3TW8B

Gef domain of dennd 1b in complex with rab gtpase rab35
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
172
structure length
169
Chain Sequence
YDHLFKLLIIGDSGVGKSSLLLRFADNTSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights regarding guanine nucleotide exchange from the structure of a DENN-domain protein complexed with its Rab GTPase substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords DENN domain-containing protein 1B
total genus 64
structure length 169
sequence length 172
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tw8B00
1US8B 2JJ2D 2QPOA 3TSZA 1EESA 3AVQA 4JT4A 4BFYA 4KVAA 2FSHA 5G3YA 3H0KA 3W6OA 2XSZD 4Q1DA 4HSEA 4LUCA 3I92A 3R7WB 4G5GA 4A6PA 3TR0A 4OQFA 5AUQA 1U8AA 4PO1A 2HF9A 5AUPB 3Q72A 2IS2A 1WCV1 1ZP6A 2YOGA 3D8BA 1BYIA 1VG9B 1BOFA 3GJ6A 3AF1A 3W6NA 1CF4A 1JXOA 5KPJA 1ZMXA 2HJGA 3F0TA 3SBDA 3ADBA 1WBDA 2QMEA 4MA4A 1P61B 1U98A 3O47A 1XMIA 4BZXA 1UAAA 1QHXA 1OH7A 2ZUBA 2QL6A 2R9VA 2Q0HA 4FMDB 1RKBA 1E2FA 1TMKA 1U90A 4EPVA 2RGCA 3SS8A 2DFTA 3W9YA 1KDOA 4XH9B 2WWWA 1N6NA 4P32A 5JSZB 1G7TA 3QIAA 1OXXK 4AG6A 3DOEA 1SULA 2ZI9A 1KDRA 1PLKA 2Q6TA 3REGA 1NG9A 2OCAA 2ZYUX 3NDPA 4Q4HA 4V0OA 3RHFA 1QHSA 1EGAA 3GJ7A 4TSFD 3Q85A 3NBYC 4Q1FA 2ZSFA 4B6FA 1IN4A 1YE8A 3HU2A 1JR3E 4OYHA 4J0QA 4LYHA 3ZYCA 5JCPA 1JALA 1YZQA 2O8BA 3QG5A 1KTVA 4JLKA 2HYDA 4G5SA 3T15A 1MOZA 2GJKA 4Q4AB 2P5TB 4D4LA 1KNXA 3NG1A 3EPHA 1U8YA 2W2XA 1Z07A 3LW7A 4LJ4A 2HUPA 4U02A 5E7MA 1WB9A 2O8FB 4YQFA 4GFDA 3EC2A 4B73A 3LXRA 2IYUA 4PR0A 4Q7KA 3A1TA 2IXFA 4ZIRA 4KFRA 4X8LA 2KE5A 3QE0A 1TPZA 6Q21A 2PX3A 2AXPA 2XZLA 4QBGB 5FR1A 1KKMA 4QGFA 4AK9A 4ARZA 4AYWA 4RKEA 1ZCAA 3CPJB 2GDJA 1VG1A 2OXRA 1Z83A 2GVZC 1FP6A 5EE1A 2A3RA 4LHYA 3LDAA 3KUDA 1YZUA 3FDIA 5B2ZA 1W46A 1GITA 1FQKA 2FNAA 2J0QA 5CJ2A 1FNNA 4AI6A 3GFPA 1P2UA 2Q3FA 2HF8A 3GLHE 4I99A 4D4MA 2Q3HA 2ZJBA 3MJHA 2VIIA 4HB4A 4TWZA 1IOZA 3OIWA 2H7VA 4NH0A 3CPEA 2C04A 4MGYR 2A30A 4YLGA 4E5UA 4EJSC 3DMDA 1CR4A 2GCPA 4TLBA 4D0LB 5KSZA 1XD9A 4JVNA 4G1UC 1RFLA 2Q21A 4RFVA 3CUEF 2WSMA 5JZVA 3VKHA 2ANBA 5FPYA 1ESNA 1PLLA 1W0JA 2NTYC 3P26A 3UK6A 2QMUA 2OESA 5FFMA 1G19A 1OSNA 4V0ME 3KKPA 1M7BA 4XVUA 3R20A 3CH4B 1TEXA 5AJWA 4HAWA 2YWHA 5DH9A 3GQBA 1A7JA 1ZVQA 2LWIA 2PEYA 3DVLA 2MSDB 2VSOA 3LWNA 3U7EB 3RS0A 3QVVA 3L0IB 4Q7LA 4ZDIA 2QBYB 2V6IA 4ZI2A 5SZJA 2ZM5A 1GWNA 2GWHA 2WV9A 4OI1A 3IILA 4KODA 1GNRA 2VEDA 4M9SA 3TVTA 2AD5A 2RGBA 3QKRB 4KLNA 3QPUA 3GLIA 4MDFA 1X8JA 1VDZA 3MSXA 1Q20A 1JR3D 4HLCA 2PX0A 2ZE7A 1NN1A 1NJGA 4PAOA 4JYBA 5AJXA 4B76A 1Z5ZA 1PJRA 2OFOA 1E99A 821PA 2OCBA 4EQ6A 4Z8XA 3IQWA 3EPLA 4RFSA 2FE4A 1NJFA 2QPAA 4M1YA 1D5CA 4WA7A 5L3QB 1D8TA 1UDWA 1GRNA 2ZE8A 3SJAA 2QGNA 3KJEA 2GEVA 1NLYA 5G40A 3KB2A 2PBRA 3ZIAD 3CRRA 4URZR 4HUTA 1GIAA 4PSKA 4NONA 2HCBA 2I4IA 2IF2A 3F5FA 2EFCB 2ZRHA 4HYYA 2ZVPX 1KGDA 3OEHA 2V7QD 4YMUA 4DCVA 3R9WA 5KHOC 1XTSA 1VECA 3RC8A 4W7SA 4URWR 4C0BA 1R5BA 3AVOA 1PZNA 3NXSA 3NHAA 4B2LA 1DARA 5DE3A 5KYKA 4MQBA 4KO8A 1T6NA 2VA8A 1DOAA 1XEXB 5B64A 2VHJA 1CTQA 3LQQA 1U99A 1N5IA 4PAMA 4A8JB 4F92B 3M6AA 3OIYA 1XFAA 3RAPR 4B43A 1MO3A 4HAXA 1KY3A 1P9RA 4RD2A 4Q18A 2FPLA 2ZAOA 4LHWA 4JIMA 1DAHA 1TU4A 1FW6A 5H68A 4V02A 2XITA 2KI5A 3BGWA 3NBXX 4KFUA 4TTQA 2XXAB 5E7JA 2RGXA 1E69A 2W0MA 2EU8A 1Q1EA 1E94E 2VP0A 1DE0A 1XNJA 4DSNA 2V8OA 3B1WA 4TQAA 5EE3A 3TKLA 2QENA 2IYZA 2JAQA 2WICA 4L4UA 1TTTA 4NDZA 2PLRA 1GL6A 2Z0MA 4WXPA 1UJ2A 3U5ZB 4IDNA 4ZDJA 2ZRCA 3Q8XB 4BRUA 3GJ5A 4OQNA 3B85A 3QXCA 1XP8A 2QE7D 3RRZA 4OL0A 1Z6YA 3NEJA 4FMCB 5GVRA 2G3YA 3CZPA 1E0SA 1TUIA 1XCPA 3B9QA 5HE8A 2AFIE 2F55A 3IEVA 2PJRA 3KQNA 2QSZA 2CLDX 3IHLA 2F1IA 4M22A 5A5GA 1G3UA 3DDCA 4ZDWA 3UWKA 3CRQA 3GLGA 1GDDA 4MGKR 2WBLC 4K81B 2IUUA 3QBTA 1E1QD 2R6GA 3GJ3A 4RZUA 3IIMA 1E2IA 4C3ZA 2XNDD 3E1SA 1W7AA 3SR0A 1S1CA 2XEXA 1XXHA 1RIFA 4HUQB 4UNSA 1YZGA 2YVUA 2A9KA 2VP9A 2GKSA 2UZIR 1P73A 1EFCA 3DPUA 2W6JD 3KKQA 4E03A 2O0HA 1IY0A 4LYAA 1ZIPA 2ZR0A 3QPWA 3KJGA 1OT3A 2F43B 1G4UR 2ZJ8A 2EWWA 4TT3A 3ZZ0A 1XB2A 5E95A 1HQYE 2HLDA 1SVKA 3SZRA 3SQXA 1Y3AA 2CLCX 1XJ0A 1GZSA 5CIWA 3VMFA 2AL7A 4NYJR 2REXB 2NQ2C 1G21E 4IOMA 4OI4A 4PC7A 1QG4A 1SKQA 2YWEA 3ECCA 3C15C 2KB0A 5GVSA 2O8BB 1ONBA 1QBKC 2XZPA 4QOSA 1JAIA 2F3TA 1KZGB 1D9ZA 3I72A 5BN5A 2QSYA 2ZRFA 1F5NA 5L3QA 4IFBA 4CT5A 3R8FA 1U2RA 5JEDA 5KOYA 2FZLA 1W49A 3OHMA 1IHUA 3FMPB 2ODWA 3QY0A 3VFDA 4PHTA 1NG1A 1R8SA 3G0HA 2AKYA 3THXB 1BS1A 4GOJA 3EZ6A 3NH9A 4BFTA 1N6LA 3PJRA 2HLDD 3AF0A 2WJHA 3KKMA 1BIFA 3BFKA 2D06A 4WAUA 5DGXA 4AYTA 4Q9KA 1VCOA 4Q1BA 1S8FA 2XTMA 3EZ7A 4DIDA 4NYIR 3TUIC 1E2JA 4P4SB 2IYVA 4C2UA 3FYHA 4LV6A 4GNKA 5JSZA 4X8HA 1RVDA 2OCYC 2OG2A 2E1RA 4BLSA 1HA3A 1IJEA 3C14C 3T1OA 1NN0A 2RKOA 2BHRA 1E2NA 3RYTC 3P32A 5L3SB 4DUGD 2AK3A 2IYQA 4B2PA 2OEPA 1OFTA 3A58B 5G53C 4XVQA 3KQKA 2VBCA 1OW3B 2A2ZA 2IYLD 2XX3A 4ZCLA 3KUCA 2PMDA 1SZPA 2KWIA 2OUKA 4LI0A 5AK0A 2Y8EA 1NLFA 2QUZA 3UG6A 3AM1A 3ZIAA 1JPJA 4PQRA 1OH8A 2ZSEA 5FOXA 2IF0A 4Q7JB 2HDNB 5DNYB 2VP5A 3VNUA 5FUWA 1S0UA 5D3QA 1Z0KA 2ZRMA 3B2EA 1KMHB 1JR3A 1Z0AA 3LV8A 2WJIA 5IT5A 1EFUA 5FOUA 2KJQA 4FCVA 5JI3E 1S2MA 2WPDA 3NC0C 5CK5A 1KI1A 1MO6A 3K1JA 4IOLA 1NVXQ 1ZNXA 1J8YF 2JIZA 3REFA 4RFSB 1R10A 4KVGA 4S2EA 4HAVA 4PZZA 2VLIA 4PPGA 1E2MA 4PC2A 1H8HA 3RSOA 3J81k 2ZS9A 2J87A 3QENA 1Q3TA 2N42A 1EXMA 4RZXA 4H9GA 3T5DA 1CLUA 4YONB 4Y0VA 1JQJC 2PT5A 4KCGA 4LJ6A 4GT1A 4HDOB 1XD2B 1SXJD 2WKRA 2Z4RA 1Q1QA 5KSPA 4Z54A 1MO5A 2ZI4A 3ND9A 3AVUA 2ZSDA 4CF7A 3PEYA 3ZD7A 1T5LA 2BM1A 1KJZA 4JL8A 4KU4A 5FBRB 3SU8A 3MAAC 3QF4A 2XTNA 5KNCA 5A0FA 1DPFA 3KDSE 3U6BA 2QTFA 4YXWD 4L9SA 5BWMA 4MKIA 4F38A 5J4KA 4LY6A 5CM9C 3I4LA 3AVYA 2W00A 3A8TA 4HB3A 3KL4A 2V7QA 1NN3A 3L43A 2VHQA 1LV7A 1I2MA 2GAOA 3GCGA 3UIEA 1CIPA 2F7SA 3MG9A 2RGDA 4WVFA 1XXHE 1DAGA 4W9MC 3KKOA 3SQWA 1O87A 1IJFA 1ZW6A 1ZC4A 1OXTA 3FMIA 1QF9A 5BYJA 1LB1B 4ZPXA 3PIRA 2IXEA 4PHHA 1G8PA 1NBMD 4NTZA 4V03A 5EE9A 3DM9B 1EFRD 4UNQA 3PXGA 2ERYA 4RD6A 1EFTA 1G3RA 4GI7A 3ZS8A 4EUNA 1IN6A 3AVWA 4HDCA 1QRAA 3QXJA 3I5XA 4ESVA 4LDJA 2QP4A 4DDTA 2F9MA 4RCYA 3B1XA 1T8UA 2ZRGA 4QXAA 2A7QA 3D6TB 4Q5IA 2QTVB 3HR8A 3LW8A 4O2LA 3B60A 3RNLA 2V3CC 4FINA 1G8GA 2PZFA 3MWJA 3TNFA 2Z5FA 1LS1A 1E1RD 4PC1A 4PPQA 2ZETA 4BPBA 2PL3A 2R65A 3QNUA 5L3RA 4ESHA 4B74A 1Q1ZA 1W1WA 2FPKA 4DLZA 1SVMA 3OAAD 1XZQA 3LRPA 3CWQA 3Q7QA 1JJVA 2J7PA 4XWAA 4KFTA 5H70A 4B2IA 1W47A 3O8DA 3CX7A 4A2PA 1NSTA 2ZUCA 4FD2A 1K5DA 3I3SR 3PUZA 2WJVA 2ZUDA 1KI2A 1M6NA 2QZ4A 3A1VA 4I1VA 4W5HA 2O8DB 1H8EA 4V0LA 1N3BA 2XNSA 5G41A 3THYB 4F4CA 4TLDA 1VCMA 3W3ZB 4UXHA 2WJYA 2HCJB 5TMPA 3B78A 3VHXA 2CNWA 3C8UA 1UKEA 1SVLA 1GP2A 2WIBA 2WHXA 4JYCA 1TQDA 2V1XA 1VYVA 2ATXA 4ZDKA 1V5WA 3CH5A 2Q9AA 1G5RA 2WAXA 3ZD6A 3SHFA 2DB3A 2WMNB 1AQYA 1KKLA 2WKQA 1FP7A 1PUJA 2XSZA 2EFEB 1SHKA 1X1SA 1P2VA 2ZI5A 3PITA 3CF6R 1R5NA 2C78A 2JDID 4MRVA 2X2EA 3WMGA 3W6PA 1NKTA 4PANA 2F6RA 2VHCA 3CF0A 2H57A 5TY0A 1EFRA 4DLTA 4CYMA 3D3QA 4LHVA 1LTQA 1FUUA 1W4AA 4MYUA 1ZM2A 2H5EA 3BAFA 5CDFE 1FOEB 3N2EA 4PTLA 3WY9A 4FN5A 4BLQA 1VHLA 2FH5B 4JLOA 3HYRA 2C99A 4EKDA 3AF4A 4NMMA 3AGQA 2ZR7A 2CHVA 4YMTA 3U4QA 1VHTA 2FJUA 1G8FA 2JLUA 1G6OA 3HR7A 4LJAA 4M1SA 4UQOA 4TMZA 3B9PA 1KYIA 4ZV4A 4MKFA 1OHHD 4HAZA 5JHGB 1E0KA 5H8WA 1CXZA 1P72A 5IDVA 4IVRA 3GMTA 1E9DA 4P4SA 5EP2A 1OHHA 3EZ2A 1G41A 3LLUA 4LHXA 2I1QA 4FMBB 1ODFA 4NKRA 4NE2A 1XTKA 3LBNA 3K8YA 1OIWA 2FGJA 5DI3B 2CL7X 5HZKA 2QP9X 3DMNA 1G7RA 3AP3A 1YZTA 1T0HB 5EZ5A 2OCPA 1Z0JA 1X3SA 4GZLA 1TF5A 3O8RA 4OHZA 2RCNA 3TLXA 3FVQA 1YR6A 3CX8A 3GLIE 2J59A 2BBTA 2QAGA 1DAEA 2QEQA 4BFWA 2VH5R 2YOFA 5BN4A 4E09A 2L0XA 5BXQC 3VR4A 1QHIA 2FMXA 5EP4A 2JGNA 4R2IA 1QHGA 1N6IA 2ZTSA 1D2MA 4Q21A 3QQ5A 1COWD 5EQTA 3U7HB 1FPMA 1N5LA 3BB1A 3PEUA 1IBRA 4E22A 2CNWD 2QMHA 3V4RA 4TTPA 4B3GA 2REBA 1YZKA 2DFLA 1ZNZA 3L0SA 2OAP1 1JEDA 1ZD1A 4TSFA 3RVBA 3FFAA 3WXMA 1FZQA 8OHMA 3K9LA 4DLSA 1P4SA 4JBWA 4LYJA 2FN4A 1P2TA 3VR3A 4IOJA 1NMXA 1KJWA 3RWMB 2JATA 4N3NA 2R6DA 4ITRC 3AKDA 3U2QA 1UM8A 4QHSA 3I8XA 3U7FB 2Z83A 5D3MA 4NCNA 3IGFA 2FA9A 2O8CB 1H65A 4P31A 1AN0A 3BK7A 1AM4D 2J3EA 3A1WA 1P9NA 1HT2E 3M0EA 1XTIA 2DCUA 3B1YA 1KK3A 1E1RA 4PC6A 4QNRA 2XGJA 2OBMA 4XSHA 3BJIC 3KFXA 5DO9A 4P3YA 3L2OB 2IYTA 1YQTA 3CKLA 1RRGA 2ZYVX 1P6XA 4WZ6A 4UNRA 1AS2A 221PA 5FPTA 4N1AA 2EFGA 4TLCA 5FH9A 1OH5A 4ZO4A 1XEWX 4UJ3A 5EP3A 4RD1A 3VKWA 2YC4C 3TQCA 3SJCA 1C1YA 1GOTA 2IYWA 4FI3C 2IUSA 3I73A 2XJ4A 4URXR 3TH5A 1WQ1R 1MRNA 2VO1A 2JLSA 3CO5A 4IXMA 3OF5A 3MLEA 1WMSA 2FX3A 1ZCBA 3CBQA 3IKJA 4A1FA 3TW4A 4IW3B 2GJAA 4GRAA 4OK6A 3ZQJA 3IDQA 5BW8A 4EFLA 1P62B 4QNMA 2J9RA 2GXAA 1CJKC 3PCRB 5CK4A 2H16A 3CLVA 3EA5A 2ZIAA 3W3AA 2ZJOA 3LQRA 1ZIOA 3W5IA 2J41A 2OM2A 1KJYA 3OE7A 4IFEA 3VKGA 4RD0A 3RRMA 5E7IA 4M1TA 1J8MF 4EPRA 5FBWB 3RSLA 4IRUB 4CT4B 4BLPA 2OHFA 2VHTA 3HDTA 3VR1A 2OFWA 3SE0A 2GJ8A 5TXGA 2ZROA 4Z51A 3U3OA 4AC9A 1Q12A 5FTJA 2JLWA 3OESA 2DFNA 1SVOA 1N0WA 2WOJA 4TN1A 2C2HA 2CCJA 1R0YA 1C4OA 1Z3IX 3ZVNA 2D7DA 2H1LA 2YWGA 2BKEA 3K0EA 5AJVB 2QP3A 1OKKD 2QTHA 3A37A 3JZAA 4Q9HA 3RDPA 1E79D 1JAHA 1QHYA 4A8JC 4OKSA 2GJ9A 2Z43A 2OZEA 4LJYA 3TRFA 3O8BA 3N2IA 4KSBA 1Z6TA 4HAUA 4TQ9A 1CS4C 2GCNA 4JLBA 3N5CA 1XJCA 3F8TA 3SDZA 1IY2A 2OILA 1X6VA 4C4PA 1LS6A 5CIQA 1G7SA 2XB4A 5JS7A 1GRQA 1VG8A 1J2JA 2CL6X 1S9HA 1N5KA 3L82B 4AKIA 4DC9A 1IAQA 2G88A 1F3OA 2E9SA 4Q1EA 1CULC 2IHYA 1N25A 2J46A 3FMFA 1S96A 4QJ3A 1PLJA 4MH0R 4DJTA 4OI2A 2V9PA 4UNNA 2LKDA 5JRJA 4O25A 5HCIA 1Z47A 3I5YA 2ATVA 1OH6A 3BE4A 4MITA 2ZREA 3WP1B 3QPVA 2YOHA 1NMZA 3F3YA 4HLQB 1XCGB 3VNVA 2D2EA 4PFSA 4O3MA 1GKIA 2BWJA 3RS4A 4OHWA 1VIYA 5E4FA 2ZE5A 1AKEA 4GP7A 2RHDA 5KSOA 1E2DA 3THYA 1RRPA 2O8DA 1MABB 1RJ9A 4D0GA 4FW9A 4Q00A 3A4MA 2RGNC 2CJWB 1E3MA 2VP2A 3LX8A 2IYRA 4MGIR 5TARA 3UMFA 3BH7A 4RJLA 3CR7A 1J7KA 3B8HA 3THOA 2FPMA 3FPAA 2GJSA 1E9CA 1Q44A 2EFDB 2JCSA 1JEEA 2W2VA 3TK1A 2HYIC 4B71A 2XXAA 1SVSA 2VYFA 5AJYA 4G0NA 3UATA 2D2FA 2B8TA 4MRNA 3WNBA 4I1UA 3PV0A 5KU1A 3GFOA 721PA 1CR2A 1EX6A 3I1FA 3K0AA 4DWJA 3PFIA 4G3XA 3B6EA 3OFNA 2X19A 2BVNA 4TQUS 1E9RA 4V0KA 1GKUB 1G64A 2ZRBA 4QHYA 1CJUC 4EPYA 1VYUA 5AJZA 2ZITA 1P9WA 2CMKA 3RWOA 3C41J 3QKUA 3B82A 5FUVA 1KSJA 2NO6A 4HLDA 3GFTA 4AKEA 1OXUA 1VTKA 3KZ1E 2CK3A 1T4GA 1XEWY 4R7ZA 5JECA 2J0VA 4LJ7A 2VTKA 1SKYB 4FCWA 3X1ZA 3K09A 5HR5A 1RC8A 3A36A 3U3RA 5K8IA 1II8B 2FFBA 2ORVA 4N0EA 4TZ6A 2QM8A 3PQCA 1P3JA 4KFSA 1HE1C 2HJVA 3SFVA 4DCNA 2ZEJA 2GXQA 2O8EB 1E2EA 4F93B 1SXJB 4ARZB 5J40A 2WJGA 3V00A 1E9BA 1E9AA 1GAJA 1NVVR 2QG6A 4KBFA 4L8GA 2QNRA 1BYUA 4ZIRB 1AK2A 1T3HA 2QORA 2D62A 4LBWA 3BBPA 4AY2A 1RYFA 2R6AA 2EVWX 2JLRA 4IDQA 5HPYB 2PCJA 3AKCA 1A5TA 4KJZA 2D3WA 3W8RA 5FI1B 2ERXA 3IIJA 4B3XA 1R8QA 2VP4A 3K0CC 1I4DD 3GLFB 2AK2A 2C5LA 4EAQA 4D80A 1YKSA 1Z2CA 4OK3A 3EPKA 1Q1BA 4BFSA 2GF0A 4IHQA 2BMDA 5EE0A 2R6FA 2B8WA 3IBYA 3MWKA 2OBLA 5SZHB 1W0KD 2G77B 5F98A 3WP0A 1JXMA 1T91A 4RSGA 2N46A 3K09C 4HZUB 3LH5A 5CYPA 3W8NA 1W48A 5IK2D 1VCNA 1V43A 3BFVA 3CIOA 4CGZA 4GBMA 2BEJA 5IF9A 2NGRA 2QBYA 4GOXA 5EUMA 3GLFE 1I4LD 2G83A 2W6IA 3AKEA 1SVWA 1UBCA 2QM7A 1W5SA 1OIVA 3ZZUA 5FOWA 4Z1MA 4FWTA 1LW7A 5LBIA 1R6BX 2JEOA 2VPPA 1QHNA 4F4JA 2OT3B 3VTKA 1NRJB 2ODNA 2ZRNA 3VX4A 1TQ2A 2BDTA 2RGNA 3A4NA 3C5CA 4CDGA 1R0ZA 5C4MA 5HCNA 3X1WA 1RZ3A 4FMCF 3HU3A 4EJSB 3QSYA 3NTUA 2ZRKA 2DR3A 2VRWA 4D0NA 3QKSA 4TL9A 1JI0A 2AXNA 2AWNA 1ZD9A 3QXSA 5D3MB 3DZ8A 2ZU6A 3QVUA 4EQ6B 4Q47A 2ZJZA 1ZD8A 4DDWA 3EX7C 3BC1A 4D26A 5TVKA 3GJXC 1YR9A 3QJYA 5HZHA 4TMKA 4OHYA 3BWDD 1E6CA 1BH2A 1FFHA 1TQ4A 2NG1A 1AS0A 4CW7A 1HE8B 4S35A 1F2UB 2FOLA 4URYR 1Z22A 1OFUX 1UBEA 3MMPA 5EXPA 2WWYA 3BH0A 1DBSA 1G4AE 3T1TA 1UEIA 1G17A 3CONA 4JL5A 4A4DA 1D9XA 3LXXA 2ZS7A 1A82A 4W5WA 1OIXA 2WM9B 1KI9A 2R8RA 4M9QA 5DN6A 4C0LA 1GNQA 3THXA 2IYXA 2O8FA 1WRBA 2G1KA 4ERNA 3FWYA 2GHIA 1OYYA 1TUEA 4RZ2A 1RJ9B 4UJ5A 5F2EA 521PA 5UKDA 3LY5A 4HDQB 4IVPA 1A2BA 5JFGA 1P7CA 3I62A 1UF9A 3LA6A 2IS4A 1E9EA 3B1ZA 4NL4H 3QEJA 2A5DA 5EP1A 1XXHB 4HUQA 1LVGA 3QF7A 3UWOA 1G8HA 1XMVA 4JKYA 2IEYA 4MUAA 2UZ3A 4H1UA 4C30A 4NU0A 5JJIA 4GOKA 3E2IA 2J7PD 4Q48A 4UXJA 5CYOA 5CB6A 3TUZC 2FSIA 1OF1A 4WW0A 1M74A 3NIBA 3QUSA 4G5OA 3UMSA 1QVRA 1NY6A 4IXNA 1VCIA 1S1MA 2OE2A 1QVAA 1KIMA 2ODEA 1U81A 3WHLA 3FTQA 1GILA 3G5UA 1U9IA 2Q3MA 5TB5A 4EPTA 2GZDA 3CF2A 2ZRIA 1TADA 3TAHA 2C9CA 2PLFA 2IX3A 5IK2A 3GEIA 2B6HA 4DLVA 3UXMA 3R9XA 1Y63A 4GMDA 1ZYUA 4D25A 5DHAA 2NPIA 1ZUNB 4POAA 2ZRJA 2FG5A 1EG7A 4OJKA 4DLUA 4JLPA 2YV5A 4JL6A 3H86A 4OHXA 5ANRB 5CLLA 1AGRA 5LD2C 2P3SA 3EARA 1II0A 1F2TB 2BJVA 2GRJA 2EW1A 2QE7A 1R5OA 1M8PA 1US8A 1NL3A 3DOFA 3NBZC 2C9OA 4Q03A 4I1SA 3LD9A 3K0FA 3OIVA 2GXSA 1Q0UA 4Q7MB 3QG1A 1FMJA 2J0UB 5CLQA 4QGGA 2ZPTX 3QI2A 4B33A 2J7KA 3BERA 3UANA 1KO8A 4BFXA 1AKYA 5FTMA 4EPWA 1GFIA 4KYIB 4LBVA 1EX7A 1IXSB 1UKZA 2NO1A 1N5JA 4MRPA 2JJ1D 3EC1A 4JKIA 2W6JA 4DT1B 1PVOA 2XB2A 4FIDA 5FOSA 4M1KA 3MCAA 4O0MA 2C8VA 1H8ED 4MRRA 3TJZA 3NDBB 1CJTC 1NIJA 1RRCA 2GVDC 1Z08A 3AH8A 1E4VA 4RY2A 4WXRA 4BRWA 5JLJA 3WHKA 1IY1A 3EG5A 1ZINA 2ZSBA 4MYHA 1KMQA 2CK3D 2XNDA 4TL7A 3W90A 4C0AC 2HXYA 4C7OB 1DG1G 4LJ5A 1KK1A 5HKKA 2CLSA 3FHTA 1YZLA 1G7CA 2EFHB 1BO6A 1SXJA 5A4JA 3DHWC 3WRXC 5J4LA 2BJWA 3NWJA 1Z0FA 2A5GA 4YDSA 5BN3A 1NBME 2CHQA 4PO9A 2OFXA 3VU9B 3TIFA 1W5TA 1II9A 3QXXA 4LBYA 1WBBA 3MGCA 3RC3A 4JVMA 3RRNA 1MABA 1QDEA 2BMEA 3MJRA 4EIWA 3NVAA 3SOPA 3ZZTA 3U61B 3L0PA 4LRWA 3EASA 1KI3A 1TU3A 2VSXA 3C5HA 2J1LA 2YWFA 4NPHA 2N1BA 1XRJA 5JBQA 3ADDA 1TNDA 3IO5A 4M1OA 2OLJA 4H1VA 2B21A 2JJ2A 1JECA 3CRVA 3EIQA 2X77A 5K8TA 2QT0A 5KDDA 2ZANA 1NBMA 1B0UA 3DZDA 3OEED 4JBXA 4JLAA 4XIGS 4DEXA 4TLAA 4ILEA 2FFQA 5JCZA 5B57C 2IUTA 1NP6A 1KO5A 3W5JA 1KO7A 4FCTA 4EPXA 2LCFA 1GL9B 2AWOA 2V54A 1PUIA 4Q1AA 4TL8A 4R71A 4A2QA 1QHHA 2GCOB 1MKYA 4TYPA 4C0HA 1MR3F 4JSYA 1ZAKA 3EWSA 2AN9A 4QGAA 1KI6B 1X8LA 2PMKA 3TUJC 1II8A 4MKHA 2OSBA 4BLTA 2GK7A 5J4HA 1CRQA 4A9AA 4DUGA 2W6ID 4DRZA 5C46F 3UMRA 3KQHA 3AVPA 1CJMA 2EWVA 2GESA 5JWHA 4JS0A 2MSEB 1F48A 1HT1E 3QKTA 4XVRA 1AZTA 4JT2A 1UKVY 1E9SA 4RKFA 5FBVB 1BKDR 1U0LA 1KAOA 4L16A 1XPRA 4IDHA 1DAKA 2GBLA 3H84A 4TYWA 2D4HA 4DLWA 4QKQA 3GEHA 4ZKDA 1YU9A 2YHSA 1E2LA 3THWA 5EUQB 1H8HD 1DS6A 4UNPA 2HV8A 2NZ8A 4EFNA 4ZCIA 2VF8A 1CJVC 1YR7A 2YJTD 3ASZA 5K8UA 1ZC3A 3K0FB 3QF4B 4MDEA 3FHCB 2QRNA 3MWLA 2WPDD 4Q19A 4CEJA 3X1XA 3HPQA 3B7GA 4LX0A 4A0RA 1L4UA 1L2TA 3L8ZA 1E98A 2O52A 4LC1A 3T12A 1GM5A 1G18A 2ONJA 1R4AA 1PV4A 2JA1A 4RCZA 3AP1A 4PPNA 3AF3A 5CDFA 5J47A 2JLXA 1M34E 5CJPA 1XX6A 1JPNA 4Z8YA 4TT3D 1FX0B 1ANKA 2JLZA 2Z4SA 5E3HA 5LD2B 4URVR 1OXSC 1MRSA 4GP6A 1MV5A 2XOKA 1W4CA 1F2TA 4US2R 3SBEA 2FEMA 1UADA 3WMFA 4WZAE 1N6KA 3Q5EA 3RLFA 3HWSA 3U4QB 1ESMA 1XEXA 3Q3JB 4QJ4A 2GA8A 3MFYA 3NKVA 3LX5A 3RS2A 4ZKEA 5KDOA 5CM8B 4CEHB 2C03A 1EFHA 1UKYA 4KBGA 3RRYA 1CP2A 3KQLA 1HH4A 4IVQA 4OBEA 1E1QA 3BRWD 3KKNA 1NMYA 4LHZA 3TBKA 1ZNWA 2QU8A 1J90A 5C1BA 2MSCB 4AIIA 5EXXA 5L3SA 5L3VA 3CR8A 3R9IA 1VMAA 3L0OA 4P4TA 2D7CA 1GKYA 3GPLA 3QEOA 4ZCMA 1NY5A 4GPTA 5J5CA 421PA 1YJ5A 3IUYA 2IYYA 4DSTA 1G291 4MRSA 2DWPA 4AYXA 3Q5DA 4KV9A 1Z8FA 2DBYA 4Q4JA 2FEOA 4QBIA 4O2RA 3DO6A 1E32A 1T9HA 3TW8B 2CVHA 4P0TA 4BLRA 4IEEA 1E2QA 2QY9A 1M2OB 4C7OA 3VHLB 2C95A 2UKDA 2V6JA 5H1YA 5KDLA 2V55B 1ZBDA 1G3QA 2IWHA 4OHVA 1EWQA 1G9XA 3FFBA 1XWIA 4A8JA 4IEIA 4GDFA 1KAGA 2JJ8A 3FKSD 1ZUHA 4EFMA 3IO3A 5C18A 1KK0A 2WWIA 1K5GA 3X1DA 2GILA 3RS3A 4DCSA 2A5JA 1GUAA 2AX4A 2KBEA 2CCGA 4YDHB 3L8YA 3VU9A 3U60B 1IQPA 4PSAA 3EIEA 1BMFD 4WBSA 1S9DA 1XU4A 2P2LA 4IDOA 3X2SA 4A6XA 1DELA 1OLOA 2QT1A 4NCHA 3RABA 2G0NA 3K9NA 1KI8A 1E96A 1SGWA 4B6EA 1FQJA 3B13B 1M1YE 2HT6A 4CZ2A 3LLMA 5C4GB 1M7HA 1FL9A 2QAGB 5EE5B 4Q01A 2NO7A 4Q1CA 3WBKA 4L9WA 5J4YA 5FL7D 4B3CA 1ZM9A 1ZM7A 2P65A 4LZZA 2F43A 4HEJA 4TMTA 5EXTA 4ACBA 2NO0A 2B7BA 4NYIQ 4Q4HB 3OEHD 1JBKA 2ZJYA 2O8CA 3KQUA 1QG2A 3DKPA 3FMOB 2ECKA 2RAPA 3PR1A 2BBSA 3W34A 2BBWA 1LNZA 1N6RA 4V0MA 4BE7B 5LB2A 1NVUQ 3ZVMA 3EAQA 4LPKA 3DM5A 3ICEA 2YC2C 1Z6AA 4JLDA 1OYWA 4LJ8A 3FE2A 4DHEA 1U94A 1BMFA 4JLNA 2A5FA 4X8MA 4CEIA 4DVGA 1COWA 3CZQA 3ZVRA 2YYZA 3I32A 3PUXA 3A6PC 4HZIA 3SFZA 1DO0A 1N6PA 1F6BA 1N2CE 1CBUA 5SZIA 2NZJA 1HEIA 4PHGA 2F3RA 2MMGA 2EQBA 2IWRA 1XF9A 5TV2A 3BB4A 2G0TA 1Z06A 4BZPA 1R2QA 4QGHA 4K46A 3BIFA 4GSYA 1Z28A 5HTKA 3UKDA 4IDPA 3EPJA 3SC3A 1TQ6A 1N0UA 1DVRA 2FFHA 4UXIA 4ASUD 1OKKA 4DSUA 5JS8A 4EJSA 4RD4A 3LFUA 3CWZA 2EYUA 3T5GA 1WP9A 3KXKA 1VIAA 3RANA 4Q02A 2C9YA 3BORA 5LB4A 2F1HA 1AQUA 3X1YA 3AP2A 4GMXA 4QL3A 2V1UA 1UEJA 4QBHA 4M4SA 2I3BA 3ETLA 2H92A 3V9PA 1K8RA 2NOAA 2Q9BA 1JNYA 4DXAA 5J4VA 1HYQA 4DCUA 3K0CA 4G01B 5FL7A 3AB3A 1P5ZB 1EK0A 3H2YA 2BMFA 3PUYA 4U5XA 1W0JD 4AURA 1UDXA 3IIKA 2IA5A 4WZBE 1TAGA 5JMTA 4JLVA 3PUVA 4DDUA 2UVQA 1C9KA 1EWRA 5FPKA 3U6KA 2X1VA 1N0VC 5LDDC 3KXLA 3O8CA 2BM0A 4MKGA 2J5XA 1OE0A 3BFXA 4OI0A 1VG0B 4JBYA 4LYFA 1W0KA 4YMSA 3R7WA 4F7WA 2VF7A 3MD0A 1KO4A 1SKYE 5DYIA 4YMVA 3GLGB 3EZFA 4Q4AA 4JVSB 1TF7A 2ZS8A 4JJKA 4LCBA 4OK5A 4DT1A 4A15A 5M04A 2DWQA 1KDTA 5L8VA 1P75A 1W2GA 1E2KA 4D82A 4WOPA 4M8NE 4JLJA 2AR7A 4XTRA 5DLQC 1P2SA 4P33A 1CU1A 1LF0A 2ZI6A 2ZJ2A 4TYNA 2QRZA 1KI4A 2ZI3A 5DHFA 2H18A 3T1QA 5JI2E 2PH1A 3H1TA 4IJMA 1CR1A 3OZXA 4ACAA 3B1VA 4NHOA 1T5IA 1L8QA 1UBGA 2C98A 2GXUA 1J70A 1ZRHA 5KNDA 4PQYA 4R98A 5FOVA 1E2HA 2ZRLA 4KLZA 1DAIA 1U8ZA 3PVSA 4AKGA 1TEVA 1QHHB 2GCOA 4PSVA 4B32A 2IEZA 3K70C 2PT7A 4A0HA 2BMJA 3KJHA 4D6PA 1D2EA 3PEVA 3P27A 1Q21A 3HP1A 1D6JA 2WMOB 5DIFA 2RGGA 4MGZR 4LV5B 3LNCA 3QXHA 1HV8A 4JLMA 2MMCA 3ICQB 1DG3A 2IC5A 1CRPA 3ZQ6A 1F60A 5BYKA 2PEZA 2CJWA 4KSCA 5TDHA 3LVRE 4FWIB 1YZNA 4Q9LA 4MUBA 2O8EA 4BLOA 1FTSA 4E07A 1IXZA 2AD1A 3M1IA 2H8KA 1QZXA 1Z0IA 4DEYA 3K70D 1S3SA 2YNMA 3G82C 4HLUA 3FB4A 1O3YA 4PAQA 1YVDA 2BCGY 4KXFB 2G6BA 3AGPA 3N70A 3ZGXA 2F9LA 1J99A 5HE9A 1XJQA 4KITB 1W36C 1GG2A 2BKUA 2RHMA 1X1RA 2IT1A 2LKCA 4YC7A 1KI7A 3KJIA 2WWHA 121PA 2QROA 4I81A 4Q9JA 1HQCA 4LWZA 3ZS9A 3K0AB 621PA 5DISB 1XMJA 4C0KA 2P6RA 1G6HA 3GLGE 2C96A 2FSGA 2HXSA 4OJQA 2P5SA 4OQXA 1XBTA 1RE0A 2DY1A 3FKQA 3SYKA 3I8SA 2ZRAA 3EW9A 5FR2A 1JQLB 2P67A 5KPDA 4G5RA 4PPFA 3VQTA 3JZMA 3JVUA 3KX2A 4B44A 2ODBA 4QM7A 2IL1A 2K5UA 4R2HA 1AS3A 1ZM3A 4Q4LA 1Q57A 3A1SA 3WMEA 4RZ3A 1G3MA 2VP6A 3AVXA 4ZI3A 1ZU4A 3NBFA 3TQFA 2ZU0C 2G9NA 4M53A 5FOTA 1SQ5A 2R6CA 5FBQB 3WNDA 4B34A 1CEEA 1AIPA 4CRWB 3U7GA 3CNLA 1IN8A 3B5JA 3V4FA 2QPTA 5DSZA 4YXWA 3P4YA 1WF3A 3GLHB 1NNEA 1GSIA 2RGEA 5DI9A 2GTPA 3RS5A 2ZJ5A 1OPXA 5GJVC 3K53A 1A2KC 1HUQA 3AV0B 3U44B 4QM6A 4M9XA 4PC3A 1YRBA 4TZ0A 3LO5A 2F1JA 1FTNA 1XPUA 3AVVA 3WYGA 4BECA 1CR0A 1TL7C 2BC9A 2DWOA 3ONWA 3GP8A 4XSGA 2ZXUA 2ZAMA 1RYHA 5FTKA 1W36D 3GLFA 2JJ1A 3EWAA 1E9FA 2ZYWX 1A1VA 1XD2A 5P21A 1T3SA 3BH6A 4W5JA 4JZKA 1VPLA 2O5VA 2REOA 3VR2A 4A2WA 4BUJA 1XPOA 4XWKA 2AFHE 2P6NA 1JJ7A 4CEIB 2C77A 2GZAA 3GD7A 4LGMA 4QBFA 5C2JB 5JEEA 2DHRA 5K8LA 3KTAA 2XJ9A 4URUR 3WBJA 5JWOA 4QFMA 2IXGA 1AGPA 2BCJQ 4GL2A 4IOKA 1T3LA 1IXRC 1W2HA 4V0NA 4CIDA 1KO1A 3KB1A 3Q9LA 4U7DA 4US1R 2NPFA 2OAQ1 1UPTA 2HEIA 1AJEA 4FXPA 3LBIA 1SVIA 5GADl 5JJLA 2BOVA 3HPRA 5JJKA 1KDPA 4XOIA 2BBOA 4LOAA 1OFHA 5EXSA 1XTRA 3ADKA 2OBNA 4HI0E 2FDCA 1HURA 2OLKA 3GJ4A 1W44A 2OO7A 5CITA 5LPNA 4KYUA 3AVTA 4AG5A 4AD8A 1Z6XA 2G1JA 3BOSA 1DO2A 1XTQA 3KXIA 1WDTA 1L7VC 3P4XA 2CHGA 4Z1MD 4BFZA 2W58A 2IYSA 4PHFA 3I61A 2JLVA 1YR8A 5FTNA 1AA9A 1GVNB 5B58C 4C9BA 1Z63A 2D74A 3C4JA 3IEUA 2FFAA 3OAAA 4M1WA 2V4ZA 2VQSA 3SN6A 3TAUA 3ZH9B 5G3ZA 2QAJA 2GAAA 3BS4A 3CRW1 3M4YA 1Z2AA 3IPYA 4BFUA 3UG7A 4HZUA 1ZUIA 2R62A 2FF7A 3LVQE 1OV4A 4NYMQ 5GJCA 2ZJAA 2WWXA 4DLXA 1F2UA 3BB3A 3DEFA 2O0JA 4HAYA 4JMPA 4QHTA 4AKHA 2AHOA 1KHTA 3CNOA 4A0GA 4M0LA 3AUXA 5EJEA 4DB4A 1NKSA 4BGDA 3HJNA 5IHPA 2CXXA 4NCJA 4TL6A 5DN6D 1E4YA 1Z6GA 3K9HA 4C0QC 1LFDB 2GBLC 2BEKA 2E87A 3QKSB 4NYJQ 4RVCA 5AUOB 4D4KA 1X86B 2RB4A 1N6OA 2WKPA 1XEFA 2DPXA 1W36B 1XZPA 1DAMA 2H17A 5FPSA 4B3BA 2W83A 5AWFC 2NMVA 2YZ2A 4NZYA 1NVVQ 3ZLJA 4TYQA 4DDVA 3IHWA 5F9FA 3PUWA 5JWRA 1ELOA 3TSWA 4DLYA 2JASA 1IN5A 4TMWA 5BQ5A 3NHBA 1IONA 1KZ7B 2EYQA 4B3DA 3PEWA 4KAXA 1W4RA 1KNQA 1VYTA 3D31A 2VL7A 2DFKB 4UKDA 3CNNA 2QMOA 4WIAA 2GEDA 3AF2A 3UPUA 1RW4A 2X2FA 3WYFA 4A36A 3AKYA 3SNHA 2QAGC 1NIPA 4TYYA 3Q7PA 5KSYA 1W4BA 2IS6A 3VX3A 1D2NA 4LBZA 3TGPA 2FSFA 3C16C 3IPXA 4TMXA 1MH1A 1IM2A 1XD8A 2KBFA 2R44A 1SXJC 2WOOA 2ZQ5A 4M9ZA 4BZQA 5KO2A 4XD7A 1XCMA 4NP6A 4B3FX 3OEEA 4PZLA 5FBLB 2IBMA 1L4YA 4JVLA 5F9HA 3BXZA 2QQEA 2PZGA 1CKEA 2ZRDA 5FUYA 5GJWC 2FZ4A 4DLRA 2J45A 2WWFA 4KHZA 1DAFA 1FNMA 2QA5A 3NC1C 3T61A 2JDIA 1M7GA 4BEJA 1JR6A 2CL0X 3WNCA 3AQ4A 3AUYA 2J0UA 4QC2A 3U44A 3T06B 2XZOA 3EA0A 4PX9A 3P1JA 4OQMA 1XDBA 2A78A 3GJ0A 1G16A 5IRCD 1IN7A 4HB0A 2B92A 1R0XA 2RMKA 2WSSD 1KK2A 1ZU5A 4F91B 1NI3A 4LJ9A 4PXAA 3MUFA 1NLZA 4A92A 3VAAA 2B7CA 4XD7D 3CPHA 1K6MA 1MT0A 1OJLA 4LPSA 2ZVQX 1U0HC 3HU1A 3FHOA 1KSFX 1NSFA 3EXAA 1KSGA 4ON9A 4M21A 4MYTA 5FI0B 3ND8A 1WA5A 2ZI7A 1E2GA 4NCIA 3SJBA 4PQFA 1OB2A 4BEBA 2ASEA 2JLYA 3OIUA 3S1AA 3GJ8A 2ZSAA 4DCTA 5ELXA 3NEYA 2HT1A 1KSHA 4BWYA 1X8KA 2A5YB 3SHWA 2NO9A 1DADA 3ZDQA 2NIPA 3LBHA 4LV8B 4FMDF 1G3IA 2GZHA 4L15A 1G5TA 1ZNYA 3T34A 1GRRA 3CRMA 1I4TD 2FU5C 3BD9A 3T1VA 4B75A 1TX4B 1U9IC 4LSGA 5DI3A 4C0SA 3TMKA 1OB5A 2F1RA 2CEAA 2WSSA 2RGAA 1T0JB 3JVVA 1ZJ6A 4BASA 3A4LA 4PZYA 3CW2A 5FUXA 4B48A 3OFND 3NH6A 2IS1A 3ADCA 3MWYW 2GNOA 3GLIB 2P0EA 5DYGA 1Q3HA 4DSOA 2CBZA 3FKSA 4BFVA 4I1OA 3CM0A 2ANCA 2WVJA 3AEZA 3TE6A 2BV3A 3TSOA 1R7RA 4NCKA 2W2TA 5GJBA 2WIAA 1S4QA 2QQ0A 4HATA 4HB2A 2J0SA 2VHUA 5FPHA 4D4JA 1FMLA 4P4UA 3K9GA 1G20E 2WAYA 3KTAB 1WXQA 1GNPA 3CB4A 1KY2A 4GZMA 4XJXA 1DTSA 1UBFA 1NN5A 4R9UC 4DKXA 3EZ9A 1NF3A 2GEUA 2WWGA 3SYNA 4XWOA 1FUKA 1ETUA 3K70B 2DYKA 3QKRA 1MO4A 2FGKA 1GL7A 4OQLA 2XTZA 4DB2A 1AZSC 3RS7A 4XTCS 4M1MA 1Z29A 3A1UA 3ASYA 2FWRA 3GLHA 3OE7D 4QRHA 3IBGA 1E0AA 3DKVA 4NBSA 1G1MA 1SXJE 4F4IA 1B23P 2IW3A 2ORIA 1G8YA 1P60A 3QBVA 4ABYA 1FX0A 4DBLC 4US0R 3VR6A 5KTYA 3C7KA 3THWB 1DEKA 2PCLA 3IQXA 1YHNA 4A82A 1TF2A 5B30A 1Q22A 4AWXA 4EDHA 2IHBA 1JB1A 4KI0A 3WRYC 2XOKD 3D7MA 3PG5A 4RD3A 4LK2A 2CE2X 2KSQA 3SEAA 4PO8A 3SJZA 3SYLA 2I1VB 3EIHA 2ZR9A 1G5PA 5JRZA 5KUTA 4JSTA 4ASUA 3U3MA 4CVNA 2O0KA 1E79A 1LF5A 2WJJA 4II7A 5EZ6B 2FV8A 3MRSA 1OXVA 1YRAA 3KFVA 4QG7A 5AUNB 5JHHB 2QN6A 4Q66C 4NYMR 3ZVLA 2ORWA 1I2DA 2RH5A 2QI9C 2OXCA 4DIEA 4HLUC 4B47A 2Q9CA 1N6HA 1S3GA 2W0SA 2VSFA 4N0DA 1GTVA 2GETA 1Z0DA 4C0JA 2WTUA 2CDNA 4U00A 4MYCA 1NVWQ 1XTJA 2X8AA 3CX6A 3E70C 1HY3A 3FGNA 3K0SA 1KMHA 2CVFA 1VKJA 3QOFA 1KI6A 1E0JA 2XAUA 2CE7A 1RPZA 1ZM4A 3TVDA 2JLQA 1KOFA 5FTLA 4TMVA 3HYTA 3SI7A 1XMSA 3S1AB 2ZE6A 1T8TA 2AKAB 5SZKB 2PJZA 2QGZA 3H4MA 3PENA 5HKKD 1U0JA 2ZRPA 4CEHA 1LY1A 1HTWA 2YKGA 1OFIA 4D81A 4K8OA 4Q9IA 3U3JA 2GF9A 2OV2A 1E2PA 2WZQA 3ZJYA 5F3WB 4D2IA 4YMWA 2SHKA 2GK6A 2ONKA 4Y0AA 3E5HA 4I4LA 4A0FA 5AR1A 1SHZA 1UFQA 3LAWA 4IKEA 3WYAA 2Z6VA 2YINC 2JIZD 5FL3A 5KNBA 4BQSA 2R2AA 2PZEA 3DL0A 3U3KA 3R8CA 1A4RA 3FOZA 3P20A 4G5QA 4Q4JB 5CB8A 1RRFA 4L5BA 3TR5A 1WE2A 1R0WA 3VR5A 4B35A 2P6UA 4TLEA 3T35A 2BIFA 2TMKA 4DZZA 4X8OA 4LC0A 4C2TA 4M2LA 2ZYTX 4JJZA 4TTRA 4CEJB 4QJ5A 3GEEA 2CCKA 2IK8A
chains in the Genus database with same CATH superfamily
2QPOA 3HB9A 5F51A 1T10A 4JT4A 4BFYA 3HTXA 2HK6A 2AHRA 4KVAA 4FWBA 2XGGA 3W4KA 1PQUA 4Q9DA 2D1SA 1QHFA 4FHCA 1QK4A 2Y67A 4LUCA 4Y2PA 4G5GA 1D04A 3RGGA 1I33A 1KP2A 5AUQA 2C8KA 4PO1A 2XOEA 5AUPB 1WCV1 1ZP6A 2VA9A 5LQAA 3AF1A 4YLEA 1GAEO 4ZAFA 1CQJA 3F0TA 4OHFA 4ESEA 1WBDA 3FXAA 3GVIA 3N28A 4MA4A 4ZV7A 3ABSB 1QHXA 3OKPA 1NI4A 4NNPA 4BVGA 4KJXA 4EB3A 1V5FA 1JKJB 2RGCA 2ZT5A 1KDOA 1Y1QA 3JQAA 4K6OA 4XH9B 1N6NA 1UPCA 2FE1A 1OXXK 4TT8A 4F3RA 3PFBA 4MS1A 4UM7A 2QRKA 3GC6A 1KBZA 1BJKA 1PLKA 2PRJA 3G49A 5IM4F 2D8AA 2Q6TA 4I14A 3SDSA 5JADA 2OCAA 3NDPA 4V0OA 2A0KA 1VPWA 5KWIA 1QHSA 4ZAVA 1O9GA 4BMSA 2WHYA 3GUVA 3HYCA 1X2BA 2QQGA 4J16C 3RPEA 2TYSB 5ERGB 2H1OA 1IAVA 2H31A 2X3UA 3K35A 4GIBA 4R16A 4CG3A 1RNLA 3TX2A 5T41A 3ZR4B 4RTKA 3DFKA 5JCPA 2Q6KA 1NMEA 1JALA 2W6MA 4HWSA 1Z5NA 3UK7A 2JRLA 2DBZA 2V6GA 4JITA 4YR9A 1XVIA 1VSTA 1AHNA 2Z9CA 1UZLA 4D9MA 2HQ1A 3IFSA 2BI7A 1C9MA 2X1HA 2P5TB 4BIIA 5AVVA 4TUYA 5ICGA 4UE6A 3QHAA 2VDJA 2PSFA 1SBIA 4EZBA 5LQDA 1Z18A 3SZGA 5E7MA 4B6QA 4YXFA 1SPXA 1EK2A 2TRSB 3EC2A 2QQFA 5DDIP 4B73A 6GPBA 4ED9A 4BQPA 3IDSA 4AT1A 3QFRA 4PR0A 3WL7A 4FHFA 3G2QA 2P30A 3H2IA 4C4TA 4ZIRA 3BZUA 1V96A 2WYVA 3QE0A 3ZJ4A 4BB5A 6Q21A 1UR5A 2PX3A 3CLRC 4I4IA 1MFZA 1ZN8A 4QBGB 5M34A 2XCRB 4ARZA 1VGVA 2HJ9A 4RVUA 4AK9A 5JROA 1GEGA 1ADYA 1ZCAA 3S1LA 1VG1A 2EQAA 3I1JA 2GVZC 1FP6A 4UU1A 2PRKA 3QWFA 1IOWA 1DHTA 5EJ5A 1UOPA 2QSUA 3AR7A 3KUDA 1EGVB 3P0EA 3OQVA 3IT2A 1LJUA 1RXEA 1GITA 4M0UA 2FNAA 3E22B 3BQMB 1PR0A 1FU7A 2WWVD 3UJDA 2Q3FA 4LCEA 2HF8A 5ALMA 3CV3A 3ZCSA 1TDJA 1VFNA 2O9JA 2Q3HA 2ZJBA 3KQSA 4BU0A 4HB4A 3GG2A 5KNCD 4NH0A 1S3FA 1UMCB 4L3OA 4MGYR 4CIBA 3T9DA 3DMDA 1CR4A 4G0PA 1DQRA 1CUFA 4TLBA 1F0YA 5KSZA 3WRXA 1QZTA 1RFLA 4RFVA 1VBKA 1WD7A 5JZVA 2OO5A 3COPA 1FYDA 3PFNA 1F6DA 4G6ZA 4JFAA 1ESNA 2BZ0A 1W0JA 3I9KA 5FPYA 5GONF 4C5BA 1JHAA 3T7RA 2QMUA 1ML3A 2AVDA 2IQIA 1NXVA 4YAJA 1OSNA 3N87A 4JJGA 3EEYA 3NHMA 2WIDA 4B17A 5JAZA 4FFBA 3R20A 4PX2A 1PVDA 1ZGBA 4BQIA 3V8NA 4HAWA 4EW2A 4RQTA 1ZVQA 3G8AA 3GHHA 2XECA 4DQDA 4K6GA 4CLRA 1OZFA 5SY9A 4WD3A 3RS0A 1RZUA 2A14A 3BWEA 3NJ4A 2CVPA 4WNCA 5BW6B 2GWHA 2WV9A 3EJ6A 4ZI2A 3IILA 1TRKA 1I4OA 4IQFA 3TVTA 1VE9A 1ZRNA 1DJOA 1TMGE 1ZITA 2VDWB 3RU7A 1WM1A 3QPUA 1HETA 1O4VA 2YXEA 4FR5A 4MDFA 4ENTA 1T13A 3FPCA 2L18A 3M4JA 3MSXA 1Q20A 3QHPA 4OX9Y 3MLAA 3TB6A 1JR3D 1C8LA 2G9RA 3LPCA 2GJ4A 4HLCA 4MA0A 4W1SA 3ZBPA 1HOXA 4WV3A 1G60A 2PL5A 3BPSA 2ZE7A 1W94A 2RHTA 3GJTA 2AG5A 2XE7A 3IJRA 4FZVA 4M38A 1DNPA 1URPA 4MPRA 4PAOA 3OX2A 1G8AA 5AJXA 1PJRA 4ZVRA 3UHFA 3DWIA 4F84A 3O3OB 5I3CA 4JP1A 4KPUA 3IQWA 4RDHA 2FE4A 1NJFA 2QX9A 1D5CA 1GZDA 5BRAA 4GGOA 3K72B 4OREX 3VZSA 5SICE 1D8TA 1UDWA 3VDRA 4IS3A 3UKJA 2GM9A 3WLFA 1PT6A 3KJEA 1NLYA 1A9YA 3KB2A 2WK1A 1VBMA 2YFYA 3CRRA 1ZOPA 4URZR 2JI8A 2Y99A 4IV0A 4PSKA 1FDTA 1M2KA 2HCBA 2IF2A 3QXGA 4RLHA 4L0MA 4F46A 3NHWA 3LKZA 5KTTA 3F5FA 2ZRHA 1B8NA 1TM1E 3ESDA 3S28A 5MGNA 1KGDA 1XVVA 5KYWA 2V7QD 4G26A 2ZWOA 4J7UA 5DGDA 4YMUA 3NC4A 3H99A 5KHOC 4E6PA 3RC8A 5FF9A 2I8CA 4W7SA 4C0BA 5TX7A 5LMUB 1PZNA 2A1TR 3ZX5A 3OU7A 1E2UA 1VFPA 3V4LA 4PW0A 5KYKA 4MQBA 4IXTA 5DP1A 4A27A 1Z13A 1QH0A 5CA1B 1T6NA 3ZBUA 2QU7A 1DOAA 1XEXB 4E5VA 1U7TA 2R8YA 4FFBB 4DNFA 3OY7A 2R79A 1VLVA 5B64A 1PW5A 5C8DA 1U99A 3N2GB 4F92B 5EIEA 4Y2TA 3M6AA 3ZWMA 3C5WP 4Y6PA 1O58A 2HUNA 1Y8QB 1I7SB 2A6PA 3IR5A 4B43A 3UYKA 2JFUA 4CU5A 4X1OA 1DC4A 4DR1B 3E9DA 2PX6A 1ZONA 4MI6A 2X13A 4H6WA 1LJ8A 3TI9A 4NMLA 1YQXA 1EK5A 2JGJA 1CQIB 1DAHA 2CFTA 1EWKA 1TM7E 2ZSHA 1KFEB 4JIMA 2DBVO 4V02A 4BBZA 5MFPA 1RC0A 1JLLA 1NZDA 2JKZA 3V32A 4TTQA 5JU6A 2XXAB 1E58A 3JZFA 4HQFA 4M36A 3T94A 1CEYA 2YWXA 5AKJA 2V8OA 5ICSA 2B83A 3AL2A 1BE1A 3B1WA 3N8KA 4IGAA 3TKLA 4IQ8A 4BNKA 5E2AA 4DRYA 3IUBA 2Y0PA 2X7JA 3NM5A 4BTEA 2X0KA 3NYRA 4OX9B 2NWQA 1LTHR 5IULC 1UJ2A 4N9QA 4AO6A 3BRCA 2NU6A 2WUGA 1M2JA 3LUFA 4ZDJA 5GY7A 3Q8XB 4IWYA 4ATNA 1F9AA 3GJ5A 3X0DA 1USWA 1E4OA 4KGDA 4FBGA 4TTSA 1EU1A 4PTYA 2JVJA 2CB9A 3QXCA 3TCNA 5EAIA 5AQEA 4DB2A 3IEPA 2AE1A 3SS7X 1I2CA 1TA4A 1MA3A 1YMVA 1XCPA 3H1BA 4RMIA 5JD3A 3O8OA 3TG8A 3IEVA 2PJRA 5DBGA 1AK1A 4RJTA 1QYCA 4KXLA 5SYAA 2CLDX 1KVUA 1YRQA 2F1IA 4XFJA 1N4DA 5D6NA 1T5DX 1Z4QA 3STYA 1R88A 1WZEA 1TIPA 5A5GA 5IZCC 3UWKA 1VE7A 2GQ0A 2MSKA 1XU9A 3EEIA 5IH7A 3DQPA 3RT1A 3ETHA 5EWMB 3F6EX 2IU6A 1E1QD 4L22A 5F9MA 1E2IA 3PA6A 2HL6A 4R0MA 2B4QA 3LCRA 1AQ6A 4ZVNA 4ODIA 1SVNA 2QTGA 4B8ZA 2GPAA 2P27A 4G63A 3RU2A 5CA0A 1YZGA 5EHXA 3KUXA 4X3OA 3VTZA 3LX4A 2UZIR 1P73A 1NI4B 4W8GA 4AMUA 5LUAA 1VIVA 2W6JD 1EM8A 1PJBA 2JLBA 4I4TF 1MXFA 2J31A 2OGTA 3P5SA 3PXCX 4BUZA 3SR3A 4PBSA 3V9AA 5CFOA 3QVTA 2ZTHA 1CQJB 5CLGA 2P9CA 5K0NA 2QRLA 3BCUA 5E95A 4IIBA 3ZZ0A 4PPYA 2RC6A 4U8GA 4PONA 2HLDA 5ADWA 1Q2XA 4NF2A 2XTJA 4BO5A 4E4TA 3UJ8A 3MPUA 3QWIA 4UTNA 3SQXA 2OPBA 4MV6A 4U8HA 4TM7A 1J0AA 2XZDA 1WSAA 2PLNA 2XUGA 4NYJR 2REXB 1G21E 3OURA 4UATA 1LC3A 1A27A 1RVV1 3RJ9A 3AHCA 5H9VA 1R3UA 2NQ8A 3D7RA 3GPIA 3AM5A 4X66B 1QP8A 1ONBA 4Q3EA 4QG3A 1G0OA 1SBQA 3ZHTA 4LMBA 3FDXA 2Z9BA 4WZBB 1PR4A 1AZLA 4RJ2A 2QSYA 2QTZA 2ZRFA 3IEKA 3LP6A 4H3KB 4O3FA 3EG9B 4IFBA 5EIBD 1GCGA 9LDTA 5L3QA 3KR0A 5KOYA 3RK4A 5JBNA 1K2VN 1YQDA 1W49A 1GAQA 3QY0A 3SLGA 3NASA 1NG1A 3PQ2A 4PHTA 3THXB 4GOJA 3NH9A 1T26A 1N6LA 4BFTA 3IEMA 3AF0A 2WJHA 3MWFA 3GA7A 3LY7A 1ADJA 3NKLA 1QYVA 4ZO8A 3AW8A 2OKCA 5GWXA 4K3UA 5DGXA 4WAUA 3L8GA 4DZTA 4Q9KA 3HCFA 1RHKA 4NZOA 4Q1BA 4X92A 2OBYA 2CXSA 2LDXA 4MEAA 4TKUA 4FILA 4RE5A 3AC0A 1GN9A 1E2JA 1G8KA 1Z7YA 2JEZA 1L5FA 2QM0A 3LBFA 3OZUA 4GNKA 4I50F 4AY5A 4DA9A 1UJCA 2DCMA 1AKWA 1B16A 1K3UB 2OCYC 5KWEA 2E1RA 1IJEA 4UC0A 1N9ZA 4XDYA 4AF6A 1QNLA 2RKOA 2BHRA 4KIUA 4DHWA 1BEUB 3P32A 1R6TA 2Z95A 3SE7A 1UP6A 2AK3A 2BP7B 1D07A 2R6ZA 3A58B 2HBRA 1BJRE 1FJHA 2A2ZA 4GRDA 2PMDA 2Q2WA 1L5HA 1QIMA 2H9AA 1QH1A 2WZBA 1G66A 2FF5A 2OUKA 4IUCS 1PR6A 1NLFA 2O3JA 4IGEA 4A8PA 5KQSA 3EDQA 1E77A 3AM1A 3JPYA 4OLBA 1NT2A 2PK3A 4OXIA 2VXOA 3T5CA 3ETCA 4TV9A 1N57A 2IF0A 4Q24A 4Q7JB 4CFZA 2HDNB 5DNYB 3AFGA 3TL3A 2VP5A 1PEDA 1XP5A 3V7YA 5IJ9A 4EEKA 1JG7A 5F77A 2H9IA 1YRHA 4ZOLF 5CDUA 4MLZA 1PHRA 2WJZB 1NW3A 3RUPA 2Q1UA 1DT3A 2YCBA 2E7ZA 2ZBUA 3DLIA 4CQLB 1SD1A 3H2BA 4O59O 1G21B 3I53A 3BWVA 1TECE 3QSGA 4X00A 1KI1A 5CK5A 3H5RA 3UGJA 3PWKA 3V55A 1FXSA 4A0QA 2Y0EA 4CKEA 3REFA 2OD2A 1R10A 2CXPA 4MVJH 5DWVA 3HM2A 2Q1TA 4OGKA 4BMOB 3VNRA 4EO7A 2OFFA 4PPGA 1HZZA 2FG6C 5JPCA 3H9BA 3PWTA 1SCAA 4RZXA 1EXMA 1CLUA 1T2VA 4Y0VA 2BGKA 1JQJC 5CB0A 5G0SA 4ERXA 4KCGA 3CUKA 2CFRA 3HXPA 1BHO1 4BB0A 2P4EA 3O9ZA 2EC5A 1BS2A 2P7IA 3OHPA 1XDZA 2EHJA 2NU9B 4EJ0A 3NTVA 4RLFA 4XLLA 2Z4RA 3G5TA 2AKEA 3R41A 2ZI4A 4FYXA 5A7HA 4Z54A 3ND9A 4E14A 2X40A 2RHBA 2KM1A 3O95A 5IKMA 1KJZA 2EZ8A 2JS7A 1DTEA 3HJGA 3GUZA 3MAAC 2XTNA 3QF4A 3TNYA 1GPAA 5ILOA 2WUFA 3EWNA 5TQ0B 3BXOA 2O3TA 2RHWA 1E6LA 3LIIA 2V7XA 4M9UA 5C80A 1NN3A 2W2PA 5JT1A 1Y3CE 1LV7A 4P1ZA 2PYIA 5EPEA 3ND5A 4Y9DA 1DCTA 3PX3A 4HVCA 5AW6A 3KKOA 1M83A 3NOVA 2FJPA 1DX6A 4Y6LA 3A3NA 2G8NA 3G8CA 1TYAE 4XX0A 5DULA 4EGJA 2DLCX 3KYDA 3KEQA 4HD8A 3X3HA 4AW9A 1U1DA 1G8PA 1AKVA 1Y7PA 2YN2A 1FYEA 3DE5X 3DEJA 1PNQA 4YO8A 3K0BA 4BJ1A 5C7YA 2RG1A 1TUGA 3SZOA 3HCCA 3DTVB 4QSMA 3PXGA 2HCTA 1M2HA 3KNZA 3ZS8A 9LDBA 1IN6A 1TXGA 3AJ9A 3NTRA 5CNMA 5I45A 1IBMB 2AZDA 1L5WA 2YCLA 1QRAA 3F47A 2BGWA 2IY8A 1CUYA 5IKOA 4EEXA 1K86A 3K2QA 4LDJA 1Y33E 1FJGB 2O7QA 3TBHA 2IIBA 1QTRA 4HS9A 2GBFA 3HR8A 4RHFA 4U9HS 1G2OA 4CTNA 3GT4A 5KEIA 3LGXA 3DVAB 1P74A 1MB9A 3MWJA 1UKBA 3COWA 2Z5FA 3DOHA 2DT8A 4UEKA 5L9AA 4N6OA 3ONFA 1LS1A 1VBNA 2DSNA 3MERA 4UE2A 4PPQA 2ZETA 1O0CA 3WLAA 5JAMA 5IBRA 1AXEA 4N4AA 5BSMA 4LNAA 1E6EA 4DWOA 2BT4A 1OZGA 4NAUA 4B74A 1NJ6A 2H11A 2PD6A 4YQEA 4BO2A 5DNUA 1NJ1A 1MEOA 2PGIA 1JU4A 2IPXA 2DFVA 3CWQA 1I4EB 5DW0A 4A10A 4AVYA 3O8DA 4CLOB 3CX7A 3DYIA 3OTIA 1W5AA 1NSTA 3NHRA 5ECWA 5IX8A 1K5DA 2Z2JA 1HRKA 1YJ8A 2LIVA 4DPMA 5HIAA 1M6NA 4GYJA 4ALIA 1H8EA 1BCSB 1DEAA 2IODA 3CG4A 4MQFB 4A5OA 1Q6ZA 4KGZA 3RSCA 3W3ZB 4UXHA 1XAHA 2OP0A 3JAMA 5CRIA 3W4JA 2HCJB 5ECDA 5K3OA 1DFHA 2FCRA 1SKAA 2FMFA 1VE5A 3QFSA 5I4BA 1WS6A 4ZZ1A 4F3YA 4BKMA 1WMFA 1WTCA 3HCRA 3VHQA 4GG1A 1L1QA 2PTHA 5HS4A 3K16A 2NVBA 2FFJA 3U81A 4YJ3A 1RWQA 5AM2A 1HDIA 2WKQA 2H1HA 3AY6A 5LYYA 3C6KA 3FVWA 3KL2A 1P2VA 1ZHOA 2CFSA 3CF6R 2C78A 4V1CI 2V45A 1NKTA 4KIWA 4PANA 2XIQA 1LDEA 1DOZA 2VHCA 1P33A 2RBKA 3F6RA 4FOPA 4HMQA 4RK4A 5DV9A 4ZQEA 3LY9A 3VV3A 1LTQA 1FUUA 3KJNA 2H5EA 5K51A 3VR5D 4FEGA 4UZEA 5EHZA 2QUHA 3W5UA 3RBAA 4PTLA 3GA0A 3SX2A 3WY9A 4KYTA 5CA0F 5F5NA 5KTPA 3COVA 2B4AA 4E7OA 1ZHFA 1XVUA 3FNHA 4TTTS 1Q3KA 5DSXA 5HBRA 1XTUA 2KYRA 2UZAA 4HDRA 3SKVA 1L3IA 3AF4A 3ZWWA 5EJMA 3DZKA 2X8JA 3DVQX 5KNLA 4U7WA 6NULA 5GIPE 3D3NA 1DC3A 4FZRA 2JZOA 5C34B 3H5LA 4YPOA 1G6OA 1SIBE 4LJAA 3W90A 1KEEB 2QL7A 5ALNA 3B9PA 4ZV4A 2IZ5A 5DYNA 4JP2A 2ZOSA 3QW4B 4GRIA 5IDVA 5JAQA 1Q0SA 5B1YA 1REQB 1IY9A 3AEUA 4GE0A 4PCUA 2FLKA 1PGJA 3F3SA 4LDRA 5IJ0B 1G41A 1V8BA 1VL2A 3KVYA 2I1QA 3HY6A 4LISA 1Z25A 4H3HB 4NE2A 3VJRA 3HP7A 1FUIA 1XTKA 4XAQA 3SGLA 2IZOA 3HCBA 2FGJA 2Z58A 1UBRS 3VR1A 1U6KA 5CDGA 1EQ2A 1RYDA 4J3FA 4J75A 2O19A 1OVMA 2PA3A 3UICA 3FFTA 5EZ5A 1JQDA 2H8GA 1BWQA 2HMTA 2OCPA 3A1EA 1NW6A 1IDOA 5DXFA 2FZEA 3KJFA 3K9CA 4PGHA 4F3KA 3O8RA 3QWHA 1N8NA 5CPFA 2ZUTA 3WISA 4D8YA 2IFTA 3KV3O 1PBTA 4R1UA 3U39A 1NYQA 3NTQA 1I30A 2H0RA 1PZGA 2YVKA 1BMQA 2VH5R 3IVXA 1U9YA 4P7JA 4QDKA 1K68A 1QH1B 4N3CA 2JGNA 3JQ8A 1QHGA 4AX4A 1ZQ1A 1XTZA 3UTDA 1CUSA 2HB6A 1GPJA 4YQYA 3LDGA 4I50A 2TS1A 5EQTA 4DARA 4HWOA 5AIBA 1KORA 2W98A 2CNWD 2QMHA 2DULA 4DUPA 3V4RA 1MT3A 4C01A 1DQSA 1QH9A 4DIMA 4GWLA 4V39A 4HWTA 3LCVB 1P5RA 3MJEA 4REQB 5AI9A 2FRDC 1ZNZA 3PUKA 3RVBA 1JEDA 2IXDA 5JOQA 3D8SA 1YCGA 1FZQA 3MWEA 2R66A 1B6SA 2RONA 3K9LA 1NW7A 4IGKA 2W48A 4N5IX 4TKUB 5ES3A 5JCJA 1P2TA 1YRYE 2DVMA 3HKBA 3I12A 4PN7A 5BQPA 1NMXA 1KJWA 3ITEA 3R0JA 3VH4A 5K0SA 5CXQA 1GTZA 3AKDA 3U2QA 4BVJA 1R15A 3RSHA 2AR9A 4ONEA 2X4DA 2Z83A 3FPKA 4Z86A 1AV6A 4BO4A 2FA9A 1H65A 5D1HA 2I0FA 5EKXA 4P31A 2CLMB 1QXSA 1V8DA 4RJIA 3UXYA 4MICA 4RGVA 4TGLA 1MHPA 3IAM1 1V9SA 3HZHA 3I45A 1OVGA 1Z7EA 1XTIA 1MEEA 3VH1A 2ZPUA 3B1YA 4ZCPA 1KK3A 2M6LA 1M8FA 1R4MB 3RRFA 1PZEA 4J2OA 2FHPA 3BMNB 1L6IA 1QANA 1ESEA 2NZXA 2O7NA 2OBMA 1T2FA 2WB4A 5DO9A 2QTLA 3AHJA 3K2EA 3HABA 5K0BA 1SRQA 2ZYVX 4PLYA 3AEXA 1NQUA 1ECJA 1DI0A 1QJCA 1T29A 4OEHA 4DDKA 1V5GA 2ZIUB 1OH5A 2ZCJA 4OMFG 1XEWX 2J6HA 2X7XA 3W9BA 1VRWA 2YC4C 4ZYZA 5KWJA 4ETWA 2IXBA 2IYWA 2WE8A 4I6EA 4E30A 4FI3C 1GKKA 3I73A 4IEFB 4X91A 4BTVA 2OL4A 1Q7BA 2CNBA 2G5CA 2YDYA 2WAMA 2GN9A 4QPNA 2CF6A 3C6ZA 1MXHA 2AMVA 1ZSNA 1ZCBA 2HSWA 3C70A 3D6MA 1LLDA 2H54A 1ZLYA 4GRAA 1XOIA 4ANFA 4XR9A 3GFBA 5EINA 1TKRA 1W85A 2MR6A 3AIOA 3HO6A 3IDQA 2BH2A 1Z26A 3VR4H 5IAOA 2GXAA 2PKEA 4MQ6A 3PCRB 4OOFA 3I04M 4MWDA 3A05A 3FOFC 1FB5A 3FFWA 5HIKA 2O54A 1DHRA 2LCIA 3CLVA 3EFEA 3VUEA 2QL9A 1HWYA 3ZDCA 2BHNA 2WT8A 1ZIOA 1GDTA 5K8JB 1LK0A 5I4CA 4UTZA 3KQYA 3NW9A 3O94A 1ZKDA 2BHLA 2EFYA 3FCYA 4HL6A 3TEFA 3O0TA 3V1MA 5E7IA 1LC0A 2OTCA 5CT4A 1J8MF 3Q87B 5CFLA 2PRSA 4O4IB 5FBWB 2H0QA 4Y2VA 1F7VA 4C6HA 1B0PA 2WPNA 3I9NA 1X2EA 4Y6QA 4OA8A 2V9ZA 3VDMA 1P4RA 2OHFA 2VHTA 2I55A 2RIRA 1FYWA 5GGXA 2FVXA 1QQAA 2D54A 3WLMA 2G36A 3PDJA 5IC5A 1QV7A 3KVVA 4WZAB 1JJFA 4AC9A 3D6VA 5FTJA 2CBGA 3E3MA 1SK8A 5C5CA 3OESA 4EUSA 5L6MB 3KELA 2ZUEA 1N7JA 1K88A 1N0WA 3MGKA 4I1IA 5GM1A 1L7AA 3EXIB 4KX3A 1NVMB 4XW2A 4AICA 2O1XA 4F60A 2GZ1A 1JDZA 4Q3BA 3B2NA 2H1LA 3BF8A 3K0EA 4UVIA 4G37A 5KHLB 1ODSA 1VRCA 1OKKD 2QTHA 3JZAA 3Q4GA 4QFBA 1H4TA 3EXEB 4RQBA 4II3A 4Q9HA 5AHWA 1PJ3A 1JDBC 1JAHA 5DMXA 1LQ2A 3GLSA 2YWCA 3F96A 1HL3A 2JHAA 4QQRA 4DW8A 2E4WA 2GJ9A 1ZLXA 4R83A 1U3TA 4G1VA 4TV8B 2PRZA 4WOBA 3TRFA 1K89A 2CNLA 3N2IA 1Z6TA 4KSBA 4TQ9A 4COOA 2XMCA 2NSHA 5FRDA 4ZI7F 3UM9A 3FTEA 1WZNA 1X6VA 1M1YA 1OPRA 4XM0A 1LS6A 3AI2A 4HDMB 4KXQA 5CIQA 2XB4A 4OAQA 4ZO7A 4EA9A 5JS7A 1QLJA 3A4YA 1QQ7A 3WDSA 1GRQA 1J2JA 3DEIA 3QMMA 4JXJA 4CR8A 2Q7OE 2CL5A 2HK7A 1N5KA 1NVAA 3I4FA 3PQDA 4J4TA 5AVYA 3PE3A 1Q5PA 1EVQA 2GN4A 3QYJA 1CULC 2J46A 3NVDA 1WNTA 3FMFA 1Q2UA 3EMKA 3ZDXB 4MH0R 5CB4F 3LC0A 1EDOA 4E6EA 4O25A 1SUIA 3LQ2A 1QPZA 3BE4A 4MITA 3I2YX 2ZREA 3RI3A 2C2YA 1I3MA 3TEMA 3QPVA 2AOTA 4AM8A 3LG2A 3VNVA 3DAFA 2VDUE 4C2BA 2CZCA 3FSGA 4O3MA 1GKIA 4HNHA 4OH7A 2B4KA 1Z62A 2XTAA 3BGSA 4OHUA 4OHWA 1RYBA 1Z3CA 2VK1A 3UJAA 3R7BA 2BSXA 1E2DA 2GD6A 2HA2A 4YJ3F 3R7AA 5K0CA 5CBKA 1MABB 1IZYA 2EP7A 4D0GA 3NOQA 2C7GA 4BCBA 4EG1A 2QTMA 4ZARA 3LX8A 2FY8A 1XL1A 3C1OA 4PVCA 1PTJA 4N49A 5LIPA 3DHYA 2PYZA 4LI3X 4E0BA 3MMNA 1GZ6A 1FXWF 4YT2A 2FPMA 3FPAA 2IXAA 2ECPA 2GJSA 3ISJA 3JAKB 4G0YA 4WGFA 5C7OO 2J5BA 5JLAA 1MH9A 1YIOA 2XUOA 2JCSA 1VCHA 3H5AA 3LUPA 2XXAA 4YI5A 2HQRA 4YRFA 4B71A 4DREA 1C9JA 3E15A 1QMPA 3LK6A 4Y0NA 5HUQA 2D2FA 3AEUB 4O2AB 2B8TA 2Y3IA 1ES9A 1DZ3A 3LPMA 1EKXA 4FR0A 3WNBA 2OK7A 1NTRA 4K6MA 5T8KC 3PV0A 5AVSA 4NCBA 1UFRA 2B7LA 3GFOA 1CR2A 3IP6A 2BH9A 3TZHA 3RTDA 3TRHA 1J8DA 1YL7A 2RD2A 1Y8QA 1OZ0A 4I5GA 6ABPA 2HIGA 3PFIA 4AJPA 4P92A 3FPEA 3DNFA 2X19A 4K9SA 3FSEA 3NALA 1VPEA 2QTVA 2RH4A 2UV8A 1L1FA 4AXXA 4V0KA 1FNSA 2O8VA 4E2XA 1YTLA 3EOBI 1GYPA 2A92A 4XDHA 5HKLA 3DSRA 4FGKA 5TT1A 4ZGBA 1K0FA 3QPDA 3BDAA 3OA0A 3GGGA 1O97D 2QHXA 3A6JA 4O4JF 4PR3A 3ACBA 5H3LA 3PTAA 3NWBA 1XJ5A 3CLHA 4FHZA 2V7UA 4FJ0A 2ECOA 1M2EA 3QYAA 4GZ6A 4MQ5A 3A9SA 1KSJA 4HRYA 2XB8A 1RWMA 4L8FA 4N7JA 3ZY5A 5C5DA 3M4XA 5CGZA 1QFMA 1GHTA 3UXHA 3DLBA 3ZZ1A 1EHIA 2QIOA 1M8JA 3TQSA 2F3QA 3V80A 1YDMA 1NVTA 3QLEA 1RT9A 2JHGA 1N2CA 4R7ZA 4QYWA 5HGXA 1SKYB 4BHTA 3OC0A 4GM0A 5HR5A 3QFHA 1GQFA 3SQDA 1II8B 3EGXB 2B35A 1H3EA 2VXYA 1ZXBA 4N01A 4KFSA 1CY7A 1HE1C 2OHVA 1G8JA 3DLAA 4EYGA 1RMYA 5J3JA 1SXJB 2GN8A 3V1UA 4ARZB 1L8LA 3OTWA 4RV5A 3FI0A 2WJGA 4Q3NA 3ILXA 3V00A 1E9BA 4YRMA 3KHUA 2NNWB 3OSZA 4ZZ0A 5CAEA 2Y68A 1SBYA 4EBFA 2W37A 1JSCA 3IIEA 4ZIRB 4E1BA 1RXUA 2AG1A 2D62A 3IAS1 1RYFA 5L7YA 2EVWX 3RH0A 3SVLA 4H4CA 2PY6A 1S6YA 3AKCA 3MD9A 3ZIDA 1QYXA 2D3WA 4QDXA 3SHVA 1XLTA 4QOIA 1J9ZA 2IP1A 2R84A 3ENNA 3QK7A 5FI1B 4A6DA 3NFRA 1YFKA 4P7KA 1R8JA 3OQ1A 4BNNA 4RDCA 2GRAA 3RUAA 2C5LA 3MM4A 3P9CA 2V6MA 1Z2CA 3EPKA 1C0EA 4G84A 4LJSA 3QGMA 4MVJP 2BUCA 3OP4A 5KQPA 2BMDA 1PZXA 2W6NA 3RYHB 5DHQA 4XI9A 5CH3A 1AY0A 4AP6A 4XM2A 1U28C 3ZXIA 5KVVA 5JC1A 1YHZA 4Q3AA 4OXRA 1Y34E 5AXAA 1NNI1 2N46A 4KQFA 1L7OA 3LT0A 2NM0A 3QU5A 3LH5A 3AONB 1W48A 1RBZA 4F2PA 4IQ0A 1QO0A 3KZCA 5EESA 4CGZA 2BGGA 5EJIA 2BEJA 4DQVA 1NVGA 1S2GA 1T35A 2NGRA 4GDMA 1GQQA 5EUMA 4J3JA 5A5EA 2W6IA 2L69A 1UBCA 2ZWIA 3GCZA 4I1RA 5EGNA 4D4IA 2COEA 1OIVA 5JXJA 1RQ7A 4OXKA 1WAMA 1YU6A 2HNAA 2JEOA 4CKYA 4HXYA 2BGNA 1J2YA 1SO8A 3O8QB 1X0XA 4IHJF 4ZJZA 4XCVA 1VPVA 2ODNA 4U0JA 2BDTA 1JU3A 3EUAA 3A4NA 4D3XA 2IPMA 1VJGA 3C5CA 2NU8B 2BFCA 1R0ZA 1VE6A 4ZEXA 3BDIA 3W3AD 1JA9A 1I13A 2WWRA 1RZ3A 2XBUA 4K88A 2O2JA 3G9UA 3QSYA 2BZ1A 4MAMA 1A97A 2DUWA 1PIWA 2FTKE 2Y1FA 3ZZNA 3QKSA 2AT1A 5JFTA 3HB5X 4J0FA 1JI0A 2CDAA 2J85A 2NTVA 3LXMA 3OM1A 1DCFA 1YQWA 5E1OA 5B3JA 5D3MB 5TR9A 3EHDA 2ZU6A 1RI2A 5ESWA 3W5VA 4EQ6B 4BVKA 3LHDA 3SIXA 3P8ZA 4EJ6A 5HZHA 3ZY6A 1Z36A 3FLBA 5IVPA 4WPGA 5JAUA 2BDUA 5AI0A 3DBLB 4FK8A 2FOLA 3SHQA 1UDCA 5DU2A 4URYR 2WWYA 4Z4EA 1E7YA 1DBSA 4HN4B 1BN6A 4ZQBA 3V6MA 1A71A 2BFAA 5KCMA 4H4DA 5T67A 1P80A 1LTKA 3H8JA 3Q10A 1CEQA 2YXLA 3U9TA 1Y7LA 1SC6A 4MQEB 2FYTA 3GFRA 1M2OA 3K1AB 4PE5B 5THQA 2WF5A 4M0PA 4UVHA 4R3WA 4W5WA 1PEYA 1KI9A 2R8RA 4JLSA 3TCKA 5LWQA 3AFNA 3D6UA 2IYXA 4LVNA 1UPFA 4QAQA 5K09A 4AQYB 1UQTA 1FFXA 1YNOA 1X9GA 1WPGA 2JGDB 3I1IA 3NM4A 4MPJA 4UJ5A 5EIWA 1RJ9B 521PA 3R2JA 2J30A 1TAQA 3RBVA 2ID7A 3LY5A 4HDQB 2PJDA 1TJNA 5B4TA 1P7CA 2EDAA 2Q1YA 4RY0A 4ZRMA 1YQGA 4ZU1X 3I62A 4BNGA 4BX8A 5I8WA 5FUQA 4NL4H 4KL8S 2XPCA 1V37A 1K8ZB 2OCXA 5EP1A 1I3OA 1XXHB 1LVGA 3NUZA 4HUQA 2OD9A 4DSZA 4HQRA 5KJFA 1T3GA 3R75A 2GX6A 3H5TA 4JKYA 2IEYA 2KHZA 4RPIA 4YMHA 4KFCA 2WAOA 1Z8HA 4J0KA 4LJRA 1I1QB 4FNAA 4ALLA 4GOKA 3E2IA 2J7PD 3EVFA 4UXJA 5AVRA 3TUZC 4Q9NA 3B2QA 3HDGA 2HXGA 4F3TA 4G5OA 3B6ZA 5JARA 4NARA 4DY4A 4Q93A 4TROA 1OAKA 3LBAA 4ZRDA 1FSPA 4IUDS 1P4JA 2NUAB 3RWBA 5A3RA 1S1MA 2ZJ0A 5CD9A 3D3EA 1J5EB 1QVAA 2HD4A 4C6TA 4XWYA 1KIMA 1U81A 1OWPA 2YZ7A 4RIGA 3G5UA 4RAQA 5TB5A 1Y4DE 1HC7A 4KWCA 3DLHA 3VYRB 2P35A 2OQ2A 3NI2A 3PT5A 2IX3A 5K3DA 4FDLA 4DLVA 1VP3A 1J0BA 3R9XA 2D5IA 2PS0A 2HR1A 1H4VB 3VJKA 3WSTA 4E5NA 4BNJA 4YGXB 2B1IA 3A70A 4RPCA 2CFOA 2FRXA 4L5YA 1EG7A 1Y7TA 4BAZA 4ND7A 2YV5A 3EGXA 4RHXA 1AGRA 2F3SA 4WBNF 1RC1A 1RDFA 3D8RA 5I7AA 2GRJA 3SBOA 2WIFA 1ZXXA 2I4LA 3V7WA 3EG9A 1M8PA 1T6ZA 1US8A 2IU4A 4B4WA 4KO3S 3VO1A 4YNBA 3DAPA 4XFDA 3W6UA 4DY6A 2HBYA 1GPNA 4JR1A 1N9GB 2B2XA 2Y4NA 2WW8A 4MQ4A 2IOFK 4OP2A 3LD9A 4TTIA 3QG1A 3ZE1B 2PRYA 2C7OA 2J67A 2WJAA 2J0UB 3L79A 5ALTA 5LBUA 5CLQA 1WVGA 2G7MC 1LZLA 2R1TA 4QGGA 1QIIA 2BGMA 2ET6A 2UUPA 5KX5A 1E1CA 3T7KA 5A3VA 1KIAA 3ZWQA 3L0CA 4PCVA 5BVGB 3BT7A 1BD3A 4MLDA 1AKYA 1YQEA 4D8XA 3W9UA 4AS3A 3IVAA 4Q34A 2PUEA 1EX7A 4J03A 1UKZA 5L51A 4UMVA 2JJ1D 2JZCA 1NP7A 2A57A 3LF2A 4FIDA 5CUQA 4DM3A 5KU7A 1NJ2A 2C57A 2Z2ZA 1EZ4A 4JQZA 2K7FA 4Q7EA 1RRCA 3ML1A 1Z08A 5JSYA 4RY2A 3UAVA 1U5CA 3WHKA 4OMCA 2R6HA 4IDDA 4MR8B 1ZINA 2C5FA 2ZSBA 1KMQA 2VWPA 2XNDA 3T8YA 1H23A 2DUNA 2C3MA 3A2LA 1DG1G 3FETA 3I64A 1HT3A 4WZBA 1W5EA 3TXYA 3BRSA 4LRQA 4PLWA 4EGSA 2EFHB 4O4HA 4PHCA 2OP1A 1SURA 4JAVC 3T3HA 1MNQA 2GAFA 2C2XA 4GOND 2BJWA 2GS9A 1PNVA 4ZP1A 2A5GA 2JIBA 3WL5A 2BGIA 3IIIA 1Z8NA 3PA8A 2I1LA 3VU9B 3TIFA 1W5TA 1II9A 3ENQA 3QXXA 3G89A 3KOUA 4LBYA 5KC8A 5CIYA 3RC3A 3RRNA 2K6GA 1MABA 4YT8A 4P7GA 3DT8A 4KHPB 4IV5A 3NVAA 4Z4HA 3U61B 3L0PA 5AKHA 4H15A 4UPEA 3EASA 2VSXA 3PWZA 5TJ9A 3EIXA 4DPKA 4QE3A 2YWFA 5HRAA 1V7CA 4BXOA 3WMXA 2EG9A 1P1FA 1V41E 4O4JA 5L7WA 4ZZIA 1RXCA 1TNDA 1UC8A 4A0SA 4GKJB 1JTFA 2B21A 2JJ2A 3BWBA 4M46A 3QTTA 4IYRA 2X77A 3R3UA 4XQEA 5K8TA 4CKEB 3IERA 3O4HA 1SQSA 3IDAA 2ZANA 5BWNA 1NBMA 3BEOA 4DNQA 1W0CA 4HP8A 2A9VA