3TW8B

Gef domain of dennd 1b in complex with rab gtpase rab35
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
172
structure length
169
Chain Sequence
b'YDHLFKLLIIGDSGVGKSSLLLRFADNTSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DENN domain-containing protein 1B
publication title Insights regarding guanine nucleotide exchange from the structure of a DENN-domain protein complexed with its Rab GTPase substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 64
structure length 169
sequence length 172
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tw8B00
1NMZA 2ZRHA 4BFWA 4X8LA 1HURA 2FPLA 2IHBA 3IGFA 1HY3A 2QT0A 3NBFA 4XSHA 4B75A 1JXMA 3D31A 1N5IA 4NE2A 1WP9A 1ZW6A 1TNDA 2IHYA 4V03A 3AP3A 4DLVA 4JS0A 2YHSA 4GOKA 3AF2A 2Z5FA 1ZC3A 4HYYA 2ZJYA 3WP0A 3N70A 1FP7A 2ZR0A 3C41J 2O8BA 3RHFA 3UKDA 3BORA 2IYZA 1KI6B 2IT1A 4A0FA 4OQLA 1Z8FA 4AYXA 3KKMA 2W00A 3QIAA 4QBHA 3OEED 3TSZA 2RGXA 2NQ2C 2BMJA 2HDNB 3LVRE 2CDNA 5EP4A 3PCRB 4HZUA 4Z8YA 3TNFA 1KK2A 2Q3HA 3AGPA 3HU3A 3FKSA 2LKCA 2D74A 3NBXX 3MWYW 4CGZA 4KVGA 3EPLA 2HT6A 3A58B 3M1IA 5C46F 1E4YA 2ZR7A 3SOPA 2ZM5A 1XJ0A 2ZRAA 5BYJA 4LK2A 5FL3A 1IM2A 4RD1A 4KBFA 1JR3D 2BJVA 3LX5A 3K53A 3NH6A 3M4YA 3ZZUA 1KK3A 4RZUA 5EE5B 4PXAA 3N2EA 2EFDB 4XH9B 3QY0A 3VU9A 2C04A 4URYR 2UZIR 1A82A 5AJYA 2EWWA 2ODWA 2JA1A 2P3SA 3P32A 4AWXA 2F1RA 5FTNA 1N6OA 3VNUA 3RRZA 4JVNA 1YR8A 4DB4A 3IIMA 3W5JA 2XZPA 2DWPA 1ZUHA 2H7VA 2DY1A 2A5FA 2WMNB 4W5WA 521PA 1VCIA 4DLXA 2PMDA 4TL6A 3WNCA 3OE7A 4EJSA 1F48A 4OI0A 4Q02A 2AWOA 4IVQA 3QF7A 1L4UA 1A1VA 3FKQA 4KITB 4P4SB 1ZNZA 1A2KC 2J0UB 1KSGA 1OV4A 1YR9A 3NC1C 3P26A 4LDJA 1CR2A 2HYIC 1CR4A 421PA 5HZKA 4KO8A 4HLUC 4CRWB 2CK3D 2CL0X 4V0NA 3TIFA 2XXAB 3MG9A 2KSQA 1E3MA 3KX2A 3B9QA 5LD2B 4Z8XA 5KHOC 2GZDA 3CWZA 2ZRMA 1M7GA 2AKAB 4RD2A 2VYFA 2KBEA 4A92A 3ZDQA 3EPHA 1D2NA 1UBEA 1IXSB 1N0WA 2D2EA 1VTKA 2QEQA 3C5HA 2ZS8A 2QE7A 2L0XA 4LSGA 5FI0B 4A0RA 1DO0A 2W0SA 3QXCA 3BWDD 3WNBA 1XX6A 1BOFA 1SKYE 4ESVA 1T8UA 1VMAA 1J2JA 5DYIA 4ZI3A 4JJKA 4RCYA 1N5KA 3RSOA 4ESHA 4QJ3A 3GJ6A 4DSNA 1Q22A 2OZEA 2XTZA 1IY0A 2QT1A 4LBWA 5FPKA 3VAAA 2XSZD 1W4BA 1ZCAA 4IKEA 2E1RA 4LJYA 1DG1G 3K70B 1E2GA 2FPMA 2GEVA 1DARA 4XWKA 5E7JA 5AJZA 4LBZA 1G41A 4R7ZA 1NVWQ 5CYPA 2JLZA 2OFWA 221PA 4JLNA 3SHWA 3RRNA 3GP8A 3CONA 3U7GA 3KQHA 1E2NA 2QU8A 1G8FA 3KJHA 2CL7X 3D7MA 1WDTA 3BE4A 5JS7A 4MKGA 1VG1A 1E2HA 5GJVC 2REOA 3HPRA 3QSYA 4TQ9A 1MO3A 1TQ4A 5HE9A 1YRBA 3EC2A 5A5GA 1CR1A 3AKEA 3BD9A 1XBTA 4F91B 2QQEA 4IXNA 4I1VA 2FE4A 1EWQA 4IEIA 3KUDA 3MRSA 1QHHB 3QKRB 4F7WA 1QG4A 1FOEB 2AK3A 5DO9A 4E03A 5F9HA 1YHNA 1MKYA 1XEWY 3R9WA 1FMJA 3SJZA 1E2KA 2XOKA 4ASUA 4N3NA 3KQLA 5EQTA 3FMPB 2WKRA 1T3HA 5EP2A 1OH5A 3KKOA 2FV8A 5E3HA 3I62A 4URUR 1D9XA 4UNNA 2HXSA 2BJWA 2ZPTX 1R0ZA 5FTKA 1IOZA 2Q3MA 2H8KA 1JPJA 3MAAC 1OH7A 3QJYA 5TARA 1AIPA 4ZI2A 3NKVA 1XMVA 2R65A 4JBWA 2B6HA 5TY0A 2R2AA 2GK7A 4PO1A 5LPNA 2HLDA 1G6HA 2W2VA 2OFOA 5CYOA 4PO9A 2F6RA 2QPAA 4LJ9A 4LV5B 2B92A 4H1UA 3UWOA 1I4TD 3CNNA 4B3GA 1G3UA 2AKYA 3HP1A 4DIEA 4OI1A 4L4UA 3UMSA 3TVTA 1UKVY 5A4JA 2W6IA 1MO4A 2YOHA 3QKUA 3LLMA 1FNMA 1G17A 3SE0A 4PPGA 3OFND 5FPTA 2V7QD 1O3YA 3L82B 3PEYA 1KO1A 3RS2A 4OYHA 2QY9A 2X77A 1HEIA 3VR2A 4DT1B 1LNZA 5BYKA 2QM8A 4I1OA 2FDCA 1HV8A 3R20A 1P60A 4EUNA 4R2HA 3W34A 4AD8A 4GT1A 1KI6A 4IOJA 4OHXA 2GA8A 3GMTA 4R2IA 2KBFA 2ZRCA 4ZDJA 4EPYA 4HSEA 3CPJB 4KSBA 5CIWA 4DB2A 3U3KA 1FW6A 3LVQE 2FSIA 2QMOA 1E9BA 2BBSA 4XTCS 1OH6A 2HJGA 3CNOA 3TLXA 2J45A 4CEJB 5EJEA 4Q00A 3VKWA 5KU1A 5DI9A 2IK8A 3LNCA 3BAFA 2O8EB 1W4RA 2H57A 3GD7A 4OKSA 2GXQA 4M9QA 4C3ZA 2OO7A 2PX3A 3HWSA 1MH1A 4RZ2A 1G4AE 5EUQB 3B6EA 1GRRA 3SQXA 1DOAA 1SXJD 2ZI9A 1AA9A 3AH8A 1UPTA 5DHAA 2IUSA 1LV7A 1G6OA 1R8QA 5J5CA 3WY9A 1RC8A 2ERYA 4DLRA 4TT3D 2VPPA 3H1TA 4RKEA 2V3CC 1P9WA 4KV9A 3WHKA 1Z2AA 1N5JA 4UXIA 4D4JA 3DMNA 2JASA 4P3YA 4KFRA 1E1QD 1IN7A 1BMFA 3DZ8A 1V43A 1P7CA 2NO6A 4O3MA 3K8YA 4O25A 3GLGB 1II0A 2DHRA 2NPFA 5JWOA 3T61A 2C9YA 4MGYR 1AQYA 1KKLA 1VG0B 1YVDA 2C8VA 3IO5A 3U2QA 3W6NA 2C98A 2PL3A 4GI7A 2IL1A 4YDHB 1SZPA 1OHHA 2V8OA 1OXXK 3CO5A 4US0R 5FOXA 4R71A 3PUZA 3QXJA 3AVXA 121PA 4P4SA 3NXSA 3U3JA 3CF0A 2J0UA 4NP6A 5JEEA 5C1BA 2H92A 3A1VA 3LY5A 4LHXA 1AZSC 2QI9C 2VSXA 1XEXB 4M1YA 2JLVA 2XXAA 1NLZA 1S9HA 1W0KA 4LJ5A 1U81A 4B47A 1JAIA 1UDXA 2YWFA 3LX8A 2BBWA 1Z0DA 4I1UA 3GLGE 4L16A 3EXAA 2LKDA 5G53C 5JJKA 3I73A 3QBTA 2CLDX 4ZIRB 4AKHA 1SVMA 1Z0KA 2FPKA 4OQMA 4US2R 2GXAA 5JI2E 1T91A 2QMUA 1AQUA 4V0ME 3MUFA 2VF7A 1SGWA 5KPJA 4HAUA 2NOAA 2Z4SA 2ZJOA 1XXHB 1VKJA 1ZM7A 2YNMA 4RVCA 1GSIA 2BCGY 4MDEA 2GF9A 1SVKA 1LW7A 5HKKD 2GJ8A 1IJFA 2X1VA 2EVWX 4K8OA 4W5JA 4JL8A 2VP5A 1HT1E 1XF9A 1R7RA 5KSOA 1MRNA 1NF3A 4TL8A 4PTLA 2CVFA 3SU8A 2FFAA 1UBCA 3KJGA 2GCPA 4EFMA 1NNEA 3EG5A 3T5GA 2GEUA 2PZFA 4G5SA 4MRPA 1XMSA 4C7OB 4U5XA 4C0HA 2B7CA 2OUKA 3CPEA 2G77B 4MRSA 1II8B 1KMQA 1WF3A 2IUUA 1Z47A 1P2UA 3GLHE 2A5YB 3B1ZA 2J59A 1G8YA 3QKRA 1QHHA 2AXPA 4B2PA 4UNQA 3A8TA 1ELOA 5TVKA 2IS1A 1YR7A 4OHWA 2AWNA 1UADA 4JIMA 3A4LA 4TLBA 2ORIA 3CR8A 2J0VA 3JVUA 1CJUC 2KWIA 2DFTA 2OCBA 1ONBA 5E7MA 1XEFA 3AF0A 3AUYA 3EIQA 2ZEJA 4LHWA 1N0UA 1D8TA 1NIPA 1RVDA 1CJVC 2BEKA 4KYIB 2PT7A 3BJIC 4FWIB 1XTRA 1G9XA 1FFHA 4TQAA 5L3QB 3FGNA 5G3YA 3FPAA 4GZLA 1QHYA 3R7WB 4NBSA 2WJHA 3GJXC 2GK6A 3NG1A 2NGRA 2OBNA 2IYXA 5E4FA 1E69A 3QNUA 4CEHB 1UBGA 4BZPA 2E9SA 3ZZ0A 1LTQA 4BFVA 2ZI5A 2QAGC 4AK9A 4YXWD 5DN6D 2YKGA 1JECA 1RJ9B 3KUCA 3NC0C 3P1JA 2RGDA 4URWR 3RAPR 2WJVA 1NJFA 2B21A 5UKDA 3QG5A 3IUYA 1RRGA 1UFQA 2Y8EA 4NYMQ 1FNNA 1H8HA 3W3ZB 1TU3A 1HT2E 4UNSA 2O8DB 2KI5A 3P4YA 2GHIA 2BBOA 1NVXQ 3I32A 3ADDA 2ZI6A 2JJ2A 2PZEA 2RGBA 2ZJ5A 3SHFA 4LJ6A 4ZO4A 4DT1A 1IY1A 2WSSA 4D0NA 1MT0A 2WWGA 4LJ8A 4IEEA 3IQXA 2GF0A 4BLOA 3VFDA 4CYMA 2BHRA 3OE7D 2R62A 2VSFA 3QEJA 1DAHA 1KJZA 3FDIA 3LV8A 1Z0AA 2C95A 4JLDA 2CLCX 4CEJA 2IUTA 4JLPA 5BN4A 4URVR 1VDZA 2JDIA 1FTSA 2ZAOA 1PZNA 4ZCLA 2UVQA 2O8EA 1SKQA 4JYBA 2J1LA 2ZSDA 4B48A 1CKEA 1P73A 5HR5A 1CXZA 3QXSA 3WHLA 4IVPA 2XTMA 1ZD1A 1JPNA 1RKBA 2FFHA 2J9RA 4QBIA 1T0HB 3GEIA 5DHFA 4MKFA 4DLZA 1JALA 1RYHA 1EESA 3P4XA 5KSYA 4Q9JA 3SNHA 1CIPA 2ZJ2A 2QTHA 1ESMA 5HTKA 2ASEA 2BC9A 2O0HA 3WMFA 4B44A 2ZXUA 4ZDWA 1J7KA 3DDCA 1B0UA 4P0TA 4YLGA 3PEWA 3WYAA 4DCVA 2YZ2A 3CZQA 2W6JA 2QP4A 4TMTA 1ZNWA 5FFMA 3GLGA 2IS2A 3IEUA 3LD9A 1YZUA 2GESA 4LY6A 1Z0IA 4YMVA 3B1XA 2FA9A 2ZRBA 4PSKA 3ZGXA 1GWNA 2RB4A 1G19A 2WV9A 3EC1A 2CLSA 3Q85A 2WOJA 4PFSA 3QI2A 4QGFA 2WKQA 4TYQA 3IBGA 3OEHA 4AG5A 3QUSA 2C2HA 3GJ5A 4JLMA 5AUPB 1P72A 2R6GA 1JEDA 5EXXA 5HZHA 1XEXA 4QHTA 1HE8B 2NIPA 5CLLA 1KSFX 2LCFA 2YVUA 4ZCMA 3K09A 2QN6A 1I2MA 1GZSA 1RIFA 4DLYA 2XOKD 4JT2A 4LI0A 4MRVA 3PVSA 4ASUD 1KJWA 4EFNA 3AQ4A 3CR7A 3GLIB 4ZIRA 1XTIA 4JL5A 3ZD6A 4DLUA 5B2ZA 4IOMA 1W0JA 4JLBA 4DWJA 4RY2A 1P2SA 2PCJA 1X1RA 1DG3A 1RFLA 1XXHA 5GADl 4LWZA 2ZANA 3LBIA 4G1UC 4B33A 2IF0A 3PEVA 4NCJA 4WZBE 1OXUA 1P2VA 3AKYA 1XMIA 1HUQA 3PFIA 2FMXA 3T1OA 2HLDD 1NG9A 5HCIA 4ITRC 1EFUA 3I8XA 4IDQA 1XJQA 4KFUA 3F8TA 2GILA 2IEYA 4WZ6A 4QG7A 5AR1A 3VQTA 3O8CA 2J0QA 1S1MA 3DHWC 2ANCA 2ERXA 4YDSA 4C7OA 3GLIE 1P5ZB 1XCMA 3X1XA 2W6ID 2Z4RA 4QKQA 3REFA 3SQWA 1TADA 4BASA 1FUUA 1VCOA 1II8A 1TF5A 3WMEA 1Z06A 2AL7A 1L4YA 2WKPA 2AK2A 2QP9X 5CM9C 2NTYC 3K0CA 4A2WA 1T3LA 3SN6A 2RGCA 1OFTA 1XCGB 1N6PA 3H86A 1KDRA 3LQRA 3MGCA 3GFPA 1JXOA 621PA 3E1SA 3I3SR 4FW9A 2XJ9A 2F1HA 1QVRA 1YKSA 2Q6TA 4MYTA 4EKDA 2OXRA 1FPMA 5L3QA 3B9PA 4PHFA 3ZQ6A 4A6XA 1OKKA 4MYHA 4B76A 1DEKA 3DKPA 3R7WA 4C0SA 2A5GA 1DS6A 4CT4B 4TZ0A 4Q4LA 2F3RA 3A36A 4CEHA 1II9A 1T3SA 4TTQA 2FNAA 1RJ9A 2NZ8A 2D62A 1W48A 2GVDC 3IDQA 1Z2CA 4GPTA 4KSCA 3WBJA 4FD2A 4M1WA 2ZRIA 1IAQA 3DL0A 1XFAA 5FPYA 2GXUA 4ZCIA 1GKUB 2V4ZA 4NYJQ 1KAOA 4UJ3A 2O8DA 1N6KA 4LYJA 1N6HA 1ZUNB 5IRCD 3I72A 4ILEA 3FHTA 2WOOA 5JSZB 1R0XA 2EYUA 2GJ9A 3TQCA 1VECA 4DSTA 2CXXA 2VLIA 2WICA 4B6EA 2IYSA 4RCZA 4HLCA 1BH2A 1U98A 2GJKA 1ANKA 1E0SA 4CZ2A 1A7JA 4CIDA 4DCTA 2ZTSA 4NYIQ 1G3RA 1TL7C 2PEZA 3ECCA 4NL4H 5SZKB 1G8HA 5KPDA 2REBA 5CM8B 4V0LA 2C9CA 4QHYA 2Q21A 4BFZA 1RPZA 2BM0A 1W36C 3RC3A 2J41A 2A78A 1OXTA 1E2MA 4PAOA 1W36D 2EYQA 3KQKA 3UWKA 1W46A 1G291 1XU4A 4WBSA 3K0EA 3IKJA 2V1XA 5GJBA 4J0QA 2WJYA 3PR1A 1I4LD 1W0KD 1COWD 3ASYA 1H8ED 3OIVA 3TAUA 4TLCA 1ZM4A 5HE8A 4DCNA 3AKCA 5A0FA 2J7PA 2C96A 4YMTA 5IDVA 2IW3A 3L0PA 3AVQA 5FOUA 2CCJA 4ZV4A 821PA 4P32A 1OH8A 2ECKA 1XMJA 3K9HA 1WQ1R 3E2IA 3GJ3A 4OI2A 3V9PA 3W9YA 3IEVA 1D2EA 1S0UA 2OHFA 3LW8A 1U99A 2IYWA 1GL7A 3HDTA 5FUVA 3SYLA 1NJGA 1CULC 4W7SA 1WBBA 2YWGA 1AKYA 4M22A 1E9SA 1ZNXA 1NBMA 1WE2A 1E1RA 2VSOA 3THYB 4DEYA 3AP1A 1J99A 5JHHB 5FR2A 3K70D 1Z6GA 1ZUIA 3DVLA 3TAHA 2G1JA 4DC9A 1JQLB 1KI2A 2A30A 1H65A 1P9NA 2OFXA 2JIZD 4TYWA 4JSTA 4EIWA 2ZYWX 1PV4A 1R6BX 4MUBA 4OI4A 2CHGA 3R9IA 5JJLA 3CRMA 1UJ2A 4GRAA 4TN1A 5CITA 2J87A 3AVWA 4U7DA 3U61B 4M9SA 2VA8A 2A3RA 5EZ6B 5KUTA 1OB5A 4AKEA 5AJWA 1VIYA 1YZTA 4QBGB 2WPDA 1B23P 3WRXC 1OFUX 3PV0A 2GBLA 2ZRDA 1E9RA 1XD8A 2ODNA 1P2TA 1XEWX 1E99A 5EE0A 1DADA 1HH4A 4NCKA 2ODEA 4FCTA 1P75A 4S35A 5B64A 2YV5A 3QE0A 3GLIA 4RD3A 3HR7A 5C18A 3A4NA 1E0AA 3W6OA 3U44B 1OT3A 4D4LA 1IBRA 3U5ZB 5AJVB 4B35A 1MO6A 2OXCA 4OJKA 3WRYC 2QL6A 4X8HA 2PMKA 2ZVQX 3TH5A 4TMKA 8OHMA 1AN0A 5FH9A 2P5SA 3QVVA 1HQYE 3Q7PA 4HAXA 4M9XA 2IYVA 3TRFA 1IJEA 1S3GA 2VHQA 1G5TA 1WMSA 4UXJA 5FR1A 5C4GB 3UATA 1DE0A 4C9BA 1Q3TA 3AVOA 1Z29A 2AX4A 3GQBA 4U02A 6Q21A 2IC5A 4B2IA 2QTVB 4XJXA 2F1IA 3SYKA 4W9MC 2C9OA 5IF9A 2OV2A 1N6IA 1HYQA 4HB2A 5J47A 4TSFD 3A1UA 1IONA 1E94E 1QHXA 1U8AA 3NEJA 5DH9A 4C2TA 2ZI4A 1TTTA 3CX8A 1Y63A 2P6UA 1K5GA 2FWRA 2WMOB 3CIOA 2XNDA 2WWXA 5D3MB 4KU4A 2JJ8A 5G3ZA 1KY3A 3EA5A 4Q7KA 3UMRA 4DXAA 2JJ2D 4PQRA 1E2DA 1KHTA 4C0QC 1X8JA 4NCIA 2X2EA 4AI6A 2C03A 2BBTA 2HEIA 3CBQA 2XB2A 2KE5A 1MV5A 4PC6A 3CZPA 2FF7A 2GAOA 3PQCA 4AIIA 2Q9CA 4HDOB 4MYCA 4GDFA 3ASZA 1G7TA 3ZQJA 4BWYA 4DCSA 2VP0A 2H18A 3RS4A 3W5IA 4Q9KA 1TF2A 5D3QA 1X6VA 1GP2A 2OAP1 3QOFA 2YINC 3QXHA 1E0KA 2JDID 1NKTA 2ZSBA 4QRHA 3PENA 1TPZA 4PAQA 1FX0B 3O8DA 4Q5IA 2G88A 2XJ4A 3FFBA 1KAGA 1L2TA 4LC0A 3VX3A 3TGPA 5F3WB 4RFVA 3B1WA 4JYCA 5KDDA 3F5FA 3F0TA 2ZE6A 4PSAA 3EPJA 4Z51A 3LXRA 5FOSA 4BFXA 5TMPA 1XTJA 3SJAA 5CB8A 5CJ2A 3N5CA 3D3QA 3LA6A 2W83A 1JJ7A 1RE0A 4PSVA 1EFTA 3M6AA 3GJ8A 2RGNA 1TQDA 4OBEA 3KXIA 3KJIA 4B3XA 4KJZA 3AVVA 2G1KA 3EZ2A 3IPXA 4HB3A 4K81B 4Q1AA 5JSZA 1L7VC 1U9IC 1W1WA 2O8FB 1CR0A 1SVSA 2W6JD 2G6BA 5SZJA 4M4SA 3B60A 4LPSA 4XD7D 5EXTA 1XZPA 3W90A 2Q3FA 2RKOA 1FZQA 1AS2A 4JT4A 4HAWA 5FBLB 2F9LA 4FMBB 4DRZA 1E9AA 1TUEA 1LVGA 1VHTA 5DSZA 5JECA 2P6RA 3B13B 3OEHD 1S3SA 1CU1A 2UKDA 2QPTA 2B8WA 3SZRA 3IPYA 2R9VA 3IIKA 1KO4A 4QL3A 4GZMA 1Z22A 4B3BA 3U6BA 3BOSA 3OAAA 3EARA 1BYIA 1RYFA 2FN4A 2V54A 3KZ1E 1SXJC 3THOA 3NDPA 1ZRHA 1GKYA 1Z28A 3CF2A 1N6RA 3HJNA 1FQKA 2QZ4A 4CW7A 1JNYA 2ODBA 3OESA 2WZQA 4PPFA 3QKSB 4MRNA 5FPSA 5JBQA 3AVUA 2AD1A 1XPRA 2J3EA 5EP1A 5FL7D 3I8SA 1ZU4A 3OHMA 1U90A 3GEEA 3AVPA 4E22A 4HB0A 1CJMA 4E07A 5K8TA 1KGDA 1NP6A 3BERA 4N0DA 3MWKA 2VH5R 1E9DA 4PAMA 4X8OA 3V4RA 3HPQA 4Q4JB 2V1UA 2ZJBA 4CEIB 2LWIA 5IK2A 3T1TA 3I5XA 2DFNA 1UF9A 3THYA 3C15C 4Q48A 1X1SA 3LRPA 2GXSA 3C8UA 3MWLA 1HTWA 4KODA 4BZXA 3FWYA 1JEEA 4EQ6B 2GJSA 2OESA 2NPIA 5H70A 2V9PA 4B2LA 5M04A 1S8FA 1FQJA 3IHLA 4NPHA 2QUZA 2JLUA 4BRUA 5CDFA 3WBKA 5FOWA 3RC8A 2PX0A 2O0JA 1XD9A 3GJ7A 1WBDA 1AK2A 3ZS8A 3BXZA 2RH5A 3SBDA 5FTLA 1OSNA 2IWRA 3NBZC 1GG2A 3DMDA 2CHQA 1TEVA 4GFDA 2GCOB 3MSXA 4JMPA 2HXYA 5AK0A 1IXRC 4TLDA 1R2QA 1ZU5A 4GP7A 1L8QA 4PC3A 3L0SA 3R9XA 4PC2A 1YZLA 4L8GA 3T12A 1Y3AA 2BVNA 5FTMA 1G3MA 1UM8A 4BEBA 3RSLA 2IXEA 2VP4A 3I5YA 3SC3A 3KQUA 5IHPA 1KJYA 4GL2A 2I1VB 3QPUA 2WWWA 1Q1QA 2OBMA 2VL7A 3E70C 4A8JC 4EPWA 4RD0A 3U44A 3RABA 3VHXA 1K5DA 4HUQB 3BFKA 3EWSA 2WJJA 4DBLC 4I99A 1OKKD 3BFVA 4C0JA 1GL9B 1JB1A 3V00A 5EE1A 5KNDA 4V02A 1Z0FA 4O2LA 3TUJC 3THXB 4HAYA 3AUXA 3KB2A 4LV6A 1DAEA 4LJ4A 4Q01A 3CF6R 2QROA 2TMKA 2H17A 5L3SB 4Q1FA 1VCNA 2GDJA 2JJ1A 2QSYA 2YJTD 2AN9A 1XB2A 1XWIA 5DIFA 2ZYTX 4N1AA 1XNJA 3ZZTA 4BGDA 5SZHB 3U4QB 2QGNA 4D0LB 4HATA 1ZVQA 1S4QA 1ZIOA 4HZIA 3A4MA 2HJVA 3AV0B 4LHYA 1NN1A 2QSZA 1EFRA 1KSJA 3NEYA 5D3MA 2A2ZA 1TAGA 1XXHE 1WRBA 4LBYA 4Q9LA 2BKUA 4B73A 4F4IA 1HE1C 3L0OA 4Q7JB 1XTSA 4B71A 1RZ3A 2OCPA 3VX4A 3K9NA 2VIIA 4FN5A 1GFIA 2VBCA 5JZVA 5F2EA 3ZJYA 1NLYA 2GWHA 4QNMA 4JLVA 5JMTA 1VCMA 4LYHA 4DUGA 1ZBDA 3KXLA 2O8CB 4HLUA 4Q66C 1S1CA 2CJWB 3T1QA 2O0KA 4YQFA 4G5GA 3FKSD 4LPKA 3TUIC 4AC9A 3I92A 3AGQA 3I4LA 4PANA 4LCBA 4P31A 4FCVA 1G7CA 2XNSA 3R8CA 3L43A 4FMDB 3ZVMA 2N46A 5J4HA 2CBZA 2GEDA 2OM2A 2GCNA 4BZQA 2ZUDA 4PPQA 3IIJA 1FX0A 3ETLA 5FUWA 3FVQA 4RSGA 2J7PD 2IYYA 5BXQC 2XSZA 2R6CA 4PQFA 2PZGA 2ONJA 2X2FA 4LBVA 2XZOA 1KO5A 3R8FA 4CVNA 2OG2A 1GNRA 4C0AC 1QZXA 1P9RA 2B8TA 4QOSA 4DJTA 3CB4A 2IF2A 5JI3E 1G7RA 1OXSC 1K8RA 4A82A 2ZRKA 1GDDA 1NIJA 2WVJA 1Q57A 3L2OB 4BQSA 1E1RD 2DFLA 4DSUA 3EIEA 5K8IA 3K0SA 2O8FA 1AGPA 5FTJA 3ZYCA 1CEEA 4TLAA 3ZVRA 1XDBA 4EJSC 1CRQA 1GRQA 4QGGA 2VHUA 1YRAA 2BMDA 4M53A 4EPRA 4A0HA 3RYTC 4JVSB 1U94A 4XVQA 2D4HA 3HYTA 3TW8B 3MLEA 1ZNYA 4M1SA 4A0GA 2CL6X 4UNPA 3RS7A 3WXMA 4NKRA 5H8WA 3LDAA 2ZRLA 1R0WA 2FZLA 2X8AA 2OCYC 4G3XA 4QM6A 3NTUA 3TSOA 5JCPA 1OW3B 4B3DA 1FUKA 1KMHB 2WTUA 4MH0R 3QENA 4D2IA 2ZR9A 3QKSA 1R0YA 1ZM9A 2QE7D 3AEZA 4ARZB 5KNCA 3AM1A 4U00A 3FB4A 1W5SA 1IXZA 2BEJA 4QJ4A 3VR6A 4ZDKA 1NMYA 1ZMXA 2AR7A 2YC4C 2H5EA 3CPHA 1CS4C 2WWYA 4GSYA 4NCHA 2XZLA 2RGGA 1KTVA 4URZR 3REGA 1T0JB 4JL6A 3TKLA 2P0EA 3GLFB 1IN6A 2KB0A 4HDCA 2PEYA 1EX6A 3BIFA 3FHOA 1MOZA 2PH1A 4Q4JA 2QAGB 3EZFA 4CEIA 5L8VA 1XD2B 2FG5A 3W8NA 4HEJA 4NU0A 1KOFA 2Z43A 1AS0A 3RLFA 2BDTA 3S1AB 4C0KA 3AVYA 3OF5A 2P5TB 1XTKA 5FBQB 1M1YE 4EQ6A 1GITA 1KNQA 3Q5EA 1G3IA 3OFNA 1LFDB 3QEOA 4LYFA 2DBYA 2V7QA 3NIBA 4M1TA 1AS3A 4TLEA 4I81A 4KLZA 3FHCB 1G16A 3I61A 4XWOA 2AFHE 2PJZA 2V6IA 2QENA 5K8LA 1N0VC 3NDBB 3A1WA 3N2IA 1OIXA 4KFTA 1ZINA 4XTRA 3RS5A 3T34A 3TMKA 4D81A 3A1TA 2XGJA 2AD5A 3E5HA 1Z83A 3RRYA 1AZTA 5GJWC 2XNDD 3WNDA 2R6AA 5FI1B 2IS6A 1M2OB 2W0MA 4Q18A 1NBME 2GCOA 2FOLA 2VTKA 4LGMA 3TBKA 4GMXA 1KNXA 4WXRA 1R5OA 4WVFA 3KL4A 1EFCA 3UPUA 2WWIA 2OLKA 3SDZA 3BH0A 3D8BA 4MGKR 1PJRA 2C78A 1NLFA 1T5LA 1K6MA 2ZVPX 4LJ7A 3BRWD 4FINA 4M8NE 2RGAA 1TU4A 4FMDF 1U0LA 4Q1CA 4RFSB 4DDWA 1F2TB 2YWEA 4HUQA 4A2QA 4DVGA 1PLJA 5JWHA 1KDPA 2F43B 2F1JA 1PUJA 1UEJA 2HF8A 4BLRA 2W58A 2WIBA 2OBLA 5JLJA 3KXKA 1OXVA 3QG1A 2R44A 4C30A 1T9HA 1E96A 3THXA 3FTQA 4XWAA 4MKHA 2REXB 4MRRA 4TT3A 1TX4B 4L9SA 5EP3A 2IYQA 3K9LA 2PT5A 1M74A 4L9WA 5FOTA 4MDFA 1OE0A 5L3SA 4V0OA 4FXPA 3SFZA 3VKGA 3PEUA 5J4KA 2GZAA 2EFGA 1GOTA 3TK1A 3U4QA 5KDOA 1OFIA 2G0TA 1CBUA 3OIWA 4M21A 4NCNA 4JLKA 2YOGA 2R6FA 2ZU0C 3DPUA 3KKQA 4A15A 4F4CA 4D25A 1I2DA 1ZJ6A 2BMFA 3AP2A 4WAUA 3GFTA 4XOIA 5FBVB 1ZM2A 4M9ZA 2O5VA 2CNWA 2V6JA 5EUMA 1BIFA 2DWQA 3TSWA 2HCJB 1M8PA 1FMLA 2FFQA 4H9GA 4PZZA 2IBMA 3LW7A 4M1OA 2YC2C 1Q12A 1VYVA 3TW4A 1JAHA 1EGAA 1OB2A 4ZDIA 1DVRA 2OT3B 4NTZA 2Q9BA 3L0IB 4G5OA 3TR5A 3AF3A 5KSZA 3L8YA 3UG7A 1E79A 1GNPA 1KI8A 2IX3A 3H0KA 2O8CA 3IBYA 1OIWA 2RAPA 1DAIA 4GP6A 2CJWA 4PHTA 3U3OA 3PIRA 3EZ9A 4Q9IA 1OFHA 4GMDA 4MGIR 3B1VA 2HCBA 4NYMR 3MJRA 1Z07A 3FYHA 4F4JA 4JVMA 3BB3A 3ADBA 2GZHA 2ZE5A 1FL9A 3SBEA 1D9ZA 3B78A 2Z83A 5DLQC 4I1SA 4FIDA 1YZQA 4M2LA 3OAAD 3CW2A 4OL0A 4ZPXA 2JLXA 1AKEA 4RD6A 5CK5A 1X8LA 2ZE7A 2XTNA 1NRJB 4IJMA 5DE3A 3VHLB 3B1YA 3MFYA 2FSFA 3SFVA 2VHCA 4OQXA 3THWB 1LF0A 2AXNA 4P4TA 3O47A 4FMCB 4LZZA 2Z6VA 5ELXA 2YOFA 1XJCA 5FBRB 5FPHA 3EZ6A 2QBYB 1J70A 5J4YA 3NHBA 1DAGA 4R9UC 1U0HC 2EQBA 1N5LA 1U2RA 2GKSA 1G3QA 4RZXA 4QHSA 1RRCA 1BMFD 4IDOA 1GNQA 3RANA 4IVRA 1M7HA 1T6NA 5IK2D 2ORVA 4POAA 2XITA 4LJAA 1F2UB 2ZRNA 1YZKA 2VHTA 3TE6A 4GOJA 1F3OA 4LRWA 1UKEA 1NVVR 1T8TA 4GOXA 4H1VA 2WWFA 3WP1B 1E9CA 2JLYA 4PX9A 3MD0A 1E9FA 2FFBA 3MCAA 4Q4AB 1OHHD 2JLRA 1BKDR 3MMPA 4DDVA 721PA 2ZE8A 3CRVA 3HR8A 1NN0A 1YE8A 5F98A 1TUIA 4IOKA 1KYIA 3SEAA 1XZQA 4JJZA 3ND9A 4A36A 5CIQA 2ZRPA 4P4UA 2W2TA 4GNKA 4C4PA 3FMFA 4OJQA 1KI4A 5LD2C 3VR5A 1LB1B 4M1MA 4QC2A 2JGNA 3LO5A 2IS4A 3LBNA 4WA7A 3HU1A 1KMHA 2ATVA 4IDHA 5JWRA 2JATA 2ZIAA 1GUAA 4ARZA 2RHMA 5DI3B 4HI0E 1ZC4A 4TMVA 1N25A 4PO8A 3U7FB 2ZUCA 1SVIA 1P62B 3CWQA 4HB4A 4TYYA 4O0MA 2OSBA 1NSTA 4TMXA 3GLFA 4YXWA 4YMUA 5DN6A 2GETA 5TXGA 3Q5DA 2I1QA 4KFSA 3BFXA 3K70C 2QAGA 4IXMA 4OHZA 1XD2A 2WSMA 3K0FB 4KXFB 4BE7B 3S1AA 4BUJA 2MSEB 5TDHA 1IY2A 2WM9B 4IHQA 5KYKA 5C2JB 1XP8A 2KJQA 3CLVA 2J0SA 1QVAA 1YU9A 2JJ1D 1CJTC 3PUYA 3LH5A 3PXGA 3ICQB 2WAYA 5TB5A 4NHOA 1KKMA 4O2RA 3KFXA 3VR4A 5LDDC 4JVLA 5KO2A 1W44A 1Z0JA 3BK7A 4C0BA 2C5LA 1EFRD 3CNLA 3LWNA 3KDSE 1VHLA 4D0GA 2WWHA 1SKYB 2D06A 3G0HA 2HYDA 4LX0A 1J90A 1P6XA 1NMXA 3WYFA 4A9AA 2A7QA 2GAAA 3GJ0A 1CP2A 4N0EA 2VQSA 4UQOA 5EE3A 4BEJA 5JEDA 1Z3IX 1G7SA 2DYKA 2ZJ8A 4D26A 1Q20A 1OYYA 4D6PA 1W36B 3EIHA 2QRNA 5J4VA 5JHGB 5AJXA 3T15A 4IOLA 4RKFA 2IXGA 4DUGD 5CDFE 1DBSA 1DAMA 1KI3A 3DEFA 5AWFC 1VYUA 4RFSA 1F2TA 1DELA 1J8YF 4YMWA 2F43A 4ON9A 2MSDB 3EX7C 1OJLA 2WIAA 2X19A 3SI7A 3UXMA 4A1FA 2CMKA 2NO7A 2ZETA 5DISB 2SHKA 4UNRA 4BRWA 2J5XA 5CB6A 3LAWA 1PLLA 4FMCF 5GJCA 4TZ6A 4WZAE 2OLJA 3TUZC 5TV2A 4K46A 4Y0AA 3VMFA 4AYTA 4Z54A 1YJ5A 3VR3A 2BMEA 4B6FA 4MUAA 5DGXA 4JLOA 4Q1BA 4QFMA 4OQFA 3NVAA 4BLPA 1YQTA 1H8HD 4OHVA 1SHKA 3UIEA 3LBHA 3BB4A 1Q1BA 1EK0A 5HPYB 3X1DA 3DM9B 4EFLA 3TR0A 5LB4A 1ZYUA 4LV8B 1E32A 1N6NA 1JR3E 3KB1A 1CLUA 1EX7A 1G8PA 1I4DD 1RW4A 1G5RA 1TQ6A 3ZS9A 2BOVA 1NVUQ 2VRWA 2WSSD 3F3YA 3P20A 4IRUB 1VYTA 2HUPA 1W5TA 4EDHA 4DZZA 2GNOA 3A37A 4DCUA 4ACAA 4CT5A 2O8BB 2DCUA 4PHHA 3IQWA 4WW0A 4D4MA 1QHSA 3CX6A 1OIVA 3H2YA 3O8BA 1QG2A 2JCSA 3ZH9B 2D2FA 1MO5A 2EW1A 4EAQA 2QNRA 4BLSA 2HF9A 1MR3F 2GVZC 3RVBA 5J40A 1QBKC 3DZDA 1LY1A 1F5NA 4MYUA 3K0AB 4NYJR 4AURA 3X1ZA 4IDPA 1JI0A 2EFCB 2RGEA 5EXSA 1QHGA 2NO9A 1KY2A 1T4GA 3NWJA 3T35A 1D5CA 2CE7A 3KFVA 4ZKEA 2JLQA 3DO6A 4DDTA 2ZRGA 1YZGA 4HLQB 3THWA 1AGRA 2QRZA 2GTPA 2MMCA 3OIYA 3U7EB 4B3CA 3EWAA 3LXXA 1G18A 2OAQ1 4HDQB 1Z6AA 2QBYA 1R5NA 4NYIR 4Q47A 4Z1MA 4LC1A 3EAQA 4TWZA 3SYNA 4EPTA 1OPXA 2G83A 2B7BA 4QXAA 5KNBA 1KK0A 3A6PC 1BYUA 4D80A 1G1MA 2ORWA 3B82A 1G5PA 3PUVA 1GRNA 1Q1ZA 3VTKA 4PQYA 5KOYA 1GTVA 1EFHA 1F2UA 2W2XA 5FOVA 2ANBA 4MITA 3G5UA 3AB3A 4S2EA 2J7KA 3T5DA 4AY2A 2NZJA 4BFUA 2CCKA 1VG9B 1Q1EA 4QM7A 4Q4AA 3TJZA 3AF4A 1NKSA 3UANA 2I4IA 5FUXA 5CK4A 2ONKA 2CHVA 1F60A 5CJPA 2JLWA 3VR1A 1S96A 4A6PA 1XTQA 4UJ5A 2VP2A 3ZIAA 1KSHA 2F7SA 1ZD8A 1U0JA 4IFEA 3SS8A 1GILA 3CUEF 2G3YA 4FI3C 4TMZA 3K09C 3NH9A 1DO2A 4WXPA 3LQQA 3RS0A 1CTQA 1UDWA 5IT5A 1HQCA 1CRPA 3BH7A 1M34E 2CVHA 2XAUA 4RJLA 3QF4B 5AUQA 3DOFA 4US1R 5DI3A 1OF1A 2QA5A 5GVRA 4UXHA 1N2CE 4KCGA 1FTNA 1W0JD 1E2QA 5B30A 1E2PA 2ZREA 3J81k 3BBPA 1QHIA 3UK6A 4DLWA 1VPLA 4BLTA 3X1WA 2FEOA 2VHJA 2BKEA 1CF4A 2NMVA 1P61B 2BCJQ 4B3FX 3D6TB 3PUWA 3IILA 4JKIA 3K0FA 4XSGA 5H68A 2FEMA 1ZCBA 4ZKDA 3Q7QA 1VG8A 4NONA 3U6KA 3EPKA 2IWHA 2ZUBA 2PLFA 3QKTA 4ABYA 5JRZA 1NG1A 4B74A 3VKHA 4I4LA 4HAZA 1RRFA 2N42A 2O52A 3KJEA 4NH0A 2BIFA 4Q9HA 4C0LA 4G5RA 3KKNA 3C16C 3Q3JB 3QBVA 2EWVA 4LYAA 2HV8A 3ADCA 3FMIA 2IYUA 3TVDA 4KLNA 2ZSFA 1R10A 3OEEA 5JFGA 3K0CC 1WA5A 1ESNA 1Z6XA 2BV3A 2CNWD 4RD4A 4DSOA 5J4LA 2NG1A 1JBKA 1GKIA 1T5IA 1O87A 4L5BA 2J46A 1UAAA 3Q9LA 4XIGS 2EFHB 2OILA 3QXXA 2DB3A 2MSCB 4X8MA 4DLSA 2A5DA 2JAQA 2F9MA 3BH6A 2ZYVX 5H1YA 3EW9A 4KVAA 1XRJA 1E79D 3U60B 4Q7MB 2ZAMA 4G01B 2ZJZA 3A1SA 1AM4D 1GL6A 1KIMA 2CCGA 3Q72A 3SJCA 1COWA 2VP6A 1SXJB 1H8EA 1TF7A 2DR3A 1JR3A 4TL9A 1DAKA 3U7HB 3BS4A 1XPUA 1US8B 2WJIA 3CRW1 2QGZA 4PC7A 3FOZA 1UKYA 1QDEA 3ZLJA 2QQ0A 5P21A 1RRPA 2WAXA 5B57C 1ZD9A 1IN4A 3IO3A 3CH5A 2QG6A 1DAFA 1G64A 3GLHB 2ZRJA 3ONWA 3ADKA 1V5WA 2ZROA 1R8SA 3OIUA 4DKXA 2C77A 4CF7A 5DYGA 4F93B 1KO8A 1ZM3A 4DHEA 4PHGA 4D4KA 4UKDA 1JQJC 3PUXA 4D82A 1SXJE 4CDGA 2JIZA 4YC7A 1ZP6A 1U8ZA 1JJVA 1P4SA 1E2JA 2DPXA 2VO1A 2QMHA 4F92B 4RZ3A 2GJAA 4R98A 4DDUA 1JR6A 3AKDA 4E09A 1GIAA 3RRMA 4IFBA 1XCPA 3QQ5A 1HA3A 1UEIA 2Z0MA 5E7IA 2CK3A 2XB4A 4JSYA 3RS3A 2RHDA 3KTAB 3W8RA 2FGJA 5SZIA 1Z63A 1F6BA 1KO7A 1SHZA 2ZYUX 5BWMA 1BS1A 3AF1A 2BWJA 2A5JA 1W49A 3CH4B 2DFKB 4AG6A 1SVWA 3GJ4A 4OK5A 4Q4HB 1WCV1 2C99A 2E87A 4M1KA 1S2MA 3ND8A 3K0AA 2ZRFA 3H84A 1NSFA 4L15A 4MKIA 3RDPA 4PPNA 5LB2A 3TQFA 4BFSA 4Q03A 4QJ5A 3C14C 3X2SA 3C5CA 3LLUA 5KTYA 4G5QA 4KBGA 1KDTA 5C4MA 1MABB 2IA5A 1BO6A 4TYPA 5FUYA 4BECA 4A8JB 1W4AA 5EE9A 1SVLA 2AFIE 1KI7A 2FGKA 1QRAA 4HAVA 2CEAA 5F9FA 1S9DA 4HLDA 3ZVNA 3EA0A 4HUTA 3UG6A 1UKZA 4URXR 3GFOA 1CJKC 1W2GA 1N3BA 1Z5ZA 5E95A 3SR0A 3PITA 1E2EA 1NN5A 3QPWA 2YWHA 2F3TA 3M0EA 4Q19A 1Q0UA 5CLQA 2QM7A 3KKPA 3MWJA 3ZVLA 1NBMD 3FFAA 2FZ4A 5BN5A 4Q1DA 1XPOA 3WYGA 1G4UR 1M7BA 4QBFA 2QPOA 1J8MF 4JZKA 2PCLA 5EXPA 5AUOB 4TSFA 5L3VA 4B32A 1IHUA 2WBLC 1N6LA 3O8RA 4A4DA 2VF8A 3T1VA 2G0NA 3B7GA 3GEHA 1C4OA 3CKLA 1DPFA 1NY6A 3CM0A 4GBMA 4PZLA 3EZ7A 5ANRB 1E2FA 1C1YA 4PR0A 5BW8A 1E6CA 2D7DA 4G0NA 4KHZA 2IYLD 2GBLC 2WPDD 2ZQ5A 4V0KA 1W47A 4F38A 2ZSEA 2RMKA 3HYRA 4HZUB 3SJBA 4FCWA 3IHWA 3JZMA 4JLJA 4LOAA 4KI0A 2IEZA 5G41A 1IN5A 4OHYA 4Y0VA 3ZD7A 3PJRA 1YR6A 3QF4A 4QGHA 3DOEA 1EXMA 4WOPA 5EZ5A 4TQUS 4B43A 2Q0HA 5K8UA 2VP9A 2QAJA 1SQ5A 1Z6TA 5JS8A 4QGAA 2IYRA 2D7CA 2OE2A 2V55B 4TL7A 4QNRA 2OEPA 1TQ2A 1NVVQ 4NZYA 4PZYA 5JCZA 1Z6YA 5BQ5A 3U3RA 2K5UA 3FE2A 4E5UA 1NY5A 1M6NA 4NMMA 3U3MA 4FWTA 2PJRA 2P2LA 4XVUA 3C4JA 2RCNA 4JBYA 2N1BA 3X1YA 1IN8A 1LF5A 1Q3HA 3Q8XB 3CRRA 5LBIA 3VU9B 2QTFA 1SVOA 2XEXA 3AVTA 4YONB 3FMOB 1NI3A 1E2LA 2AHOA 3JZAA 3OZXA 1GM5A 1Z08A 4IDNA 5G40A 3UMFA 4WIAA 4ACBA 4YMSA 1E9EA 3W3AA 3ICEA 4JKYA 3RNLA 1SULA 1U9IA 3G82C 1E2IA 4P33A 4XD7A 1R4AA 3PG5A 4JLAA 1TEXA 4LUCA 3GLFE 2OCAA 4OK3A 4EJSB 2F55A 2FH5B 2HT1A 2P6NA 2PBRA 2CE2X 3BB1A 1E4VA 4BPBA 1Q21A 3B8HA 4V0MA 5B58C 2XX3A 5GVSA 1E0JA 1MRSA 2P65A 2QMEA 3H4MA 4EPXA 1LS1A 5AUNB 4MGZR 1EWRA 1Q44A 1QF9A 3CX7A 5HCNA 2ZI3A 2QP3A 5L3RA 3KQNA 4ERNA 1IQPA 1A4RA 1U8YA 1G8GA 4Q21A 4DIDA 1A5TA 2ZITA 1SXJA 4XVRA 3W6PA 2NO0A 2R6DA 5BN3A 1ETUA 1X3SA 2D3WA 3GPLA 4IW3B 5JJIA 2ZJAA 1US8A 4KYUA 4MA4A 1KZGB 1ZIPA 3MJHA 4LHZA 3P27A 5FL7A 1NL3A 1W2HA 3V4FA 4TYNA 3K1JA 3DKVA 1KZ7B 1D2MA 1ODFA 2EU8A 2WJGA 2FSHA 3EASA 3GLHA 1PLKA 4Q7LA 1E1QA 4M0LA 4DEXA 2MMGA 2YYZA 2A9KA 3B85A 1D6JA 2QORA 3JVVA 4LHVA 3L8ZA 2JLSA 2RGNC 2H1LA 4Z1MD 1G20E 4TTRA 3T06B 2ZS7A 3C7KA 4OK6A 3VNVA 3LFUA 1A2BA 4W5HA 4BLQA 2ZS9A 3B2EA 1C9KA 1FP6A 3HU2A 4DLTA 1PUIA 4Q1EA 5KDLA 3BGWA 2PLRA 3DM5A 1DTSA 2BM1A 1KI1A 4C2UA 2FSGA 1UBFA 3I1FA 3NBYC 1GVNB 4BFYA 2EFEB 1LS6A 5FBWB 2I3BA 2ZI7A 4PC1A 3NHAA 3KTAA 3WMGA 3QVUA 4TTPA 1WXQA 4JBXA 4NDZA 1VIAA 4B34A 4KAXA 4MQBA 1YZNA 2DWOA 4OQNA 3BC1A 4Q4HA 1KDOA 4II7A 2IXFA 2ATXA 3ZIAD 2Q9AA 4BFTA 1KI9A 1OLOA 3CRQA 1P3JA 1KK1A 3B5JA 4AKGA 4TMWA 2FU5C 1X8KA 4A2PA 1R5BA 1EG7A 2GRJA 2UZ3A 1W4CA 2P67A 2WHXA 1MABA 4EPVA 2FJUA 1W7AA 2FX3A 4A8JA 1X86B 3RWMB 5JRJA 2R8RA 1G21E 1ZAKA 3GCGA 4AKIA 1WB9A 1QHNA 1GAJA 3RWOA 5DNYB 1E98A 1OYWA 2JEOA 2G9NA 5HKKA 3K9GA 3QPVA 2NO1A 1AJEA 4AYWA 2VEDA 5KSPA 1PVOA 2H16A 1NN3A 1TMKA 2ZU6A 2ZSAA 2IYTA
chains in the Genus database with same CATH superfamily
1NMZA 4JP8A 4L78A 1C4XA 1NTOA 3HXKA 4C2AA 3RBXA 1NOJA 1VKOA 4XSHA 1KAMA 1DFGA 3DUWA 1NRXA 3B20A 2EDAA 2MOKA 1P3DA 5DLPA 3BRQA 1FNDA 3F7NA 3EGXB 4GYKA 1BW9A 2AJTA 5TPWA 4BC0A 4QDZA 5HCUA 4IHKA 4ND6A 2C2GA 5HM8A 3LCMA 4UNIA 3C3XA 5EWMA 4V03A 4ZEMA 4XD2A 4Y1EA 3TECE 1ZOOA 2OP1A 3G5MA 4YFVA 4ZN6A 5MGNA 4QYIB 2GN9A 1U3UA 2ZJYA 2YHIA 1P77A 3N70A 3GDFA 4W5OA 2ZR0A 5IN5A 5B3AA 1FZTA 1X7GA 3RHFA 2C7BA 1GPAA 3P2MA 5HYVA 3BORA 1S8OA 1NVMB 3HI6A 4OQLA 4I1YA 1K6IA 5B7QA 2QN1A 2JFPA 4MVXA 4JI8B 3OEED 4JUFA 4F9GA 2JFUA 4N5HX 1YBFA 2D0OB 1NJ1A 2HDNB 2NQ2C 2CDNA 3NUZA 3R6DA 5EP4A 4YGXB 4KDEA 1VA4A 5EERA 5TPZD 3RK0A 4C21A 1CYEA 1KK2A 1XN1A 1BH6A 2BGUA 1CX9B 2I4NA 3BG5A 3HU3A 2ECQA 3ITEA 3L1HA 1OFVA 3ME5A 4UE2A 4BVJA 1BHJA 3RFTA 4DBZA 3MWYW 1EG2A 1FFSA 4MVJF 4I6JA 4YQZA 3A58B 4YX9A 3M1IA 3TR6A 2ZR7A 2VHXA 3R2JA 1GPH1 1U0RA 3SOPA 1Q11A 4KTTE 1N2HA 2B4QA 5IJZA 2ZM5A 5FP0A 3TDNA 5ALJA 1R6DA 3F7TA 3FZYA 3WQBA 4BNJA 5KQLA 3IVAA 2OV4A 2CUKA 3NT4A 5KYWA 1KVQA 3EN0A 3WWEA 4EMSA 3GVHA 4BZZA 3JWPA 1USUA 3NH6A 3MMSA 4UMEA 2OHJA 2XBLA 4UBKA 4CETA 2NZYA 2CV2A 3T3IA 5KX5B 1QQTA 2FG7C 1VKHA 3R76A 4D9MA 4ZI7F 3H83A 5FNVA 2OBYA 1UC9A 3AFMA 4J6FA 3VU9A 3U16A 3IPAA 1I1QB 1XDZA 5AJYA 2ZIGA 1MDFA 5H4HA 1XLUA 1B0PA 2EWWA 4NXNB 2P3SA 1RR6A 3P32A 4FLMA 4EG4A 1K6XA 1I2BA 4IJWA 4LNUA 3HKBB 5D6OA 5FTNA 3UGTA 5JD4A 1YFZA 4JVNA 5IH3A 1IU9A 2WA1A 1TUBA 4H6XA 3T3OA 3IIMA 4PQGA 3BSFA 2PG3A 2WMNB 2DY1A 1FQOA 2LD4A 3DFUA 1U7TA 2QRJA 3JWJA 4NK5A 4UPVA 521PA 4DLXA 2AG5A 3EK2A 3AM4A 1KU0A 4L7QA 3OE7A 3HY6A 3G1UA 5AOVA 3WZ2A 3N2NA 5FV4A 3BCRA 4MQMA 1D8AA 5SYMA 1ZD4A 4TSKA 4G4SO 3DYIA 3FKQA 3E9EA 2CUZA 4P4SB 2IJGX 2GKGA 7REQA 2I3AA 4BO8A 1EJBA 3P26A 4XE5A 1T5DX 5FA8A 4IUDS 4TUYA 3O2QB 1XHLA 4KO8A 2CK3D 2CL0X 1O9BA 5DP1A 3TIFA 4IIEA 2VJLA 1LPMA 1T9AA 2ZPAA 3MG9A 4QUAA 2BZ0A 4DDHA 4WZBA 5LD2B 4J3FA 3OEWA 3ZV3A 5KHOC 5DGTA 3CWZA 1YQDA 2AN3A 3OEYA 2HNKA 1TOAA 1LFAA 1TO6A 1XVLA 2AJCA 2GLXA 2I76A 3WLMA 2XY4A 2WUWE 1E64A 3LJKA 3T5MA 1IXSB 2D2EA 3C5HA 2QEQA 4H7HA 1ADGA 4A0RA 3QVGA 2W0SA 4CKBA 3BMNA 4EGFA 3BWDD 4HGNA 2PAFA 1BOFA 1SKYE 3WAJA 1A69A 3CTPA 1XXLA 1DIBA 4UU1A 1BQ3A 1QFXA 3V6LA 1IE3A 4AF6A 3H9QA 1P0QA 4LF7B 3GVPA 3FRIA 4QJ3A 5IZCA 4DSNA 1JB9A 4QLAA 2OZEA 2PE5A 3F78A 2QT1A 4RV5A 3W5UA 3WGKA 5HGXA 3LSTA 3F1LA 2CLMB 3DCNA 3VAAA 1RBMA 4P7KA 1YASA 5LYJF 4FOTA 4E5DA 4LJYA 4UBOA 5K0CA 2P4UA 1SHUX 3C74A 1M76A 1URPA 2GEVA 1DARA 4Z0TA 4XWKA 1J07A 4RHCA 3MJEA 2FJPA 1G41A 3W9SA 5HA5A 1IUOA 1DKPA 2PSEA 4JLNA 5AW7A 4H7JA 1D3AA 5BSMA 1E2NA 1EFVA 1Z36A 2QU8A 3KJHA 4X3CA 2WY2D 5JS7A 3BE4A 5E6UB 2X0NA 3E0XA 1VG1A 1HNNA 1RWXA 5FO1A 1ORTA 2K87A 4XR9A 3T7DA 3TL6A 2I2CA 5LP6A 3QSYA 4L3WA 1PS8A 1UMKA 1TQ4A 3O7MA 4UTOA 1Y3IA 4C6SA 5B6PA 4RLSA 3BD9A 1ZXBA 1L5HB 3KOYA 2QLMA 3FR8A 3D3JA 2D2XA 2WI8A 3PNVA 2AI2A 4PYMA 1RPNA 4IEIA 2DHQA 4OXYA 1JT2A 3GH3A 3QKRB 1QFJA 2AK3A 1FOEB 1P0FA 5DO9A 4M76B 3A1FA 2XMZA 2OFPA 1C30B 1I4OA 1LDEA 2FSSA 3AESA 3H4TA 3LBFA 4RVSA 5G0TA 2P35A 4EVRA 5BVHA 1FMJA 1E2KA 1SWVA 1SUFA 2XOKA 3K1TA 3OJWA 3ZWVA 4H15A 2YN4A 4N3NA 4BX8A 5AVZA 1XPJA 3IA2A 5EQTA 1XVVA 2GFHA 4CL0A 3VISA 3KKOA 5E3HA 3WKEA 4BVHA 3FPHA 1GKKA 1LGYA 3HG7A 2HXSA 1P1IA 4UNNA 2BJWA 2ZPTX 4XPZA 3IEXA 3L4JA 2B2XA 5FTKA 3JXEA 3G88A 1JPJA 1XEAA 3DLAA 3QJYA 3CFYA 4IY1A 3HBLA 2Y1LA 1Q2XA 3DUFA 1KJ8A 2J3IA 2ZKIA 3T1NA 3JQGA 2HLPA 3BWEA 3VR6D 2J3MA 1KERA 3RFCA 1QMPA 5L7TA 1PFWA 3EVCA 5DZSA 1TYEB 2VSQA 2VNHA 3MWEB 4KIFA 1MA0A 3LE8A 1T1IA 1MGOA 2GK4A 4G1EB 5CFRA 1PGPA 4PO1A 2R5FA 3FRHA 1CEQA 3H05A 1G6HA 3FNFA 2EX4A 3IAHA 3ND5A 5BNTA 1GZDA 4PO9A 2AFRA 4D98A 1O4VA 2F6RA 2QPAA 1N2OA 2ZAYA 4P92A 1I4TD 1QNFA 2DECA 2A67A 2EP7A 3CNNA 3PYXA 1G3UA 3C8DA 2I1WA 4TMYA 5JANA 3GP3A 4L74A 5HIMA 1TIKA 4DM7A 4FDVA 4L4UA 2HMUA 3UMSA 3TVTA 1OMOA 2W6IA 1SKBA 2WJZB 3A27A 3L0YA 3C98A 3EIFA 2RHGB 3O2SB 5G1PA 3RVJA 4DPMA 4PPGA 5AKIA 3KOMA 2VK1A 3TG8A 1UDCA 1DXOA 2HTFA 2AV6A 3GLVA 4FZJA 1O3YA 3L82B 3LL4A 4MJ7A 4RSHA 1XAHA 3EAGA 5EKXA 1E3IA 1RC0A 3RS2A 5CT4A 2QY9A 3HNOA 3PRHA 4FYWA 4F4UA 1WSWA 1DZIA 1DV1A 2YX1A 4P35A 3NYQA 4QRIA 3L07A 4DFDA 5BYKA 4KIJA 3TQOA 2DPHA 1YJQA 3WKAA 4EVSA 5GIPE 2D5BA 2YZKA 4PSDA 1OQAA 1Z68A 1C1XA 3DXXA 2HK8A 2KBFA 3PX2A 2DZDA 4V38A 3NX4A 3CPJB 2X8JA 5CIWA 4NEHB 3L77A 3QYFA 5FWYB 1A7UA 3TB4A 3VYRB 1E9BA 4XTCS 3KP1A 3CNOA 5AK5A 3TL3A 5CG1A 5KC9A 2VXYA 4ZALA 1O96A 5DI9A 2IK8A 2JLAA 3MBIA 4AUKA 2A9OA 5I4IA 3BAFA 2O8EB 4BFCA 1HFEL 4JLSA 2HC9A 1KETA 4OKSA 5CCXA 3BIOA 3N28A 1BCSB 3OY7A 1E3SA 4JU9A 2PMEA 3FDFA 3HWSA 1MH1A 3I30X 4RZ2A 2JFNA 2PZ8A 3UH1A 1V0JA 1KYTA 3IURA 4IGFA 3D1VA 4ND2A 2HQSA 4IV5A 5D84A 1WZIA 5DTEA 1B43A 4NEQA 1R8QA 1E1CB 1NBIA 3GRFA 2W93A 4F5DA 1N0HA 4QYSA 5TEVA 2ERYA 4O2BB 1U31A 2RI1A 4KV9A 2HA6A 4CF5A 1RXVA 3DULA 1CE8A 4COOA 2XCRB 3KZCA 4W1SA 1H9AA 3TXAA 4P3YA 4M1EA 4KFRA 4U5QA 2IE0A 1V43A 2NO6A 3MT0A 1IULA 4O3MA 1Q7GA 2IDKA 4JODA 4DV4B 1PBTA 4O25A 4HGPA 1UJBA 5ALLA 1II0A 5EN4A 1OLSB 3EGEA 3ZZMA 2LGJA 5JCOA 3HUDA 4F11A 1G6Q1 3NASA 3O8NA 3U7RA 1SU8A 2KW5A 1PI3A 2W90A 4EP1A 1MC4A 5DNCA 4HNHA 1NFQA 3W6NA 1RTTA 1V26A 2P8JA 1NDQA 4YDHB 2IL1A 1Z4PX 3KR2A 5FWXA 1N5OX 1MT3A 3QELA 3O8LA 1OHHA 2V8OA 1OXXK 4TZKA 5FOXA 1I2AA 2LE0A 2O3SA 3AVXA 3IP9A 3ESXA 4DWOA 3RU7A 3UW1A 3G2QA 4G26A 121PA 1KVSA 2BTQA 2Z8YM 3CF0A 3NXSA 4NP6A 4E4RA 1UXGA 1O6ZA 5FLYA 3VM6A 2YVAA 2QI9C 4M7PA 2J31A 2PA3A 3SC2B 4MVJH 5I47A 1JG4A 4NV3A 4AJ9A 1IBMB 4M1YA 5BV2P 1P29A 2EGUA 4JUDX 3BHMA 1S9HA 2C0PA 1ECGA 5BNFA 2BGTA 4Z7NB 5E2BA 5GWXA 2CY0A 2NX2A 1NW9B 4X1YA 4WWHA 4DQXA 3RGGA 3SXPA 2PD4A 2GOYA 3D81A 4RSRA 1V3TA 2Q4TA 1Z0DA 3N6XA 4OX9Y 2FX5A 1SXPA 3EXAA 1CVLA 2RKWA 2I6XA 1YVUA 3DEYX 5REQB 5JJKA 4AKHA 1IJBA 1M0EA 2FY8A 2QX8A 3ST7A 1ISRA 2DHCA 4BP3A 4HKTA 3CKMA 4MYSA 3H1AA 1PQ4A 4KUEA 2ZFUA 4YB8A 1Y5RA 5A71A 4AJEA 2GHQA 4MI6A 3PVCA 1VKJA 1ZM7A 2E2WA 2SICE 2YNMA 4XLZA 5HMLA 1JLLA 1GSIA 1LCIA 3ORRA 4QVIA 1REQB 3R0ZA 1YRWA 2GF9A 4Q3AA 5I7RA 2OMEA 4K9SA 2GJ8A 2C8JA 3GG9A 3Q2OA 3U1TA 1DINA 4K8OA 3VO2A 4U9HS 4W5JA 2VG8A 2VP5A 1J24A 3OZFA 4LRUA 3TZEA 1UM9B 1K06A 2KHZA 1R7RA 1QVWA 1ZRNA 3I76A 3KTFA 2XGOA 3AHHA 4G9BA 1NF3A 4PTLA 4OQYA 1V3UA 2GCPA 1NNEA 1T2AA 3PSHA 1P80A 4G5SA 3P97A 1JVSA 1XMSA 3RU9A 5AOBA 4C0HA 2IU0A 3BULA 3NWOA 1W5AA 1NVAA 3N2KA 3GJTA 3G5LA 3RM3A 1WF3A 1C7IA 3C7CB 1Z47A 3RSHA 5LQNA 1P2UA 1WY7A 2X9LA 3LPAA 4EA7A 1WNTA 2AN5A 1RDFA 1G8YA 4YUVA 2IS1A 1NF9A 3RIGA 4UNQA 1OU4A 3FCCA 1OZGA 1BEUB 4GMGA 4FBLA 4REQA 4MIOA 4CQLA 1UJ4A 3IA7A 4EVIA 4CKCA 2GM3A 2M9MA 2ORIA 2W7TA 3D2BA 4RDXA 4X3OA 3KL2A 4ZQCB 3WKDA 2HRZA 2DFTA 1SD1A 3CRZA 1GN9A 5K2MA 3VR5D 1ONBA 4EG6A 5IF3A 5K99A 3V97A 5E7MA 3AF0A 3LQFA 3C87A 3EIQA 2ZEJA 4HEA1 1NIPA 2ZTMA 1CJVC 2BEKA 3BICA 4FCCA 2PT7A 3HKEA 2L82A 2L19A 4TQAA 1G9XA 5L3QB 4DV2B 4NZPA 3QEBZ 3UA3A 4J16A 3FGNA 2G07A 2IY7A 4C29A 5A03A 1TGYA 4M1QA 4KR9A 2V9ZA 2BGMA 3LHIA 2VQEB 1R88A 2OBNA 4BNDA 3VZBA 5E4FA 2HK9A 3TB6A 1YIOA 1EQUA 4MW2A 1I3KA 2W37A 4PYRA 1B3BA 4CEHB 2E9SA 1NU6A 1ORIA 3BMQB 2GO1A 2FPUA 3WTCA 3ZK9A 3ZZ0A 4BFVA 5BWNA 4AK9A 3H1EA 1JECA 4P5EA 4E1VA 3P1JA 1F4VA 3EGWA 3OTGA 2RGDA 3RAPR 2WJVA 1SXHA 3M4NA 4LDQA 2QYTA 5AOAA 2B21A 3W5HA 3D6UA 2IHVA 1DCFA 2P6PA 3IUYA 3NBAA 1Z0SA 4I4TF 2QLBA 1FNNA 5GMOA 5EIWA 1TCBA 3VPGA 1TM5E 2PKRA 5HHTA 4UNSA 2G80A 3OPNA 1CF2O 2KI5A 2CXNA 2GHIA 1NVXQ 2Y0EA 1ZI6A 2HJHA 2ZI6A 3KSBC 1NXXA 1Y8AA 1Z18A 2HI0A 2OLEA 1EM8A 2HXGA 3EJ6A 2BP7B 4IRMA 3URMA 1NNSA 4LJ6A 2YASA 1H0SA 1JLKA 2XYQA 4PLGA 3HZRA 3E9QA 1NMSA 1GZ7A 3QVTA 3C1TA 4ID3A 1M2EA 4NBRA 4ZYZA 4LJ8A 1YQ9A 4IEEA 4EW2A 1YCGA 3F4LA 4HADA 3L6OO 1Z9BA 4OA8A 3VFDA 2B4YA 1K4YA 1GLNA 3N59A 4DSAA 3PC8A 2QG9A 1IUKA 1L5OA 2YYSA 3EZLA 2V5VA 1KJZA 3E7FA 5DRTA 2HMAA 3LV8A 5MGBA 1P17A 3H0CA 3ASVA 3KKKA 1GGNA 1UMBB 3RT9A 2IUTA 3I53A 4JLPA 1DKMA 4RJIA 2ACWA 4DA4A 2BHNA 3AI2A 2VDRB 2INGX 4TXJA 4UC0A 5FLEX 1E3WA 2O6HA 4GR5A 4M8KA 5DOZA 3SZLA 5L4SA 4IWYA 1HTTA 2V97A 4AUEA 3CNQS 5AJTA 4WKBA 2VT7A 5HR5A 1GPNA 4R8VA 3JYHA 1BRMA 3GF4A 2X5JO 4PRYA 4NCAA 4LA4A 4IVPA 1N2JA 2B78A 2C9MA 3EAFA 1ZD1A 4L8VA 3SPXA 1RKBA 1ISGA 3DHNA 2YXLA 1RMTA 4MKFA 1XTTA 2IX9A 3EGCA 3KDPA 3RWBA 5DBIA 1R9NA 5KSYA 5LQAA 4B83A 4QYXA 4YT5A 1B1CA 1JFVA 2BC9A 2O0HA 4K40A 2P62A 4WFKA 1FDUA 1LBQA 1VE5A 3NTOA 4ZDWA 2ZXUA 4F2WA 4Q24A 1ZQ9A 3DDCA 2A1UB 1WTAA 2WFZA 1NBEA 4G37A 2D5CA 2FUG1 2NU9A 4YP5A 3I5MA 2AMJA 5CVUA 4ZAYA 4TMTA 2QP4A 1KFJB 1T1JA 1CZUA 2IS2A 1SC3A 5FFMA 3GLGA 2GZMA 1BE0A 4OKNA 4YMVA 3L7MA 3ZUGA 2C9ZA 3EGIA 1PL6A 3NRBA 5BRAA 3WDKA 1GWNA 1F38A 1H2BA 2WV9A 2XMGA 1WOYA 1E6KA 1U1IA 1UAYA 2WOJA 3KR9A 3Q85A 4PONA 1U3GA 3GBSA 2IEAA 3BA6A 2RC6A 4K6KA 3D43A 4KB5A 4YLEA 1XLVA 1PSDA 2BR3A 3QUSA 1CY0A 4JLMA 3N0VA 4KX3A 4BJHB 1MB4A 3T54A 4KQ2A 1P72A 1SXIA 3OQVA 3PD7A 2I9KA 2W48A 2QWXA 5EXXA 5HZHA 1QCYA 3SWWA 1KSFX 1L8OA 1QF7A 4CT0A 2P41A 4JLUA 2QN6A 5FWAA 3ZY5A 4DMKA 4MQ4A 2VWPA 1RIFA 4B3TB 4OM8A 4B46A 1U7WA 4ASUD 1LBHA 2AFVA 2QI9F 4M89A 1KZ1A 1MHPA 1PO7A 2V0CA 4RV9A 2ZJ4A 3ROEA 5A06A 1NRWA 2QVGA 1W0JA 3EY4A 4DM4A 5CLFA 2CNLA 4X91A 3R0JA 3BL8A 4DJJA 2RBKA 3I8OA 3NHZA 1WIWA 1YU6A 3GDWA 1UXIA 3L3BA 3LBIA 3OMXA 4JNCA 3KWFA 4IIBA 3Q7IA 4OCZA 3PEVA 4NCJA 4WZBE 1BEZA 1Z5WA 1XMIA 1HUQA 2HHCA 3PFIA 4IQ8A 1HE5A 4IGKA 4BCCA 1X7YA 3OPYA 1CWUA 4ITRC 4K5QA 1C8LA 4EHNA 2OP0A 1VE3A 2PH5A 3F8TA 2GILA 2IEYA 5C7IO 3RVOA 5AR1A 5LA6F 1M8JA 2RHLA 5ITWA 5CMLA 2J0QA 1WHTB 2RK4A 3WR5A 3DHWC 2ERXA 4YDSA 5JZBA 3FD8A 4I1RA 1AC5A 4RQUA 1CB0A 3PUKA 3X1XA 4QKQA 2Z4RA 3REFA 2VHVA 2B4RO 4LDPA 2FWJA 1VCOA 3DP7A 1Z06A 2AL7A 1L4YA 4GUDA 4HDAA 1P7PA 2A14A 4L76A 4DMFA 1NMEA 2BKAA 3ELWA 1N1GA 5CM9C 4RK5A 5C4IA 4A1OA 5J2UF 1BDMA 1K1EA 3HP4A 4WXEA 1VP9A 3QHPA 2O5EA 1N6PA 1UDBA 1ZH0A 4M99A 4ITVA 2I4LA 3ROZA 3F9RA 3MGCA 4FN4A 4XLLA 5A6SB 2VF2A 4FW8A 4JHXA 4DARA 5G2OA 3DFZA 2HZ7A 1XNGA 4M0UA 4TS3A 4FW9A 3E27A 1E18A 2VZ8A 2NNLD 3T6KA 2VDMB 1EZZA 1YKSA 2Q6TA 4ZMRA 4L95C 4XX1A 3D3WA 2OXRA 3LX4A 1B8PA 4KOAA 1XQVA 1U2SA 4PHFA 4A6XA 5BSEA 4B76A 1GGHA 1SPBS 1WMEA 3FOBA 4D5GA 4C0SA 1I80A 3SICE 2B2CA 5IHXA 1K08A 2GS9A 1Z75A 3LRXA 1NUQA 1EK1A 1T3SA 3DZFA 4RSMA 2P3LA 2XMDA 1AHIA 1RJ9A 2AC4A 3WGQA 5IDWA 2D62A 1ZN7A 2RK6A 2VF4X 1YR3A 2OKCA 2ZATA 4EYSA 3CNHA 2LPMA 4ZREA 3VC7A 1JHOA 1Z8DA 1NBAA 3Q1LA 4N41A 3DFFA 4MV0A 2WJ6A 2ZRIA 2PV0A 4YPOA 3CNBA 3GEBA 5FPYA 5K5EA 2VPZA 3PTZA 4JR1A 1N6HA 4RMGA 3I42A 5F35A 5IBPA 3WWOA 2K7FA 1V37A 3X1YA 2EYUA 1U9JA 1UOPA 2JB9A 1VECA 3ANXA 3HN2A 3P9PA 1YONA 4DSTA 5HGJA 5G1OA 6ABPA 1EYZA 1FSGA 4OKIA 2FE1A 3BXHA 4ARAA 1DUIA 1DOZA 2AS0A 3UMBA 5ADVA 1U98A 4UHBA 2GJKA 3PFGA 4CZ2A 2VUUA 4H27A 1QVVA 5FV7A 1HSZA 5JAQA 5TQ0B 4B7CA 1R6XA 4I5EA 3ECCA 3JQRA 1ZGHA 5SZKB 4B5KA 4MP3A 4H1WA 3R6WA 1EE9A 1W87A 4V0LA 1AF4A 2C9CA 5KOJA 1XZAA 3EHEA 2Q21A 5JY1A 1K9SA 2JH8A 2DKNA 3ETDA 4TRNA 4MQ6A 2J41A 1FTWA 5LOVB 4PAOA 4EY3A 3GIDA 5E6RA 1P5FA 10MHA 4MW6A 4CLDA 3JASA 1W46A 3OT1B 4WBSA 2V1XA 2ABWA 2Q99A 1K8ZB 3WMRA 2WJYA 1Q77A 3IKMB 4DL9A 2C29D 2WF8A 4BEWA 4YY3B 4YRAA 1H8ED 2H1FA 3OIVA 3TAUA 3W6UA 1I3NA 4D9CA 4IWXA 3WNQA 2C96A 4ES6A 2E4VA 4DZRA 5FOUA 2CCJA 2Q1TA 4GI1A 4P32A 4E5SA 1SRRA 3BTVA 5DDIP 1OH8A 4FT2A 4QIHA 3S4YA 2GAFA 1JMKC 5EMKA 4DM3A 3E2IA 1Y34E 4HDSB 1CC1S 5KTMA 5DBFA 1NF2A 2OHXA 2PR2A 3HSYA 3M83A 3KKLA 1T24A 2Q4EA 1NJGA 3EFBA 1U0TA 4GM1A 4QDUA 5L7YA 5B1YA 3R7SA 4UE6A 4EQZA 1QWSA 2P75A 5HIIA 2QD4A 2Q5FA 2NUBA 3NTLA 5BR1A 5IU6A 3ODGA 2DQ4A 1YOVB 1PAUA 2XD4A 3KE8A 5CYFA 2G1JA 4DC9A 1JQLB 1KI2A 1WAMA 2QZJA 2ZKLA 4JEHA 1H65A 2HBZA 4LMPA 2VDKB 4B4VA 3MTGA 2OFXA 2OZLA 3D5TA 3LM8A 3PQDA 4BQFA 1EVQA 3H17A 4E1AA 2MSNA 5COBA 1R6BX 2Y05A 3OPMA 4MUBA 3PJDA 4OI4A 4MVWA 3CRMA 1UK6A 5CITA 3N6VA 4KRYA 1XZEA 3QOXA 1EVIA 4BO3A 2W4MA 3VOAA 1LK5A 3U61B 2FEPA 2VA8A 3R5SA 4RPHA 2IPXA 2P77A 1UZMA 1EHIA 4YJ2F 4YJ3A 2BFPA 3NNDA 4QBGB 4ZZ2A 4O4HB 3SHQA 5LVAA 2C0CA 2WPDA 1B23P 4Q9NA 3U39A 3CMMA 3PV0A 4FT4A 5FUQA 3ROXA 4DCPA 2G8LA 3P0IA 2ZIWB 3NWEA 1NMQA 1P2TA 4LZOA 3S5JA 4WZAB 2V7TA 5EE0A 5B4UA 1DADA 1KPGA 3MWDA 1H93A 4L5AA 3TZBA 2B35A 1F8UA 1M0SA 1ADCA 1QIEA 3DE4X 3NXKA 4Q3CA 1BKSB 1ZL2A 2ODEA 3GGSA 3QOYA 4FCTA 4HQNA 4ODIA 3H18A 4MUYA 3VA7A 3IT2A 1ZAYA 2ARKA 4IPTA 2VZEA 2IPOA 3ILHA 4K28A 2F4NA 3GLIA 3CF4G 3HR7A 1OA0A 2J9FB 3A4NA 3C43A 1V5FA 3P2IA 4L27A 1EDOA 4FNAA 2FR0A 3KWLA 4D4LA 2VJMA 3NJRA 2WTNA 3QTBA 5IC4A 1YZFA 3KOUA 4UOQA 2BFBB 4C0XA 4DR4B 4DQVA 3TH5A 4YAWA 4CF3A 2JAOA 4TMKA 8OHMA 4IF4A 3B89A 4Y9UA 1WHSA 4NH4A 1E89A 1HQYE 2E4XA 4YBZA 3IMKA 3CCFA 4CM9D 1IJEA 1IVYA 3EHDA 1G5TA 1KXJA 1WMSA 3PFWO 5EKTA 4EG5A 5CB4B 3NOOA 2WTMA 1Q3TA 3CCBA 2IZOA 2OD9A 2R25B 3F6YA 3NBKA 3FWKA 4S1NA 1BCRB 1ECBA 2QTVB 4DXDA 3BMOA 3ABIA 3EXEB 3WJ2A 1OX4B 4C88A 1U0SY 3NHSA 4S1PA 2OV2A 1RWOA 2QTRA 1NUHA 1KJNA 1QDUA 4GR4A 1HYEA 4JBLA 4H08A 4KH1A 4FGLA 4MWSA 1N3YA 4ZV9A 1IONA 1E94E 2JI6A 4G84A 2XH8A 3OPQA 5FFNA 4U9UA 1VIDA 3F6PA 4NE9A 3KPYA 1KY3A 2XLCA 3N3BC 1YACA 4DXAA 2Q3JA 1GCAA 2ZDGA 1HOXA 4PQRA 5TLSA 2GH1A 4IZIA 4MQUA 5TQJA 1A3CA 1E2DA 4GDMA 3K1ZA 4B6OA 1CUFA 2DBQA 2QZZA 2X2EA 4YAGA 1ZJJA 4GVXA 4B6SA 1ZG3A 3CBQA 3ZE0B 3GXBA 2QTAA 1LVHA 4MUEA 2A3NA 3CUTA 3LPNA 3B3AA 3ONEA 4KE8A 1JYFA 3WQSB 4Z9XA 3BRWA 4CV0A 1QGUB 3D0QA 4BWYA 3PWKA 4JUAA 3W5IA 4HNTA 4Q9KA 1ID8A 2JFFA 3MQ4A 1TQ8A 2WDZA 4ZAGA 3LWDA 5CCDA 5K0JA 4XDYA 2PVCA 1UR5A 2OAP1 3QOFA 3WKCA 1POWA 1E0KA 3Q3GE 1NKTA 2Q7XA 3KT6A 3LLCA 5G4LA 1WV0A 2DUMA 3A2MA 3O8DA 1YHYA 5ALXA 1MAUA 1TCCA 2DHEA 4PG6A 2Z2ZA 4RFVA 3UMCA 4EHDA 3LXUX 2V7UA 4NOMA 4IHJF 3COSA 1G0NA 1ZRSA 3LCRA 4I3FA 4PSAA 4Z51A 4ZIRB 4JYPA 9ABPA 3GJQA 3SJAA 4GPAA 2O50A 1GQOA 3LA6A 3WQHA 1RE0A 3N8KA 1X70A 2HSWA 4PSVA 1E1LA 1EFTA 1YRQA 2YCLA 3GU3A 5DHPA 2RGNA 4FR2A 1TQDA 4OJYA 1UODA 2Q9UA 1P0CA 2HH9A 2X0IA 1ZUNA 5GM2A 1L7PA 4KJZA 4ZZ3A 4K88A 3EZ2A 5AHOA 4HB3A 1KJQA 3PA6A 4ALNA 3I6BA 5JNTA 3GGJA 1Q7RA 3AIOA 2XNJA 2W6JD 1SCDA 2G6BA 2HIMA 4RK0A 4M4SA 1K4MA 5CX1B 1KQGA 4B0OA 1SVNA 2C1ZA 2GBGA 4AMUA 1C1DA 1WXIA 3D3EA 1GUFA 4O8ZA 4AZSA 3T1YB 2B9EA 3RC7A 1N34B 4G9GA 1N2CB 3UN1A 4E5YA 5FBLB 3HVKA 4CMGA 1G38A 5HF5A 1BMQA 2WEKA 4HDNB 1E9AA 4DRZA 2EIHA 1VBMA 1VHTA 4KNVA 4NENB 5DSZA 5JECA 4G56A 4HQOA 4KGVA 2F8MA 4ZJUA 3IPYA 3P4UA 5HJ5A 2Y1XA 3H2SA 4QL3A 4F12A 4JOQA 4B3BA 3HNPA 3BOSA 4JR2A 5HUJA 4TVSA 3EARA 2FN4A 3FOCA 2V54A 5DNWA 2JFVA 3RVSA 1J7JA 1GVHA 4C2BA 3QNWA 1N6RA 3OA0A 3B3QA 4BBZA 5JG7A 2WD9A 5CEFA 1JNYA 1RMYA 2PSSA 2XKJE 3QKSB 3C5EA 2Q45A 2AR9A 1MC5A 5FPSA 3NM6B 5JBQA 3QEAZ 3PNQA 1RAHA 4KPFC 1T26A 2BUBA 5CXSA 5EWJA 5ALEA 2JRLA 3IP8A 1U90A 3GEEA 1N2BA 2D59A 2XUOA 1TW3A 2VLBA 1UEXC 3X43A 4E07A 5K8TA 1KGDA 1Q16A 2EKDA 2RAVA 2ACVA 1HNWB 4X24A 1LRLA 3S5UA 1I33A 4HH3C 5JAPA 5J2TA 1SK9A 4PAMA 4X8OA 1Y8QA 3V4RA 2JGDA 2JHCA 4Q4JB 2BHSA 2N1MA 4CEIB 2J67A 4NY1A 3WGOA 2MDTA 3L40A 3MHPA 1HORA 2DFNA 3KZMA 3GRRA 3C15C 5FIUA 3RVRA 4X95A 3SE7A 4Q48A 4A8TA 1FQWA 3QJGA 1D6NA 5H3HA 3RC2A 2CFTA 1K9VF 2C3OA 1M6HA 1HTWA 4OGLA 2PBFA 1JEEA 1FP4B 1YF3A 2NPIA 1GCGA 2BFDA 3HUEA 4ZWNA 2V9PA 4CFZA 1XLWA 1S8FA 1PGOA 1FQJA 3P9SA 2IV7A 3VJLA 4MKXA 3ENKA 4G4JA 3CEJA 3KC2A 2PL1A 4I9UA 3GXOA 3CH6A 1T9GS 2VN8A 2WB4A 1QH1B 4RX1A 4M7RA 3V32A 4Y2TA 3ZD8A 3RC8A 3UQZA 1ZGGA 5T3YA 4N3BA 3SKYA 4RHYA 1EWVA 1P6UA 2RH5A 2OV8A 4P3NA 2YUIA 5BOVA 3SBDA 4E31A 5TMDA 3DBVO 4V39A 2ZBEA 3NBZC 4NOLA 3GEPA 3QPCA 4I4IA 4JMPA 1LDMA 3MSXA 3QX3A 2J8ZA 2HXYA 3SVTA 4TKUB 1R2QA 5A9RA 1ZU5A 3P0JA 4GP7A 1YRYE 3KDAA 2AE2A 4ZYWA 2D2VA 2BEVA 1YFLA 1HT3A 2E89A 3E9DA 4Z4EA 2MR6A 5FTMA 3DGEC 2AIRA 3RSLA 2YRWA 2K7ZA 3BJRA 3NUGA 3SC3A 3TLMA 5IHPA 5KEIA 4GC5A 1RIIA 3I52A 4KLAA 3R4VA 4MUXA 1PQUA 1R50A 2FMUA 2OBMA 4O4IF 3E70C 5EXDA 3B9BA 2Z2IA 2GO7A 2WT4A 5F2KA 1WEKA 4GI5A 3RKUA 5I7EA 2YKGA 1W88A 3ORFA 2WJJA 5EHQA 5U4QA 1VLVA 3CZ4A 1VHQA 3R6GA 4I99A 4YVFA 4ZQIA 4I55A 2NUPB 2ZSHA 5H83A 4WE3A 3TUJC 3THXB 4HAYA 3AUXA 4LV6A 4QT4A 1JQBA 3FBGA 4CWAA 4OSEA 2BZ1A 2N47A 2QROA 2H17A 1S3FA 2ODTX 1EUDA 4GXNA 4B79A 5C3MA 1EAMA 4J03A 4TROA 4ED9A 2QF7A 4FONA 1XB2A 1XWIA 5DIFA 4N1AA 3U4QB 4EY4A 4YMLA 1G1AA 1RXUA 4P38A 5COQA 3BL6A 2EEPA 2FUCA 2HTEA 4HZIA 2H1WA 2Q5HA 3N1UA 3AV0B 5G0UA 4LHYA 2HPVA 3DE7X 4MVYA 1R9GA 4NEGA 5CNIA 4YRMA 5BW5A 3HBAA 5IYZF 1QRSA 3FOWA 3NEYA 3R0IA 4XI9A 3HQ4O 4HGYA 1TECE 4QPCA 3KETA 3KELA 1IZYA 1M8GA 3DDZX 2ROQA 5PNTA 1ZNQO 4OYLA 4Q7JB 1XTSA 1TGVA 4EARA 2UYOA 2OCPA 4EHBA 1C5KA 1EUCA 1GFIA 2Z5GA 4TRMA 2VBCA 4GL4A 5JZVA 3MA0A 4CQNA 4KRGA 2IHUA 1S8AA 1XZBA 3ICWA 4FKZA 4W9NC 4KPEC 3I0MA 2EP8A 4LYHA 5DX8A 3VU8A 4BV3A 4RMHA 4N0PA 4CUZA 3RSZA 4AZ3A 4UOZA 3WICA 2O0KA 1JAZA 4YQFA 1Y6FA 3HR4A 1TLLA 4FHZA 5JZMA 3Q3CA 2BFFA 3I92A 3SX2A 3I4LA 4EL5A 4WEOA 1WTCA 4P31A 1NVGA 3LHSA 3R8CA 3LKZA 3MCVA 3ZVMA 4U7PB 3F47A 5J4HA 1EP2B 1QZZA 3MGAA 4KLRA 1A04A 4H4CA 3ORQA 3OKCA 5E0KB 3TMAA 1ZXLA 1KE2A 3TZLA 2DM6A 2BFEB 2QRPA 1M72A 3IIJA 2WP0A 4CTOA 4EBFA 3GOHA 3DVAB 3FVQA 4RSGA 4H3HB 4HS9A 1GKLA 5E9JA 2VJYA 1NVDA 4HLNA 2WUVA 3WA6A 4RMJA 4O59O 4GEGA 2R6CA 4LHSA 3HJRA 4CUJA 5B1EA 1TAQA 3FJOA 1EAYA 4IG4A 2FLWA 4LBVA 3EGDA 1KO5A 2NZ2A 1WCYA 1Y4AE 1XP5A 1VMEA 2JIRA 1QZXA 3CLTC 4J49A 4QOSA 4AF8A 3EMVA 5C7YA 4I8XA 3CLTD 1ZA1A 1OXSC 1K8RA 3ETCA 1D1TA 4W6QA 2RD2A 3BHJA 2PFGA 1P33A 1E1RD 1H2EA 1PD1A 2DFLA 3EXHB 2ZIXA 4R7GA 2E55A 3ZU4A 2Z1DA 3V4LA 4EY5A 3MS4A 3HYCA 3MC1A 3QU7A 1CEEA 4TLAA 4DYDA 1XDBA 4PW0A 1ZD3A 4AL4A 4EB6B 4EJSC 1HBJA 4BXOA 2HQOA 4QGGA 4R1PA 5E9QA 1MB3A 4M53A 1C9YA 4ZOAA 4NBNA 4ZVOA 4A0HA 3EFHA 1ISJA 1ZGCA 2C83A 1HZJA 1HPLA 2YMPA 2FSPA 3TWOA 2EFJA 3W5CA 2CL6X 3MFQA 4CLRB 4F2GA 4JYAB 4NKRA 5H8WA 3WMXA 2Y0BA 3LDAA 2DULA 1FNCA 1I6MA 4J3NA 5KZMB 3LUFA 1JHVA 2OCYC 2VF5X 4TXMA 2WB2A 4MMXB 3IALA 4U2BA 4R8SA 1U3CA 5KKCA 3T5BA 5JQGA 1Q91A 4K3VA 1BFUA 1T13A 1SZJG 1C3OA 1SQ6A 2NVOA 3FHLA 3STVA 1RJGA 3BSWA 3NIFB 2WTUA 2RE8A 1Y7PA 2DFDA 1W35A 1YNSA 1Q3KA 1I4WA 2JGRA 3QENA 1E8DA 3QVWA 4NDNE 4CDMA 3L0BA 3FDJA 4D2IA 4DSZA 4EW6A 4JROA 1R0YA 1ZM9A 2FFJA 2QE7D 4ARZB 4CDRA 1AVTA