3TWCL

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt127 in complex with man9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
208
structure length
208
Chain Sequence
ALTQPPSASGSPGQSITISCTGTSNNFVSWYQQYPGKAPKLVIYEVNKRPSGVPDRFSGSKSGSTASLTVSGLQADDEGVYYCSSLVGNWDVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PGT127 light chain, Ig lambda-2 chain C regions
total genus 43
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3twcL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3twcL02
4BFIB 4MDIA 4JQXA 4O58H 4JGMA 5GS0L 1B4JL 4OCYH 3DYPA 2BSSB 3QUZD 4QYOB 4WW2B 4GQ9H 1LNUA 3QUYB 1DJSA 3K46A 3SE3C 2XXMB 2FJFA 1MCIA 1YMMD 3KJ4C 4X4ME 3TPUB 2HTKD 1NDMB 3FN0L 3B8SA 3I3DA 3LIZH 1ZTXH 5EIIB 3TN0D 3G5XA 3N85H 2XQYG 1I3GL 4PRPA 4YFLF 2IG2L 4UDUB 2DI9A 5KSUB 3RFZC 4HEME 5DRWA 5F7HA 5TDPB 1G9EA 3OKNB 2K7QA 3DX9B 5MI0C 4FXLA 2DQFB 5AG8A 4MDJB 1YYML 1HI6B 4PJEF 4PLJD 4YUEL 3FOLA 1NBVH 3LD8B 3MTRA 4OCSL 3EJZC 5K9KB 4U1LA 5TQ0H 2DLIA 5D71H 5FYLL 2Q6WB 1UWEL 4FFVD 3C5JA 3MV7A 1QRNE 3QZWG 2ATPB 4N5ED 4ZUWB 5JOFA 2ZPKL 4KZDL 5C0AA 1KFAL 4UNVA 4L3EA 1F11A 4DZBB 5TGBA 3MPCA 3STBA 5GIRB 4B0MM 5IEHA 2B1AL 5JORB 3OJVC 5SX5H 1CDHA 4R8WH 4QXGL 3DTXA 1G7QB 1RJZA 2J7LA 3LQAH 4LEXL 1CQKA 4YIQB 3TCXA 2H8PA 3L9RB 1NCCL 3PGCB 4PJAF 4NQXB 2VKXA 2GTZA 3G6DH 3OSKA 5E03A 3U4AA 3VA6A 1NJ9B 4OT1H 5GS0C 5F72S 3LN4A 4H1LB 3VMOA 4J6RH 4P2OB 4IBLT 3ZSTA 2HRLA 3IRZA 4YZFF 3NIDF 4BSWA 2OR9L 1KN2L 2HVJA 4EZMA 3BE1H 2VLLA 2DAVA 4NFDA 2BOBA 2JJTC 3QUXB 4YHKH 4Z77A 1G7MA 4ZFFA 1CLYH 3VFUB 1IGYB 2EEBA 3AS3A 2RCSH 2OI9C 5CJXA 2P8LA 2VDLH 4LCWB 4WHYH 5F7FA 3QEQB 5SX4I 1DBBH 5HYSG 3RBSA 2IPTL 4NKQB 1ADQH 4LMQE 1UT9A 2DDQL 3RWIA 1D5BA 3SKNB 3MYZA 3QIWC 2XOTA 4S1RH 5C0EA 2VL4A 5MEQB 5C71A 5FM4A 5MHSE 4S2SA 4FG6D 5C92A 2ATKA 5KSAA 5IFJB 4C57C 2APTA 2BVOA 2DQDH 2VXQH 2G2RA 1NFKA 3EOAA 5EBMB 1IEAA 3OV6A 1LE9B 2DICA 4G8GB 2GT9A 3WV0A 4NJAL 5DHXB 5HDQL 4U7SA 1CICC 1E4WL 1OTTD 5EOCL 3U0TB 4RX4A 5HDOA 4E42A 1T04B 4PD4J 2NY4C 1EEYA 4JM4L 1D7FA 3QUMA 4WRLA 3D48R 2NY0B 4JN1L 3R8BB 3TWCH 5JHLL 1BJMA 4MGXA 4XBEL 3WS3B 4NKMB 4J1UB 1Q8MA 4RAUB 5EC2A 4JY6A 2D31B 1X5GA 2NTSP 4EDXA 5BMFH 1KLFA 1MJUH 2EDHA 1OF2A 2YUVA 4OLEA 1XIWA 1HWGB 2BC4B 2XZAH 1X5KA 4LLQA 4A6YH 2AAVA 1J0KA 4XAWH 1LDSA 3JTTA 3NCBB 4JLRB 2IGFL 4O9HL 1U8LB 4LBEB 2CK2A 4JDTH 5DSCB 1RUQH 2OSLA 3UJTL 3GSNL 3WIFB 5JOPD 5C6PB 1JMXA 1PSKL 1KJ2L 1U6AL 3E6FB 4Q7DA 4QRTB 1U3HB 3FQWB 3PDOA 4N1CA 2VDRH 3L3GA 4X5WA 3SGKC 2K3TA 5IIEA 4S1QL 4HKZA 4K3JH 4HV8B 3EFFB 4TNWF 5DJAA 3FONB 4H8WL 5BVJA 3H3KA 1C8PA 4KRPC 3VXOA 5TDOB 1J5OH 5TQ2L 3SGJA 2MHAB 2GSIB 3U7WL 1MHCA 3RVTC 4MAYA 3MNZB 2WLZA 3REVB 5JW3L 4KAQH 1N6QH 1WCBA 5CCKH 1IAIH 2LVCA 3G04A 3MRQB 1QSED 1A6VH 3MRMA 4RRPA 3GO1H 1LP9A 3BO8A 3UTTE 3EDJA 4MQTB 5CEZE 3EO0A 3V6ZA 3BP4A 5IEKB 3UZEA 5EO9A 3MRDA 3RWEB 4NNPH 2PTTA 2JJSA 4KMTL 2F8XC 1BFOB 2N7BA 3O3UN 4TUOB 4U1HA 4WDIB 1IGML 2FATH 3ZMRA 1KIPB 3WN5A 2VC2L 3LS5H 4N0RA 1IEHA 3O4OB 1D5ZB 1TZIA 1G7PA 5K9KA 5IB2B 4JO2H 4NWUH 5C9JA 3TVMA 5L2JA 5CEZH 2DWEB 3KR3H 1QZ1A 4L9LB 5CFHA 2EO9A 1MJJB 1FJ1B 3ULVL 2EDEA 4I8DA 1F02I 2A9NL 4N0FA 2HFEB 4KJQC 1OLLA 4PGEB 3E6HB 4D0CB 4X80H 3LKSA 1S7XB 3O6FB 4OFPA 3NZ8A 2OTUA 1Q9OA 4KMQA 1P5VA 3GUTB 3U0TA 5C0BD 4MNQA 4NRYA 4OGYH 4PRHE 4TVPL 3CPLB 2JJTA 3EAKA 4XCYB 4M02A 5BV7B 1GGYA 1UB6A 3FKUS 4IS6A 5FYLD 1CDGA 1FL3B 2DMCA 3M1BB 3BD4A 4DKEL 5CD3B 5JW4R 1JRHI 3VWJA 5E5MB 5EORL 1KG0A 4Z0BL 1NGPH 5IHLB 3MREA 3WO3B 1Z9SA 1TPXB 4XB8A 5C07E 1UH2A 5D9SB 2FWOB 1NAML 3MLVH 4JRXB 3P9WB 4CGTA 2AV1B 5AD0A 2FX7H 3PGDB 3WD5L 5C0BA 5MENB 3EW3B 4J8RA 1Z9LA 5GGRY 1MIEL 5I2IA 1RUML 1LDPL 4UNTA 2HJFA 2VIRB 3PP3K 4I77L 5KAQG 1NEUA 3PJSB 1RFDH 4P2QA 3RUGF 3ZKMC 4HUUA 2V2WB 4R0LA 4YZFE 5F9OH 3PHOA 3IJHB 3WS6A 3NN8B 3T0ED 3K7UA 5C0AB 2LE9A 5F1IB 5J9PA 2W9LA 3W81A 3O6ML 2D7PA 4YWGL 1RK0A 3C5ZB 3CH1A 3RY6A 3VFOB 2YWZA 3FQNA 3MV11 3QIWA 4G7YH 2MKWA 4JY6B 1JTOA 5GRWA 3TJHC 4P5MA 5CINH 2HMIC 3TJEL 2NY1B 5DHVA 4PJDA 1X9QA 8FABB 1VSCA 4RRPG 4Y5VC 3O8XD 3N9GL 2R29H 5HVHB 4MJID 4PRNB 3B5HA 3B4NA 4PJ5D 1QLEL 5IVXA 4XNYL 1KBGH 4XPBH 5KW9L 1CFQB 1FN4A 5C09E 3DO3A 2WQRA 2VLLB 1CG9A 4H20L 3NIFF 3FHQA 3MZTA 2EIBA 4M1GH 1LO4H 1JGLL 1TITA 1HH9A 1N5YL 5IHZA 1XCQB 2YKLL 1OF2B 2QADB 1FPTL 3GB7A 4IMKC 1QLRA 3TESA 3CK0H 4KKAD 4PP2B 4RGNB 1CLZL 4F15C 1FAIL 3HAEB 3DPBA 4P2QD 4ZPVB 3WKML 2FX8H 2MNUA 4PV9B 2E8ZA 4F8TA 2BVQB 1BZ9B 2FZ3B 4OZGF 4YHIB 1CGWA 1RURL 5IV2B 1B88A 4QRPB 2AEPL 5I30H 1J0HA 3CUPA 4PJFA 1UZ8B 1HH6A 3REWA 5IBLC 3B3IB 2YD5A 2H2PC 3NCJL 1H3PL 4LPTA 1NKOA 1HOCB 5CBAB 4C83B 3GI9L 4CMMB 2HWZH 2BVEA 3QG7H 1YEDB 4BUGA 1HNFA 4C55A 1KCLA 5GSRB 4X5LA 4JPKL 5BOPA 4NQEA 2X4QA 2IF7A 1AQKL 4YEFA 3MV01 3BZEB 1EFQA 4HS3B 4Z7WE 1A1MA 1TVBB 5CS7A 3T0WA 3CH8A 3IETA 1HWHB 3CVHB 2FIKB 4HKJB 4HQQH 4XNQA 5IK3B 5T3XH 1UFUA 5DLMH 1I75A 1JZ5A 4MNQD 4Z7VB 3U9PL 3JXAA 4GBXD 3ESVF 1VKXA 1D9KA 1S9VB 1A14H 3N1MC 1DLFH 4HH8A 5GRVK 1QRKA 4ZTPH 2BJMH 2W9EL 4J3UA 2ARJQ 3P4MB 3CX5K 3HUJF 3JV4B 5TF1H 1OB1B 3RJDA 4YK4C 3PWPD 5DFTA 3TVMD 1QACA 1H0DA 5F6IC 1QG3A 2HJLA 3LKPA 3WFZA 1UM5L 1OHQA 2CLZA 4DUWA 3MRBA 4BA8A 3AS0A 4P2RA 4XVTH 2Z31C 3LEVH 1TJHH 2EXYD 2NY3D 3Q0HA 4KK9C 4OB5L 1FV1A 4KGJA 3RVXC 1TQBB 4HKBA 3ZTJG 3JTSB 4LSVL 1KV3A 1KG0B 4GRWE 1QRND 5KSBF 5ERWB 4F57H 1QR1B 2BP3A 5L6YL 4FNLH 3T3ME 1K4CA 3U30B 4PJHB 1BAFH 3OG4B 3ECBA 2ITCB 1YEJL 3EOBB 2WQ8A 2YPKB 1Q9OB 4PG9B 4NC1E 1U8KA 3MLWH 3ARYA 2A6DA 3P73A 4A6YB 3CGTA 4OBRA 2X1QA 2P8PB 4OT1L 2DM3A 2H41A 4MVBD 1KPUA 3FOMB 5GS1A 3WFDL 2ADJB 4Y2DA 5DRXA 1BD2A 3BPCA 4XHQA 2NY2C 1X4XA 5HHXH 1SJVA 4NRZB 3ULVE 4N90E 1OTUD 1ZHNB 4WV1A 1WITA 1HDMB 4YHKL 4LCUB 5C0BB 1EGJL 5JW5B 4N8VB 1XGPB 2X4UB 3PV6A 3GSVA 2OTWA 4X6CA 1KXVC 2J12B 2VDLL 1RU9H 4LCCB 3FB8B 4CNIB 1G7IB 1WC7A 2CUMA 4LKXB 3X12B 2DQJH 2M26A 3TFKC 4LASH 3IDNA 3C60D 4FQ1H 5E4EB 3SDCA 3VMPA 3X13B 3WJJA 2XWTB 2XI9A 4P46C 1LK2A 5C0GA 5MENE 2EIEA 5ETUB 1KCSH 2X4QB 3ZE1E 4FTVB 1NCAH 5BVPL 3DMMC 2Q7NA 3F7YA 3HZMA 1A21A 3FQUA 3IETB 2ZOLB 4P0DA 5T1LB 5DVOA 1NBQA 5B38B 3K4ZA 3Q6FB 4Z7NE 4NQSA 3WL9B 2ADFH 4MHHG 4Q6IA 3G9AB 4HX1A 1LE5B 4U3XA 4LU5L 2DOCA 2PR4L 4FP8H 4UIKH 3V6OC 4ZG1A 4GW1A 3ARDD 4LPXA 5DHVB 4PJBF 1UH3A 4JM4H 4FQXB 3KDMB 4JFDE 3TNMB 2B2XL 4J3TA 3QQ3B 4Y5VA 3UC0L 5HDBE 3EYSH 4LSSL 3OHXB 4TNWK 3KS0J 4FXKA 1N5AB 3O8XC 3SDAB 4W6XB 3U4BH 4PB9L 5DDHB 5BS0B 2WWMD 1UZ6F 5I2IB 1MJUL 3F7QA 3S36H 5CSZB 3TYFB 3WHXA 4BELD 3QPXL 1IC5H 3NCMA 2WUBH 3D3VD 1CLOL 4ZTOH 2XG4A 4FQIH 4CMMA 1ZLVH 3P4LA 2F53A 1N0XH 3K2UL 4QTIH 1OQOA 3ZDZE 1E4KC 2FB4H 1PQZB 4AMKL 3GBNH 5C0NC 2BK8A 2GJ6A 4ZPVA 1MAJA 3VCLB 4MJIE 3GSQB 5JR1H 4PJHF 5EU4A 1FGNH 2P5EB 5IMMB 4OQTA 4AT6B 3RWCB 3SE4C 3UBXB 4G6FD 2ZOKB 5E70A 5DWUH 4ERSL 4ZOEA 3VI3E 3CFEA 1JYNA 4U1GB 5JPNA 1Q0YH 1MCPL 3IFPB 1R0AH 3K8LA 2YZ8A 3QIBA 1UKTA 4PR5B 2E27H 4LHJB 3FT3A 2P24B 4PG2C 1I3UA 5C0JA 3JVGA 3V4VL 1MFBH 5CBEA 1FRGH 3QRGL 2I9TB 4DN4L 1Q38A 5DUMH 1P84J 3ZE0E 2X9WA 5E6IB 4HXBL 3RTQB 4G43A 5KG9A 1L0QA 1DLHB 2C3VB 2FLRT 2VZSA 5GRJH 3O11A 4FQHA 3N1PC 1HZHL 2GCYA 3F65A 2NXZD 3K4AA 5KZCD 3OR6B 4G9DA 5I19L 1XGTA 1Q94B 1RZFL 2VLKE 3WEXB 2Y36H 4HUMB 1CLYL 4JFDD 4YX2H 4G6JL 5IV2A 2W0PA 1C08A 1F5WA 2CD0A 2OZ4H 3BIKA 3NA9H 4MD5B 4I48B 5KOVC 2ZZUT 3D69A 5D1QC 1AIFA 2XWBA 4YDJB 1ZE3C 3SGJC 4LGSB 4F7PA 2AKRA 2DQIH 3U0PA 1QLFB 3FO1A 1DR9A 5IW1A 4MQSB 5I15H 3IF1A 2AJ3A 2GY7B 3O45B 2D03L 1U3JA 4P4RA 4BH8B 1I9JH 1CL7L 1T6WA 1XR9A 2A77L 3HC0B 3WMSA 1NFDA 2BRQA 1C1EL 3V6OE 2EE3A 5FA4B 1NGPL 5BRZD 3SDAA 1ORQA 2VDQH 4KVCL 2HVJB 1YUHB 3T1FA 3AB0C 3RI5K 5CZVL 1FVCB 4WVRA 1FYHB 1ZOXA 3PDOB 5AAWA 5J7CC 3VFUA 4OZIA 3MV7B 5ANMA 3T3PE 4HWNA 3EDFA 2FGZA 3IAQA 3KPOA 3L3OA 1LE9A 3OF6A 3GMNB 5BZWB 3MA7A 3HRPA 4QGTA 1CFVH 4JRWA 5KVEL 4MB5A 1CDJA 3RGHA 4EBQH 2HH0H 3ISWA 4N9GA 4BSVA 5TDOA 1OPGL 3HUJA 1ZLWK 3O81A 3IFOB 4P3DA 3QAZC 5DJ2A 1EDQA 3HZMB 3IU3A 3NGBB 4KGLA 5ESAB 3REVA 3ARXA 1YY8A 3SKNA 3Q48A 4F3FA 2CLRB 1NFDE 2CRYA 1MNUH 3C9NB 5GJSH 2YXMA 2H2PD 4D3CH 5I75C 3F8UB 1PKOA 1FYTA 1FNGB 2ZWLT 2ADGB 3MUHL 5BXFA 5DQDH 4O5LH 5ID1B 1TNMA 1W0WA 2PW1A 3D85D 1RUQL 3O4LA 4AM0B 3V0VA 3WSQL 3V5DB 2NW2A 3IKKA 1HK6A 4IRJA 5IF0A 1U93A 3SDDB 1PKQB 2VAJA 3DXAB 4PBVC 1LO0L 4MQ7A 4ZUVA 2CKBH 2I9TA 1HIMH 1T1ZB 4ZXBC 2C3HA 3O6LL 1EEYB 3RVVC 4LSUL 3T3PF 2I9LA 2YBRA 3C2AL 4HUXB 2HJKA 5IG7B 5DRNA 1EXUA 2QBWA 4Q0XL 2ENYA 2R4RH 5EC2B 2X4NB 3VXMA 4OF3A 4FQJH 4N68A 3UZVB 3WLWC 4JQIH 2VLRB 2VXTL 4NN6B 3WFEH 5JLZB 1RUKH 3QDGE 3CFDB 3VDCA 3T0DA 2XXCB 3KVQA 3TNMA 1A6VL 4A2MA 4H20H 2O93L 3RGVB 4NGHH 3O6FA 1N7MH 1ZVHA 4MAYB 3OG6B 4X99B 3KPPB 3AM8C 5EUOA 2J5LC 1PGRB 3PWUB 4PJBE 4WWKA 4NNPL 1ZEAH 5T3ZE 3ILQD 1JHLH 3OXSB 4QGYA 1S5IH 5GGQH 3MV7E 4TUKL 4Y16A 1HSAB 2Q86B 3LAFA 1RURH 4OV5B 3UEZA 4LSPL 3AAZA 5E2WH 4R7NB 5JZ7D 2PETA 1RD6A 1GZPB 1OP3K 3N1QC 1B4RA 3WIHL 3AREC 4NWUL 1F13A 4HW6A 1OL0A 3WFBL 2RAMA 2DM7A 5CBEB 3F58H 1PG7H 4N0CD 4L1HA 3ROOA 1RZJH 4Y1AB 2X1PA 1BLNA 4MX7A 3GMQA 3THML 3DVGA 5DMJB 5E6IA 2ZOKA 3V7AE 4LLDA 3WS3A 2X1OA 4H0IA 2EKSA 4BH7B 1UKSA 5DD6B 3LQZA 1OAXL 5JO5A 3VFPA 1FZMB 5MP6L 1WBXB 1MF2L 1S9YA 1JUFB 2ZCKH 3WLBB 4KJWC 5T3XL 4UILL 1MI5B 3LZFL 1NGQH 1ZT1B 4MB4A 5DK2B 4K8RC 1GIGH 4FXKB 4UQ2A 3D39D 1IE5A 1BQSA 1AKJA 1NAMA 1INDH 3BIKB 2JKXA 5GSVA 5CHNA 3U9UB 4NUGH 3U7YL 3QJFA 1WBYA 5IVZA 3KPTA 1KEML 4WI5A 4QHNB 5FYKU 3K2MC 1GGUA 3MGOA 1UM5H 1IGJA 1U3HD 2YEZA 3NFPB 4G9DB 4Y5YA 1B4JH 3WHE1 3CJJA 4GKSB 3HCVB 4HFUH 2UWEE 4PY7A 5DQ9B 4K07A 3KNBB 1XR9B 4Y4HD 2FCBA 3GK8L 5DXWA 4ORGA 1I8KB 5F9OL 1W72L 4U1JA 5AUMA 4FXGA 4QHUB 1UWGL 4XNMA 2RJMA 3MFFB 3EYVB 3L95B 1EVTC 5E9DA 2HKFH 5F7UA 3G6JE 3W39B 3V7AG 4C4KT 3N85L 1YEJH 2BMKB 4XBGB 3SE8H 4PLJC 4HIEB 5BV7H 5HYSA 3DGGA 4FTVD 1P1ZA 1T66C 5GS2H 3MUGA 1LP9E 4HF5L 4X9IA 4W4OA 4Y4FC 4UDTA 2C9AA 5E08H 5JNYA 1OT1A 4QHLB 1P7HL 3SKUD 4H25A 4X9BA 1WF5A 4GRWF 4OCSH 1GVIA 3ARDB 4RGMC 5FCSH 3SGEH 3QDJA 4NM8H 1H8OA 3QIBD 3WKNA 1RV6X 1CT8B 5ISZE 2XA3A 5F9WB 4WCYH 4FTVE 1P7QA 4PJGF 1KB9J 2EE2A 3TA3D 3BXNB 5F1IA 4N5UA 1N5YH 1EPFA 5BRZB 3P77B 2ICCA 3MV9D 4G8EA 3PL6B 4HS3A 4V2CB 2DIBA 3PDGA 4HPYH 3NBNA 2FYYB 1FPTH 1GPOH 2FX8L 1U8JA 2DLHA 1TFHA 1IL1B 1NCCH 3PQYD 5JO5B 2BCKA 1C12A 2YR3A 3F62A 3SCMB 1F4WL 3OAZK 1NBYB 4FFYL 2O5YL 3B43A 2C26A 3IS0X 3U79A 4JANA 4Z7UE 5CWSB 4PP2A 1JNHB 3FO9B 4RDQF 3VXTB 3UBXG 5DK2A 1GGCL 3I6LD 4YXKH 1UJ3B 4PRDA 2FX9L 1D3CA 3O2VL 2X4TA 3TBSB 5EU6D 4ALAL 4PRHD 3UPRA 1QSEA 3D0VA 1CG9B 4MNHA 3ESUF 3LDBB 3RZCA 3QI9D 2FD6H 3IDXL 4LIQL 4DFIA 4XMLL 1NLDL 5M94B 1I7RA 5FHAL 2EEAA 1U2HA 3BP7B 4JG1L 4K7FA 2BVPB 1EO8H 1BOGB 1S7SB 2WP3O 3S36X 2XKUA 1DUYA 1LK3L 4ONGH 2VQUA 4K8RD 3HAEG 3G5YA 3FN3A 3CSYA 1SYSA 2BNQE 4ODSL 1DLFL 5CJOL 1JRHH 3I6LE 4OLYH 2W9EH 5HI3D 2C1OB 2ZUXA 4ZTOL 3N06B 1JGEA 2MJWA 2YD6A 5DO2D 3X11A 1YEKH 5LXGH 2AK4B 2JCCF 4JREB 4NZUL 2X7LB 3GMMA 4FFZH 4WW1B 3AM8A 3K8MA 4J7RA 1RIUH 4M3KB 2H6PB 5DD6A 2Y25A 3ZL4H 4I3SH 1DP0A 3QZWA 3LEVL 1HXMA 2Z9TA 1JP5A 2VXUH 3F6IA 5E5UB 5FYKH 5C6TL 3OR7A 3DGGB 1I3RA 3P9MB 3MQIA 2Z8RA 5DJ0A 5DJ6B 5EOCH 2BXYA 1RAMA 5C8JB 3HR5A 1YQVH 1BP3B 4TOYH 4F57L 4MS8C 3KXFA 2NZIA 4PJ5B 3TWCL 4JN1H 5JHLH 1SVCP 2C1PB 1ZTXL 1BLNB 1J0ZA 4MX7B 5L6YH 5KSAD 2E27L 5FYJD 1K9TA 4HMCA 5EBLA 2DKSA 1II4E 4AQOA 1V3JA 4DGIH 4P3WA 3QJFB 2IG2H 5IVZB 4WUUA 3G6JF 4GSDL 1ES0A 5E24E 4XP4L 1O7SA 1FSKC 4UV4L 5DI8A 2B8OT 3NH7L 1UXWA 3QQNA 3GB7B 1I9RH 5C08A 1QFWL 4WW2F 3BMWA 1ZT1A 4HK3J 4QOKB 3RGVA 1TVHA 1HHIB 4XGZA 1FIGH 4LPUA 2VH5L 1A4JA 3B5GA 1I8KA 1I1AC 2APWA 3DJ9A 3UJJL 4GT7A 3REWB 1DQQA 3TJHD 4NQUA 5FCUL 4KUCF 1REIA 5E9DB 5JDJA 3TZVB 1WLHA 4AENA 1DN0B 4DW2H 2BCKB 5JPMB 4U1KA 4HIEA 4WHTA 3ZTNH 4HZLB 1TJIL 1VFBA 1CFTB 1MI5D 4R4BB 5MERA 3L5WB 3KWWA 2B1AH 3HCVA 1KJVB 3TBVA 4ZNEA 1U8NB 4MNGA 4Q58C 4I0PC 2ICEB 3GSNA 1K3ZA 4EQ2A 5MEND 1XGQA 5I15L 3ZE2E 4EOWH 5CEZL 4JLRA 4M8QA 2KDGA 4Z0XA 4YXLH 3BD5A 4G5ZL 1FG9C 2HN7A 1QSFA 2HLAB 4PJ9A 3SEPA 3UTTD 1C1EH 7FABH 1DBKL 1JUFA 4DFHA 4GBXC 3DHMA 4LRIA 1L6ZA 4MWFA 3QCTL 3OKDA 4KMTH 3T0EB 3MUGB 3VU2A 5IVXE 3ZTJH 1N4XL 2R56H 4CKVX 4JGJA 3ARFC 1KN2H 1IGMH 2FATL 2OMBA 1FO0H 4K23L 4UQ2B 5C0RL 4Y4KC 2NXYD 4E42B 4Z7WB 5CGMA 3DROB 5D7JA 2VLRD 4XI5C 2HFFA 1RK1B 2A6JB 4R0LC 4XBPB 3VRLE 1DZBA 4U2ZA 1IKNA 4HHAB 3TIDB 4NSKA 3T09A 5JA9A 4PB9H 4MA1B 2IMNA 3EOTH 1WAAA 4L3ED 3G5ZB 3QUZC 2BFVH 1U8OB 4GKSA 4X80L 5EC1B 3WXWL 1Z5LA 5I73B 5EO9B 3MLPA 4HWUA 3EO9H 1HQRA 3S97C 4S1RL 4DKAA 4ELMA 1YNLL 3QUYD 3ARVA 4KTYA 2YPVH 2C1PA 2XQBL 3QIUA 5L0QC 4HLJA 4JO3L 4GS7B 1KIPA 3WN5B 4XH2B 4HFWB 3GMPA 3QUXA 5FGRA 1C16B 4UZGA 5C9JB 1QQDB 2E3VA 3BDYH 4AQ1B 2A2QT 1BPVA 1E4WH 1XF4A 2XPGB 1OOAA 4L8SB 4LF3B 5F70A 5I16A 1Q0YL 4KKCC 5LAXA 4C56A 1RUMH 1J8HA 2GJJA 1Q1JH 5MEPB 2MHAA 3SE4A 4QRSB 3UX9B 1V7NH 4XCFL 1T21A 2YSSA 5GGUB 4EJ1C 3DIFB 5CEXA 1ED3A 3RUGA 3LSOB 1KLGB 1M4KA 4QXWA 2GUOB 4PYHA 3AU1B 4TUJB 4A6YL 4B7LA 1ACYL 3NCYS 4M6ML 3C6LB 3SGKA 1S9XA 5IEKA 2YS4A 4XXDA 1ZEAL 1JZ3A 3D1MC 1NGZB 1BFVL 4ENED 4TN9A 4BH8A 4PUBL 1XF5A 3T4YA 4JRXA 3GSXB 3GJFH 2GSIA 3C09C 3O2DA 3PWVA 3O2WL 4PRBA 1F90H 2V5RA 4U1SB 4S1QH 5L9DH 3FQTB 5F88A 5F9DC 5IBUG 4GW5A 4MJIB 4TTDD 1A7RL 4Z5RB 1U2CA 1T7WA 4JFYB 2HLAA 2UYLA 2AJUL 3GIVA 4J2XA 4M7LL 1S7TA 4TVPD 3W0WA 1IVLA 1Z3GL 3THMH 1BJ8A 2UVEA 3E2HB 2BC4A 5FF6A 4I0PD 1N6QL 1A4KA 3UYRL 3G9VA 1TZHB 5CKGA 2DQIL 2VLKA 4P2OD 3E6HA 3A6CH 4JJHA 5DD3L 2WBJC 3CMGA 4G80A 4F37K 3BZFB 1IAIM 1JGLH 4LCYA 1MHPL 1NGXA 1A0QL 3L5HA 5IB2A 5JMRA 1HHHA 1CLZH 4KVCH 5HHNA 1FFOB 2DWDA 5FYJU 4OZGA 1R24B 3FONA 4PJCF 3KWWB 3F7VB 3OJ2C 2VC2H 3H9SD 1RZ8B 4E41A 1KEMH 4WHDA 1T7YA 4ZO9A 3W0WE 3D25A 1XGQB 3DXAA 4ZUVB 2C1OA 3STZB 1OSPH 1MWAH 4M8QB 4H26A 4OLZL 3MCKB 2VN7A 3GI9H 3CFEB 4K7PL 1VFAA 4NDMB 3QJHB 1G9NH 3L3IA 1WUNT 3PDDA 2V2XB 1QLFA 2IPKA 3FO1B 4KUZL 5I18L 4G9FA 4K94H 1KNOA 3MRNA 3HLAA 1MHEA 4MS8D 1AHWA 3CFDA 1VPOH 1HQ4B 2NZ9D 4POUB 5FV1L 3RAJL 3WJJC 1HXYA 5DTFB 1PKQE 1T1WB 1V3MA 4Z0XB 3MRRB 3LHPL 2WAHA 5KG9B 4P4KC 4PRIE 1KC5H 2JB6B 4YE4L 3JUYA 1JYXA 3RIFF 1NMAH 3U36A 5IJVB 1AXSA 3QDHA 3WCYA 2CIKB 3PV7A 5T1MB 4MWFB 1PEZA 4LVHC 1J11A 4D8PA 2WBWB 3HG1D 5GGSB 3FAWA 3T2NL 5IROA 1CXKA 3BD3A 4GAJH 4UDUA 4Y4FD 1JPGB 3GJFA 1C7TA 2OQJA 4JRYA 5A1AA 1NC2D 4X7FC 5C0ND 4YDJA 3O9WC 3W9EA 4R2GD 4JQVA 3GM8A 3IDGA 2VZTA 3T4AB 5E8EB 5FO7A 3E1F1 3C8DA 2JJWA 3LQAC 4G8FB 3MJ8B 4IMLB 4RAVB 4YHZH 3QNXA 5HVGB 1Q72H 4JZJC 2APVA 1ZHLA 3GSRB 4IIQC 1BGXH 1IAOB 3V0AC 3H9ZA 3VFMB 3H9SE 4YC2C 4R26H 2VISA 3T77B 3KPRD 4RA0C 4MJ6B 4R90H 1N0LA 3EJZD 4P49A 4MXWH 3ARSA 1GGCH 2KKQA 1IGCL 3NIDE 2B1HH 2EXWC 3FCTA 4HXAL 1NMBL 4U0RB 1G0XA 5IFHH 2AEQL 4PRPB 3VFGL 3KLAA 1T03H 1EGJH 2OR8A 3D85A 3MLZL 3W5NA 1HSBB 2QQKH 3HS0A 2Z92A 5I6XC 1IJ9A 3KPPA 1OAUH 1S8DB 5K59F 1ZWIA 4MQXD 1VADA 2G5BA 1ZV5A 4MDJA 1D9KC 3B9KB 3L95A 3Q3GB 4V1DB 3FFDB 5B4MC 3TCLA 1ULVA 4NKDA 4XMKH 3L3IB 4U1LB 2FLBT 4QOKD 1RJYB 1KGCD 4WI9A 3D3VA 5LXGL 1EBPA 1XMWA 3U82B 2AVGA 5IUSA 1EFXB 4WV1B 5IGXH 2C3XA 2DMBA 3NPSB 4UOW0 5GRUH 3NCJH 3SDDD 5SWZB 3TZVD 4DOHE 2C5DC 3ARQA 3MRPA 4XNQB 1P7KB 3HTLX 2XNAB 4G6KH 5HPMB 3QSKB 5HXMA 1CK0L 5JXED 4Z18A 5D1QD 3FB5B 4RMWA 2MCPL 1W72A 2HT2D 5FKAA 4Y5YC 1E27A 3MACL 1KGCE 1H8SA 2H8PB 4JVWA 1P7QB 3BKML 1LK2B 1T5XA 4G3YH 2VLJE 2BSSA 4XP4H 5EUKB 5KS9F 4OZFB 1YEIH 4ZUUB 4HF5H 4LQ1A 3PIQA 4U6HA 2VQ1A 3O9WD 4WTWA 1JPSL 3P73B 1FV1B 2WUBL 5HGBA 5JHDE 1VFAB 5GRYA 3TIEA 3SDXB 2NX5A 1DL7H 1DEDA 1IGJB 2YEZB 4R4ND 5AZEH 5DEGB 1Y18A 5L2KE 1FORL 3UJJH 3SDXF 5BCAA 3HA0A 4PJHA 5IB5A 1NC4B 2W59A 3QG6A 5D5MB 3H3BC 1GAFL 4HDIB 1DSFL 5KBNC 1OAZL 3ROOB 5CP7B 3W11D 4FN0A 3UAJC 1JI2A 1ZLVK 4FNLL 3BGFC 3MV7D 3DETD 4L9DA 1FZMA 2OP4H 2YUZA 1L7TL 2W60B 4NFBA 2BX5A 1ORSA 2V7NA 3MLTB 3QNYB 5INDA 4NRZA 4JGUA 4HGWB 4RX4D 1OLZA 1HQ4A 2GYSA 1AHWC 3ARGD 3LKOB 4DKFH 5DFVC 3MMEA 3MV8B 5K9JL 2RFXB 4EQ3A 1T2JA 1FAKT 5D6DC 1MRCH 1U8QA 4YPGA 2B5IB 1ZA6B 3VXME 4OGXL 1ZMYA 4ZNCD 1U8PA 2FX9H 3MGOB 4LIQE 4G42A 3VGAC 2IQ9H 3E8UL 2IALA 4UTBL 3S37L 5GRZA 2RQ8A 4XMLH 1RU9L 4FMKA 1R3KB 1MCWM 1J1OL 1BIHA 2AQ3A 1DANU 3RI5F 1GZQA 2H9GB 4L4JA 3ZHLA 2HT4C 3U4EA 1S9WA 3TH3T 3EYOB 3GBLA 1MJ7H 1DE4A 1QSEE 3ARRA 1EA9C 4WEBL 4GXUM 4NKOB 2PXYC 1ZXQA 3FT4A 5D6CA 1NANI 4YDVB 1NCAL 1Z6JT 4KRNA 2M1KA 3A6OA 2DRUA 4KHTH 1FGVL 5DS8B 5CD5D 4KU1A 4JDZB 1JNHA 3VWKB 5BOZG 4I5BA 3NZHH 1C5DA 3CDGA 3B9AA 3CSBA 4JVUA 3A6BL 2BNQA 1ONQA 4UOJA 5EU7E 5I8OL 4IRZH 4MNQB 4DTGH 2OSLB 4KDTA 5L88H 4XZUA 3GIZL 1ROWA 4OZIF 5INCA 1T7XA 3CIQA 4WEUD 4OUUB 1U95B 2P45B 4FRWA 1BZQK 2LTQB 3HNVL 4XP1L 1CFVL 5C07A 2JE8A 5AAMA 5FYKE 3BKCL 3V6ZB 2EDDA 4TSAL 3GDBA 2YD1A 1P9MA 1YDPA 5J06A 1J7VR 5C0JB 2FWOA 1YNTA 4X6DB 3D85B 3OZ9H 3M8OH 2QR0A 4GG8A 1U91B 4OZHE 4YFLI 1EX0A 3BVNA 2NY3B 4FZEL 1JF1B 3FT2B 3QPXH 4JM2D 4R9HA 1EHLH 2H1PH 4MSWB 4NNYA 3EGSA 5H35A 4GKZB 2JJVA 1FG2B 3SGDI 2ZUSA 3IVKB 1A3LL 1G0YR 4OFDA 1OAQH 3GBNL 3MRMB 4KJYA 3RZCD 3LH2H 1KTDB 1EERB 1CZ8H 2NX5D 4PJ8B 4BKLA 1BBJA 4RFOL 5JQ6H 3EO0B 1K4DA 5I74C 3VFTB 4IOSD 3SJVD 3KYNB 2IFFH 4Y8DC 3F6LA 1HCFX 3NN8A 3SGEI 1JF6A 2E6QA 5C08E 2KZWA 3D39B 3HUJB 1TJIH 1DQJA 3L7EB 4KK5C 4KWUA 4MJ5A 4Y19D 2Y5TA 1VEOA 5D5ME 4AEIL 1SEQL 1I9IL 5HHVH 4JQIL 4PREB 3UYRH 1G7PB 5IM7B 3HZVB 4QKXB 2HT4D 3CDCA 3FQRA 5GGVY 1OGAA 4XCCH 4EOWL 1VDGA 5EB9A 4LVNC 1RIHL 2JJUA 3L3JA 5IMKA 3TBWA 3VFWA 5DUBA 2OK0H 1INQB 1YMMA 4TULH 3QRGH 3VE0A 2F54E 1CFTA 4UTAL 5J6GA 2F53D 4R97B 3CVIH 5J1AA 3O45A 3WEXA 3S4SB 2XIDA 2HFEA 15C8L 1DQMH 1A0QH 3QFJE 3QUZA 1U8NA 4MNGB 4YO0B 1VCAA 1NFDB 2QL1A 4OGAC 5EU4B 3HI6H 2CK0L 1RZ7H 1YN7B 2Z93A 1I8IB 4NO2A 3BZDA 5D1XC 2J4WH 4JFPB 1HZHH 3DI3B 4P57A 3R06A 4X9HA 3QDJE 3MRQA 5AWNH 3LRGA 4OCXH 2VE6B 5HI4D 1UQSA 4HIHB 4QRUB 3SPVA 1OSPL 3ARFA 2P24A 3IDJA 3PHOB 4JFZL 3NA9L 3JWNC 4LF3A 4PYGA 4ETQA 3MNVB 3BQUC 3I3BA 3RP1A 4PP1C 5FIEA 3CFJB 3G08B 1XGYL 1L7IL 1GL4B 2YUWA 5E4IA 4MD0B 4ELKA 1TZIB 3QDJD 2ZCKL 2D03H 2NYYC 4HJGA 3VGGA 2MQCA 5F9JA 2VDMH 3O11B 4FQHB 3GRWH 1I9JL 4I1NB 5I1KH 5MEOB 1JNJA 3P11L 1E27B 2XFXB 3CLEL 4Z7UA 4UUJB 3KPOB 1AJ7L 1GIGL 4BFBD 4OF0A 4G9FE 3PHQA 1AO7A 1S9XB 3QQ4B 5D2LE 3U1SH 1Z5LB 2AXJA 4UB0L 1NSNL 3BPOB 4IRJB 1D6VL 3L5XH 1QBBA 3RVTD 2DIJA 4X6DA 2ZCHH 2GAZA 4ZUTB 4RGOH 3RVWC 2DQGL 1P4IL 2C4XA 3GGWB 3MRCA 3C5ZA 5KVGL 3FQTA 2BNRE 1PY4A 1GYAA 4YR6A 3SO3B 1XT5A 1B0RA 4G6ML 1X5XA 5EFIA 3VWJB 2Z4QA 1YEFL 3O4LB 3I85A 3EUUA 4M7KH 2A83B 4OF7A 4PS4L 4IOFC 5F3BB 1XF4B 2DM2A 5DVLA 2FHBA 4QT5A 5HDBF 1AQDA 2VLKB 1J0YA 3DNKA 1PZUB 1J8HB 2HFTA 2XZQL 1DVFC 4I9WE 3MRKB 3TH2T 2YSSB 3OJMB 4IRSD 1FVCA 1ZVYA 4FQQB 4EKXA 4TTDC 4EI5C 4WFFE 4UQ3A 4HJ0C 4IOIB 2QV2A 3PP3H 3IS1X 2D4DA 4JM2C 4M9OA 2XPGA 1QSFE 5C0CA 4WO4D 3SY0B 5HBBA 4R90L 1HHGA 4NQDB 1QFUH 3MODL 1C5DB 2QSQA 3HFML 4D2NA 4HUVA 1CGUA 1ZLSL 2R4RL 1N3NA 1QFOA 4GAYB 4WU5A 1XCTB 25C8H 2B1HL 4U6YA 4NM8L 2IH3A 1GJIA 1DBMH 2A6DB 3IVKA 4ZO6A 3CZFB 2NTFB 3LN5B 2BMKA 3UO1H 5KZCB 4NGHL 1XZ0A 3OKLA 1AE6L 4LCWD 5E94B 43CAB 5EC1A 1EVUA 1OW0C 5E2JA 2AJYH 1T5WA 5EZOH 4YDIH 1A6AA 7CGTA 5AEAA 2QSCL 4NP4H 3MRBB 1TVBA 4KZEL 1I4FB 1CD9B 2XWJB 4U1SA 1XH3A 4TNVF 4DN3L 2HTLD 4WI8A 1JGVH 2JELH 1FG2A 2BVYA 4HMDA 1WIPA 1DQDL 2YD3A 4Q9QL 3UROR 4GRLC 4LVEA 5E2TH 4BKLB 1JF5A 1H3TA 1PG7L 1JPFB 3DX6B 4WENB 2GT9B 5ACLA 5F7EL 4NQXA 4ZOCA 2PN5A 2MCPH 1IGTA 3J8F7 2FO4B 5GHWH 3KYOB 1BFTA 4P2OA 3KPRA 2J6EA 5AUMB 5T1LA 1OM3L 4KV5E 3IFLL 5LWYH 5FHAH 4XCEB 2L7UA 3HAEH 1FVDB 3RAJH 1EO8L 3KLSA 5I8KL 5LVEA 2X70B 4PJAA 5F7WC 2G60H 3SJVB 3KYMA 4Q6IC 3LHPH 3SCMA 5CIPH 4WFFD 5SWQB 1BD2B 3BPCB 1P5UA 4KRLB 2W65B 3QDGB 2R23B 3S9DB 2YPKA 3MLSH 2HLFC 1PX3A 2KUTA 4FFZL 1BX2B 5FKPA 2VLJA 5IESL 1UWEH 3PV6B 2YZ1A 3VXPB 3UPRB 3D0VB 3C60C 3UTTB 3VG9C 4KZDH 5KSAB 5IFJA 4I4WB 1MUJB 4YDKH 1BF2A 4YBHA 1TTUA 2F54D 1R3HA 1OB1A 5DK0A 4ELME 3MX0A 4QY8B 1WFUA 2V5SA 4LCUA 1DDHB 1HXYB 3AUVA 4AYFA 4DZBA 5DJYA 1G7LB 3TO4B 2F74B 4WU5B 4UBDC 4IHOB 2X4UA 1MHHA 4WJ5B 1N6VA 1KULA 2XN9B 5I1DB 5C0FA 3JWOL 1U8JB 5LGJB 3RWDA 3VH8A 1UXSA 4EUPG 1YY9C 3ZDYF 3IDGB 4DAGL 4G6AD 4EI6B 5ISZD 1V5JA 1FIGL 1MRCL 5GGSA 4PB0H 4WUUD 3UTPE 3F7VA 3BXNA 5E00B 4LLWB 5CLTA 1IGCH 4O2FA 3MCG1 4K2UL 4HIJA 4EIZC 3ULUL 1UJ3A 3HB3D 2IQ9L 4PFEA 3IT8D 3JZ7A 4HGKC 1MFNA 3MRPB 2EH7L 3MV9E 4LNVA 4DGVL 1KSRA 3NFNA 4CMHC 5EIQA 4ONHB 4YQXH 1NMCB 4KKBD 3MLZH 1ZANH 4YLQT 1ZSDA 1MCHA 3Q5OA 3TNNA 5HGAB 3LD8C 4M93C 5C86A 4PLNC 3MBED 1BOGA 1S7SA 3CMOL 2Z31A 1HDMA 1T5XB 2CKNA 4KJQD 5KN5A 2QHLA 2R4SH 5DQJA 5AYUL 4XXCA 4D9LH 1MFDH 3CFCH 4YAQB 3A0OA 1NL0L 3MLYL 2AK4A 2R9HD 2X09A 1NFIB 1XR8A 3CU1A 4U1NB 2BHUA 1KLUA 2CO7B 3FFDA 5EUOF 2FSEB 5GS0H 1EGJA 3SDCC 3OAZH 1QHOA 1CT8A 5J11C 1Y18B 2GSGB 3BKJH 4UUJA 1RJYA 4TQEH 4D8PB 2E6PA 3H9HB 2R0KH 5EH1A 4K23H 5ECJE 3RPKA 5I9QB 5J13C 4O2CB 4WTZG 3P77A 1T20B 1WIUA 2EDWA 3FB6A 5D70H 1S8DA 1UACL 1NLDH 3TC9A 4JG1H 3OAUH 1KF9B 2ZNWA 4PRID 4NCDA 1SJEB 4N0UB 1AD9B 4NYLB 2P7TB 4LDOB 3HRZA 2DWEA 3BP6B 4O9HH 1URLA 5SV3A 4Y4HB 1B6DA 2PYEB 1OP5K 3IYLW 1IC4L 1XF1A 1KJ2H 3WIHA 5J9PB 1BFOA 1S7XA 2IANA 2X4OA 5IB3A 5CGYC 5KJRL 4HGMA 4UINL 5IBUB 4I13B 5C3LD 2XTJE 3PIQB 2DD8H 4MNQE 4NIKB 3T65A 2Q8AH 3GSOB 4NRXA 4Y0GA 2P5EE 3QIWB 5J1TC 5I1GH 1MCLA 4GXVH 4QWWC 3AFLA 2DN7A 2N7AA 4WUKL 4R8WL 1Q1JL 3H9SB 1KTKE 3FFCB 1IGTB 4JFFE 1N3NB 1MY7A 3LKSB 3QUKB 3ARPA 4FQLH 3MJ9A 1JZ4A 1OP3H 2VDKH 3DBXB 3QDMB 5HGHA 5HYQA 4XPHH 1KIRB 1D6EB 3W2DL 2BSTB 2VXVL 2CK0H 3VGFA 3CLFH 1KPVB 3ULSA 1SYVB 43CAA 4CAGA 3O2WH 2UY7A 4LLMA 1BM3H 3MV9B 3LS5L 4BM7A 5DFVD 3WE6B 4JRYE 4OZFH 4C4KO 4LOUD 1SJHA 5DJ2B 2F74A 4NJ9L 4QRPA 4ZSOE 1NLBL 4YBLC 3RVUD 4JFXB 3KPNB 1T21B 2I25N 4AIZB 1RMFL 1T22B 3HC3L 4S10A 3ULVH 1HEZA 2ARJA 2ZJSL 2G9HA 3QISA 1MUJA 1ADQL 4PJ9C 4Z7OE 3C6LA 2AP2A 2NY5L 2YD8A 3GSUB 2NW2B 4HLZH 3BEWA 3WUWG 3TN0A 1XF5B 4FZ8L 4P4KA 1CR9L 1T20A 4G5ZH 5EU6B 4HJ0D 3VXQB 5ALCL 1X7QB 4PRBB 7FABL 1AGDB 2YPLA 3Q1SL 5L8KB 4UB0H 2IADA 2W1NA 2DYPD 4Z5RA 5CD3A 4IM8A 5ITFA 5D93B 4DEPC 1YPZE 4IRZL 1A9EB 4LHUA 5IKCB 4P5TC 3MREB 1OP5H 5C0RH 3UP1A 1SBSH 1XF3B 5D72L 3RKDC 1B0GB 5IMOA 2ESVA 4XP1H 3RWJA 5BZDB 1NC4D 4ELMB 1TJGL 3ZKSD 1JHTA 5BS0E 5ICZB 1A9BB 4X6DE 1GZQB 4K71C 3V8OA 4CBPA 5B3JE 1CTNA 4PS4H 3ZT5A 2R1WA 1GGIL 2BNRD 3GHBH 3UTZB 3S35X 2AJVL 5I18H 2XZAL 3OZ9L 5E2VH 2DL9A 4GBXA 1I7UB 4KI1A 3OKOB 1OGAB 4ODUA 4O51A 1YNLH 2HA1A 3NFSL 4EIGB 5JXEC 1ZKAA 4OD2A 1LEIA 1JVKA 5J1AB 2W9DL 4WWKD 4PGBB 2H3NB 1Z2KA 3NVQA 1FC2D 1T80A 4GG8B 2WWKT 2IFFL 3PXHA 4O02H 3O6FC 1NMAL 5CINL 2BNUA 2Z91B 3PABB 1LD9A 1Z0NA 1J5OL 1TTFA 5TQ2H 3N9GH 2R29L 1S7UB 5T33L 3HKFA 4XNYH 1SYVA 1I9IH 3X3GL 4L8DA 1H3WM 1CD1B 3DRQB 3SPVB 4U3CA 5ICYB 4YDLB 1YDPB 4HAGA 2NCMA 1AD0B 1XEDA 1A4KB 1JI1A 1NGZA 2IPUK 4LLMB 5J56B 2Y9RT 3HI1B 1U91A 3QUML 4ZODA 3QIUB 5TPWH 3CXHK 4N8VA 3G08A 2Q87A 4MSWA 4NNYB 1D5BB 4M6MH 5H35B 2Y72A 4ZYKB 5EZOL 2DLTA 5DD5L 3RTQD 1CDBA 2ZUQB 4NZRH 4TRPH 3EJJX 1KTDA 2ATKB 4PUBH 3GIVB 1F6AB 2LFGA 3UMTA 2E9JA 4RFNB 4BFIA 1QD0A 4PRHB 3UTSB 3LKPB 3D39A 4F33A 5I1CL 4JHZA 4JFDB 3CFKB 1X4YA 1GC1H 3OAYH 2EC9T 3F7YB 3F12B 2IH1A 1G7QA 2NXZC 3QG7L 4JFOB 2A9NH 4ZPTA 3VFVA 2J3SA 4NKMA 3HE7A 5IVNA 2Q76A 1DQLH 4YIQA 1XGRA 4Y2DC 1D5XB 2UZIH 4RQQB 3AY4C 4JPIA 4EDXB 4GJTB 1H8NA 3ARZA 1YQ2A 3VFSA 3KPSB 1R3LB 1XF3A 2CGRH 1MWAB 4XNXH 1IQWH 1I7TA 1N64L 4DKEH 4H1LA 5IW3A 1JGDB 3AS2A 1H3GA 3DUUB 5DZOA 1NUGA 4FFWC 4BSWB 2DKMA 1K5NA 3PWJB 3DVFA 1AGBA 5HYQB 2E9WA 4CNIA 3QT2A 1UB5A 4N1EA 1UGNA 4XWGH 3ME0A 2NXYC 3KYNA 5DGRA 3LN9A 2GIYA 2Y07H 3VH8G 4E41D 2PYEA 4HIXL 3GKWH 2F5AL 1KIQA 4K7PH 4LEOA 4D0BA 3K3QA 5DHVH 2VZVA 2CSPA 5T5NF 2QQQA 4LSVH 4NQVA 3QDMD 4NN5B 3QWOB 1T22A 2LU3A 1GHFH 2EDLA 3DETC 5SWZE 4DOHB 3FB8A 4XTRD 4G8GD 2H6PA 2CJUL 5DC0A 2H26A 4QXTA 2QSTA 2VTFA 5J6HB 1RI8A 5EIVA 2Z8SA 3EYUL 3P9MA 4JR9L 3SGDH 3ECBB 4K7PY 3GJFB 4F7EA 2LAAA 4U49A 4WIQA 2ICWJ 4QWWD 2L7JA 4J3OC 2CLVA 1G7JA 3I2CH 4OCWH 4UU9A 4EN3C 3OKKA 3TBSA 3B83A 1XH3B 4KVNH 5E8NA 5EZLA 4A6YA 4XNUL 4KJPD 2YRPA 4NQCA 3V6FB 4XBGA 4GW1B 1E6OH 4XPBL 5KW9H 5E8EA 2YMXH 5DI8B 4I2XA 4JRXE 3STLA 3TV3L 4W4OC 4Y4FA 5DJ8A 2IBZX 4RDQG 3B6SA 3GJEA 4U6XA 3OHXA 3TYGL 1R5IA 4YK4B 1AE6H 4M48H 4LLVA 5KVFL 5BW7C 3VXRE 3BSZH 3B9KA 1ETZB 4J3VA 4KROD 5FO8A 2JB5H 1U58A 3QDJB 4NHCH 4X6CF 1RHFA 3KJ4B 1FE8H 3QA3A 2AEPH 3OR7B 4ZNEE 5I30L 1G6VK 1QBMH 1KJ3L 3CFCL 1MFDL 1RZKL 3EO1B 4DKFL 1NL0H 3MLYH 4Z6AT 3ARGC 1CS6A 1SYSB 3PWLB 1UCTA 1M05B 4ODXB 4WGWB 3FQXB 3O41A 3DUUA 12E8L 5D7SH 1YJDC 4P48A 5B38A 3QWRA 2X4RB 3D5OF 5LG1A 1UA6L 1OGAD 1MOEA 3MSPA 4UI2A 5BQ7A 1JYWA 2UVFA 1F3RB 1A7NH 1KCVH 4NWTL 1NCDL 2D7TL 1T3FB 4RZCB 3QXWA 1J1OH 1YJDH 3QQ9C 2MCG1 5F8RC 4Y16D 4RMQA 1DFBL 1EAJA 1MCNA 1SEBA 1A14L 2DJUA 1NUDA 3V4UL 4JFDA 3IXTA 5HYFA 2X4TB 1BMGA 1K8IB 3MJGX 4HEPG 4FQCH 4L4VA 1AR1C 4YHYB 5I1HH 2WANA 4CU6A 1LMKA 3GHEH 4FQIL 3LRHA 4NO3A 2KQMA 3X14A 2OR7A 4ONFH 3GMRA 1OAYH 3VFOA 1S3KL 3NABH 5IHUH 3TIEB 3VMNA 3G6AA 3T1WA 5EZIL 4RGNE 5H94B 1JPFA 2F53B 2XTJC 4DKDC 5GGSY 3KPSA 4G6KL 3G5YB 3S3JA 4KK5D 4WO4B 1UYWH 5L88L 5T5FH 4CW1B 1XIWD 2CDFA 4GXVL 1LILA 1F4YH 1JGUH 4PJ9D 4O2EB 4XCEA 1CXFA 3FB7A 4R2GC 3CZFA 1FL3A 3M1BA 3QCUH 4NUJA 1NPUA 4JKLA 2ED7A 3KYMB 3QR2A 4OI8A 4DN4H 4FQLL 4QXUL 3STLB 5DJ6A 1AD0A 1QLRB 3H9YA 4MDIB 4PV8A 1JGDA 4K3EH 5EZJB 4JDVA 3IFOA 1BX2A 3NIGE 5FKPB 3ZKMD 2XWJA 1VHPA 5D7KD 1JPTL 2BNRA 4MAUL 3PWJA 4NQVB 3GSWB 4AL8L 5SWSD 1K2DA 1RZFH 2YWYA 2AK1L 4YXHH 1MCCA 3DYMA 3VXSA 1INEL 4N8CH 1FNSL 5TE7L 4OD3L 5F7YC 1X6LA 2HLFD 3QA3B 4G6JH 5FV2A 5JW4Q 2PCPB 4R7NA 1WTLA 1Q9KA 1EJ6A 5TFSH 2P1YA 3G5VB 4B41A 5C08D 1EK3A 4AEIH 2YK1L 3FO2A 1UC6A 1P69B 1MFAL 3ARGA 3KYOA 2AS5M 2QJDA 1MCBA 2IH1B 2CLRA 1VEMA 4F2MA 1F3JA 5SX4H 5FYLE 2Q76B 4UV7L 3VXMB 3U0PB 4U31A 4WHCA 5L8LB 1MCQA 2VL5A 1C7SA 5K9JH 5I1IL 2B20A 5HGDA 5ACMA 2PTVA 2XZCH 2FRGP 1RZ7L 3IB4A 1HKLL 1X5HA 1H0DB 4LU5H 3UBXI 2OR9H 4YHIA 4JHBA 2APXA 4LLVB 4M62H 4M7ZB 4X8JB 2ZG3A 3E8UH 4ZS6D 2Y5EA 2HJFB 4P5TA 4J3WA 3LSOA 1ETZA 4AH2B 3D3VE 3MBEA 2HT2C 3EYSL 5GZOC 1UACH 2HH0L 2CPCA 4P2QB 2V6HA 1P53A 4QOKE 4OLVL 3TLRA 5JLZA 4HSQA 1B6UA 2KH2B 4HD9A 1I8LC 1S7VB 5I76A 1J8HE 4D94A 1KELL 1KIQB 4Q2ZB 4PY8I 1O0VA 4D3CL 3D25B 1ZVSA 4KRPB 2W0KA 2VWEC 4ORGB 1QPXA 4L4TA 2J8HA 3RUGE 4QHKI 1YY8B 1U8MB 1DBJL 5I1KL 3JVGC 5C9KA 3RWFA 1KLGA 3CLEH 2W9DH 2ERJB 5EULV 5H37G 1FGVH 5B3NA 2ADGA 3LOWA 5C0DB 3HG1B 3L5JA 1RZIB 3NZHL 2R0WH 5JR1L 1NSNH 2RB8A 3TGXA 3O9WA 3P0VH 4JKPL 2DI7A 2A38A 1R5WB 5FF6B 4DTGL 5DO2C 1MI5A 1IM9B 2V7HA 2ADIB 5CJ8A 5AYQA 3SDDA 4GRMA 4CVWA 4JFHE 1MCPH 3CX5J 4LMQI 4KKAC 5D2LB 1M71A 1RSFA 4PRIA 3CDFA 5HI4C 2UWEB 4JAMB 3X3GH 3QRFM 5E8DL 1WT5A 2GY5A 4GW5B 4MJIA 2EH8H 3N1GC 4XH2A 4H0GA 3S5LA 4M7KL 1QRNA 5E99L 4JFYA 3MJ9L 5D7IB 2PKDA 4YGVA 5FO9B 3LMJH 3VFTA 5DEFA 3MRJB 3TA3B 4OZGB 3PGFH 3GMOB 4XHJC 1A1NB 3OX8B 3RWHA 2UUDK 4HIIB 4JE4B 1EAPA 4MCYB 3TF7C 5GRJL 3FTGB 3UJTH 5CSGA 1WFOA 4OIIL 1WV7T 2X4OB 1I8LA 1NUNB 2WZPD 4PJXA 1PSKH 1I8IA 3CUPB 2VDRL 2HMID 3H0TB 4Y89A 5E2WL 3T65B 3Q6FA 1OTSC 3OXSA 1OGTB 2LAGB 2CRMA 5EA0L 3LKRA 5JIKA 3Q5YA 4POYA 2BOBB 4L8CB 5B39G 4XTRC 5ITFB 4EXKA 1J87A 3WIIL 3F58L 2VAAA 2QKIB 2X4PA 2GK0B 2IAMC 4MMXC 3DXAE 4R6UA 1YNTB 5HHVL 5CCKL 5BZDA 2JIXA 1J1XH 3M07A 5F96L 4IJ3C 4PG9A 4KY1H 2WLYA 1AFVH 2A9ML 1RIHH 4O2EA 4V1DE 3MOAL 4HZAA 3MLUH 4ZXBB 4TSCH 4ELKB 3WIFA 2CIIA 3TT1L 2BDNH 4NDMA 1N64H 2PUQT 2PO6C 1ZGLA 3WHXB 5I71C 2A1WH 1YYLL 2FGWH 4ZDHA 1P4LA 1A1OA 3PHQB 2X44D 3QQ4A 4JRYD 3WXVL 1OY3B 4NN6C 4MJ2A 4OM1L 1PYWA 3TN0B 2PYED 2R2BB 5AWNL 9CGTA 1J05B 2MTPA 5DTFA 3QI9A 2RGSA 5IMMA 4QNPE 1CE6B 3ARBD 4MAYC 5KVEH 2CH8A 4EBQL 4P5KA 5GGTH 3VRLF 4P23D 5JPNB 1OPGH 1F3DH 3MRFB 4XB7A 4JKMA 5KVDL 1RZIA 5DD1H 1S7UA 5KSVB 1CXHA 1MPAL 3S6CA 4FOMA 3CXDL 1WEJL 4JO4L 4WTXA 4Y5VB 1RULH 4X7TA 1JV5B 1LQSR 3KXFB 4PJ5A 2D7QA 5GGRA 3SE8L 3P11H 5DDHA 5BS0A 1J0IA 4APQA 1C5CH 4PTTB 5ADPH 1ITBB 3U1SL 3ZYOA 4PJ7B 1IT9L 1KPUB 1W72B 2VE6A 3FOMA 3DYOA 1UH4A 1G7HA 4O51B 1KEGL 2P5WD 3TA3A 5DJAB 2DQGH 1P4IH 4PIRF 2XRAH 3QEQA 5C08B 3VXTA 5BS0D 1YEEH 3RA7L 1CDUA 3H7LA 4B5EA 1CGYA 3BOVA 4I3RL 4HWEL 2YXFA 3JTTB 5T33H 2BXZA 3O4OC 2O5XH 5ICXA 3LKQB 5F89A 5DJCB 2R2HA 1MFCL 1YEFH 4MD0A 1A7PH 1WCBB 3T0AA 1T83C 4I9WD 4L9LC 3RZCB 1DBAL 4OSUL 3IAGC 1NCTA 5TE6H 5B39B 4FQ2H 1DN0A 2BVOB 5TPWL 4GMSL 5D7JC 4JB9H 2EC9U 2ZSVA 1G9ML 2X1XR 1SBBA 2LV4A 1PX4A 3L5WA 5JW4N 4H8WC 2OXGA 1AXTH 5FM8A 1KPRA 4FTVA 5D5MA 2JCCA 4DJMA 4OFYD 1CL7I 4OCMC 2OL3H 3B2UD 3KPLB 4I0PA 5EO1B 1JN6B 5C70A 1U8MA 2FIRT 3FJTA 5EOQL 1S7WB 4OFYA 2X05A 5KTEH 4KQ4H 3WNKA 1EO7A 3FRUA 4PJDF 5DEZA 4PB0L 4HULB 5F44A 2FECI 2G75A 3HFMH 1XIWC 1SMOA 4BYHA 4JZOB 3RPIB 4NZTL 4D9QE 5DJ0B 3WUWB 4PJ7E 1GOGA 5CD5C 1DBML 3QULB 5T1KA 4YBQD 1I1AA 4DGVH 4UAOB 3NACL 4XGZB 1OARL 1A22B 2J1KA 3BDXA 1KCVL 4NWTH 4M1GL 1AP2B 4XNXL 4RISL 1QSEB 2VXSL 4MNHB 2YN5A 3LKRB 3I9GH 4AENB 1R3IH 3HE7B 3N0PB 4OAWB 4X9FA 1E4KA 3BPLB 4F7MA 2QSCH 3BH9B 4HV8A 3RNKA 3FCTB 1MEXH 1RZGB 4G8IB 3BP5B 1DUYB 3RIAK 3DMMA 2AGJH 2GJ6B 4M4RA 1NC4A 1S3KH 3NABL 4ZQKB 4JFHD 4AG4L 1I1FA 4NPYB 5SWSB 1DQDH 1KCKA 2EIZB 3ZT6A 4S0TD 1ZWIB 5FYKL 5F7MC 4HK0A 3RDTC 3I6KA 1FVEA 1VENA 3PL6C 2GJZB 3GKWL 3MV8E 5FDWB 1S9WB 3ALXA 1EJOH 4NKDB 1JNLH 5DHYA 1JZ8A 1MH5A 4TYUA 5F7DB 1FFNA 1ZGLM 1YQVL 2DQTH 4W4NA 1PEWA 1JGUL 3EJYD 1YNKH 3LPFA 1AY1H 3SCMC 1T5WB 3IJHA 5IB5B 4X9GA 2HKFL 4GRMB 2IEPA 3U83A 2UWEF 5DLML 4QRQA 1UADC 1BZ9A 2FZ3A 1M6OB 1G1YA 3EYUH 5HYJB 4JQXC 1J18A 1MJ8H 3DUHA 2HAZA 4D9RD 3SOBL 3FB5A 4HCRH 4OCLC 4QCIA 4XCNA 2DM4A 3L3HB 5F1NA 4RGNC 4XC3L 1T83A 5D7LE 3QUXD 5JDSB 5D96B 3G6JA 2VH5H 1R3HB 4MAUH 1FQ9C 8FABA 1LVEA 4HGWA 3LIZL 4Z7UF 1U92B 3ULVF 3IXAB 1S5HA 1TVHB 3IJYA 1PLGH 4P46B 2AK1H 2RFXA 4PJCB 2C3WA 2ZUYA 4GMTH 5DMGC 4KC3B 3EHBC 5TE7H 1FLRH 2FIKA 4HKJA 4IRSB 5IK3A 3RQ3A 5LJYH 2Q8BH 4E5XB 4XCYA 2X4RA 5I1GL 1YEGL 2JIXD 5J3HC 1FYTB 4Z95L 3EFDL 3ORJA 3WO4B 5C07D 2VLRA 4EI6A 4ELMF 5SWQA 4Q9RL 5D8JL 4ZUWA 2E7BA 1VERA 2GK0A 3GMLB 5F7NC 4HUWA 3CCHA 2FHFA 2X10A 3QULA 4XC1H 5IVXB 1F45A 2NNAA 4C54A 5KSBE 1R5IB 1KJ3H 3T04D 4C56E 3TO2A 2O5YH 5CEYB 2DB8A 4APQB 3QHTC 3EYFA 1UENA 4OBSA 3R4DA 3UTTA 3IDIA 4DCQB 1QQDA 5D7SL 2J88L 3H6JA 2QSVA 1Q9WB 1RVFH 3T2QA 3ULUH 1FFOA 2DWDB 4WW2C 1A1OB 1UVQA 2EEDA 5CAYB 4JN2B 2Z31B 3QH3B 5GQBA 1YA5A 1RZ8A 3F7PC 3I02B 1NGYB 1HCVA 2UY6A 1ZANL 4IHOA 1YJDL 2YC1B 1RUAL 1RK0B 2ITDB 4QHUA 3F5WA 2QQNL 1A6UL 3NPZB 2YPLD 3RDTA 2P42B 3MRFA 3AU1A 4TUJA 3D2UD 1F2XK 5CMAA 4FQCL 2WK2A 3SKMB 2R4SL 1NEZB 2XG5A 5D1ZB 5AYUH 3VDBA 1PZ5A 1Z9MA 4NZUH 3CFBB 3LRSA 4LLWA 1WQVT 3QFJD 1NBZA 5MI0B 3FN9A 5I17B 5LGKA 2NR6D 3GSXA 2EDQA 4K8RL 4PJBB 3WE6A 3ZL4L 2RCSL 2EYTB 3Q1SH 5H8DA 1NCNA 5DZNA 3BQUD 5C6TH 4I0PB 5EO1A 1CFQA 1FN4B 5T3ZH 4L4VB 1GGTA 3BKJL 5E8NB 4LLDB 4FP8L 4UIKL 1JHKL 4CVXA 3CU7A 2KQNA 3DV6B 2NW3B 1SMAA 1W0YT 5HHME 4TOYL 1T7ZA 4P3CH 4X7CC 2B2XH 3ULUD 1AXSB 3W0WB 4NC1C 4HPOH 3UC0H 4LSSH 1ODAA 2O61A 1NEZG 3S4SA 1T2XA 3GJEB 4U6XB 1J12A 3KPSE 4GSDH 1MY5A 3V5KA 3MJ9H 5IROC 4L1DA 4U05A 4UV4H 3QEGH 1EH9A 3L6FB 5CHNB 4FXGB 1ND0B 4WWKB 2P4AB 2Q7YA 1YY9D 1YMME 3MCLH 3ZKXB 5B8CC 5CIPB 3AXLA 1JPTH 2FEDC 2ZSVB 35C8L 4JFED 3QFJA 2A83A 4MA3B 1Y6KR 3QXAA 2PYFA 4P2OC 3DMMB 4UINH 1F90L 1MCOL 3NAAH 2A73A 5EA0H 4BQCA 2VSDA 1S7RB 3T4YB 3ARBB 5BMFL 3BI9X 3BN9D 4PJEB 5ACZB 3QUXC 4P23B 4X4XB 1WWWX 2YD7A 5DVKA 3DVGB 3S3PA 4W6WB 2CDGB 4ISVB 3EYQC 4PJCE 2R0LH 4S1DC 2QHRH 4ZS7L 2CR3A 2AV7B 3AROA 5FUCE 1H3VA 1T0MB 1S7TB 4ODUB 4KY1L 5CGTA 1PD6A 3MOAH 1DANT 1T0NB 1U6AH 5DFWH 2P8LB 1TNNA 3SDAC 3OBAA 2C4FT 3MV9A 1MHPH 4NHUA 4WY7H 3JV6B 3EJYC 4L8SC 1CU4H 2NY7H 4PLKD 1DBKH 3V0WH 5SWSE 1XCTA 3GGWA 4MNGE 1FL5B 3FAXA 4F7CA 5CKAA 4NO0B 4V2BA 4AY0A 4HX1B 5F9JB 1B0RB 5K93A 5I19H 1K8DA 2E9IA 4UT6L 1A9EA 4LHUB 3TBTB 4OQ1A 3ZE0F 4MD4B 1AI1H 5I1CH 5ICYA 3KLDA 2EYSA 3ZT7A 3BEWB 1GC1L 1KIUA 2B39A 1RMFH 3P9LB 2HT3D 2Y7QA 5ICZA 4PGJA 2BY3A 3QCVH 4OJFL 2ZJSH 4KUZH 4P57B 1DQLL 1FIEA 4F2MB 3MCKA 3DUSB 3UTZA 1MPAH 4YHOL 2NW3A 3MRGB 3VI3F 4DUVA 3FQWA 1ES0B 4B50A 3T0VA 1Q9WA 1AGFA 5FO9A 5HGDB 1A7BA 4JCLA 1MQKL 4JY5H 3L3KB 1LEIB 4F9PC 2V5YA 4P46D 4N0FB 2A6KA 4O4YH 3BDYL 3ZO0A 2V17H 3C8HA 3D18B 1AIFB 2ICWI 2EDTA 2FJHB 5HGBB 4HJGB 1U3HA 2OL3A 3QIBC 3T2NH 2HKHH 5C0DA 1Q9LA 2VLME 2YOCA 2G9HB 5F1OB 3CC5B 3RZWA 4OF8A 4FMFA 1F4AA 4QEGA 5A2LH 4JPIB 2C7UB 4JCMA 1CD1A 3DRQA 4NOFA 3VXSE 2VZ1A 3QXAB 4PBXA 5D2NB 2NY2D 3ZSSA 4OSUH 2ADIA 4PBWD 2NY6B 2EKJA 3FO2B 3IDYC 5TE6L 1GH7A 1NAKH 4G8EB 5FECA 4LLUA 5GJSL 5DGQA 1J8KA 4JHWH 3QDME 1ORQB 1T66D 3AC0A 2MSPA 1BEYL 4J1UA 4RAUA 4WUUB 4JR9H 3QEQD 1BVLA 2OL3L 2R69H 1LDPH 2VOTA 1WZKA 1LO0H 4O02L 3FFCD 3O8XA 3MRIB 3VJ6A 3BN9C 2BSRA 2YA0A 3BPNB 4JZNA 4OLUH 4P99A 4PJIF 3V5KB 1N5AA 3MMEB 5C0CD 5D1QA 3VW3L 3AGVA 4M7LH 4F7TA 2R1WB 1VEPA 4MD5A 3MBEC 5JTWA 1U8QB 4YPGB 5J89A 3E6FA 2BY1A 2VXTH 3TZVA 2M2DA 5IFHL 3VH8B 3VFGH 5CGYD 1L9MA 5CIPA 3VI4E 4DK3A 4QHMB 5CSBA 1I1AD 5A16B 4WHTB 2NY4D 3QFJB 3UXFA 1PQZA 3BH8B 5KS9A 5L2KA 2XA8L 1N7ML 4QOKA 3V52H 4LVHB 1KCUH 1MELA 3WJLA 1JHLL 4OZ4B 4O00A 4I48A 5GGQL 4TUKH 5DC4B 1LO2H 3F5WB 1FZJA 2VQ1B 4ZFZA 3MRGA 3IFPA 3LKNA 3OAYK 4JKKA 5CMAB 4AG4H 1ZGLB 1CBVL 4C58B 4WNQA 3EDKA 1B9ZA 2CDEA 4PLKC 5HGAA 2VWEE 3O2DH 2CXGA 3SDYL 5A40E 3S34L 5EWIH 3HR5B 4Y4KA 4LFHD 5KVDH 1OCWH 1IM9D 2APBA 1LEKB 4PRIB 1MIML 3VXUD 5LQBH 4H88H 1I9EA 1YPZA 1MLCB 3EYQD 1NFIA 1EHAA 2NYYD 4OUUA 4FQXD 4JFEB 4LQFH 1U41A 1XF2A 2EDBA 3RVUC 3LZFH 2BY2A 2I27N 5HI3C 3MLTA 3G5XB 5BO1H 5D1XD 1YEIL 4LFHG 1EZVX 3P4NB 1JPSH 5KSUA 5EUKA 4NUGL 1DUZA 3QXVA 4ONFL 5DVMA 2ZCLL 3BVNB 3OGCB 5DC9B 2H9GA 4CADA 4EDWL 1AGCB 4HWEH 2NY1C 3GM0A 3FQNB 2JTDA 2NX5B 2H26B 1ZT4A 4R7DA 3AREB 3K0WA 4HFUL 1OP9A 3IF1B 5D7IE 4YDVA 1OAZH 3VG0H 5T5FL 2Q8BL 5E00A 1CYGA 2OZ4A 1S7RA 4HDIA 4JB9L 3B6SB 4ZTPL 4R96B 2BSED 3RNQB 1A6TB 1DQJB 3L7EA 4P23A 5TF1L 5DJCA 3MJ7A 1LNUB 4Q9RH 4ONHA 2BY0A 3BWAA 3CSGA 3TPUA 2A74A 1U58B 4XC1L 4LHUD 5F7LB 1T1YA 5HSFA 4Y5YB 1QSVA 2MQ3A 4OZHB 4K3EL 4XP6H 4MCZA 3T0EA 2DQUH 1A5FH 3HAEA 1JBJA 2PTUA 4KVNL 4M1CD 3R0MA 4K9EL 4OCRH 5ALBL 2FH8A 2AK4E 4N5EC 5EU5B 3OKNA 3QUYA 2KL6A 4YXHL 3PWUA 4UOW1 5C7XH 2GJZA 3B3IA 5K9OA 4WCYL 1T03L 2Z35A 3NACH 1MLBA 2RBLA 1BQLL 1W0VA 2ZKHL 4C83A 3ZDYE 2G75B 2IPKB 3GRWA 3S98A 5KVFH 3JV4A 5B21A 1JCKA 2MKLC 2F8VA 4JFFD 4O2CA 5FGBC 1SY6H 3WFDH 5C0IB 4Y8AA 2DYPB 3IXTB 4XAKE 4F7TB 4HUXA 4RIRB 5C09D 4ZS6C 5GRUL 3ZKNC 1HHKB 4CU7A 5LCVH 5GZNC 4WFGE 1SM3H 3C5JB 1R3JA 3C08L 1E4XL 5TE4L 3KLHD 3BGFB 5F6IB 4M4PA 3QO0A 3G6JB 3BP5A 4GQ9L 3PGCA 2F5BH 3OMZA 4XVJL 1QFHA 2DLEA 1SQ2N 5ETUA 2ITCA 2R0ZH 3KHQA 4YO0A 2Q3AA 3LKQA 4CW1A 2Z0BA 3BWUC 3PL6A 2OTPA 4RAHA 3MACH 4DUXA 1AY1L 2CUIA 1A7NL 4OKVB 3I6KB 1Y6NR 1NCDH 5F9WC 1RJZB 1CGTA 5IQ7H 1I3GH 2YD2A 1DFBH 1HOCA 1FCCA 5HJ3A 1OWRM 3TZVC 4WUUE 3UTPD 3ZHKA 5C2UB 1KN4H 1MJ8L 1KJ2B 2ADFL 3BHBA 4G8IA 5FO7B 5EOTB 3IDMB 1EHLL 2WM0A 4HG4J 2VITB 1EV2E 2VN4A 4H1LH 5CUSH 5H37H 3MNVA 3O3DB 3KPMA 3MZGB 2IAND 5AZEL 5EZJA 1OAQL 1MCEA 3OKEB 3PWVB 4KKLD 2OI9B 5JNYB 1JTPA 1RUPH 1UM4H 1FORH 4L3CA 4XVUD 1FVEB 4GW4A 1QKZL 3MRRA 4UIMA 3IGAB 4PGCA 3ARDA 4P4KD 1MLCA 2EKSB 4BH7A 1AD9A 4NYLA 1X5IA 2P8PA 4NN7B 4PJDE 4L4TD 4Y19A 3OKOA 3U4BL 1FLRL 4UQ3B 32C2A 1QP1A 4TVPE 5CILH 3RHWK 4OD2B 4Z95H 3SY0A 4ZMAT 3P0YL 3KPQA 3VJ6B 2UZYB 3IXAA 3T0EC 4Q2ZA 8CGTA 2AI0H 5HYEA 2A0LD 4JHAL 4WU7B 4U7MA 3SDCD 1I1YA 2XN9D 5C0BE 4I2XE 3WUZA 1R5VB 1A6ZA 4WY7L 1XGUA 2IBGA 1QVOA 4HH9B 4BQ9A 1IBGL 4HUWB 1EFXA 3QUZB 4WI2A 3GSRA 4RMTA 3D6GA 2EDYA 4LSTL 3QO1B 4U6VL 3WLWD 3E3QE 4X7EC 2AJXL 3RU8L 1J86A 1AI1L 3PP4L 4P5TD 2DQHL 4OLWH 5L0QB 2EZ0D 3ILPA 4JFZH 4M8VA 2W92A 4ODTH 3OJDA 4WNQB 3TVMB 4EN3D 2NY6D 2DLFH 2WBJD 4HJJH 4ZXBD 2J8UB 1MHEB 2OJEA 4RBPH 3DX6A 4LVOB 1WWAX 2JF1A 5EU3B 4Y16C 4ZAKB 3KLAB 4OTXL 4PGBA 6FABH 3O3EB 3BZ4B 3GJFK 1MCSA 3X17A 2LQRA 2B4CH 4CJ0A 2DQDL 4D0DA 4NOBA 2Z8WC 4AIZA 1KJMA 1EMTH 2AQ2A 4JG0H 1FSKB 4GOSA 3KS0H 4GRLD 5IW6B 3ZKND 1KXTB 3MGTA 4ZPTB 4NJAH 3QCTH 1A3RH 2XFXA 3BO8B 4UBDD 3ZDXE 4N0CC 1HINH 1JHKH 1QYGL 4QNPF 1FLTX 2NZ9C 4WEMB 5E94A 3QWQB 5C0CB 1PZ5B 4M62L 3S37X 4X6EA 2RHEA 4HBQA 2GITB 2H3NA 3HC0A 2W0FB 5FEBA 1FZKA 2AV1A 3DX8A 4XBEH 1MHCB 2Z92B 5D2LA 1U3YA 4U1GC 2IH3B 5IFAH 5LGHL 2E6JA 5DD1L 5LBSH 4LSQL 1WAAF 5ESQB 1CF8H 3LN5A 5DT1H 2Z4QB 3M8OL 1CTOA 4X4MA 5JHDB 1WFTA 1OSZB 2VDOL 3MRHA 2XZQH 3OR6A 3UAJD 1F4XH 4HUUB 4FQXA 1P4LB 4KK8D 1BHGA 1FJ1A 1EO5A 2NY5C 3CFIC 1WZ1L 2I07B 5I1LA 4Z76B 3V2AR 4M1CC 1HYRC 1A3LH 3U6RB 1TCRA 1XFPA 4NNXA 4JO3H 4RSVA 4OI9A 1M71B 3EBAA 2P5WB 1FO0B 2AK4D 3CFKA 4B7IA 4FA8A 2AEWA 3BMVA 5HHMD 5C1MB 1KB5L 4Y5XB 3C9NA 1WT5C 1U8PB 4WHYG 2F19L 1SJXA 1B2WH 1D5XA 1F6AA 1RIVL 3MOBH 1PDKA 2L0DA 3GMOA 1R3LA 3V5DA 5T1LD 1X5JA 4GG6E 1FH5L 5C0CE 4KDVA 4QF1A 5CJQH 4IRJC 1FNEB 2DF3A 4NRYB 4NQCE 5CP7A 3H0TA 4UTAH 1NFDF 3HE6B 2HJKB 3U0WL 4X4YB 5IG7A 1ACYH 1LD9B 1YUHA 2OS7A 2DQEL 5GISL 5L2KD 1VB9A 4YDIL 5JPMA 4H0HB 3C2AH 4OIIH 1ZK9A 3BN3B 4NP4L 3OKDB 3A67H 2A0LC 2J6EL 2DQCL 3IRPX 4ODHL 4P4RB 4P9HH 1BZ7B 5BJTA 4KMLB 3WDJA 4CL7A 4JFQA 1M7XA 3WFEL 3MBXH 2BNQB 2ED9A 5E2TL 2FJGA 2CMRH 2OCFD 5DMKB 1S7QB 5C0FB 3QWRD 4F7CB 4P9HC 5I66B 5EG6C 4KTEH 3QCVL 2RIKA 3C5ZC 3O0RH 5IB1B 4XVSL 3A6CL 1L7IH 4EI5B 4DVRH 4S0SD 5DD3H 4ONOA 1V7ML 1S5IL 4E0RB 2R8SH 1GC1C 5FA3A 4PGEA 3L7FA 3IFLH 3ABZA 5LWYL 2D4FA 2VDML 4LSPH 4RISH 4P3DB 3BZEA 2QR0B 3QI9B 4L5FH 4KPHL 5EORH 2A1WL 1AJ7H 1BREA 1DQQB 5HVHC 5EPMB 3O3AB 5BO1L 4FABL 4DQOH 4L8CA 3BT2L 5E5RB 1A6ZB 5DMYA 4KKBC 4RGOL 4KTDL 2ZCLH 1A7QL 1DEEA 5ESVB 3WD5H 2J8UA 5IVXF 1ZS8B 5EOTA 3C09B 5IESH 1QBAA 2W65A 5DS8A 5GS0D 5F6HI 5JOFB 5T1KD 5I1LB 2N1KA 3I84A 4F7EB 3GSNB 4G6MH 3ULVD 3HZKA 4LGPB 4XNZC 4IIQB 1EJOL 2QADC 5CJXC 3NA4A 3VFNA 3ZYZA 4I77H 3VG0L 4GW4B 5T3ZD 1MCWW 1IILE 3UDWA 3WDIA 2DQTL 3OB0H 4CDHA 1A3QA 3VXUA 5C6WH 3FO0H 3GFUA 4BK4A 4LARH 4HKBB 3FQRB 3HHRB 3VWKD 2VR4A 3CXDH 4Y4KD 4POZC 3FL7A 5JXAH 2Q1EA 1V05A 1CFBA 1WJ3A 5I16B 5DQ9A 1C5CL 3MJ6A 3JWOH 4NT6B 4ZQKA 1IKFL 2AABL 1L9NA 3SOBH 1KC5L 3L5IA 4YE4H 4I18C 3BUYB 4PG2A 1CDIA 4YAQA 1FC1A 4JFPA 5JMOC 2CXKA 4F9LC 5INCB 4FG6C 4URTB 4YHNB 3SE3A 3MGTB 3QDMA 1H5BB 3GK8H 1SJEA 3ES6B 1IM3A 1D9KB 2YRZA 4L29B 2FBJL 4ZFFB 4ZD3L 2Q6WA 2X4SA 2HVKB 5E0QA 1IC1A 1H9VA 2OM5A 4X6EB 1CCZA 1YN6B 5E56A 4ETQB 2DIAA 5FUOH 1PG7W 2Y06H 5DRWB 1KTLB 3ZZ1A 4WV1C 2ZG2A 2D3VA 4KI5C 2VJXA 2XA8H 1VGKB 3HN3A 4U6TA 1KCUL 5DZLA 3V79C 4N0UA 3I75B 4LCCA 3EIFA 1S9VA 1AXTL 1P2CB 1QBLH 5D8JH 3WKMH 5I1AA 1LO2L 5IJKC 4MXVE 1TQBC 3K4DA 3QEUB 4Q9BA 2BVQA 2R2EA 1F00I 1NJ9A 2ARWA 4AZ8A 4WW2A 4P4KB 5A2FA 3QDAA 5IB3B 3C08H 4XAKD 3DSFH 3U30C 1PJ9A 3S34H 5F21B 3CDYA 2FJFB 1H15A 3MFFA 4TQEL 2XTJD 4NQSB 3WL9A 5F7EH 3HZVA 1FBIL 1AC6A 1T1XB 4HXAH 1NMBH 1W8NA 4WFGD 3HMWH 5A2KH 5A16A 3QFDA 3PF2A 5ERWA 3GNMH 3S8WA 1GPOL 3T4AA 1H3UA 2HT3C 3W5MA 3H9SA 1ZHNA 3P4OB 3OAUL 1ADQA 1CICD 2UZXB 4NBZB 3MUY1 4FFYH 5DVNA 4MA7L 1OW0A 3C5ZD 5HYJA 1KN4L 1J0JA 1JN6A 2BNRB 2DQFA 2FH6A 4XMKL 4OCYL 4F58H 4MXVF 3EYFB 1WICA 1BBDH 3WNLA 3S4SG 3S88H 2AGJL 1KB5B 2NY0D 2A74B 4AEFA 4FQQA 4DCQA 5GS1B 4HWBA 3EOAB 2NX5E 1IC4H 4IDLA 4GG6B 3C6SA 4K7FB 1I85C 3QHZL 4XVTL 5T5NG 2PW2A 1BJ1H 1OTUC 4M93B 1B3JA 1LEKA 2D9QB 2Q8AL 4F80A 3BIBX 1HSBA 3HS0B 1JNNL 1T1WA 2F15A 1YPZB 2CUHA 4U6YB 1NUFA 2OTWB 4X6CB 3BGAA 5DMIH 5CJOH 5DJDB 3V6OA 1OAKH 4RWHA 5I66A 2F8OA 1MVUB 1NCBH 3LPGA 3QEQE 5JDSA 1P6FA 4IRJD 2X4SB 1RQ5A 4KRMB 3OF6D 3E3QC 3H42L 3VGAB 5I1EH 5J11B 3T3MF 1JPGA 4I3SL 1F58L 2IAMD 2VDKL 2VXUL 2PF6A 4JO1L 4XX1E 2BNQD 3W2DH 3UJIH 4Z7VF 1G84A 3RKDD 4DAGH 3BRFA 2DYPA 1MAMH 4CADB 2XTLA 5JIPA 1AC0A 3MR9B 4PRAA 1DL7L 1IBGH 2VDNH 3U7AA 5HHOB 4U3HA 2R2CA 3CXHJ 4QXGH 5J8OA 2WP3T 1BM3L 3H3PL 4NC2B 2VDPH 3NPSC 4YPJA 5DURD 4BK5A 1NBYA 2H2SD 1A6PA 1X44A 3MGAA 4KJPC 4KI5E 2EH7H 5EO0A 1UJ3C 2EDOA 1DSFH 5F3BA 2PXYB 3LQAL 4LEXH 2A6IB 1BQLH 1QNZH 3I50H 1YEGH 4K9EC 4XHJD 4D0CA 3QUYC 4PJFF 2O26U 3I6GB 4IIQA 3VFNB 4C59B 4G6AC 1HHJA 1NC2B 2R0LL 2X9XA 3MJ7B 2AXHA 4MJ6A 4YHNA 1K2DB 1ZGLP 2Z91A 3PABA 1HEZB 1YMHA 3B9VA 4QRPE 2E8YA 3MXWL 4ZSOA 4DWHA 4KROB 6FABL 2EICA 1KCSL 5IJVA 5GJTL 1HXMB 1CXLA 3SJVA 3OKLB 5BVPH 2B4CL 2XICA 1LEGA 2VAAB 1CVSC 5FA3B 1OD9A 1I7ZB 4GAGL 5LCVL 5CZXD 4PP1D 2ZUTA 5EBWA 3TH4T 4OGXH 2W07A 2Y6SC 5HYIA 2MPAL 1QFPA 4I3GA 2R0KL 4HUNB 4POZD 2EC8A 3RWGB 2VIRA 2MOVA 4F9LA 4QRPD 5DF0A 1QRNB 2HN7B 1IMHC 2YPLE 4OZGE 3AMLA 4Y88A 1AGEB 5D70L 3QXDB 4KUCD 3BP4B 2V9RA 2IQAB 3MRJA 3QNXB 2EDXA 3C5SB 3GMNA 5BZWA 2F58H 2PTTB 3GHBL 4EUPH 3WFCL 1G6RB 5E2VL 1FHGA 4F33B 1A9BA 3UTOA 4J4PA 4U1HB 3QPQD 2XNAA 3IFNL 5HPMA 4Z7WA 2P8MB 1EEUA 4V1DD 3NFSH 1FL6A 2GTWA 3NTCH 3FZUC 3K2UH 4IS6B 2FB4L 5IQ9A 2JK5A 1K85A 1V3KA 2X9YA 2XY2A 4M3JA 4PJAB 4AEHL 4LGRB 4CVUA 3K81A 2XY1A 3DVIA 2EXYC 3EFFA 4EEEA 2J8OA 5T3ZL 1FGNL 5D4QA 4W81A 5D9SA 1EAPB 4MCYA 5DWUL 4ERSH 1PKQA 4U1IA 2DMKA 4XP9L 5DRZB 5HVWA 1X4ZA 3S7GA 2WMPA 4X0KB 1R0AL 4KH2A 4XPFH 3JBG7 2EDJA 3PXJA 1UB6B 2CIIB 5IWLA 5A2IH 1IM3B 5B22A 2X4NA 3QDGD 2EE6A 3BRGC 3AB0B 2B4CC 2VABA 5DMGD 3EDDA 3L3OB 2NR6C 1Y0LB 4GG6F 3HI5H 2XKNA 2ORBL 4XMPL 2IAMA 5DD5H 3AVEA