3TW5A

Crystal structure of the gp42 transglutaminase from phytophthora sojae
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
366
structure length
344
Chain Sequence
EANGNQDIAKLEAYFGTKMEMTLKDLPTVGVHTPSPWAGPYWPTYQDSINVQWSQGQPSAAEKYAKAFGKDVKTFMDAVSKKNGIDSQSGRKKCSSDDDCSTLTDGSSCSIRTGKTSGYCIPTWFGISHAWSPAAILETEPKCPVKHNGVTFQPMDLKALVSLVYDGARVQTVFTGDLNPAYFHIASANILGKLNSTFVADVTAGAEVWNQPVRGFKVYEQTEMTLEEGAQTFYGLEAYPWNAAAKSLVYVKSRLSWIYETYTDGGLVSSGQIDKFTTGQYYYYLLELDDAGEIIGGEWVYGSDDDHPDFLWLPKAKPAANTVTSVGLSYADVSMLLKKSAACT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transglutaminase elicitor
publication title Structural and Phylogenetic Analyses of the GP42 Transglutaminase from Phytophthora sojae Reveal an Evolutionary Relationship between Oomycetes and Marine Vibrio Bacteria.
pubmed doi rcsb
source organism Phytophthora sojae
molecule tags Transferase
total genus 91
structure length 344
sequence length 366
chains with identical sequence B
ec nomenclature ec 2.3.2.13: Protein-glutamine gamma-glutamyltransferase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16683 TGase_elicitor Transglutaminase elicitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.130 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 3tw5A02
3TW5A
chains in the Genus database with same CATH superfamily
3BRXA 2HSNA 4C7PA 4FHRB 3SWVA 1R8ME 4D7QA 1AOWA 2H0KA 3HJLA 3L8NA 1BC3A 2HYUA 1AVRA 1YGMA 3SOHB 1W45A 1PBVA 1R8SE 1AVHA 1HAKA 4C0AA 1N41A 4Z21A 1W3WA 3ABQA 1AEIA 4OIYA 2VXGA 1R8QE 1MCXA 4JXHA 1AIIA 1HVDA 1HM6A 4MDVA 4Q2SA 2H0MA 2IICA 3ABOA 1BC1A 3TW5A 3AO0A 1N00A 1ANXA 2II2A 1XJLA 2R09A 1A8AA 2K6XA 4JK1X 4KMUX 1BCZA 1R4AE 1C1KA 1G5NA 1LKVX 4L5MA 4JMOA 4KN4X 1XSZA 3USWA 2XO2A 1N44A 2ZHJA 1AVCA 1BO9A 1A8BA 1HVEA 1BC9A 2H0LA 1Q8DA 2IE7A 2ZHIA 1DM5A 1YCNA 2QEZA 1DK5A 3ABSA 1AXNA 3ANYA 1SAVA 4D7RA 4EVFA 1BCWA 1I4AA 1YJ0A 1BC0A 1UPTB 1ANWA 1RE0B 1W7BA 1S9DE 3USYA 3LTLA 1ALAA 1YIIA 4JWLA 1M9IA 1XT0B 2R0DA 4HREA 2ZOCA 2XO3A 4JMIA 1QC7A 1N42A 1ANNA 2HYWA 2IE6A 2HYVA 4EVHA 1KU1A 4MDUA 4X9PA 3AJCA 1HVFA 3ABRA 4A4PA 4FQ0C 1BCYA 2Q4CA 2OY9A 1HVGA 2RANA 4KN7X
chains in the Genus database with same CATH topology
4JMIA 1QC7A 2HSNA 4C7PA 4FHRB 3SWVA 1R8ME 4D7QA 1BC9A 1Q8DA 3TW5A 3HJLA 3L8NA 1KU1A 2R09A 3SOHB 4D7RA 2K6XA 1PBVA 3AJCA 4JK1X 1R8SE 4KMUX 4C0AA 1RE0B 4A4PA 4Z21A 1S9DE 4FQ0C 3USYA 3LTLA 1LKVX 4OIYA 4JWLA 4L5MA 4JMOA 4KN4X 1XSZA 1XT0B 2R0DA 3USWA 1R8QE 4KN7X 4JXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TW5 A; 
#chains in the Genus database with same CATH topology
 3BRX A;  2HSN A;  4C7P A;  4FHR B;  3SWV A;  1R8M E;  4D7Q A;  1AOW A;  2H0K A;  3HJL A;  3L8N A;  1BC3 A;  2HYU A;  1AVR A;  1YGM A;  3SOH B;  1W45 A;  1PBV A;  1R8S E;  1AVH A;  1HAK A;  4C0A A;  1N41 A;  4Z21 A;  1W3W A;  3ABQ A;  1AEI A;  4OIY A;  2VXG A;  1R8Q E;  1MCX A;  4JXH A;  1AII A;  1HVD A;  1HM6 A;  4MDV A;  4Q2S A;  2H0M A;  2IIC A;  3ABO A;  1BC1 A;  3TW5 A;  3AO0 A;  1N00 A;  1ANX A;  2II2 A;  1XJL A;  2R09 A;  1A8A A;  2K6X A;  4JK1 X;  4KMU X;  1BCZ A;  1R4A E;  1C1K A;  1G5N A;  1LKV X;  4L5M A;  4JMO A;  4KN4 X;  1XSZ A;  3USW A;  2XO2 A;  1N44 A;  2ZHJ A;  1AVC A;  1BO9 A;  1A8B A;  1HVE A;  1BC9 A;  2H0L A;  1Q8D A;  2IE7 A;  2ZHI A;  1DM5 A;  1YCN A;  2QEZ A;  1DK5 A;  3ABS A;  1AXN A;  3ANY A;  1SAV A;  4D7R A;  4EVF A;  1BCW A;  1I4A A;  1YJ0 A;  1BC0 A;  1UPT B;  1ANW A;  1RE0 B;  1W7B A;  1S9D E;  3USY A;  3LTL A;  1ALA A;  1YII A;  4JWL A;  1M9I A;  1XT0 B;  2R0D A;  4HRE A;  2ZOC A;  2XO3 A;  4JMI A;  1QC7 A;  1N42 A;  1ANN A;  2HYW A;  2IE6 A;  2HYV A;  4EVH A;  1KU1 A;  4MDU A;  4X9P A;  3AJC A;  1HVF A;  3ABR A;  4A4P A;  4FQ0 C;  1BCY A;  2Q4C A;  2OY9 A;  1HVG A;  2RAN A;  4KN7 X; 
#chains in the Genus database with same CATH homology
 4JMI A;  1QC7 A;  2HSN A;  4C7P A;  4FHR B;  3SWV A;  1R8M E;  4D7Q A;  1BC9 A;  1Q8D A;  3TW5 A;  3HJL A;  3L8N A;  1KU1 A;  2R09 A;  3SOH B;  4D7R A;  2K6X A;  1PBV A;  3AJC A;  4JK1 X;  1R8S E;  4KMU X;  4C0A A;  1RE0 B;  4A4P A;  4Z21 A;  1S9D E;  4FQ0 C;  3USY A;  3LTL A;  1LKV X;  4OIY A;  4JWL A;  4L5M A;  4JMO A;  4KN4 X;  1XSZ A;  1XT0 B;  2R0D A;  3USW A;  1R8Q E;  4KN7 X;  4JXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...