5JP4A 1MK7B 2GS0A 1XD4A 2DHJA 1WJ1A 2YT1A 4DBBA 5D3WA 2DX5A 2P0FA 2D9VA 1KZ7A 2RSGA 2Z0PA 2P0DA 4DXAB 2JP2A 5DHFB 4DX8A 2EMSA 5CLLB 2EJ8A 4K2OA 4IOYX 1Z87A 3AJ4A 3ODXA 1U5DA 1FHXA 2ELAA 1WI1A 1DROA 1U29A 2RUKB 3QIJA 1EVHA 2P8VA 5J3YA 5C5BA 1K5GB 1NU2A 4HB2B 1P6SA 1EAZA 4HDQA 2LYDA 4NY0A 4P7IA 4L6EA 3X23A 1X1FA 3HW2B 3BINA 4K81A 2XQNM 3D8FA 1MAIA 4EKUA 1TJ6A 2GJYA 5C79A 4CYEA 4MT7A 2W2XD 3ULBA 4DX90 2DTCA 2K2UA 4CHMA 2X18A 1ZVRA 5LONB 3QBVB 5C5BB 2D9XA 3ODWA 5KQ4A 2GCJA 4PNKA 1LB1A 3TO1A 2YSZA 3DXCA 2DYQA 1PMSA 1DBHA 2IFSA 4HAWB 2DLWA 2RGNB 1U27A 5JHHA 4NSWA 3D8EA 2Z0QA 2D2QA 1EF1A 1FHWA 4HHVA 3RCPA 3DXDA 4A6HA 2RNRB 1M7EA 3MDBC 1KZGA 3KSYA 1KI1B 1EGXA 1PLSA 4GPTB 2DN6A 2J0JA 4A5KA 2LG1A 2YVCA 2YRYA 1UEFA 2G35A 5CLQB 2HTHB 4A6FB 3ODOA 2ZPYA 5DI9B 4H8SA 1UNQA 4MK0A 4TKNA 4GMVA 3KY9A 3QWMA 4GN1A 4ZRJA 3TFMA 1FB8A 2EC1A 5GOWB 1U5GA 3TCAA 3HQCA 2LULA 3AU5A 1BTKA 3CXBB 5DH9B 1N3HA 4GMXB 3TW1A 3LJUX 1U2BA 4XWXA 5C16A 3GYOA 1ZC3B 2CODA 2W2XC 2H7EA 4WSFA 1SHCA 3FM8C 5KQ1A 4EJNA 1FHOA 2VRWB 3N7CA 2ROVA 5D3VA 4C0AA 2MKRA 2YS5A 3SUZA 2I5CA 4ZRIA 3PVLA 2FJLA 1ZSQA 2VSZA 2D9YA 2DHKA 2LOZA 3PEGA 1MPHA 2IYBA 1X1GA 4KHBB 3SV1A 4WJ7A 2ROZB 4A6KA 1MK9B 2AEHA 1P5TA 1I2HA 2UVMA 2M14A 1PFJA 1QC6A 3VOQA 2DHIA 1WVHA 2Y7BA 2KCJA 3GYPA 2CY5A 2D9WA 5HE1A 2DFKA 4D0NB 2YS3A 3O96A 1X05A 2OQBA 3SYXA 4KVGB 3UZTA 1ZM0A 1XCGA 1H4RA 1XODA 3MPXA 3U7DA 2HE7A 1H10A 2CY4A 3F5RA 1E5WA 2R0DA 2EMTA 4HAZB 2R09A 5FI1A 2Y8GA 1XX0A 3OANA 1UPQA 2OTXA 2L2IA 3TVVA 2I5FA 5D27A 4KHAA 3BJIA 2L1CA 4PQ0A 2N0YA 4HB0B 4MY6A 4CHJA 3ZDTA 3ZVRA 4HB4B 5C6RA 2COFA 1MIXA 1V89A 1NTVA 3P7ZA 2RVBB 2D9ZA 2MFQA 5KCVA 2KUPA 3WYFB 5D3XA 2MWNB 3PSCA 4ZRKA 3D8DA 1B55A 4K17A 2J0KA 2K00A 5DIFB 1IRSA 3P6AA 3KRXA 1DDVA 2MDXA 4HB3B 1TXDA 2GCLA 1OY2A 1AWEA 1UPRA 1X86A 2PZ1A 2ADZA 5EFXA 5HE3A 1XR0B 3FEHA 3F0WA 4HDOA 3PP2A 2YS1A 3KZ1A 1Y5OA 5HE2A 2P0HA 4Z2NA 3U8ZA 1V5PA 1OQNA 1QQGA 3PVUA 1LW3A 4GXBA 2VKIA 4HAVB 1DDWA 1W1GA 4YL8A 2COCA 1UNPA 2QKLA 4BBKA 3A98B 2RLOA 2K2JA 1U5EA 3KRWA 1U5FA 3T06A 2Y8FA 2DX1A 2N23A 3VIAA 1WG7A 3A8QA 2I1KA 2H7DA 3ML4A 4IFSA 1WGUA 2YT0A 1SGHA 2I1JA 3G9WA 3SO6A 1J0WA 2NMBA 3CIKA 1XKEA 1BWNA 1AQCA 3PG7A 3PVWA 5JLJB 1V5MA 5FI0A 2DKPA 4F7HA 4IAPA 1MIZB 1OMWA 1TQZA 2D4QA 2J59M 3V5WA 4F7UP 1P3RA 3SNHA 4WVFB 1DYNA 4K2PA 1V61A 2J0MA 1DDMA 1FAOA 1M7RA 2Z0OA 1MKEA 5DHAB 2M38A 3FSSA 1NI2A 3HK0A 3A8PA 1WJMA 4HATB 2W2WA 5JHGA 2V76A 1NTYA 1RJ2A 2Q13A 1WGQA 5L81A 2YF0A 4HAUB 2CAYA 4Z2MB 2LOXA 1I7AA 1GC7A
chains in the Genus database with same CATH superfamily
2QKMA 3NSUA 2UZSA 1GC6A 2E2XA 2UZRA 2D11A 3PZDA 3WA0A 1J19A 3IVFA 3ULCA 3U12A 2ELBA 2RRFA 2AL6A 3M1IB 4HAYB 4GNKB 2NZ8B 1FGZA 4Y94A 4HAXB 2DYNA 1K5DB 5J3TA 1Q67A 4KAXB 4TYZA 5D3YA 1X11A 1BAKA 4EMOA 1RRPB 2D10A 2LKOA 1FOEA 3AU4A 1ZC4B 2DKQA 4GZUA 1V5UA 4B6HA 4OSNA 1BTNA 1FGYA 4KHOA 1ISNA 1GG3A 2CRFA 4YONA 4F7GA 2COAA 5HE0A 1W1DA 2KGXB 1UNRA 1Y19B 2DA0A 4QXAB 2BCJA 1T77A 5LOPB 1W1HA 5J3QA 3DXEA 4A6FA 1V88A 5JP4A 1MK7B 2GS0A 1XD4A 2DHJA 1WJ1A 2YT1A 4DBBA 5D3WA 2DX5A 2P0FA 2D9VA 2ZKMX 1KZ7A 2RSGA 2Z0PA 2P0DA 5M4YB 4DXAB 2K8EA 2JP2A 2NBVA 5DHFB 4DX8A 2EMSA 5CLLB 2R2YA 2EJ8A 4K2OA 4IOYX 1Z87A 3AJ4A 3ODXA 1U5DA 1FHXA 2KR0A 2ELAA 1WI1A 1DROA 1U29A 2RUKB 3QIJA 1EVHA 2P8VA 5J3YA 5C5BA 1K5GB 1NU2A 4HB2B 1P6SA 1EAZA 4HDQA 2LYDA 4NY0A 4P7IA 4L6EA 3X23A 1X1FA 3HW2B 3BINA 5IRSA 4K81A 2XQNM 3D8FA 1MAIA 4EKUA 1TJ6A 2GJYA 5C79A 4CYEA 4MT7A 2W2XD 3ULBA 4DX90 2DTCA 2K2UA 4CHMA 2X18A 1ZVRA 5LONB 3QBVB 5C5BB 3DCXA 2D9XA 3ODWA 5KQ4A 2GCJA 4PNKA 1LB1A 3TO1A 2YSZA 4KHBA 4QJ5B 3DXCA 2DYQA 4D6WA 1PMSA 1DBHA 2IFSA 4HAWB 2DLWA 2RGNB 1U27A 5JHHA 4NSWA 3D8EA 2Z0QA 2D2QA 1EF1A 3NWFA 1FHWA 4HHVA 3RCPA 3DXDA 4A6HA 2RNRB 1M7EA 3MDBC 1KZGA 3KSYA 1KI1B 1EGXA 1PLSA 4GPTB 2DN6A 2J0JA 4A5KA 2LG1A 2YVCA 2YRYA 1UEFA 5I2SA 2G35A 5CLQB 2HTHB 4A6FB 3ODOA 2ZPYA 5DI9B 4H8SA 1UNQA 4MK0A 4TKNA 4GMVA 3KY9A 3QWMA 4GN1A 4ZRJA 3TFMA 1FB8A 2EC1A 5GOWB 1U5GA 3TCAA 4QJ4B 3HQCA 2LULA 3AU5A 1BTKA 3CXBB 5DH9B 1N3HA 4GMXB 3TW1A 3LJUX 1U2BA 4XWXA 5C16A 3GYOA 1ZC3B 2CODA 2W2XC 2H7EA 4WSFA 2YT2A 1SHCA 3FM8C 5KQ1A 4EJNA 4OT1A 1FHOA 2VRWB 3N7CA 2ROVA 5D3VA 4C0AA 2MKRA 2YS5A 1ZYIA 3SUZA 2I5CA 3NW8A 4ZRIA 3PVLA 4L1RA 2FJLA 1ZSQA 2VSZA 2D9YA 2DHKA 2LOZA 3PEGA 1MPHA 2IYBA 4QJ3B 1X1GA 4KHBB 3SV1A 4WJ7A 2ROZB 4A6KA 2GUMA 1MK9B 3HSAA 2AEHA 1P5TA 1I2HA 2UVMA 2M14A 1PFJA 1QC6A 3VOQA 2DHIA 1WVHA 2Y7BA 2KCJA 3GYPA 2CY5A 2D9WA 2Z13A 5HE1A 2DFKA 4D0NB 2YS3A 3O96A 1X05A 2OQBA 2FJUB 2K49A 3SYXA 4KVGB 4DIXA 3UZTA 1ZM0A 1XCGA 1H4RA 1XODA 3MPXA 3U7DA 2HE7A 1H10A 2CY4A 3F5RA 1E5WA 2R0DA 2EMTA 4HAZB 2R09A 5FI1A 2Y8GA 1XX0A 3OANA 1UPQA 2OTXA 2L2IA 3TVVA 2I5FA 5D27A 4KHAA 3BJIA 2L1CA 3FVCA 4CSQA 4PQ0A 2N0YA 4HB0B 4MY6A 3NWDA 4CHJA 3A58A 3ZDTA 3ZVRA 4HB4B 5C6RA 2COFA 2Z59A 1MIXA 1V89A 1NTVA 3P7ZA 2RVBB 2D9ZA 2MFQA 5KCVA 5LG4B 2KUPA 3WYFB 5D3XA 3NWAA 2MWNB 3PSCA 4ZRKA 3D8DA 1B55A 4K17A 1MI1A 2J0KA 2K00A 2KIGA 5DIFB 1IRSA 3P6AA 5I2MA 3KRXA 1DDVA 2MDXA 4HB3B 1TXDA 3OHMB 2GCLA 1OY2A 1AWEA 1UPRA 1X86A 2PZ1A 2ADZA 5EFXA 5HE3A 1XR0B 3FEHA 3F0WA 4HDOA 3PP2A 2YS1A 3KZ1A 1Y5OA 5HE2A 2P0HA 4Z2NA 2KIEA 3U8ZA 1V5PA 1OQNA 1QQGA 3PVUA 1LW3A 4GXBA 2VKIA 4HAVB 4HSIA 1DDWA 1W1GA 4YL8A 2COCA 1UNPA 2Z14A 2QKLA 4BBKA 3A98B 2RLOA 2K2JA 1U5EA 3KRWA 1U5FA 3T06A 2Y8FA 2DX1A 2N23A 3VIAA 1WG7A 3A8QA 2I1KA 2H7DA 3ML4A 4IFSA 1WGUA 2YT0A 1SGHA 2I1JA 3G9WA 3SO6A 1J0WA 2NMBA 3CIKA 1XKEA 1BWNA 1AQCA 3PG7A 3PVWA 5JLJB 1V5MA 5FI0A 2DKPA 4F7HA 4IAPA 1MIZB 1OMWA 1TQZA 2D4QA 2J59M 2KUQA 3HIEA 1P3RA 3SNHA 3V5WA 4WVFB 4F7UP 1DYNA 4K2PA 1V61A 2J0MA 1DDMA 4GOUA 1FAOA 1M7RA 2Z0OA 1MKEA 5DHAB 2M38A 3FSSA 1NI2A 3HK0A 3A8PA 1WJMA 4HATB 2W2WA 5JHGA 2V76A 1NTYA 1RJ2A 2Q13A 1WGQA 3B77A 2YF0A 4HAUB 5L81A 2CAYA 4Z2MB 2LOXA 1I7AA 1GC7A 2Z4DA
chains in the Genus database with same CATH topology
2QKMA 3NSUA 2UZSA 1GC6A 2E2XA 2UZRA 2D11A 3PZDA 3WA0A 1J19A 3IVFA 3ULCA 3U12A 2ELBA 4HAYB 2AL6A 3M1IB 2RRFA 4GNKB 2NZ8B 1FGZA 4Y94A 4HAXB 2DYNA 1K5DB 5J3TA 1Q67A 4KAXB 4TYZA 5D3YA 1X11A 1BAKA 4EMOA 1RRPB 2D10A 2LKOA 1FOEA 3AU4A 1ZC4B 2DKQA 4GZUA 1V5UA 4B6HA 4OSNA 1BTNA 1FGYA 4KHOA 1ISNA 1GG3A 2CRFA 4YONA 4F7GA 2COAA 5HE0A 1W1DA 2KGXB 1UNRA 1Y19B 2DA0A 4QXAB 2BCJA 5LOPB 1W1HA 5J3QA 3DXEA 4A6FA 1V88A 5JP4A 1MK7B 2GS0A 1XD4A 2DHJA 1WJ1A 2YT1A 4DBBA 5D3WA 2DX5A 2P0FA 2D9VA 2ZKMX 1KZ7A 2RSGA 2Z0PA 2P0DA 5M4YB 4DXAB 2K8EA 2JP2A 2NBVA 5DHFB 4DX8A 2EMSA 5CLLB 2R2YA 2EJ8A 4K2OA 4IOYX 1Z87A 3AJ4A 3ODXA 1U5DA 1FHXA 2KR0A 2ELAA 1WI1A 1DROA 1U29A 2RUKB 3QIJA 1EVHA 2P8VA 5J3YA 5C5BA 1K5GB 1NU2A 4HB2B 1P6SA 1EAZA 4HDQA 2LYDA 4NY0A 4P7IA 4L6EA 3X23A 1X1FA 3HW2B 3BINA 5IRSA 4K81A 2XQNM 3D8FA 1MAIA 4EKUA 1TJ6A 2GJYA 5C79A 4CYEA 4MT7A 2W2XD 3ULBA 4DX90 2DTCA 2K2UA 4CHMA 2X18A 1ZVRA 5LONB 3QBVB 5C5BB 2D9XA 3ODWA 5KQ4A 2GCJA 4PNKA 1LB1A 3TO1A 2YSZA 4KHBA 4QJ5B 3DXCA 2DYQA 4D6WA 1PMSA 1DBHA 2IFSA 4HAWB 2DLWA 2RGNB 1U27A 5JHHA 4NSWA 3D8EA 2Z0QA 2D2QA 1EF1A 3NWFA 1FHWA 4HHVA 3RCPA 3DXDA 4A6HA 2RNRB 1M7EA 3MDBC 1KZGA 3KSYA 1KI1B 1EGXA 1PLSA 4GPTB 2DN6A 2J0JA 4A5KA 2LG1A 2YVCA 2YRYA 1UEFA 5I2SA 2G35A 5CLQB 2HTHB 4A6FB 3ODOA 2ZPYA 5DI9B 4H8SA 1UNQA 4MK0A 4TKNA 4GMVA 3KY9A 3QWMA 4GN1A 4ZRJA 3TFMA 1FB8A 2EC1A 5GOWB 1U5GA 3TCAA 4QJ4B 3HQCA 2LULA 3AU5A 1BTKA 3CXBB 5DH9B 1N3HA 4GMXB 3TW1A 3LJUX 1U2BA 4XWXA 5C16A 3GYOA 1ZC3B 2CODA 2W2XC 2H7EA 4WSFA 2YT2A 1SHCA 3FM8C 5KQ1A 4EJNA 4OT1A 1FHOA 2VRWB 3N7CA 2ROVA 5D3VA 4C0AA 2MKRA 2YS5A 3SUZA 1ZYIA 2I5CA 3NW8A 4ZRIA 3PVLA 4L1RA 2FJLA 1ZSQA 2VSZA 2D9YA 2DHKA 2LOZA 3PEGA 1MPHA 2IYBA 4QJ3B 1X1GA 4KHBB 3SV1A 4WJ7A 2ROZB 4A6KA 2GUMA 1MK9B 2AEHA 1P5TA 1I2HA 2UVMA 2M14A 1PFJA 1QC6A 3VOQA 2DHIA 1WVHA 2Y7BA 2KCJA 3GYPA 2CY5A 2D9WA 5HE1A 2Z13A 2DFKA 4D0NB 2YS3A 3O96A 1X05A 2OQBA 2FJUB 2K49A 3SYXA 4KVGB 3UZTA 4DIXA 1ZM0A 1XCGA 1H4RA 1XODA 3MPXA 3U7DA 2HE7A 1H10A 2CY4A 3F5RA 1E5WA 2R0DA 2EMTA 4HAZB 2R09A 5FI1A 2Y8GA 1XX0A 3OANA 1UPQA 2OTXA 2L2IA 3TVVA 2I5FA 5D27A 4KHAA 3BJIA 2L1CA 3FVCA 4CSQA 4PQ0A 2N0YA 4HB0B 4MY6A 3NWDA 4CHJA 3A58A 3ZDTA 3ZVRA 4HB4B 5C6RA 2COFA 2Z59A 1MIXA 1V89A 1NTVA 3P7ZA 2RVBB 2D9ZA 2MFQA 5KCVA 5LG4B 2KUPA 3WYFB 5D3XA 3NWAA 2MWNB 3PSCA 4ZRKA 3D8DA 1B55A 4K17A 2J0KA 2K00A 5DIFB 2KIGA 1IRSA 3P6AA 5I2MA 3KRXA 1DDVA 2MDXA 4HB3B 1TXDA 3OHMB 2GCLA 1OY2A 1AWEA 1UPRA 1X86A 2PZ1A 2ADZA 5EFXA 5HE3A 1XR0B 3FEHA 3F0WA 4HDOA 3PP2A 2YS1A 3KZ1A 1Y5OA 5HE2A 2P0HA 4Z2NA 2KIEA 3U8ZA 1V5PA 1OQNA 1QQGA 3PVUA 1LW3A 4GXBA 2VKIA 4HAVB 4HSIA 1DDWA 1W1GA 4YL8A 2COCA 1UNPA 2Z14A 2QKLA 4BBKA 3A98B 2RLOA 2K2JA 1U5EA 3KRWA 1U5FA 3T06A 2Y8FA 2DX1A 2N23A 3VIAA 1WG7A 3A8QA 2I1KA 2H7DA 3ML4A 4IFSA 1WGUA 2YT0A 1SGHA 2I1JA 3G9WA 3SO6A 1J0WA 2NMBA 3CIKA 1XKEA 1BWNA 1AQCA 3PG7A 3PVWA 5JLJB 1V5MA 5FI0A 2DKPA 4F7HA 4IAPA 1MIZB 1OMWA 1TQZA 2D4QA 2J59M 3V5WA 4F7UP 1P3RA 3SNHA 2KUQA 4WVFB 3HIEA 1DYNA 4K2PA 1V61A 2J0MA 1DDMA 4GOUA 1FAOA 1M7RA 2Z0OA 1MKEA 5DHAB 2M38A 3FSSA 1NI2A 3HK0A 3A8PA 1WJMA 4HATB 2W2WA 5JHGA 2V76A 1NTYA 1RJ2A 2Q13A 1WGQA 5L81A 2YF0A 4HAUB 2CAYA 4Z2MB 2LOXA 1I7AA 1GC7A 2Z4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKM A;  3NSU A;  2UZS A;  1GC6 A;  2E2X A;  2UZR A;  2D11 A;  3PZD A;  3WA0 A;  1J19 A;  3IVF A;  3ULC A;  2ELB A;  4HAY B;  2AL6 A;  3M1I B;  2NZ8 B;  1FGZ A;  4Y94 A;  4HAX B;  2DYN A;  1K5D B;  5J3T A;  1Q67 A;  4KAX B;  4TYZ A;  5D3Y A;  1X11 A;  1BAK A;  4EMO A;  1RRP B;  2D10 A;  2LKO A;  1FOE A;  3AU4 A;  1ZC4 B;  2DKQ A;  4GZU A;  1V5U A;  4B6H A;  1BTN A;  1FGY A;  4KHO A;  1ISN A;  1GG3 A;  2CRF A;  4YON A;  4F7G A;  2COA A;  5HE0 A;  1W1D A;  2KGX B;  1UNR A;  1Y19 B;  2DA0 A;  2BCJ A;  5LOP B;  1W1H A;  5J3Q A;  3DXE A;  4A6F A;  1V88 A;  5JP4 A;  1MK7 B;  2GS0 A;  1XD4 A;  2DHJ A;  1WJ1 A;  2YT1 A;  4DBB A;  5D3W A;  2DX5 A;  2P0F A;  2D9V A;  1KZ7 A;  2RSG A;  2Z0P A;  2P0D A;  4DXA B;  2JP2 A;  5DHF B;  4DX8 A;  2EMS A;  5CLL B;  2EJ8 A;  4K2O A;  4IOY X;  1Z87 A;  3AJ4 A;  3ODX A;  1U5D A;  1FHX A;  2ELA A;  1WI1 A;  1DRO A;  1U29 A;  2RUK B;  3QIJ A;  1EVH A;  2P8V A;  5J3Y A;  5C5B A;  1K5G B;  1NU2 A;  4HB2 B;  1P6S A;  1EAZ A;  4HDQ A;  2LYD A;  4NY0 A;  4P7I A;  4L6E A;  3X23 A;  1X1F A;  3HW2 B;  3BIN A;  4K81 A;  2XQN M;  3D8F A;  1MAI A;  4EKU A;  1TJ6 A;  2GJY A;  5C79 A;  4CYE A;  4MT7 A;  2W2X D;  3ULB A;  4DX9 0;  2DTC A;  2K2U A;  4CHM A;  2X18 A;  1ZVR A;  5LON B;  3QBV B;  5C5B B;  2D9X A;  3ODW A;  5KQ4 A;  2GCJ A;  4PNK A;  1LB1 A;  3TO1 A;  2YSZ A;  3DXC A;  2DYQ A;  1PMS A;  1DBH A;  2IFS A;  4HAW B;  2DLW A;  2RGN B;  1U27 A;  5JHH A;  4NSW A;  3D8E A;  2Z0Q A;  2D2Q A;  1EF1 A;  1FHW A;  4HHV A;  3RCP A;  3DXD A;  4A6H A;  2RNR B;  1M7E A;  3MDB C;  1KZG A;  3KSY A;  1KI1 B;  1EGX A;  1PLS A;  4GPT B;  2DN6 A;  2J0J A;  4A5K A;  2LG1 A;  2YVC A;  2YRY A;  1UEF A;  2G35 A;  5CLQ B;  2HTH B;  4A6F B;  3ODO A;  2ZPY A;  5DI9 B;  4H8S A;  1UNQ A;  4MK0 A;  4TKN A;  4GMV A;  3KY9 A;  3QWM A;  4GN1 A;  4ZRJ A;  3TFM A;  1FB8 A;  2EC1 A;  5GOW B;  1U5G A;  3TCA A;  3HQC A;  2LUL A;  3AU5 A;  1BTK A;  3CXB B;  5DH9 B;  1N3H A;  4GMX B;  3TW1 A;  3LJU X;  1U2B A;  4XWX A;  5C16 A;  3GYO A;  1ZC3 B;  2COD A;  2W2X C;  2H7E A;  4WSF A;  1SHC A;  3FM8 C;  5KQ1 A;  4EJN A;  1FHO A;  2VRW B;  3N7C A;  2ROV A;  5D3V A;  4C0A A;  2MKR A;  2YS5 A;  3SUZ A;  2I5C A;  4ZRI A;  3PVL A;  2FJL A;  1ZSQ A;  2VSZ A;  2D9Y A;  2DHK A;  2LOZ A;  3PEG A;  1MPH A;  2IYB A;  1X1G A;  4KHB B;  3SV1 A;  4WJ7 A;  2ROZ B;  4A6K A;  1MK9 B;  2AEH A;  1P5T A;  1I2H A;  2UVM A;  2M14 A;  1PFJ A;  1QC6 A;  3VOQ A;  2DHI A;  1WVH A;  2Y7B A;  2KCJ A;  3GYP A;  2CY5 A;  2D9W A;  5HE1 A;  2DFK A;  4D0N B;  2YS3 A;  3O96 A;  1X05 A;  2OQB A;  3SYX A;  4KVG B;  3UZT A;  1ZM0 A;  1XCG A;  1H4R A;  1XOD A;  3MPX A;  3U7D A;  2HE7 A;  1H10 A;  2CY4 A;  3F5R A;  1E5W A;  2R0D A;  2EMT A;  4HAZ B;  2R09 A;  5FI1 A;  2Y8G A;  1XX0 A;  3OAN A;  1UPQ A;  2OTX A;  2L2I A;  3TVV A;  2I5F A;  5D27 A;  4KHA A;  3BJI A;  2L1C A;  4PQ0 A;  2N0Y A;  4HB0 B;  4MY6 A;  4CHJ A;  3ZDT A;  3ZVR A;  4HB4 B;  5C6R A;  2COF A;  1MIX A;  1V89 A;  1NTV A;  3P7Z A;  2RVB B;  2D9Z A;  2MFQ A;  5KCV A;  2KUP A;  3WYF B;  5D3X A;  2MWN B;  3PSC A;  4ZRK A;  3D8D A;  1B55 A;  4K17 A;  2J0K A;  2K00 A;  5DIF B;  1IRS A;  3P6A A;  3KRX A;  1DDV A;  2MDX A;  4HB3 B;  1TXD A;  2GCL A;  1OY2 A;  1AWE A;  1UPR A;  1X86 A;  2PZ1 A;  2ADZ A;  5EFX A;  5HE3 A;  1XR0 B;  3FEH A;  3F0W A;  4HDO A;  3PP2 A;  2YS1 A;  3KZ1 A;  1Y5O A;  5HE2 A;  2P0H A;  4Z2N A;  3U8Z A;  1V5P A;  1OQN A;  1QQG A;  3PVU A;  1LW3 A;  4GXB A;  2VKI A;  4HAV B;  1DDW A;  1W1G A;  4YL8 A;  2COC A;  1UNP A;  2QKL A;  4BBK A;  3A98 B;  2RLO A;  2K2J A;  1U5E A;  3KRW A;  1U5F A;  3T06 A;  2Y8F A;  2DX1 A;  2N23 A;  3VIA A;  1WG7 A;  3A8Q A;  2I1K A;  2H7D A;  3ML4 A;  4IFS A;  1WGU A;  2YT0 A;  1SGH A;  2I1J A;  3G9W A;  3SO6 A;  1J0W A;  2NMB A;  3CIK A;  1XKE A;  1BWN A;  1AQC A;  3PG7 A;  3PVW A;  5JLJ B;  1V5M A;  5FI0 A;  2DKP A;  4F7H A;  4IAP A;  1MIZ B;  1OMW A;  1TQZ A;  2D4Q A;  2J59 M;  3V5W A;  4F7U P;  1P3R A;  3SNH A;  4WVF B;  1DYN A;  4K2P A;  1V61 A;  2J0M A;  1DDM A;  1FAO A;  1M7R A;  2Z0O A;  1MKE A;  5DHA B;  2M38 A;  3FSS A;  1NI2 A;  3HK0 A;  3A8P A;  1WJM A;  4HAT B;  2W2W A;  5JHG A;  2V76 A;  1NTY A;  1RJ2 A;  2Q13 A;  1WGQ A;  5L81 A;  2YF0 A;  4HAU B;  2CAY A;  4Z2M B;  2LOX A;  1I7A A;  1GC7 A; 
#chains in the Genus database with same CATH topology
 2QKM A;  3NSU A;  2UZS A;  1GC6 A;  2E2X A;  2UZR A;  2D11 A;  3PZD A;  3WA0 A;  1J19 A;  3IVF A;  3ULC A;  3U12 A;  2ELB A;  2RRF A;  2AL6 A;  3M1I B;  4HAY B;  4GNK B;  2NZ8 B;  1FGZ A;  4Y94 A;  4HAX B;  2DYN A;  1K5D B;  5J3T A;  1Q67 A;  4KAX B;  4TYZ A;  5D3Y A;  1X11 A;  1BAK A;  4EMO A;  1RRP B;  2D10 A;  2LKO A;  1FOE A;  3AU4 A;  1ZC4 B;  2DKQ A;  4GZU A;  1V5U A;  4B6H A;  4OSN A;  1BTN A;  1FGY A;  4KHO A;  1ISN A;  1GG3 A;  2CRF A;  4YON A;  4F7G A;  2COA A;  5HE0 A;  1W1D A;  2KGX B;  1UNR A;  1Y19 B;  2DA0 A;  4QXA B;  2BCJ A;  1T77 A;  5LOP B;  1W1H A;  5J3Q A;  3DXE A;  4A6F A;  1V88 A;  5JP4 A;  1MK7 B;  2GS0 A;  1XD4 A;  2DHJ A;  1WJ1 A;  2YT1 A;  4DBB A;  5D3W A;  2DX5 A;  2P0F A;  2D9V A;  2ZKM X;  1KZ7 A;  2RSG A;  2Z0P A;  2P0D A;  5M4Y B;  4DXA B;  2K8E A;  2JP2 A;  2NBV A;  5DHF B;  4DX8 A;  2EMS A;  5CLL B;  2R2Y A;  2EJ8 A;  4K2O A;  4IOY X;  1Z87 A;  3AJ4 A;  3ODX A;  1U5D A;  1FHX A;  2KR0 A;  2ELA A;  1WI1 A;  1DRO A;  1U29 A;  2RUK B;  3QIJ A;  1EVH A;  2P8V A;  5J3Y A;  5C5B A;  1K5G B;  1NU2 A;  4HB2 B;  1P6S A;  1EAZ A;  4HDQ A;  2LYD A;  4NY0 A;  4P7I A;  4L6E A;  3X23 A;  1X1F A;  3HW2 B;  3BIN A;  5IRS A;  4K81 A;  2XQN M;  3D8F A;  1MAI A;  4EKU A;  1TJ6 A;  2GJY A;  5C79 A;  4CYE A;  4MT7 A;  2W2X D;  3ULB A;  4DX9 0;  2DTC A;  2K2U A;  4CHM A;  2X18 A;  1ZVR A;  5LON B;  3QBV B;  5C5B B;  3DCX A;  2D9X A;  3ODW A;  5KQ4 A;  2GCJ A;  4PNK A;  1LB1 A;  3TO1 A;  2YSZ A;  4KHB A;  4QJ5 B;  3DXC A;  2DYQ A;  4D6W A;  1PMS A;  1DBH A;  2IFS A;  4HAW B;  2DLW A;  2RGN B;  1U27 A;  5JHH A;  4NSW A;  3D8E A;  2Z0Q A;  2D2Q A;  1EF1 A;  3NWF A;  1FHW A;  4HHV A;  3RCP A;  3DXD A;  4A6H A;  2RNR B;  1M7E A;  3MDB C;  1KZG A;  3KSY A;  1KI1 B;  1EGX A;  1PLS A;  4GPT B;  2DN6 A;  2J0J A;  4A5K A;  2LG1 A;  2YVC A;  2YRY A;  1UEF A;  5I2S A;  2G35 A;  5CLQ B;  2HTH B;  4A6F B;  3ODO A;  2ZPY A;  5DI9 B;  4H8S A;  1UNQ A;  4MK0 A;  4TKN A;  4GMV A;  3KY9 A;  3QWM A;  4GN1 A;  4ZRJ A;  3TFM A;  1FB8 A;  2EC1 A;  5GOW B;  1U5G A;  3TCA A;  4QJ4 B;  3HQC A;  2LUL A;  3AU5 A;  1BTK A;  3CXB B;  5DH9 B;  1N3H A;  4GMX B;  3TW1 A;  3LJU X;  1U2B A;  4XWX A;  5C16 A;  3GYO A;  1ZC3 B;  2COD A;  2W2X C;  2H7E A;  4WSF A;  2YT2 A;  1SHC A;  3FM8 C;  5KQ1 A;  4EJN A;  4OT1 A;  1FHO A;  2VRW B;  3N7C A;  2ROV A;  5D3V A;  4C0A A;  2MKR A;  2YS5 A;  1ZYI A;  3SUZ A;  2I5C A;  3NW8 A;  4ZRI A;  3PVL A;  4L1R A;  2FJL A;  1ZSQ A;  2VSZ A;  2D9Y A;  2DHK A;  2LOZ A;  3PEG A;  1MPH A;  2IYB A;  4QJ3 B;  1X1G A;  4KHB B;  3SV1 A;  4WJ7 A;  2ROZ B;  4A6K A;  2GUM A;  1MK9 B;  3HSA A;  2AEH A;  1P5T A;  1I2H A;  2UVM A;  2M14 A;  1PFJ A;  1QC6 A;  3VOQ A;  2DHI A;  1WVH A;  2Y7B A;  2KCJ A;  3GYP A;  2CY5 A;  2D9W A;  2Z13 A;  5HE1 A;  2DFK A;  4D0N B;  2YS3 A;  3O96 A;  1X05 A;  2OQB A;  2FJU B;  2K49 A;  3SYX A;  4KVG B;  4DIX A;  3UZT A;  1ZM0 A;  1XCG A;  1H4R A;  1XOD A;  3MPX A;  3U7D A;  2HE7 A;  1H10 A;  2CY4 A;  3F5R A;  1E5W A;  2R0D A;  2EMT A;  4HAZ B;  2R09 A;  5FI1 A;  2Y8G A;  1XX0 A;  3OAN A;  1UPQ A;  2OTX A;  2L2I A;  3TVV A;  2I5F A;  5D27 A;  4KHA A;  3BJI A;  2L1C A;  3FVC A;  4CSQ A;  4PQ0 A;  2N0Y A;  4HB0 B;  4MY6 A;  3NWD A;  4CHJ A;  3A58 A;  3ZDT A;  3ZVR A;  4HB4 B;  5C6R A;  2COF A;  2Z59 A;  1MIX A;  1V89 A;  1NTV A;  3P7Z A;  2RVB B;  2D9Z A;  2MFQ A;  5KCV A;  5LG4 B;  2KUP A;  3WYF B;  5D3X A;  3NWA A;  2MWN B;  3PSC A;  4ZRK A;  3D8D A;  1B55 A;  4K17 A;  1MI1 A;  2J0K A;  2K00 A;  2KIG A;  5DIF B;  1IRS A;  3P6A A;  5I2M A;  3KRX A;  1DDV A;  2MDX A;  4HB3 B;  1TXD A;  3OHM B;  2GCL A;  1OY2 A;  1AWE A;  1UPR A;  1X86 A;  2PZ1 A;  2ADZ A;  5EFX A;  5HE3 A;  1XR0 B;  3FEH A;  3F0W A;  4HDO A;  3PP2 A;  2YS1 A;  3KZ1 A;  1Y5O A;  5HE2 A;  2P0H A;  4Z2N A;  2KIE A;  3U8Z A;  1V5P A;  1OQN A;  1QQG A;  3PVU A;  1LW3 A;  4GXB A;  2VKI A;  4HAV B;  4HSI A;  1DDW A;  1W1G A;  4YL8 A;  2COC A;  1UNP A;  2Z14 A;  2QKL A;  4BBK A;  3A98 B;  2RLO A;  2K2J A;  1U5E A;  3KRW A;  1U5F A;  3T06 A;  2Y8F A;  2DX1 A;  2N23 A;  3VIA A;  1WG7 A;  3A8Q A;  2I1K A;  2H7D A;  3ML4 A;  4IFS A;  1WGU A;  2YT0 A;  1SGH A;  2I1J A;  3G9W A;  3SO6 A;  1J0W A;  2NMB A;  3CIK A;  1XKE A;  1BWN A;  1AQC A;  3PG7 A;  3PVW A;  5JLJ B;  1V5M A;  5FI0 A;  2DKP A;  4F7H A;  4IAP A;  1MIZ B;  1OMW A;  1TQZ A;  2D4Q A;  2J59 M;  2KUQ A;  3HIE A;  1P3R A;  3SNH A;  3V5W A;  4WVF B;  4F7U P;  1DYN A;  4K2P A;  1V61 A;  2J0M A;  1DDM A;  4GOU A;  1FAO A;  1M7R A;  2Z0O A;  1MKE A;  5DHA B;  2M38 A;  3FSS A;  1NI2 A;  3HK0 A;  3A8P A;  1WJM A;  4HAT B;  2W2W A;  5JHG A;  2V76 A;  1NTY A;  1RJ2 A;  2Q13 A;  1WGQ A;  3B77 A;  2YF0 A;  4HAU B;  5L81 A;  2CAY A;  4Z2M B;  2LOX A;  1I7A A;  1GC7 A;  2Z4D A; 
#chains in the Genus database with same CATH homology
 2QKM A;  3NSU A;  2UZS A;  1GC6 A;  2E2X A;  2UZR A;  2D11 A;  3PZD A;  3WA0 A;  1J19 A;  3IVF A;  3ULC A;  3U12 A;  2ELB A;  4HAY B;  2AL6 A;  3M1I B;  2RRF A;  4GNK B;  2NZ8 B;  1FGZ A;  4Y94 A;  4HAX B;  2DYN A;  1K5D B;  5J3T A;  1Q67 A;  4KAX B;  4TYZ A;  5D3Y A;  1X11 A;  1BAK A;  4EMO A;  1RRP B;  2D10 A;  2LKO A;  1FOE A;  3AU4 A;  1ZC4 B;  2DKQ A;  4GZU A;  1V5U A;  4B6H A;  4OSN A;  1BTN A;  1FGY A;  4KHO A;  1ISN A;  1GG3 A;  2CRF A;  4YON A;  4F7G A;  2COA A;  5HE0 A;  1W1D A;  2KGX B;  1UNR A;  1Y19 B;  2DA0 A;  4QXA B;  2BCJ A;  5LOP B;  1W1H A;  5J3Q A;  3DXE A;  4A6F A;  1V88 A;  5JP4 A;  1MK7 B;  2GS0 A;  1XD4 A;  2DHJ A;  1WJ1 A;  2YT1 A;  4DBB A;  5D3W A;  2DX5 A;  2P0F A;  2D9V A;  2ZKM X;  1KZ7 A;  2RSG A;  2Z0P A;  2P0D A;  5M4Y B;  4DXA B;  2K8E A;  2JP2 A;  2NBV A;  5DHF B;  4DX8 A;  2EMS A;  5CLL B;  2R2Y A;  2EJ8 A;  4K2O A;  4IOY X;  1Z87 A;  3AJ4 A;  3ODX A;  1U5D A;  1FHX A;  2KR0 A;  2ELA A;  1WI1 A;  1DRO A;  1U29 A;  2RUK B;  3QIJ A;  1EVH A;  2P8V A;  5J3Y A;  5C5B A;  1K5G B;  1NU2 A;  4HB2 B;  1P6S A;  1EAZ A;  4HDQ A;  2LYD A;  4NY0 A;  4P7I A;  4L6E A;  3X23 A;  1X1F A;  3HW2 B;  3BIN A;  5IRS A;  4K81 A;  2XQN M;  3D8F A;  1MAI A;  4EKU A;  1TJ6 A;  2GJY A;  5C79 A;  4CYE A;  4MT7 A;  2W2X D;  3ULB A;  4DX9 0;  2DTC A;  2K2U A;  4CHM A;  2X18 A;  1ZVR A;  5LON B;  3QBV B;  5C5B B;  2D9X A;  3ODW A;  5KQ4 A;  2GCJ A;  4PNK A;  1LB1 A;  3TO1 A;  2YSZ A;  4KHB A;  4QJ5 B;  3DXC A;  2DYQ A;  4D6W A;  1PMS A;  1DBH A;  2IFS A;  4HAW B;  2DLW A;  2RGN B;  1U27 A;  5JHH A;  4NSW A;  3D8E A;  2Z0Q A;  2D2Q A;  1EF1 A;  3NWF A;  1FHW A;  4HHV A;  3RCP A;  3DXD A;  4A6H A;  2RNR B;  1M7E A;  3MDB C;  1KZG A;  3KSY A;  1KI1 B;  1EGX A;  1PLS A;  4GPT B;  2DN6 A;  2J0J A;  4A5K A;  2LG1 A;  2YVC A;  2YRY A;  1UEF A;  5I2S A;  2G35 A;  5CLQ B;  2HTH B;  4A6F B;  3ODO A;  2ZPY A;  5DI9 B;  4H8S A;  1UNQ A;  4MK0 A;  4TKN A;  4GMV A;  3KY9 A;  3QWM A;  4GN1 A;  4ZRJ A;  3TFM A;  1FB8 A;  2EC1 A;  5GOW B;  1U5G A;  3TCA A;  4QJ4 B;  3HQC A;  2LUL A;  3AU5 A;  1BTK A;  3CXB B;  5DH9 B;  1N3H A;  4GMX B;  3TW1 A;  3LJU X;  1U2B A;  4XWX A;  5C16 A;  3GYO A;  1ZC3 B;  2COD A;  2W2X C;  2H7E A;  4WSF A;  2YT2 A;  1SHC A;  3FM8 C;  5KQ1 A;  4EJN A;  4OT1 A;  1FHO A;  2VRW B;  3N7C A;  2ROV A;  5D3V A;  4C0A A;  2MKR A;  2YS5 A;  3SUZ A;  1ZYI A;  2I5C A;  3NW8 A;  4ZRI A;  3PVL A;  4L1R A;  2FJL A;  1ZSQ A;  2VSZ A;  2D9Y A;  2DHK A;  2LOZ A;  3PEG A;  1MPH A;  2IYB A;  4QJ3 B;  1X1G A;  4KHB B;  3SV1 A;  4WJ7 A;  2ROZ B;  4A6K A;  2GUM A;  1MK9 B;  2AEH A;  1P5T A;  1I2H A;  2UVM A;  2M14 A;  1PFJ A;  1QC6 A;  3VOQ A;  2DHI A;  1WVH A;  2Y7B A;  2KCJ A;  3GYP A;  2CY5 A;  2D9W A;  5HE1 A;  2Z13 A;  2DFK A;  4D0N B;  2YS3 A;  3O96 A;  1X05 A;  2OQB A;  2FJU B;  2K49 A;  3SYX A;  4KVG B;  3UZT A;  4DIX A;  1ZM0 A;  1XCG A;  1H4R A;  1XOD A;  3MPX A;  3U7D A;  2HE7 A;  1H10 A;  2CY4 A;  3F5R A;  1E5W A;  2R0D A;  2EMT A;  4HAZ B;  2R09 A;  5FI1 A;  2Y8G A;  1XX0 A;  3OAN A;  1UPQ A;  2OTX A;  2L2I A;  3TVV A;  2I5F A;  5D27 A;  4KHA A;  3BJI A;  2L1C A;  3FVC A;  4CSQ A;  4PQ0 A;  2N0Y A;  4HB0 B;  4MY6 A;  3NWD A;  4CHJ A;  3A58 A;  3ZDT A;  3ZVR A;  4HB4 B;  5C6R A;  2COF A;  2Z59 A;  1MIX A;  1V89 A;  1NTV A;  3P7Z A;  2RVB B;  2D9Z A;  2MFQ A;  5KCV A;  5LG4 B;  2KUP A;  3WYF B;  5D3X A;  3NWA A;  2MWN B;  3PSC A;  4ZRK A;  3D8D A;  1B55 A;  4K17 A;  2J0K A;  2K00 A;  5DIF B;  2KIG A;  1IRS A;  3P6A A;  5I2M A;  3KRX A;  1DDV A;  2MDX A;  4HB3 B;  1TXD A;  3OHM B;  2GCL A;  1OY2 A;  1AWE A;  1UPR A;  1X86 A;  2PZ1 A;  2ADZ A;  5EFX A;  5HE3 A;  1XR0 B;  3FEH A;  3F0W A;  4HDO A;  3PP2 A;  2YS1 A;  3KZ1 A;  1Y5O A;  5HE2 A;  2P0H A;  4Z2N A;  2KIE A;  3U8Z A;  1V5P A;  1OQN A;  1QQG A;  3PVU A;  1LW3 A;  4GXB A;  2VKI A;  4HAV B;  4HSI A;  1DDW A;  1W1G A;  4YL8 A;  2COC A;  1UNP A;  2Z14 A;  2QKL A;  4BBK A;  3A98 B;  2RLO A;  2K2J A;  1U5E A;  3KRW A;  1U5F A;  3T06 A;  2Y8F A;  2DX1 A;  2N23 A;  3VIA A;  1WG7 A;  3A8Q A;  2I1K A;  2H7D A;  3ML4 A;  4IFS A;  1WGU A;  2YT0 A;  1SGH A;  2I1J A;  3G9W A;  3SO6 A;  1J0W A;  2NMB A;  3CIK A;  1XKE A;  1BWN A;  1AQC A;  3PG7 A;  3PVW A;  5JLJ B;  1V5M A;  5FI0 A;  2DKP A;  4F7H A;  4IAP A;  1MIZ B;  1OMW A;  1TQZ A;  2D4Q A;  2J59 M;  3V5W A;  4F7U P;  1P3R A;  3SNH A;  2KUQ A;  4WVF B;  3HIE A;  1DYN A;  4K2P A;  1V61 A;  2J0M A;  1DDM A;  4GOU A;  1FAO A;  1M7R A;  2Z0O A;  1MKE A;  5DHA B;  2M38 A;  3FSS A;  1NI2 A;  3HK0 A;  3A8P A;  1WJM A;  4HAT B;  2W2W A;  5JHG A;  2V76 A;  1NTY A;  1RJ2 A;  2Q13 A;  1WGQ A;  5L81 A;  2YF0 A;  4HAU B;  2CAY A;  4Z2M B;  2LOX A;  1I7A A;  1GC7 A;  2Z4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...