3TWCL

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt127 in complex with man9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
208
structure length
208
Chain Sequence
ALTQPPSASGSPGQSITISCTGTSNNFVSWYQQYPGKAPKLVIYEVNKRPSGVPDRFSGSKSGSTASLTVSGLQADDEGVYYCSSLVGNWDVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PGT127 light chain, Ig lambda-2 chain C regions
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3twcL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3twcL02
2ZSVA 3C5ZB 1MCHA 4U1SA 1FG2B 3VXME 1BOGB 4JPIB 4XCNA 1K5NB 2FYYB 3BDBA 3O6FA 4X6CA 3UO1L 3I2CL 3SDAD 5IVXF 3RKPA 5D1ZC 4OIIH 1QBLL 1S78D 5HHQA 4O2FB 1XIWC 1XAUA 1C16A 3MRKA 4OCWH 2Y5EA 1CD9B 2GKIA 3DTXB 3DUUB 4S1QH 4I8DA 4JRYD 1P69B 1X9QA 2E7BA 2BSTA 5DJ0B 1SEQL 3IJHB 4Q0XH 4JN2A 4XP6L 3H3KA 4M48H 2H32B 1T0PB 2MKLC 3KLDA 1WIOA 2GSGA 3OKEA 4Y16D 3GK8H 3QUKB 4C56A 4HJ0D 5B4MC 1JPGB 4MCYA 1G7LB 3FO0L 4OF7A 5BW7C 3P0YH 2DYPD 1PKOA 3V5KB 4LSQL 2H2PC 1N5AA 1JK8B 4YGVA 4KZEH 3ULVC 3LCYA 4XNZB 2PYFA 4OFDA 1J1OL 4OI8A 3QULA 4XNQA 1YJDH 1QRNB 3EYFA 4LGSB 3LIZL 3TA3A 5F7LB 1JNHB 1U6AH 1NEZG 3SJVB 2FL5B 2OTWB 2YRLA 4DGIH 4XP9H 4UQ3B 4G5ZH 2NXYC 3FQXA 3OKNA 4Z7UB 3F5WA 2VKWA 4KK6D 5IHZB 3BPOB 4S1DD 5J1TC 1UVQA 4K7FB 1UGNA 4OQTL 3TNMB 2G2RA 3KJ4C 2CDEB 2PETA 5KN5A 3O6LH 4J4PA 2FWOB 3EOBB 1FVDB 3WKNA 3AREB 3KYKH 1P7HL 1A9BA 4XXCC 1GGCL 4F80A 4GKZA 4IRJD 4EZMA 1DBKH 4HIHA 5D2NA 2F54A 2EXWC 3OGOE 3BQUB 4UIKH 1KEML 5C92A 1CDGA 3NFSL 5T5NF 3IFLH 3NFPA 3VXUE 3WUWB 3L5XL 5E8NB 1X4ZA 3I6GA 4JFXA 4WWKB 5GJTH 1EEYB 4BZ2H 3ARBC 3U82B 1CU4L 4PG9B 1MOEA 1HE7A 5I1KH 1K6QH 5C0ND 4P5MA 3LN4B 4U1MA 1DDHB 4P3DA 4X4ZA 3S35H 2PW1A 2R23B 2PF6A 4FTVB 3DETC 2VLRB 1O7VA 1JNNH 4FNLL 4GUPB 1EHAA 3VFVA 3LDBB 4XPAH 1BGXL 1SMOA 4FFZL 3PWPA 4ODTL 1TCRA 1FZMB 1I7ZB 2WUBH 3CZJA 3S7GA 1ROWA 3O9WC 5T1DL 2I5YH 3WD5L 3QUML 4HC1L 4KMTH 2YUWA 3RNQB 5HVHC 1I8LA 4HV8A 2WLYA 5CGYC 4G7VH 4L8SC 4JO1L 2BVYA 4Q2ZB 5E4EC 5CEZD 4LCYB 3NCEB 2OMNA 5JORA 2NY1C 3T0VA 4HW6A 2AXFB 3R1GH 4KGJA 2KL6A 3G04B 4FABL 4LASH 1YN6B 4TULH 4XP1H 4RIRA 4M9PA 4JHAL 3CLEH 5E6IA 1S7UB 4ZODA 1TQBB 1S7SA 4EXPX 4WI6A 3WYRA 3U1SH 2EKJA 1IARB 5DVNA 1X5AA 3TO4B 1O7SA 4PJHA 3U4BH 1N5YL 2XICA 5CBEB 1T1WB 3MV7E 1N0LA 4AH2B 4N1EA 3ARYA 4KROD 4R96B 1DSFH 2CKNA 4EIGB 4OGYL 1I85C 1DVFC 4GAYA 1QNZL 1NMCC 1S9KC 3RVWD 5EWIL 4PB0L 3STLA 4JE4B 3S4SA 1HILA 5C0CB 2L7UA 3A6BH 3I3BA 3RJQB 2A83B 4JFED 5FHBH 3UTOA 1RJYA 4G6KL 3D2UA 5FO8A 2E27L 4EUPA 1MFCH 2YUVA 3M17B 5EU4A 5JOEA 1X5GA 2W91A 1NGYB 3O11A 4M1GH 1FNHA 3CMOH 3LKOB 3VMNA 2AQ2A 1A7PH 1ED3A 2NXZB 3OF6D 3FN9A 5I1DB 1OGAD 4P3WA 2J6EL 3EO9H 3QRFM 4I4WA 2NY3C 2DQFA 4JPWH 4O02L 3VFUB 1DUYB 5AAMA 5BVPL 1FVCB 4DKFH 3HUJA 3S88H 4ENED 4KGLA 4HIEA 2XZCL 4LBEA 1N26A 5SWZD 2YPKB 2WV3A 2ADFH 5GRVL 4CRPA 5KJRH 4OZIF 4HWUA 5H35B 3A6CL 1PY4A 5E08L 1RK0B 3PV6A 5BJTB 3WJLC 1ETZB 2VERN 1MEXL 1QBAA 1FPTL 3FO1B 3OG6B 2PTTB 1JPTL 5D2LF 1CFQA 1IAIL 3HE7B 3UPRB 5IF0B 3UJTH 4JQVC 1DTUA 2HJLA 2DQJH 2VIRB 4C57C 3MRQB 1P4LA 3P73A 2DI8A 5DO2C 4YEEA 1S7RB 4UT7L 2C4XA 1X5XA 3LKRB 1U3HD 3CK0L 2O5YL 3GJFB 5GRZA 5J56B 2NY2C 4TSBL 5ID1B 5HPOA 2QL1A 5IESL 4PGEB 3MV9D 2Y6SD 4QRQB 5J1AA 1CQKA 2DQUH 2LVEA 5J8OA 3OJVC 1X44A 4UTBL 1MHEB 4YZFF 1AGBB 1D9KC 3WS6C 3MJ9H 1LO2H 5HHXL 4U0RC 3NFNA 1T7ZA 5TQ2H 4Y88A 5GGSB 4JY4B 4NWUL 3SDDA 2VE6B 2EC9U 1IQDB 2XTJE 5DZLA 3BP5A 1TVHA 4AEIH 1F58L 5E94B 5IVNA 1CE6A 1TJHH 2NY4B 5FHAL 2D7MA 2GUOB 2F19H 5FK9B 2AV1B 3S97C 4NN7B 2BNRE 3LZFH 4MYWB 5IROC 5TE6L 2OK0L 4FQXD 3P0VL 3MACL 1IM3B 2J6EA 1WQVT 1ADQH 1Z0MA 4P2OB 5DDHB 1KT2A 2H41A 3M1BA 4PV8A 3N06B 1U8KA 1KIQB 2P45B 2Y23A 4JJHA 1UWEH 1MLCA 3WIIH 4OD2A 4HKZB 1NEUA 3WXWH 1RIVL 3BWAB 4GQPH 1PG7L 3D69A 5IHUH 3IDJB 3EHBC 4YAQA 2F74A 3X3GH 1NPUA 4YR6B 1RUKH 3QZWB 1BFVH 1U8NB 3KPNB 3RL2B 4PGBB 2XWBB 1DLHA 3QFJB 1TNMA 4M8QB 4XPHH 1VEMA 1I1FB 1Z5LB 4WFHD 4Y5YC 1SM3H 3KPRB 1UENA 2RFXB 1DBML 1E4KC 5E5MB 3P77A 4JFFA 1RSFA 1CICB 1WVZA 3FHAA 5FYLH 1IEBA 1Q1JL 5I73B 1DEEA 3BMWA 1OAYL 3E8UL 4X6EB 5D1QA 4JGMA 2BHUA 4L4TB 1MCQA 1Q0YL 5DLMH 3OKOB 2OL3A 4O4YL 3RY4A 2H6PB 3P4MB 3RP1A 1IT9L 4HUWB 4DEPC 4XXDB 3VDCA 3VXQB 2G75A 5CJQH 5J1SC 2XACC 4XMLH 3SJVE 1NDMA 1DQTA 5EU7C 1JGEB 2OJZH 5C07A 5C6WH 2CO7B 5LGJA 2NR6C 3RTQB 1QSFA 4I5BB 2O5XH 4IOIA 3TIEA 4ZO7A 2P24B 3BUYA 2B8OT 3WN5B 4Z78A 5DI8B 5HYIA 1LDPH 1VFAB 2HVKB 3PWJA 3HRPA 4ONFH 4WFGE 1VCAA 2XKNB 5F88B 1TQCB 3O6FC 2BVQA 4N0UA 3C5SA 1W0WB 4JFDD 1ZANL 2ZPKH 1T20B 1RK1B 5K9OB 1GGTA 2WBKA 3V0WH 4D9LL 2OR8A 5IGXL 1HSAA 3TVMA 5BRZD 4Q6IB 1MCOL 1V8HA 1CXHA 3QFDB 1M7DB 3O3BB 3FFCD 4P5TB 3H9SD 5I18L 1YEIL 3ULVE 2UY7A 4KUZL 5F3HA 3L1OH 4K23H 1XF4A 3MUHL 5IQ9B 5F9JB 4MA7H 5FM8A 4WTZA 3FCTB 3TO2A 1XH3A 5AYUL 5BS0B 5CD5C 4JM2B 3BHBA 5B3JF 4KVCL 1NBYA 4D9QE 3P9MB 1AGEB 2PXYD 1QYGL 4JLRB 5IMLB 2BDNH 5FO9B 3KHQA 3MOBH 2GTWA 4D8PA 5JO5B 1B0WA 4P59L 2FB4L 4PJFA 4F7PA 4WI3A 4IIQB 4UB0L 1DLFL 4YXLH 4Z7VE 4PRNB 3GMMA 1AR1D 4NNXA 4X6DA 1GYAA 2FX9L 3ARFA 3FQUA 2OTPA 3HRZB 4PR5A 4CADA 4K9EC 1J12A 5C71A 4K3JL 4X6CB 4Y4HA 4ACPA 2P5ED 4RFNB 3WFCL 2MQCA 2V7NA 4BH8A 3ZDYF 4R26L 1YNKL 4GRMA 3SHSA 2VN4A 4XBGA 1DBAH 3LVEA 4WUKL 3LEXA 3QDMA 2BSTB 3C5JB 4OV5A 1YPZB 5DUPL 3UO1H 3I2CH 4NQCE 5TDPA 1KEGL 3NVQA 5CD3A 2HN7B 4KKCC 1QBLH 2BNQD 2GTZA 3QXWA 4UINL 1IZKA 4AIZB 2H9GA 3GSRB 5DWUL 4BK5A 2J3SA 4CN6A 1F6AA 3C8KB 3RX5A 3ZT6A 4NQED 4ZNCD 5D2NC 2XQYK 3KVQA 5T1MB 5C3LD 5DA0B 5H37G 5CZKA 1SEQH 4HKJA 2BVOA 5EU5A 4XP6H 3ARQA 2J1KA 1NEZA 2DQHL 3T0BA 3SE8H 4U6HB 5L2KA 2CIKA 5DEFA 3V5HB 4RGNC 1OSZA 1EJ6A 5D7LA 1AKJB 1NMAL 4L29A 4WNQB 3L3JA 3VGDA 1BPVA 3TA3B 5CSZA 1X5IA 4M1CD 1OVZA 2YR3A 4AQOA 3FO0H 4R4FL 1IAOB 1NCUA 3C8HA 5CP7A 1OAUL 4LSQH 4NZRL 2CRZA 3BRDA 5HYJD 1GVIA 4ONHA 3IKKA 4AT6A 4PY7A 3BEWB 1BF2A 2KPNA 1J1OH 1XFPA 2VXTL 3QUYD 1JZ6A 5DUBA 5HHMD 2BJML 3LIZH 5IB1A 3JWNC 1I8LC 4M3KB 4N0FA 2NYYD 2JELL 1QUNA 1L0YA 2FHCA 1HOCA 1A9BB 2HAZA 4OCSL 1L9NA 4HIHB 4OQTH 2F54B 5D4QA 3IVKB 3ZHDA 1G7IA 5SWQB 5E6IC 1VSCA 4PRBA 2YXFA 3VDBA 1ZA3A 4G8EB 5F89A 5DK2B 1GGCH 3MFGB 3OXRB 4BUGA 3P4NA 3EOAB 1KIUA 3TC9A 1KEMH 4P3DB 1RUML 3RA7L 3O45B 4WO4D 1ZEAL 3ARDD 1N0XL 3L5XH 4UNUA 3MROA 1U2HA 3KPLA 5IW6A 1KTRL 1H3TA 3B9KD 4LCCA 4JHWL 5F9AC 3T8XA 5EUKA 3WHXA 1FO0B 4CMHC 1CU4H 1C5DA 3OJMB 2G5BB 3VWKD 4ZPTA 5M95B 1A8JH 4HWZA 2ATPB 4B7LA 3UTSA 4FNLH 1I7RB 3IRZA 5JORB 1S7TB 1EEZA 2VSCA 1D6EA 5HHNA 2BY0A 1BGXH 4FFZH 2R1WA 4ODTH 2VLKD 3ZDZE 2MTPA 3O3EB 4PJ8D 5T1DH 2V7HB 1CDCA 1KG0A 3QUMH 2VYRE 4HC1H 4S10A 3RAJL 3SDCB 1P7KB 1BREA 2F8XC 5FYJL 1JCKA 4JO1H 4U6YB 4OI9A 4CAGA 2WIIA 4RAUA 3VWJB 4GKSA 3WLWC 4HDIA 4Y19D 4LLVB 2A77L 5I1LA 4FABH 4QWWD 1YZZA 3U0WL 2WQRA 5CAYB 2UYLB 5EZJA 3EFFA 2EEBA 1VFBB 2BVTA 4JHAH 3QBTB 3VFRB 2EE3A 1Q9LB 3QWQB 2FH6A 3F12B 3EYSL 3S4SB 2UVEA 3UROR 4OFYD 5JLZB 1N5YH 3S5LB 4DKAA 5JOPE 4LKCB 2LV4A 3WIHA 4GQ9L 1AO7E 5FO8B 5I1CL 4XP5L 3QFJE 1CLCA 3I6KB 4K7PL 3W9EB 5EU6D 4OGYH 3OHXB 3OJDA 2UWEF 1QNZH 3CD4A 5D7JD 5EWIH 4MD4B 4MA1B 5AUMA 3QXUA 3EYVB 4ZS6C 3PL6D 1T2XA 3SGKA 1QA9A 2P5WA 3WFZA 3EDKA 1CFTB 3B83A 4G6KH 3BYYA 5E8OA 2XG4A 2E27H 4J8RA 5IB2A 4MB4A 5FECB 3MJ6A 3MRHA 1WBZB 1D5XB 4CMMA 2B5IB 2GW5A 1ZA6B 1QSEA 2JCCF 3SDDC 4OLWL 5I30L 3FQRA 4QHMB 2DB8A 3O81A 3DPBA 1U8QB 4MJ4A 4O02H 3PUCA 4WU7A 3JTSB 5CCKL 2M2DA 5BVPH 3GGWB 1B6DA 5C0BE 2ZZUT 3ILPA 5D7IA 2CR3A 2D0FA 3L3HB 3OKMA 2XZCH 3BZ4A 1YECL 1RPQA 2EC8A 3STBA 3U0PA 3A6CH 1SVZA 5E08H 2N4IA 1WSST 4UNTA 1MEXH 4GRLD 1FPTH 4JFPB 1N3NA 3A67L 1JPTH 4YQXL 5EZOH 4L3CA 4HFUL 1X5FA 4HEPG 2NW2B 5IG7A 2DKUA 3C09C 3QEQE 3RWIB 3PDOA 3TEUA 3WL9A 3MR9A 5HBBA 3ABZA 4OM0L 2XN9E 2AJVL 4UT7H 2DQTL 5EBMA 5F1SA 3CK0H 1U0QA 1BP3B 1KB9K 3E3QC 2O5YH 5DMYA 3S3SA 2P8LA 4ZS7L 1KJVB 4TSBH 4WHTA 1GXEA 4LPYA 2E7LA 3U6RA 1GZQB 2F8VA 2W0KA 5IESH 1TVHB 5TPWL 1J86A 5BS0E 4HG4J 4DCQA 3VD9A 2ED7A 5IB3B 3BPCA 1MCPL 3UBXG 4UTBH 5EU7E 5EUOA 2IAMA 3HA0A 3S37L 3AY4A 1A5FL 1XR8B 4LEOA 5HHXH 4YFLF 5D1QC 3NZHL 4TTDD 3NN8A 4DN4L 4NWUH 4AMKL 3ES6B 2YS4A 5ESQB 1F58H 3LV3B 1LP9F 2CLRB 5FHAH 5DJCA 1X5YA 1NFDA 5BQ7A 3TBVA 2Z4QA 1F11A 4EDXB 4M4PA 2CK0L 4NHUA 4X6CE 2OK0H 4IMKA 4WV1A 2E3VA 3RL1A 3P0VH 4X6FA 1P84J 3MACH 4MXVF 1MY5A 1AGDB 2IMNA 5JDSB 4KHTL 3FRUB 4UQ2A 4YAQB 2F74B 1R5IB 3ZL4L 1ZVSA 3MSPA 4TYUA 1DLHB 3MYZA 2BCKA 2I07A 4NKDA 1FV1A 3CFKB 4XGZB 4OZIB 3BP7B 1RIVH 2X9YA 3O4LB 1PG7H 3P77B 4Q9BA 4NZJA 1UWGL 1JF5A 3MCLL 4C56E 1FL5A 3GBML 4Y89A 3T4YB 3DXAB 3BKCL 4NC1C 5E00A 5C09D 5I6XC 5FO7A 5GS0L 1EO7A 3WDIA 5JHDB 3QPXL 1WZ1L 4Z95L 4LSRL 1T1YB 4HXBL 1DBMH 3OWEA 2QJDA 2B0SL 3SE4A 1Q1JH 3ZKXC 1OAYH 4Y1AD 2X1OA 1S5HA 1S9XB 4OZGA 1I3GL 3E8UH 2QKIA 1AD9A 3EDJA 3ZKMD 1Q0YH 1T0MB 1JF1B 4O4YH 3LD8C 3T0EA 3V5DA 4OT1L 1GL4B 3RGHA 1IT9H 2MHAB 1H8NA 1K8IB 4KKBC 4BA8A 3CU1A 2XFXB 4WW2B 5DHVB 2Q20A 4Z78B 3O0RL 3NZ8B 1PW3A 4M6AA 3N1GC 1QVOB 4ZMAT 5KSVA 4Y4HC 1S9WA 3SKMB 4MMZC 4M4RA 3SO3C 4ZXBD 1MI5B 5D2NE 3TVMB 3PWLB 2F54E 4ODXA 1LK2A 4YE4L 5A2FA 3DBXA 3WDJA 4GLRH 4ZOAA 5IOPB 5E9DB 1R0AL 4Z76A 3L95A 1BBDL 4NUJA 3WNLA 4ZUTA 2OSLB 1WCQA 1ZANH 1T1XA 4GMSL 4GT7A 4QRRB 3MGTB 4D9LH 2YPLD 1KOAA 5BV7B 1NBYB 1U93A 1MCOH 3CPLA 2Q7YA 4TVPD 1QFUL 4NCDA 4GG8B 1E4XI 3HG1A 3VXSD 2PYEB 1QACA 4NCC2 5J3HC 5I18H 2CUMA 1YEIH 3OKKB 3HS0A 2GTWB 5DRXA 4KUZH 1CR9L 3RVTC 3RWCB 5K59F 4OFKA 3PWPE 3HE6B 5JXAL 1ZHKA 5AYUH 4F7MB 4LLWA 1X5JA 3ARFB 4KVCH 3FQUB 4W70A 4MQTB 4CADB 5D6CB 5I2IA 1U8JB 3O6KL 1AY1L 1QYGH 3I6LE 2A73B 4DUWA 2Q86B 4NBXB 1U92B 4P59H 1IGYB 1U8LB 5EC2A 4UB0H 1DLFH 1SY6A 1RAMA 4GRMB 4M6OL 4UBDC 1L6ZA 2YBRB 2AV7B 2FX9H 2A2QT 3QIBA 5ERWA 3KGRA 3U0TB 4R7NA 3RGVA 5FKPB 3QCVL 4Z7WA 3HC0B 3IDNB 1AIFA 2D7TL 4PBWD 4R0LA 2WBJD 4K3JH 5LWYH 4XT1C 4OV5B 1PKQA 4PJHE 3WFCH 1JWMB 2X4SA 5CD3B 2EDYA 3UYOD 2GTZB 4R26H 1YNKH 1QSVA 1R5WB 4JZNA 4I2XA 4R2GD 4Q97A 3BD3A 2YUXA 1QP1A 1A02N 3X13B 4WUKH 1INQA 4CU8A 4GXVL 4I13B 1WUNT 5DUPH 5EU5B 2LFGA 3SCMA 1F45A 4JFYB 4UOJA 5F6HJ 1KEGH 1A4KB 4UINH 5KSUB 5DWUH 4U1GB 2V6HA 5ISZA 1EX0A 2IC2A 4HH9B 1EMTL 3I75A 2H32H 4GW4B 4NQDA 43CAA 4L29B 1I8KA 4JZJA 4XNYL 1CL7I 5I9QB 2VUOA 2APTA 3C60D 5CP7B 3SN6N 2IPKA 2HTKC 3SDAA 2DQHH 4ONHB 1UXSB 5DD6B 3IF1A 4LCCC 3FQTB 4M7LT 3HUJE 1NMAH 1G7PA 1G0YR 4L1HA 1INEL 1HHKA 4QHNB 5I8CA 5L6YL 2KZWA 3QSKB 1MCJA 1OQXA 3BPLB 4R4FH 4B41A 4JRYA 1OAUH 5IM7A 4NZRH 5F44A 4PLKC 4O58L 2LTQB 3RPIA 3EYOB 2GJJA 3DVGB 3DV4A 2E8ZA 4Y16A 2VXTH 3RQ3A 3MZTA 3VXRD 1G7IB 2BJMH 3JSSA 2Y5TA 2NY5C 4PRBB 2JELH 3BWUC 3IU3A 1J1PL 3GB7B 2DYPA 3AAZA 2I60L 4DKEL 2MSPA 4OCSH 1SYSB 2C3VA 5ALCL 1WWAX 4LVNC 1RUAL 4B5EA 2Y1VA 1NGZA 4CNIB 3NAAL 4FQ1L 5LBSH 5C0AD 2GYSA 3JV4A 4N8CL 4L9LB 5FYKL 2ICEB 1T3FB 2EDKA 1EEQA 4JFHD 1CFVL 2HFEB 4Y5XB 3WHXB 1FFNB 2CSPA 1INDL 2BZDA 2HT2D 2ZOLA 1RUMH 3RA7H 4ODHL 1FO0L 4L8CA 3RVUC 1ZEAH 1ND0B 4NPYB 1N0XH 1BJMA 1F3DH 5LAXB 2EKSA 4JJ5A 4H0HB 1BVLB 2P7TA 1QOKA 3SGKC 3VFMA 3VXOB 4JHWH 5GRVK 4PG2A 5EFIA 4IRJA 5AWNL 5D93B 2NNAA 3AMKA 5KZCD 3QPQC 3VD7A 3OGCB 1CVSC 1OAZL 3HCVA 1IAKB 5CHNA 3VD3A 4HDIB 1T22B 4TSCL 4PTTA 4P2RA 4KI1A 2C26A 4HGKC 1J0HA 1YC7A 4YC2C 1PG7X 4OCYL 5ESAB 3T0AA 1RZJC 4NRXB 2GJZB 3RAJH 4MCZB 5CGTA 5E56A 5FYJH 4ZAKD 5HY9B 4A2MA 1BQLL 1NC4A 4K8RD 4PJBB 2KQNA 1KYOK 5ICYA 2IFGA 3O3UN 2A77H 3CDGA 3E3QE 2VLME 43C9A 5F71A 1F13A 3U0WH 1JUFA 4MXQD 4KY1L 3MBED 2Y4SA 1NKRA 3WFEL 3JBG7 4JFFE 2DOCA 1MHCA 2P44B 3EYSH 1JGUL 1UKTA 4CW1B 2HG5B 2FBOJ 3ZE1E 3OJ2C 3DXAE 3WNMA 4GQ9H 2GK0A 3ILQC 4XP5H 2WMPA 4J8RB 5HD8D 4P3CL 4KMLB 1KIPB 3ZKQD 1NCTA 2E7LC 1JPFB 1BZ7A 5DJAA 4EI5C 4LLMA 4MQXD 2PN5A 1MCCA 2VQUA 5D70L 2VL5A 3CSPA 2IAMC 2WIMA 1WISA 1VERA 2B4CL 5C07E 3AY4C 3SGEH 2CXGA 3L3OA 4OZHB 5D7IB 1U58B 2E7HA 2R1YB 2VITA 3QAZB 1YQVL 4NN6C 3KLAA 3HR5A 5E99L 4OLWH 5DHXB 2JIXD 2XZAL 5I30H 1HCVA 1RJZB 1QBML 4HS8H 3ULUC 4FXGB 1DQML 4JFEA 2AKRA 4S2SA 1JF6A 4M93C 3X11A 2VR4A 3GMPB 3U46A 1HQ4B 1UYWL 1RIHL 4MDIA 4HIJB 2GITB 4L3CB 4N0UE 4IMKC 4WV1C 4ZTOL 1ORQA 5DEGA 4ETQA 1JE6A 3MC0A 4XPFL 4UDTA 3L5WA 1YECH 1MI5E 1DZBA 3O8XB 4U1LB 3OF6A 3MR9B 1OGAA 1MHHA 5GZND 4J3UA 2QTEA 3IXTB 5FM5O 5E9DE 1ONQA 5FOBB 3RFZC 3UBXA 5F7NC 3A67H 4YQXH 1RZGB 5E2WL 4HFUH 5HVGB 4X8JA 5TGBB 4LLQA 4WGVB 2FLBT 3GJFH 3EZ8A 5SWZA 5D8JL 1NFIA 1NFKA 1DBJL 4OM0H 5SX5H 2AJVH 3H42L 2DQTH 3QCUL 3CVHB 1J0IA 5EOCJ 1J8HB 5F8RC 4ZS7H 1ZVYA 1F6LL 1II4E 4PJFE 1UM6L 3MJ7B 4HCRA 5IMMB 4HBQA 2AJSL 4GAJL 3GSQA 5JDJA 4UDUB 4X6DE 5ENWB 5TPWH 1MVUA 4DGVL 1KLUB 4H26A 4B53A 5IQ7L 5E8PB 2LAAA 3BP6A 1SQ2N 1W72L 3TBYA 3LMJL 5BQ7B 1MCPH 2VRAA 2BOBA 1F11B 3S37H 1G7QA 1A5FH 1AC6A 3DO3A 1XGQA 5ID0B 4O9HL 2VSDA 3T2PA 1U3HA 3NZHH 1FNGB 2V5TA 3V4UL 4DN4H 1UH4A 2BFVL 2VOTA 3DYPA 5DVOA 2ERJB 4X9IA 4AMKH 3T0EC 5DD3L 5I76A 1KXVC 3CSBA 4OZFB 4MVBD 2XXCB 5B4MD 3MV9A 3ROLB 1ZVSB 1C1EL 1WK0A 4QCIB 1TENA 5HHPB 3GSUB 1DUZB 4EN3C 3QDME 1RURL 3SPVB 3WNNA 2I07B 4NKDB 1M7IB 3RWFB 3MRPB 3FQWA 3L7FA 2AJ3B 4UOW0 2XY2A 3VMOA 2OQJA 4XPBL 1BECA 2AAVA 4X7TA 4KHTH 5D1XD 1GOFA 3VFWA 5MI0B 3ZL4H 1FL5B 1FNSH 5H8DA 3RY5A 1YDPB 1MWAB 5DMGD 3AS1A 5HYSA 1I3VA 4OI7A 2CMRL 2E9IA 1UXWB 1Y18B 4FQXA 5MERA 1K4DA 2LU7A 4HUXB 1UWGH 5DD0L 4UTAL 3GKZA 5HDQL 3MCLH 4JO4L 3GBMH 5D7LE 5HI5D 3BKCH 1XCQB 3LS5L 4R8WL 1P4BH 2EH7L 4P4KA 4TUJB 3C6SA 5GS0H 3LH2L 3ROOA 1UEMA 3QPXH 1WZ1H 4Z95H 4LSRH 3OXSA 4HXBH 2Z91A 3WCYA 2B0SH 3KPSA 2A9NL 1CG9B 1U8PA 2J4WL 2DTSA 1I3GH 2CLZA 1E28B 3L3DB 5GS0C 3X17A 1OARL 1AP2A 3KYOA 3BRGC 4DK6A 4UV4L 1GC1C 4BSJA 2MPAL 3PWUB 4OT1H 1QLRA 1W72A 1CGSL 3FFDB 2XXMB 3NGBC 5FV2A 4MXWL 5I17B 3TH3T 1Q9OB 3LQAL 1WCBA 3DETD 1KIRA 3RGVC 2HFTA 4CVZA 2K9UA 4R0LC 3B8SA 1ZV5A 3K1DA 1WFNA 4POZC 4MNQB 4KZDL 4QTHA 1O5DT 2J5LC 1FC1A 5HGBA 5EO0A 5F9DC 3Q6FB 1A47A 4Y4FB 5F7EL 2DTML 4YE4H 2ITCA 3OL2A 4TPRL 4I18B 5BV7L 2VKXA 1R0AH 1U95A 5BOZG 5DRXB 1MJJB 2VMFA 8FABA 1BBDH 4P5KA 3SGDI 3D85D 3VGAC 3SCMC 4YLQT 3VGBA 1CFBA 4DTGL 4GMSH 5CJBA 1ZHKB 3VXPA 1CFSA 4NKQB 3H3BC 4XMKL 5B39G 3GSNB 4YHYC 1QFUH 5TE7L 4OLUL 5D2LA 3TCLA 2ARJQ 5EBLA 3UTSE 1CR9H 4JZJC 4MX7B 1CCZA 4U1NA 4KAQL 2DD8H 1SBBA 4PBVC 5JXAH 4JFDA 3H7BB 1DVFD 3SDAC 5KG9A 3VI4E 3BGFB 3QIBB 4R3SA 1I8MB 4BFIA 4R7NB 1S78C 1ZMYA 5BRZA 4KWUA 1KCVL 4M03A 3O6KH 3EO1B 1AY1H 1PKQB 3FFCA 3H9SA 1EEUA 4M7JL 3MNVA 1A7OL 1ZGLM 5JW4Q 1N4XH 3E6FA 1E4JA 1JWSB 4OGXL 1FYTB 4XVUC 4GAFB 1A1MB 2N7AA 5C9JA 4TQEL 1GOHA 3QI9C 4QRUA 2VTFA 3QCVH 2HJFA 1VGKB 2D7TH 4Y16C 3QQ3B 4FQJL 1MY7A 4TOYL 3PF2A 1QFWL 4LRIA 3QXTA 2PXYA 4GG6F 5IWLC 5FGBA 5DTFA 2WNGA 1UJTA 1X7QA 1QO3A 3G6AA 4BZ1L 2W38A 2NX5A 5D7KE 5C0DB 3P0GB 3OSKA 5HSFA 1KPUA 1JGVL 3I75B 3G9AB 4LPTA 43CAB 3ARPA 1X5KA 4GXVH 1RQ5A 3MXVL 4OKDA 3HMXA 5JPNA 4APQD 4G43A 4GKNA 4PJXF 1KCUL 2P5WE 1V7ML 2P5EA 3ECBB 5GRUL 4D0CA 1UWXH 2CLVA 3MRLB 4CL7A 4OBRA 1FGNL 4G80A 4L4VB 3U83A 1BAFL 1HWGB 5I19L 1QSEE 2ESVD 4XNYH 3VE0A 1N2RB 3DURA 4HFWA 3BP4A 3TN0D 1UZ6E 4GBXC 4QXTB 1ULVA 2BNQA 2R69L 1Z2KA 1FZKA 3MLXL 5EB9A 4PG2C 5D7IE 1INEH 1Q9WB 2ZOKA 5L6YH 4NQEA 3IAQA 2BSED 2Y72A 3MFFA 1D9KD 1A7QL 3FB6A 1VADA 4O58H 4LHUD 1NL0L 4HLZH 3AU1A 3G08B 2C3VB 3U4EB 3RNKB 4QF1A 3U30B 4OGAD 3AM8C 1F3JA 4GRWE 5C0NC 4ZYKA 1TVBB 1J05A 1J1PH 4ZUUB 5E6YA 4XP4L 5KS9B 4QTIL 1D5MB 5I75C 2I60H 5F7KC 4DKEH 1CD0A 4U05A 5HYJA 5KSAD 1LNUA 3UJJL 5ALCH 5AG8A 3S9DB 3HTLX 4QRPD 5J11B 1HHGA 5L7XL 4NO0B 1RUAH 3MBXL 2ZOLB 2AABL 1AGFB 1MJUL 3GMLA 5L9DL 3QEHA 2ARJB 4F57L 2C7UB 3DI3B 3NAAH 4YBLC 3DO7A 3S37X 1EBAA 5TDNA 4N8CH 4JJ5B 4LDEB 5KW9H 1CN4A 5FYKH 5EUOE 1XF5B 2ATKA 1KGCD 4N9OB 1I1CA 4POUB 1DQDL 4YHPA 4I3GA 1CFVH 3QQ4A 4AL8L 3BX7C 4YDIL 1JGLL 4IRJB 1INDH 2NTSP 2XWJB 3RWHA 4ODHH 1FO0H 1EXUA 2Z92B 2UZXB 3ULUE 2APBA 1NFDE 5JXED 3LN5B 4K3DL 3BIKA 4J7RA 5J9PA 3MRIB 2BC4B 2JJTA 5AWNH 3MNZB 4NC0B 1OM3L 5DRZB 2Z31D 3JV6A 1CD1B 1MUJA 4JFQB 4RMSA 4KROC 5HHOD 4XNMB 4NM8L 2Q6WA 1ACZA 4WO4A 5ICYB 4TSCH 4X99B 3ARDA 3RVWC 4FQ2L 4XTRC 2HMID 1XF3A 5KTEL 3JUZA 4DZ8B 1VFUA 1JUFB 1LE5B 3B9KA 3RUGA 5FYLD 4OCYH 5SX5K 1IEAB 1EO5A 4XI5C 3VWKA 3D25A 3VFNB 4LCUB 1RZ7L 1PSKL 2OTUA 3WBDA 3K2MC 3PWVA 1VGEL 2W9EL 3VFTB 1S9VB 2NY0D 4Z9KB 2ADGA 4LSSL 1TZHA 1ODAA 3QDJA 1ZWIB 3N1QC 3OMZA 4KY1H 2VLKA 1T89A 2XT1B 4PJ8A 3WFEH 1I9IL 1JYNA 1IM9D 3NBNA 5HI4D 2L0DA 3DVNA 3EKCA 1JGUH 4WU5A 1YMMD 5KVGL 4MD0B 4ENEC 4F37K 3SE3C 4OZGE 4EI6A 4KRPC 1D5BB 3GZKA 4PRPD 5DA4A 2F53B 4QRTA 1OCWL 4MQ7A 3QDAA 1KB5L 3IT8D 3T0EE 4P3CH 3Q3GB 5JW5A 3REVA 4OB5L 1MRDL 2IADA 2Q76B 2EDXA 3RIFF 2JJUA 4LVHC 2EDOA 1MFEL 4NT6A 3ZE2F 4OFYA 3UTTB 1B90A 5D70H 3IS0X 2OR9L 2R56L 4JFEB 5ICZA 5LGHL 4PRID 4KJQC 1SYVA 2Y9RT 2B4CH 2OXGA 3FMGL 3AS3A 1S5IH 2YKLH 4G7YL 3HI1B 5EU6A 3DRQA 1ZHNA 5CD5D 2Z93B 1NAML 3L5WB 3T3PF 3C87A 5D7JA 3CFIC 3CUPB 1UH3A 1FFOA 1JRHI 2JTDA 1HEZA 4KJWD 2X1PA 4G8GB 5E99H 3UTQB 2XZAH 3FB8A 1MHHB 3PL6A 1AE6L 4YK4C 3I02B 2VISB 1HHHB 2Y6SC 2FSEA 3IDGA 5JMOC 1MCFA 3GDBA 1UYWH 3L6FB 1RIHH 4IM8A 5E0QA 4GMTL 3R4DA 4X8JB 3HAEG 4ZTOH 4LLQB 4LAQL 2QSVA 4XPFH 3G5YA 2X4TA 1R3IH 1NFIB 2NZIA 5EZIL 1K2DB 4ORZC 5GRWA 4G6FB 3HG1E 1A3RL 4RISL 2G9HB 2IBZX 3OKLA 2N56A 5E2WH 1T04A 1A6AB 3QXDA 3CVHL 3KDMA 3K7UA 5CMAA 2O61B 4XH2A 3KPQA 4H26B 5T3ZL 5D8JH 5IFHL 3TBYB 5C0RL 1GGBL 1DBJH 4BFBD 2BOBB 3H42H 1Y0LA 3OAUL 3QCUH 4ZDHA 1YEKL 1J10A 1U3HB 4GRLA 1CGYA 5T5FL 3WLBA 4H5SB 1UM6H 4P4KC 2IWGA 4TUKL 3RI5K 2AJSH 3FT2A 3Q6GL 4GAJH 4NKOA 5D9SA 3NIGF 5GS3A 5H94A 1BIHA 4DGVH 3O41B 4OAWB 2OZ4A 5IQ7H 4Z7WE 3LMJH 3JWDC 1CT8A 5I1HL 1ZKAA 5L8KB 4DVBB 1PKQE 2PW2A 3E2HC 1BJ1H 3DMMB 2BFVH 2BOCA 3L7FB 3GHBL 5I1GL 5DD3H 4RGND 4I2XE 4PJAB 4U6XA 2W65B 2MFNA 3VFWB 2DLIA 1C1EH 4HIIA 3P40A 1JIBA 4MJ6B 2VLJD 2AP2A 4PTUB 4PY8I 1NDGA 1U91B 1RURH 2ED8A 3KLHD 5L0QC 2DLTA 1BBJA 4FQXB 1YC8A 4XPBH 3DX6A 5ISZE 5IFJB 5GISL 4NQDE 1CXEA 2BMKA 1XGRA 4ZO6A 5CKAA 3T2OA 5F96L 2WW8A 5DQ9B 2X4OB 1NCDL 4PJ5B 3G5XA 2XNAA 3C6SB 4W4OA 1KC5L 3DYMA 1I7UB 2CMRH 2OP4L 3W5MA 3HLAA 15C8L 5IIEB 1PEZA 5DD0H 4UTAH 5KAQG 2CRIA 5HDQH 1IAII 3WS3B 1FCGA 4ZQKB 4JO4H 5E6ID 1H5BA 3LPWA 1KXTB 3LS5H 1P6AB 4R8WH 1H3XA 3K74B 1LD9A 2EH7H 3O3DB 2JJVA 1EH9A 4JRYE 1AP2B 3KYOB 4R97C 3LH2H 2AJZA 1OWWA 1JZ8A 4KTEL 3B9EA 3MCKA 3NH7L 2MKWA 3RKDC 2A9NH 2VDLL 4Q7DA 2J4WH 4FQQA 1C12A 3RHWK 2AXJA 5HYFA 5F6HI 5FF6A 1T5XB 3SKNB 1RUPL 2UWEA 1KPRA 2C3HA 1OARH 4LDOB 5C09A 1IE5A 3MMEA 1E4WL 5DHVH 4UV4H 2MPAH 3OG4B 1QFPA 1TCMA 4HX1B 5J6HA 1A3LL 5HGBB 3DHJA 3CLFL 1WIUA 4MXWH 5EG6C 3MRFA 2IG2L 3TBWA 4MZ3A 2BVPA 4Y1AA 5B39A 3SBWA 3PHQB 4L3AA 6FABL 1UWXK 3O4OB 5K9KA 1U95B 2DJUA 4LRIC 1DEDA 3QIWB 1M4KA 2PXYC 2JCCA 4KZDH 4GS7B 1LEGA 1Y6KR 4EIZC 5FGBC 3C6LD 3LRHA 1CFSB 1I1YA 3LQAC 4MLIA 2OM5A 2IPUK 5F7EH 2DTMH 1IZJA 2C9AA 4X7FC 4TPRH 5F7FA 5DZOA 5BV7H 3EYUL 3GSNL 3BDXA 3MREB 1UACL 4LF3B 3BSZL 1CLOH 1X5ZA 2A6DA 5GGTL 1JBJA 2F15A 4DTGH 1P9MC 3BN9C 2OI9C 1RZIA 3G6JF 2CRYA 1EZVX 4NQSB 4XMKH 4BFIB 1X3DA 4ZXBA 1KCSL 4ELMA 1Z9MA 1TTGA 4X5LA 5TE7H 3T3ME 5J57B 4OLUH 3QWOA 1A2YB 3NCMA 2GCYA 4KAQH 2EH8L 4P2RE 4KKNA 4TTGA 3OAYH 4F15B 3U9UA 4DFHA 3QUZB 2VLLB 3RDTD 4W68A 1CBVL 4L8DB 1IL1A 1I4FB 2YPLA 2BSRA 1B4RA 3V8OA 3D39D 3FO2A 1I9JL 1AXSA 4N1HB 1FH5L 1CIDA 3B4NA 5CEXA 4PJDF 2DICA 3CH1B 4LCWB 4M7JH 2QHRL 1A7OH 4F3FA 5MEOA 4MB5A 3BKJL 1QHPA 3KJ6L 2WINB 5I8KL 4TQEH 3WO4B 3IS1X 1RUQL 5E1AA 2J12B 4ZUWA 4FQJH 2XQYG 4TOYH 3W0WB 5C0FB 1QFWH 3MLYL 5K9QI 2XI9A 4HUUA 3RWGA 3F7RA 4G43B 4GKNB 5CEZE 4A6YB 4BZ1H 2DBLL 2Q8BL 1P6FA 1LP9A 4M1CC 5BZWA 4PP2A 5A16B 4HKBA 4UIMB 1QFOA 1YUHA 4CVXB 2WWMD 1JGVH 4HS3B 1AGCA 1QG3A 1A6TA 3WHE1 4JY6A 3CFEB 4X98B 1NBVL 2WBJA 3MXVH 3VE0B 1WT5A 3RVVD 3D0VB 3D5OF 3LKPA 4JCLA 1JP5A 1MJ8L 4PP1D 1KCUH 1V7MH 5FA4A 1FLRL 3GMRA 5GRUH 2NYYC 5MEND 1W8NA 2BNQB 3GMQA 4PJ9D 3DUHA 2HKHH 4S1SL 1FGNH 4ELKB 1BAFH 5I19H 1TXKA 1J0JA 1LO4L 5IFAL 4CVUA 4Z5RA 2IPTL 3S3JA 4LSVL 1ZT7A 3FQNB 1KTDB 5DJ8A 4PRHB 4JFEE 3MPCA 2JK5A 1ITBB 3MV8D 4MJ2A 4QHLA 3MLXH 2EXYD 4MGXA 2YD1A 3A0OA 3PXJA 1EHNA 2EE6A 5KOVC 2JJTC 1MIEH 2LU3A 2DWDB 3VXNA 5TFSL 4ISVA 1HXYA 5L2JB 1OGAE 3G5VB 3CSYA 3OV6A 1HZHL 3V7AG 3C60A 1A7QH 4WO4C 3FT4A 1NL0H 3IETB 3VG9C 4ETYA 4JGUA 4U1HA 1A1NA 3BO8A 5E8EA 1GZPA 3QUYB 3QDGB 3ZT5A 2IH3B 5IR1B 1KLGA 3BEVA 5HHMB 3QXAA 5DJ6B 5SWZE 3VWKC 2AK4B 1AQDA 1FDLL 4XP4H 4EEEA 4QTIH 3MLWL 5EO9B 1QLFA 2GJ6B 1F4YL 3N9GL 1F02I 4FZ8L 4R4BB 4QT5A 4OUUA 5CSBA 3EOTL 5FCUL 5L7XH 3NMEA 1T89C 1HSBA 4U7SA 3MBXH 4PJ8C 1QSFD 5J12C 2AABH 4XMPL 5L9DH 4F57H 2LVCA 1CXIA 3KXFD 2A6IB 2EDHA 3FT3B 4M7ZC 4LAJH 1DQDH 1M6OA 3DJ9A 2FCBA 4AL8H 5J9PB 1JHTA 4YDIH 1JGLH 3MRGA 2B1AH 1RJLB 3DGGB 4QWWC 2DQDL 4G6AD 5ICXB 5DYOB 3MRCB 4BQBA 3MV9E 4ZOEA 3ARDB 4K3DH 5BXFA 2XG5A 4LHUG 5C0AA 1A4JB 2ILLA 2RJMA 3EYQD 3B9KB 3RUGB 1U8MA 2IBGA 4U6VL 1OM3H 4R90L 3FRPG 2X10A 3D25B 1MRFL 2YSSA 3P30L 5CBAA 4NM8H 5IHLB 1OTSC 1H3UA 4LSPL 5DMKB 2V2XA 4TRPL 1HCFX 5KTEH 2ADGB 4NDMB 3PL6C 3ZSTA 2N1KA 1XGPA 5D5MA 1AFVL 5IB4A 2CKBA 1H0DA 4F7EA 4MJIB 4S1RL 1S7QA 4ERSL 1RZ7H 1PSKH 3NPSC 3KPOB 1JMZA 1VGEH 5J06A 1VA9A 5GHWL 2W9EH 4Y19B 4HULB 1G9ML 4EI6B 4LSSH 1BX2A 4Y4HD 1G6RB 1I9IH 4PS4L 5IHBA 2GFBA 2VDNL 5D96B 4KJPD 3KPSE 2YD8A 4KRMB 4ZAKA 3QNZA 3QIUD 2VDRL 5KVGH 3NCJL 1RV6X 1S7VA 3BPNB 4HF5L 2WWKT 3UDWA 3L3IA 4PJEB 1S9YA 4MAYC 2P8MA 4JQXA 1OCWH 4JM4L 3OX8B 3MRDA 1KB5H 3MBEA 3IGAA 4RNRA 5FGRA 1FNFA 4WFHE 3ME0A 5JA9A 1NUGA 3AROA 3DRQB 4GRLC 4WDIB 4OB5H 1KJ3L 3ZLQC 1MRDH 4Q9QL 2A74A 2BVUA 5D7JB 4RMTA 1FFOB 1PZ5A 3HAEA 1HEZB 3PQYD 3FB8B 1MFEH 2XOTA 1VPOL 2YEZA 3CFBA 2HVJA 4YO0B 3IDMB 3RWDA 2OR9H 2R56H 5LGHH 1E27B 3D3VD 5F9WB 3O3AA 1EA9C 4J6RL 4X80L 1T2JA 1KFAL 3FMGH 4G7YH 5HGDA 3BZDA 1NAMH 3QHTC 2VDKL 5DMJB 3HZVB 5L2KD 1RVFL 3SDXB 1F8TL 4P46A 1AE6H 2VO5A 2FH8A 4NRYB 5A2KH 8CGTA 1NCBL 1WZKA 2WWKO 1WITA 3MV11 4UBDD 1NLDL 5CMAB 4LAQH 1R5VA 3I85A 3QYCA 1JL8A 5ILTL 4JANA 5EIIA 5DC4B 3SKUD 4OIBA 5EZIH 1I3RA 2JIXA 2R39A 1FGVL 2X41A 5HDOA 1A3RH 1BD2A 4RISH 4KK9C 4JRXD 3GIVB 3P0YL 4W4OC 4U7KA 3CVHH 4NKOB 4PJIB 3TIDA 2NY6D 2VQTA 4JFDE 1DJSA 1W2KT 5T3ZH 2VQ1B 3FOLA 5IFHH 5C0RH 1GGBH 3SY0B 1MAKA 4XWGL 5BRZE 1JTPA 4PJGB 5CJXA 3C5ZD 3OAUH 1YJDL 3QQ9D 5DRWA 5FEBA 1YEKH 1U8HA 5GSVB 4KDTA 2NW3A 2FO1A 1NGXA 3FFCE 4BELD 3H9SE 5T5FH 5J6GB 4TUKH 5GGRB 1BM3L 1Q72L 2FO4B 3Q6GH 1T0NA 1WC7A 1C7TA 4WTWA 3O2WL 1UM4L 3EJZD 5KOMC 2V5YA 2X40A 5C0JA 4YZFE 2C3XA 5I1HH 1JYWA 1S7WB 4OZFH 1NDGB 4PJ7A 2XKSA 3U2SA 4J3WA 3GHBH 3NPZB 4HZLB 4Z77A 4QXGL 2FJHA 1OD7A 3DX6B 3SGEI 4YDJA 4I0PB 5ACMA 3EAKA 4QOKB 2BRQA 3HI6L 3IFOB 1XGRB 3BFOA 3I84A 3BH8B 5GS2H 2GEEA 5FM5M 4ZUVA 4FA8A 1KCRL 2WM0A 4PLKD 4JR9L 3SBWC 2F58L 3GRWL 2P5EE 3EO0B 3BZEB 3DSFL 5FUZL 4PV9A 1FNEA 2QQKL 3CZFA 2EO1A 5GISH 2O26U 1H5BB 3PGCA 1MLBA 1QRND 3OAYK 3T08A 5F96H 1K4CB 1FBIH 1NCDH 5IEKA 5IBUB 1KC5H 4MZ2A 4QHUA 2MOVA 4X4YA 3TFKC 2EIBA 4LHQB 1P7QD 2OP4H 15C8H 3JV5A 2BNQE 3FB7B 2XPGB 5D1XA 5CFHA 4YPGA 5FF6B 3UXFA 4NQEE 1QR4A 2R2BA 3E0GA 1QBBA 1KPRB 3QR2A 3TYFB 4JPKL 1F90L 1WTGT 4PPTA 3EJYD 4F9PA 4ALAL 5J6HB 1KJMB 4KTEH 4MJ5B 4XCEA 4Z7QE 3NH7H 5HDBE 2IGFL 4UU9B 3WSQL 3BKYL 4YIQB 2WLZA 3JTTA 1XT5A 3WIFA 2VDLH 3TPUB 1QZ1A 3BYTA 4LGRB 3RVUD 3KPMA 3BQUD 4Y1AB 1RUPH 5D7SL 3WFDL 4BQ8A 3V4VL 3VXMB 5C8JB 1E4WH 2P5WD 1T5WA 4L3ED 5ANMA 1G7MA 1SJEA 3QNYA 1LEGB 3VJ6A 1A3LH 5HYJE 3RVXD 5KVMC 3G5ZA 4CBPA 5C0EA 2W92A 1AQKL 3CLFH 5DJ2A 3WNPA 4NHCL 1DSFL 2IG2H 4NWTL 3QHZL 5HHME 1YY8B 1QSED 3B8YA 4N0YL 4FTVD 3B3IA 6FABH 5IUSA 2VLRD 5ALBL 5EOTB 4MSWA 5E24E 4YHML 5F72S 5DQJA 1RZIB 3FO9B 5F7UA 3THML 5DMIL 4EJ1C 4LPXA 2E6PA 4ZXBB 4Y5VB 2J7LA 4GAGL 4JKWA 3EGSA 3ZDZF 3SE9L 1U3YA 3GSNH 4HJGA 3CIQA 4V2CB 4Z8FL 1WT5C 3BSZH 2ZWLT 1J0KA 5GGTH 5F1IA 4ZFOA 5FYJD 5ECJE 3K2UL 1KCSH 3BJ91 3ARXA 1C08A 2VWEE 1KF9B 3VH8B 4DKFL 2KBGA 3SKOA 5EC1B 1MPAL 3KR3L 1LMKA 1AXSB 3VXSB 3TO4D 1FFPA 2EH8H 5B3JE 4P48A 4L8BA 4AEFA 3D85A 5IMKB 3RUGE 4GXUN 3VI3F 1CBVH 3UAJD 3IDYC 4EI5D 1UH2A 2KZ1B 2Z35A 3WUZA 4GOSA 4WFFD 1YEHL 3TNNB 3T4AA 2NTFA 4GW1B 4IJ3C 1A7NL 5SV4A 1I9JH 4AIOA 5C0CD 1HK6A 5BZDA 4X4XA 2QHRH 5BZWB 3T77A 3C60C 4WHCA 4XAWL 1H3GA 3BKJH 2XV6B 3K80A 2VLKE 3IJYA 2VABB 3KJ6H 3LSOA 5I8KH 3L7EA 1DVFA 1RUQH 1BEYL 5M94B 3MGAA 4JY6B 5MHSD 2X05A 1ZLVH 4WRLA 3MLYH 4PD4J 2WBJB 2X4QB 3MA9L 5ETUB 3ZDYE 4ZUSA 2VZUA 1HHIB 4P4RB 2JB6B 1B3JA 2DBLH 2Q8BH 3VXUB 4Y19E 2H26A 5HJ3A 3UEZA 1X6NA 5JW4R 3P9LA 1AC0A 4R2GB 4NQXB 5IEHA 4RQQB 2ZUQB 1VACA 2DM7A 4M7LL 3I50L 9CGTA 4X5XB 1MJ8H 2HJKA 3K8KA 2ENSA 1V5JA 3X14B 1Q94B 1K8DB 1T6WA 2DI7A 1VEOA 2A6KA 2I9TB 2A9ML 5IW1B 3HE7D 4S11A 5EU6E 2YA1A 1XGTA 4NBZB 1LO4H 1YA5A 5IFAH 3F7YA 5T1KB 3BGMB 1HH6B 3KYMA 2IPTH 3P2TA 4LSVH 3MRNB 2CQVA 1WFUA 3WEXB 4APQA 1MNUL 3JUYA 2FX7L 1GHFL 2VXVL 3IAPA 1GZPB 5I1EL 4RA0C 2FEDC 1QKZL 3CAFA 3BEVB 3QXAB 1ZTXL 1YEFL 5I74B 5TFSH 1IGML 2X9WA 1JZ5A 2ESVA 3X3GL 1AQDB 1HZHH 1RUKL 3TN0A 1EK3A 1A6UL 2YZ1A 5T3XH 3UYPA 2J8HA 4RMQA 1TPXB 1Y6MR 2FJFA 3OR7A 4QT5B 1S8DA 1RZ8B 1HSBB 1JZ3A 4NSKA 2P8PB 3VXRB 3W2DH 3HC4L 4AM0B 4XZUB 3MYJB 4YDLB 3PJSB 4F2MB 3IXAA 3C9NB 4P23C 4EN3D 1FDLH 1G7JA 2R0ZH 3MLWH 5IMOA 5I1AA 4WCYL 1D9KA 2X4PB 5HGHA 1F4YH 3KLSA 2CDGB 4BH7A 3N9GH 5JOFA 4LVOC 1JHTB 4FZ8H 5FCUH 3EOTH 5DLML 1LEIB 3WE6B 4RWYH 4PJIE 1U3JA 4X6CF 1KV3A 1WTLA 4XMPH 2YC1A 4P2OD 3BGAA 2ZG1A 3FRPA 2DLHA 4ZAKC 3MJ9A 3M8OL 4K8RC 1HHJA 5DSCA 5CZVL 4FXKB 3UDWC 4FP8L 4HHAA 5KSAA 4TSAL 3ZKNC 2C1PA 5EN2B 4QRPA 4MXQC 3G9VA 3HZMA 3MBEC 1NUDA 3QO0A 4BSWB 1YPZF 4O51A 1GCFA 5M7QA 1AHWA 1TVDA 3QUXB 5A40E 2VAJA 5DJYB 5GQBA 5MEPA 4LLUA 5B8CA 1LDPL 3H6JA 1UJ3A 3GUTB 5IB4B 2CKBB 4OLZL 1H0DB 4PGDB 4XVTH 4U6VH 3WFBH 3NCBB 3KPRD 5FB8A 4I48B 4R90H 5KZCB 3VFOB 1S7QB 1D5ZB 1MRFH 1CICD 2XWTB 3QRGL 4LU5L 4ZSOA 3P30H 3WMSA 2UUDH 5DEZA 2FJGA 3PDGA 4NQUA 4LSPH 5GS0D 4OFPA 4GSDL 4TRPH 3B6SA 5IB5A 4N9GA 3GKWL 4Q74A 5JXEA 1X5HA 4ZPVA 4P46C 4WI9A 1BX2B 4L4TD 1AFVH 3W11C 4DW2L 1T80A 4HGWA 4P9HL 3L1OL 3D87B 3OB0H 4S1RH 2Z31A 4LFHD 1G6RL 4ERSH 4H1LH 1P1ZA 3QNZB 5SX4H 5GHWH 5HHOA 3DUSA 2QLVB 3ZYOA 2C4FU 1G9MH 3TLRA 1T4KB 1V3LA 3GMOB 1S9YB 3K4DA 1M7XA 1DQLL 2NZ9C 2YN5A 4X83A 5C0GB 2F5AL 4PS4H 4GG6A 2VDNH 1GPOL 4MLSA 3RTQD 1DL7L 2XTJB 5K93A 4ODUB 1FNLA 2VDRH 1B88A 3RZCB 3NCJH 2XA8L 1FJ1A 4HF5H 1UB5A 3X12A 5CJXC 1HKLL 5C09E 4JM4H 5GZNC 4UNVA 1NGWB 2BNRB 3SCMD 1DQQA 1MFDL 1B4JL 4KDTC 4R4ND 1IM9A 1KJ3H 4Q9QH 2V2WB 3GMNB 1LHZA 4NQDD 3IFPA 1YMMA 1ZHBB 1VPOH 3D48R 4Y1AE 2B7DT 1QEWA 1DBAL 2FD6L 4PRPA 4J6RH 2G60L 1HH9A 2OJEB 4FN0A 4X80H 2JCCE 1KFAH 3B43A 4O2EB 5FA3A 1I7TB 3TT1L 3PHOB 5F97E 3VFGL 2VDKH 2N7BA 4NJ9L 1GJIA 1XZ0A 2W0LA 1NKOA 3BXNA 4JM2D 3BMVA 1RVFH 2HFFA 3V6FB 1F8TH 1OD9A 1NCBH 4HSQA 1YNTB 3PG2A 5F6IB 3PGDB 4PRIA 1G1YA 2BHZA 4NYLA 4XVUD 5K9QG 4RRPG 1NLDH 4LLDB 3QI9D 4LSUL 3TIDB 2D4DA 5ILTH 4YGAB 3SE8L 4F33A 1TJIL 3FOLB 4PGCA 4ELME 5EULV 3GO1H 3UBXI 1FGVH 4RCAA 2YK1L 4MVBC 1WEJL 3FOMB 4JO2L 1HINL 5F7HA 2QR0A 1EUUA 4DK3A 2DL9A 3HPLA 4RZCA 3HNVL 3BVNB 1U8IB 3P4OA 4NO5B 1ZS8A 4Z0XA 2YPLE 5E8DL 5CEYA 4XWGH 5GRYA 4TVPE 3W9DA 1B0GA 5D1XC 1FSKC 1K3IA 3VXSE 1JWUB 1SJHA 2DMCA 1J88A 1D6VL 4XPGL 5D1ZB 2RHEA 5DMGC 4N0RA 2EDJA 2E6QA 4C54A 1BM3H 1Q72H 4Z77B 1XIWB 3O2VL 1R3KA 3O2WH 4F9PC 1UM4H 1I1AC 4U1JA 4AK1A 1LE9A 3PWNA 1PYWA 4XX1G 3RX7A 3FB5B 1S7XB 1YJDC 5ABDE 4CGTA 4LNRA 1C5CL 2HYMA 2JJSA 4WI7A 4GBXD 5FYJU 3AXLA 1BVKA 3ARGC 5HI5C 4J1UA 4GW5B 3CXHK 1LP9E 2V2TB 1XR9A 2X89D 4Y4KC 4QXGH 2IBZY 1E6OL 3GSWA 5MEQA 4MA3A 3HI6H 3HR6A 1AKJD 3PGCB 4OCXL 1MLBB 2D9CA 4MA8L 3IJSA 1KCRH 4MXVE 3NACH 4JDZB 4JR9H 2F58H 1KLFA 4DOHE 3HUJF 3GRWH 5IKCB 4P2RD 3DSFH 5FUZH 4ZFZA 1HXMA 1F4XL 1MCWW 2QQKH 4HUVA 1J11A 4CVWA 3VRJA 1DANU 4PYHA 1KPVA 3B2VL 1NC4D 3VD4A 4C83A 2VLJA 4BJLA 1J8KA 3PNWB 4IRSA 2NXYB 2V9RA 1QHOA 4XCEB 2X70B 4Z7VB 3QHFH 2A6JA 4BFGA 4WVRA 3KJ4B 2GT9B 5DGQA 5FUCC 4HPYL 3KPMB 1JV5B 1PDKA 3DX9A 3DX7A 4MWFA 1R3JA 4JPKH 1F90H 3GJEA 5ANMB 1SJEB 4ALAH 4KK5C 1ZLVK 1ITCA 2IGFH 4N8VB 2DM2A 5C0EB 4K71C 3WSQH 3BKYH 1QSZA 1AH1A 2GHWB 5D7SH 5FYKD 3WFDH 1AD0B 3V4VH 4NQCB 2V17L 3TM6A 5FKAA 4OQTA 1QTYT 4NO3B 1Z9SA 3ARBB 1ZT4B 3KS0J 4TVSa 5BVJA 1I8IA 4OIAA 1KCLA 1AI1L 1AQKH 4URTB 5CIPB 4NHCH 4NWTH 1EHLL 4Q9RL 5IT2H 3QHZH 3Q2CA 3VXRE 2HT3D 4N0YH 4XTRD 4YHIA 5JPMB 4RAVB 1Q0XL 5ALBH 2YD4A 3BE1L 4YHMH 1JZ4A 5F1IB 3O9WB 4ZFOB 1JHKH 3THMH 5DMIH 3MJGX 4XI5D 5DK0A 4IOFD 3L9RB 7CGTA 4GAGH 5HVHB 3T1FA 4W4NA 3SDCD 2R2HA 3ULSB 4L8SB 3SKOB 3SE9H 5E4EB 5E2VL 1UM5H 2NY1B 1EVTC 4HKXB 3VWJD 1T21A 1I75A 4Z8FH 3GSOA 5C0AE 4PGJA 1N64L 1QR1B 4H0GA 3C6LA 1WAAA 4JFHE 3CFJB 4XVJL 3K2UH 5GSRB 4YX2L 1FRGH 4WEBL 4RDQG 3WFHA 1KN4L 4JDTL 5K59E 3T4AB 4OD1L 4JAMA 1MPAH 4G9DA 3KR3H 3P11L 5GPRA 2AS5M 2HLAA 3OKDA 4KRPD 3WNOA 4LQFL 2GK2A 3QUMA 4APQC 4HC1A 5D5ME 3H8NA 2SEBA 4X6BA 1DVFB 3ZE1F 1JN6A 2EYTA 1NMCB 4BSVB 2YD3A 5EZOL 4WW1A 3QJHB 3DROB 1YEHH 3MNWA 4YHNA 1A7NH 3MLVH 1NBZA 3UYRL 4F7CA 2DQEL 4E0RB 3K0WA 4KJQD 4MDJA 4D2NA 3RBSA 5FGCB 1H3PL 3TN0C 4XAWH 1M05A 3RDTA 4XCYB 1CXKA 1BEYH 3ZO0A 2BY1A 1OGTB 3CXDL 3K81A 3HB3C 3MA9H 5F7DB 1EZVY 1JGDB 1PGRB 3D39A 2VDQL 4N5EC 2HJKB 1NAKL 3EDFA 5GJSL 2NY3B 3TZVC 4JREC 5I16B 3TBTB 1QFHA 4NGHL 5F8QC 3UC0L 3ZDXF 5JQHC 4WW2F 3UX9B 5JZ7C 1YMHA 2AXGA 3RWEA 3R0MA 3CFDA 1BFOB 2GQHA 4M7LH 4OGAC 1NSNH 3S96B 3I50H 1XF2B 1XCTA 2CJUL 1IEHA 3QNXB 3LY6A 3KYMB 3UCRA 2X7LA 3DIFA 2UUDK 2HFGL 4DUVA 1RZKL 2A9MH 2CUHA 5INDB 2ITDB 1TLKA 4U7MA 1FL6A 3QA3A 5KSAC 5I66A 4ORGA 1BZ9A 1CYGA 3H9HA 4KQ4L 5F1NB 4PJCA 3OR6A 4M62L 1EFXD 3LEYL 3OB0K 1AHWC 4UAOC 4D0BB 1YN7A 1JVKA 1MNUH 4P4KD 2FJFB 5ESVA 5B8CC 2DQCL 5MENA 2NY2B 2FX7H 1GHFH 4HS6A 3DYOA 3KWWA 1UJ3C 2VXVH 4PJ9A 5I1EH 5C08A 1QKZH 2YD5A 4YNYB 2E6JA 1ZTXH 3W39A 3KPSD 1YEFH 1IGMH 4P57A 3PP3H 3VCLB 3QJFB 3IXAB 3V0VA 3AGVA 1A6UH 2PR4L 1D9KB 4LNVA 3L3KA 4BH7B 5IJVA 4LHUB 2X4RB 4U0RB 1AO7B 5JXEC 3MLUL 4AZ8A 1MAJA 4YHOL 3MV8A 4JFOB 5F3BA 1NJ9A 1MRCL 3IYLW 3VFSA 5DJZB 2I26N 1BQHB 3HC4H 2DN7A 4TNWF 2Z31C 4M43L 4WGWB 3P9WB 4WCYH 5DSCB 1HI6A 4W6WB 1CFNA 4NFDA 1UB6B 2PCPB 3O6ML 2HMIC 3VGEA 2I25N 3I3EA 2C1PB 5JMRA 3MA7A 3FJTA 2XZQL 4WJ5A 4TUOA 5ACLA 2A0LD 2IFFL 3V6ZA 4DZBA 3OPZL 4I77L 4IEFB 2C1OB 3BZFB 4QNPF 3M8OH 4U3XA 5CZVH 2R1XA 3BH9B 3MLTA 5IP4A 4FP8H 4PJ7E 3QEUA 3KPPB 3REWA 2NY0C 4TSAH 4P2QA 1IBGL 5C0BB 1I1RA 3O4LD 2FLRT 3CCHB 4ZSOB 3MUGB 2H8PB 1ZT1A 2FJGB 1PQZA 4NNYB 4JZOA 5HI4C 3RWJA 3KXFA 4BKLB 3G6JA 1KJ2B 2R2EB 4OLZH 4Y5YB 5DR5L 4H25B 3GNML 5FDYA 4U3HA 4X5WB 4J3XA 3UZEA 3MRBB 3RKDD 4B0MM 3A6OA 1D3CA 2VC2L 3QRGH 4LU5H 1P1ZB 2QADC 5F9OH 4PRDA 3U9PL 1G0XA 3BDYL 3QEQB 5HHOB 1MH5A 4GSDH 1YYMH 1HDMA 2W0PA 3GKWH 2XN9B 4X9GA 1G1CA 1UEYA 1Q9KB 4WY7L 1KNOB 3MV7A 1SBSL 3GBNL 2X4NA 4MD5A 1EV2E 3S34L 4DW2H 3HNTL 5LQBL 1LEKB 4QRSB 4P9HH 4LRNL 4OZ4B 3IB4A 1R24A 4PJDA 1G6RH 2Q3AA 4DEPB 4X7SL 2FIKA 4ZFFB 5IVZA 1FZOB 4LSDA 4JCMA 2OYPA 3FTGA 5CWSA 3CC5B 5CP3H 1E6JL 4KJWC 2DM3A 3IDIA 4JPVL 1CTNA 2ADJB 3I9GL 3ARTA 1DQLH 5GS1C 4P9HC 1M1SA 5C0IA 2EC9T 2H1PL 2F5AH 2NX5D 4WUUD 1GPOH 1ZOXA 2H3NA 1DL7H 3QZWG 4AY0A 1OAKL 3MGOA 2XA8H 2AEQL 1MFAL 1B9ZA 1QEWB 1BF8A 2ZSVB 4U1SB 4XC1H 1HKLH 4WI4A 4XCNB 4F7TA 5LWYL 3O6FB 4WEUD 5ANME 1MFDH 3BN9D 2R4RL 1B4JH 1FZJA 3BW9A 4RRPA 4QRRD 3R8BB 4HAFA 5HHQB 4W6XB 2VXQH 1C16B 3MRKB 2ZSWA 3QIUA 2HFFB 1K85A 1J87A 1AR2A 2PYED 3MJ8A 1RI8A 3MZGB 2FD6H 2JJSC 2G60H 5AEAA 5DRNA 4XRCA 4JN2B 4RGMC 4LFHG 3TT1H 3HE6D 3VFGH 2GSGB 3OKEB 4NJ9H 5J0BA 1VB9A 2GAZA 5F7MC 1EO8L 3PQYA 4C56B 3NCCB 3VI4F 3HZKA 5TE4L 4MCYB 4YDKL 3D3VA 4I3RH 4RA3A 2AVGA 3F7PC 3JVGA 2FRGP 2ZKHL 1N5AB 4YGVB 4C55A 5HYEA 4LSUH 5FYKU 2VAAA 1UG9A 5FUCE 2OBGA 1BIIA 1TJIH 2PYFB 3B9DA 5J13C 3BAEH 3LPFA 4LIQH 2FGWL 3QULB 3W9DB 4XNQB 2YK1H 2PO6C 4RBPH 3AB0C 1WEJH 3EYFB 4JO2H 4EDWL 3UJIL 1H15A 5DD1L 1HINH 4O5LH 2Q1EA 3WJJA 4IRSC 4QYOA 5AZEL 2R15A 3EBAA 3FQXB 3OKNB 3HNVH 4KJYA 3OB8A 4PJBF 2NMSA 3F5WB 3TV3L 3KLHC 3ALWA 1CGXA 1FVEA 1Z0NA 5E8DH 4M5ZL 1UVQB 1A6PA 2G5RA 3EDEA 1OTUD 4LNRB 2G2RB 5SWSD 5KN5B 3X3FL 1UKQA 1X4YA 5CGMA 1D6VH 4XPGH 3SGJC 4JRXA 2ZCKL 1XR9B 3O2VH 4JY5H 1LO3L 4PLNC 5J7CC 1MQKL 2EDNA 3VD5A 4GKZB 5IV2A 2X42A 4MA3B 5D2NB 4U2YA 2J8UA 2HP4A 4XWOD 1QQDA 1C5CH 1H3VA 3B2UC 3C5ZA 3SQBA 4XBEL 1FG2A 1BOGA 4JPIA 1K5NA 5KVEL 2FYYA 2Z8RA 3NFPB 2EDLA 1YYLL 5LBSL 4X7EC 2J8OA 5TJWK 2WANA 5L8JB 5FGCE 5KBNC 4ZFZB 3I6GB 1HXMB 4JFXB 4OCNC 3MCG1 4RGNB 4O2FA 1TMCB 1NBQA 1E6OH 1UZ6F 3ULVL 3VXTA 4OLXH 4OCXH 2ZCHL 2R9HC 4MA8H 4P5MB 3DTXA 4U1MB 1FN4A 3MRRA 3DUUA 1CGUA 2PW1B 3FN3A 3IFNL 4OZHF 5D7IF 4NQVA 3IJHA 4P2CG 3WXVH 2R2CA 3VFVB 3V7AE 2H32A 1F4XH 3PWPB 1KB9J 1TCRB 4XCFL 1ORSA 3QUKA 1BQUA 3B2VH 1R3JB 3BT2L 4HV8B 3DSNA 1JPGA 2FECL 3GJEB 4M5YH 3V5KA 4G8IA 3QDJD 1KULA 1JK8A 1UCBL 3H3PL 3C6LC 4RIRB 4W81A 2K1MA 4HPYH 5E6IB 2M1KA 1QRNA 1S7SB 5A3IC 2ESVE 1IC5L 3W5NA 2FL5A 2OTWA 4PJHB 4B50A 2CIIA 3N0PB 1CQYA 1P7QA 1WJ3A 4FFYH 4Z7UA 3T1WA 1UC6A 3T04D 1CK0L 3F62A 1IC4H 5DK3A 4K7FA 2IPUG 4NKIH 3TNMA 2DMKA 4GAYB 4JRWA 5B3NA 2CDEA 3STLB 4YHIB 2ZUWA 1HILB 3EOBA 1FVDA 1MELA 2V17H 1D5IL 4H0IA 1RJYB 4L5FL 3U36A 1A9EA 2LAGB 3D2UB 3SO5A 4CMHB 4EUPB 3ULUF 4NCC1 1AI1H 4Z6AT 2CH8A 5EU4B 3T1FB 1EHLH 4Q9RH 3F8UB 3O11B 3RDTC 1OTSD 2YXMA 4HLZG 1ED3B 3BQUA 3OQ3B 3NCFB 4V2BA 4XC3L 1Q0XH 5ADPL 1F97A 3U48A 5HI3D 4L3EA 3BE1H 5E8NA 2VR9A 4O2CA 4I4WB 2DQFB 2RB8A 3NOIA 4WWKA 4PB9L 35C8L 4QRPE 1L9MA 3HUJB 5JUEL 4JAMB 3LN4A 4CJ0A 1DDHA 4HIEB 4LBEB 5E2VH 3TBSA 4FTVA 3OKDB 2VLRA 1DR9A 1N64H 4GUPA 4HS8L 3PV6B 3QUMB 3MLSL 1KGCE 4M6ML 3PP3K 5IW3A 4X6BB 1I7ZA 4XVJH 4YX2H 1J1XL 1CFQB 4JVWA 4RGOL 4WEBH 1KN4H 4YFDB 2WWMC 4JDTH 3MNWB 4AENA 1CDBA 1GH7A 4OD1H 4ZSOE 3GHEL 3RNQA 3P11H 2HJLB 4LDLB 4F7CB 1MCRA 1L6XA 1P4LB 4LCYA 3P73B 4MDJB 4MAYD 4HWBL 4LQFH 4UZGA 5IK3A 3RVVC 2AXFA 2QSCL 4PP1C 3G04A 4WENB 4OV6F 4PJ9C 4I9WD 1OP3H 1S7UA 1B2WL 3UYRH 2YN3A 5HHOE 2DQEH 5J1AB 1ZE3C 3TO4A 1GSMA 2CGRL 1H3PH 1T1WA 3EZJB 5E2UL 3OTTA 5CBEA 3TCXA 4YFLI 1WZMA 4FQHA 1KBGL 2VDML 4AH2A 4HLJA 3NFNB 5FYLE 4GG6E 2APFA 3CXDH 5AZ2L 3KAAA 4HK0A 4EI5A 4HD9A 3SDDB 3DECA 2UZYB 2EXYC 3BP5B 1BJ8A 5LKNA 1MCSA 5LG1A 2VDQH 1CE6B 5C0CA 1NAKH 5GJSH 3QP3A 2UVFA 2A83A 2X7LB 4JG0L 5I71C 1PZUB 3DIFB 4MHHG 5DD5L 4NGHH 3UC0H 5I8EA 3M17A 2QQLL 2UZIL 1KELL 3QA3B 1WWBX 3LKOA 2R0WL 3ESUF 2CJUH 4PJCB 3HN3A 3O8XD 1KT2B 3M1BB 4LCIL 4PV8B 5I1DA 4HUKB 1YMME 3S5LG 1U8KB 5I1IL 2P48B 4F58L 4KK9D 3PGFL 2HFGH 1RZKH 4PRPE 1MLCB 1OAXL 3KWWB 3VFUA 4OD2B 4EQ3A 3HHRB 1H9VA 3ZTJH 1FVCA 3C09B 3F58H 4KMQA 3D69B 4KQ4H 2YPKA 4M62H 4BUHA 1FNSL 3LEYH 1QPXA 2P46B 1J8HD 5BJTA 5T5NG 2DQCH 4PRIE 4KDVA 3TESA 3FO1A 5T3ZD 3VFSB 3HE7A 3UPRA 4JFFB 4NN5C 3BRFA 2VIRA 4M9OA 4G6AC 3RIAK 1IEBB 3OAZH 2Y25A 1DEEB 3MRQA 2PR4H 1HI6B 1BMGA 1CFNB 1S7RA 5D1QB 3VRLE 3MLUH 1P4BL 3LKRA 4DQOL 4YHOH 2OL3B 3GJFA 3FZUC 3MA7B 1MRCH 5ID1A 3EYQC 4TUOB 3K46A 1OHQA 5EBGA 2CD0A 4PGEA 5AG9A 4M43H 1H8SA 4QRQA 2G75B 2BSSA 5HYSG 4KV5E 3R8QA 1MHEA 3O6MH 1NDMB 3LPGA 5C07B 5LGJB 4JGJA 2XZQH 1Y6NR 2KH2B 3V8CA 1IAMA 5GGSA 4JY4A 5GS2D 3W81A 1QSFB 2VE6A 2BP3A 1IQDA 3UPAA 2IFFH 4IOIB 3TIEB 3OPZH 4I77H 2DLGA 5E94A 1HNGA 2MMXA 3BUYB 3QWRD 3KXFB 2GUOA 5B21A 4EN3A 1LVEA 2D7OA 3TFKD 5FK9A 3PWJB 5E7FA 2D0GA 5D71L 1CLZH 1NLBL 3PABA 1WWWX 5F7YC 1JI2A 1IBGH 2BVQB 4N0UB 3C5SB 1KJ2L 1IM3A 2YMXL 4WFED 5E5UB 4P2OA 1HNFA 3TYGL 1HSAB 4KJPC 1KIQA 5I6XB 2DDQL 1OAQL 3V6OA 3QIUC 3MLRL 4MD5B 5DR5H 3GNMH 4NUGL 1V3KA 5F3HB 4RBPK 4HKZA 1XF4B 3ARRA 2VC2H 3TO2B 4RGNE 1XH3B 4WHYH 3IDJA 3ZKXB 3U9PH 3BDYH 3DX8A 1EGJL 1NC2D 3BHBB 3LOWA 3V2AR 3QZWA 3KPNA 4WY7H 4XB7A 3N85L 2VLJE 3RL2A 1MCNA 1SBSH 3GBNH 3S34H 4PGBA 3HNTH 2XWBA 3LD8B 1E0OB 3QFJA 4IHOA 5LQBH 2HWZL 4D8PB 4Y2DC 4LRNH 4PJFB 1I1FA 1Z5LA 2EDDA 4F7PB 2DD8L 3KPRA 3JVGC 4PY8J 2RFXA 4X7SH 5E5MA 3GMMB 3R0NA 4NNXB 4X6DB 1CICA 3MGOB 1BZQK 2X5PA 1F2XK 4PR5B 1E6JH 2IH1A 3H7LA 4JPVH 4X6EA 4F7TB 3I9GH 4MNQD 4L4TA 4Y4HB 3CX2A 3RIFK 2H1PH 1FZJB 3OKOA 3SO3B 2V7NB 4BH8B 4FMKA 2H6PA 3WJJC 1N4XL 1HQRA 2M26A 3P4MA 4U2ZA 2OX5A 1OAKH 1PVHA 1RY7B 1UKSA 4HUWA 4XBGB 4XXDA 2AEQH 5KS9F 1MFAH 4Y4FD 2RGSA 2A1WL 2EDWA 3VXQA 1OT2A 2FNBA 3FONA 3LEXB 3QDMB 5DRNB 4L4JA 2R4RH 5TDPB 1JGEA 2X4UA 4A2LA 3V7MA 3RTQA 4I5BA 2H9GB 5CSGA 1F6AB 4YBQD 2NY6C 2P24A 2VXUL 2ICWI 3UZQA 2CPCA 2I24N 3WN5A 1NCCL 5I15L 4NZUL 1VFAA 1KYOJ 3D3VB 4HKJB 3ALXA 2BVOB 3C5ZC 3T3PE 3QQ9C 3T3MF 3FAWA 1NEZB 2XKNA 5F88A 5F1OB 5E03A 1W0WA 3CMGA 3TJHD 1BIIB 3D0LA 5K9OA 1FIGL 1IFHL 5L2KB 4OGZA 2CIKB 5DEFB 1EO8H 1OSZB 5D7LB 1VDGA 4Q6IA 3EJZC 4N90D 3L3JB 3JV0A 2BX5A 1H15B 5CSZB 3LRSA 5TE4H 3S36H 4YDKH 1M7DA 3O3BA 4P5TA 4K9EL 2QSTA 3EOYG 2ZKHH 3UTPD 5IQ9A 1FYTD 1URLA 1NGPL 5F9JA 1WAAE 4HEME 4AT6B 1X6LA 2CXKA 3FCTA 4PY7B 1VENA 5BS0A 2FGWH 4JM2A 1U8OA 5DUBB 3P9MA 4FHBD 4EDWH 1UCTA 3UJIH 3FL7A 5SX4I 5IB1B 1AGEA 4N1CA 5DD1H 4JLRA 5JTWA 4N0FB 5FO9A 3F7VA 4XAKD 5AZEH 3TV3H 4IIQA 5F93C 3QI9A 1HOCB 4PRNA 2OS7A 5IV2B 4RWHA 4M5ZH 2COQA 4K55A 4XNZC 2J8UB 3T0XA 3HRZA 4M61A 5IWLA 3X3FH 2Q87A 1NCWL 3NIGE 1ZA3B 2ARWA 4HMCA 1F4WL 2ZCKH 3JWOL 1LO3H 5F89B 1MQKH 4PLJD 3P4NB 3VXTB 1CGVA 3N1PC 2ZUSA 3BPOC 4L4VD 25C8L 4CJ1A 1FN4B 3MRRB 3S6CA 2XKUA 1P4IL 4XBEH 3H9ZA 3D39E 5KVEH 3C5JA 1YPZA 1YYLH 4NQVB 2B2XL 4KKLC 3MROB 3KPLB 5IW6B 5KW9L 2HN7A 4LCCB 2FEDD 2NQCA 3AREC 3EJYC 5EUKB 3T8XB 3ULVH 4AIZA 3GSRA 1ORSB 4LQ1A 1DN0A 1C5DB 3C8KA 2LABA 2ZCHH 4ZPTB 3AFLA 4HWZB 3IFNH 5T1MA 4GBXA 3BQUC 3UTSB 1EEZB 4G8IB 4EOWL 1D6EB 5HHNB 4U1KA 2R1WB 4JN1L 1T2QL 2X89A 4F9LA 1XF1A 4U6HA 4XCFH 1KG0B 3RVXC 4NO2A 1UT9A 3V5HA 4WWKC 1AKJA 3VW3H 4WNQA 5T3XD 3BT2H 1QFWM 3PXHA 4P23D 3DWTA 3UPCA 2CUIA 4PJCE 2APVA 5DFVD 2WIIB 4RAUB 4GKSB 1IAOA 2CIIB 1OP3K 1P7QB 5I1LB 1UCBH 3AM8A 5MENE 3H3PH 3LDBC 3BEWA 2AQ1A 3EFFB 4LVNB 5EZJB 4NO0D 3ALPA 4JHBA 5EZLA 5C08E 2YA0A 2H2SD 2HTLC 4E5XA 4MAUL 2ICES 1NMBL 1IC5H 2Z8WC 3B5TA 4XVSL 5JW4N 2J88L 3U36B 5T1LD 1A9EB 4Y2OA 3ZKND 4KTYA 3MV8E 5EIQA 1CK0H 2NLJA 3OJDB 4LL9A 3IVKA 1OY3B 5AUMB 1FFQA 5CIPH 2VNCA 5SWQA 4Z7OE 5KSBA 1YEDA 1TQBC 2ZUXA 3F7QA 4G8EA 1QA9B 1D5IH 2P5WB 2PUQT 3KPTA 4L3EB 4KVNL 4L5FH 3TO4C 5E8OB 4O2CB 2OMBA 5DK2A 3T0DA 3OXRA 4HUMB 5IB2B 1JRHL 3DVIA 3EOAA 2V5RA 3MRHB 3HMWL 4CMMB 3UAJC 1QSEB 4XC3H 3O45A 3TBSB 5IVXA 5ADPH 1ACYL 1PFCA 4P46D 1CDJA 3FQRB 3W11D 4PJAF 4X0KA 3INUL 1ZVHA 2FX8L 4YC2B 4F8QA 3WV0A 4ZOCA 4PB9H 4WU7B 3W82A 35C8H 1FO0A 4P2QE 4UT6L 3ILPB 4AENB 4IDJL 4HJJL 5JUEH 1S5IL 2G5BA 2YKLL 3OKMB 1QSFE 5I0ZA 4M00A 3BZ4B 4HK3J 2ATPA 3ARUA 3U0PB 1JHLL 3KXFE 1I7RA 1FP5A 2NXZC 2NZ9D 1S7TA 3G6JE 3NIDF 4ODVL 4R9HA 5IK3B 2R0LL 3MLSH 1BD2D 1D7FA 4HMEA 1EDQA 4M6MH 1JPST 2JB5L 4Z0BL 3O3EA 1N3NB 3OAZK 2UY6A 2V7HA 1YEEL 5K33A 1J1XH 5C7XL 1GGIL 4RGOH 3GHEH 5DC9B 3SDCA 1P7KA 3MXWL 3MUZ1 5IG7B 2AGJL 4GRWB 1A7RH 4U6YA 4CU6A 2FEEL 1R3IL 3PDOB 3WL9B 4NC1E 3VWJA 4HWBH 4LLVA 2QSCH 5EBMB 2F53D 4ODWA 4UUJA 4FQHB 3LKSA 2UYLA 2P8LB 2X1WL 2AJYL 4R7DA 5BOPA 2W1NA 1VFBA 4NC2B 4WHTB 2EEAA 4HK0B 4EI5B 3EFDL 4PJDE 3U6RB 3VFRA 1Q9LA 2Q8AL 1B2WH 2P49B 3HE7C 5H2BA 4DCQB 3F12A 3SE3A 2RR3A 4OFVA 1MFBL 3BPCB 2CGRH 3UTTD 5JLZA 2AJXL 5E2UH 5E4IA 5EUOB 3S5LA 2IAMB 4LKCA 1AXIB 5I8EB 1KCKA 1KBGH 2VDMH 4LEOB 4YXKL 2EZ0D 3I6KA 3NN8B 5AZ2H 3W9EA 5I1JL 3OHXA 4NN6B 4X8XA 1C5BL 2EO9A 4MD4A 4G8GD 4M02A 3EYVA 5DJCB 1NFDB 3TBVB 1YNLL 4M93B 2CK2A 4JG0H 5DURB 1CFTA 1EHXA 2DF3A 3JZ7A 2Z4QB 4JB9L 5DD5H 1MFNA 4NHUB 2E7MA 4WV1B 2UZIH 2QQLH 2GY5A 1KELH 1OP9A 4X6FB 3RL1B 4U4BA 1LO5A 2R0WH 2YD7A 2YRZA 5FECA 3WO3B 1WBZA 1D5XA 3GI9L 1ZA6A 4UQ2B 3B5HA 4LCIH 1KENL 5I1IH 4OLVL 4G6FD 4X7CC 4F58H 3DARA 2GI7A 4QHMA 4U1IA 2NY4C 3PGFH 2C3WA 1BLNA 5JNYA 2BCKB 1OAXH 1FV1B 1U8QA 2P47B 3JTSA 3GGWA 4NN7C 1SHMA 5AAWA 4KK8D 3L3HA 1N59A 5HPMA 1U41A 2NPLX 3PQYE 3S36X 4P2OC 1FLTX 5CLTA 3MOAL 4FFWD 5E00B 3V6OC 5FO7B 3D3VE 2ADIA 4JFPA 5CILL 4FS0A 1I1AD 2IAND 1JJUA 4C58B 5KVDL 3O2DH 2NW2A 5EIVA 1ZLUH 2OLDA 1F3DJ 2OL3L 5L2KE 3RWIA 1GGUA 1QPPA 2BSSB 4XX1E 1S5HB 4OZGB 1EFXA 3ARGD 4DAGL 2QKIB 1AD9B 2IMMA 2XQBL 4N5UA 4DQOH 4Y4KD 4OJFL 3DMMD 1F6FB 5ELIA 3T0EB 1KJVA 3V5DB 3ARVA 1GZQA 4H88L 2K7PA 2HT4D 2E7CA 1CICC 3U79A 4ZO8A 5IB3A 4EN3B 4K3GA 3Q0HA 5I73C 4G6JL 3DHMA 1BFSA 1XR8A 3PABB 4JRXE 5KSVB 4NP4L 3IDXL 3IAGC 1IGFL 5EORL 1S9WB 4X9BA 4GH7B 3ES6A 4ZG1A 5ESQA 3LV3A 3MRMA 4GO6B 2J8UE 2CLRA 4ODXB 3MX0A 4PJ5D 1LK2B 4LLAA 5C3TA 4EDXA 3DBXB 3SGDH 3GBLA 5D71H 4Z76B 3L95B 1NLBH 3DV6A 1P5VA 4NUJB 1PAMA 1H3WM 4ZUTB 1KJ2H 2YMXH 4PBXA 1AGDA 5JDSA 1T1XB 2QV2A 2X1XR 3Q48A 3DX8B 3FRUA 1Z9LA 1WICA 3TYGH 3RTQC 1R5IA 1U93B 3CPLB 2Q7YB 5A2JH 2DDQH 1OAQH 3MLRH 3HG1B 3MRJA 3QISA 4POYA 3QO1A 1JMXA 5DGRA 2JKXA 3WN5C 4NUGH 2VB5A 4KK5D 2ORBL 2DL2A 3HS0B 2EYSA 2VZ3A 3CFKA 4IHOB 4XGZA 2LQRA 4OZFG 4OZIA 1CLOL 3BP7A 4LSTL 1TQCC 3O4LA 4LLWB 1EGJH 4R4NC 4U6TA 5EDXA 1T83C 3T4YA 1QLEL 4Z7QF 2IH1B 5HDBF 3DXAA 5I2IB 3N85H 3D9AL 4Q6IC 3HZYA 3KYNA 3LKNA 2HWZH 1GIGL 2D2OA 5JHDA 4P5TC 5EC2B 1T1YA 3NGBB 1HQRB 2R4SL 4G42A 5ERWB 4DUXA 4NOFA 3RGVB 4Z7WB 2AI0L 1AIFB 4JM2C 4Y8DC 1QRNE 1S9XA 4R0LB 3FONB 5E70A 2A38A 4BFEA 3N50A 5JW3L 3QIWD 4J12A 1T0MA 1JF1A 2X4UB 4E41D 2X4SB 3DRTA 2J5LB 4Z7UE 2HKFH 4JZNB 4I2XB 3VA6A 4IIQC 2MHAA 4RAHA 1K8IA 2A1WH 3TJEL 3H9YA 2XFXA 4WW2A 5DHVA 1INQB 2HRPL 3NZ8A