3TWCL

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt127 in complex with man9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
208
structure length
208
Chain Sequence
ALTQPPSASGSPGQSITISCTGTSNNFVSWYQQYPGKAPKLVIYEVNKRPSGVPDRFSGSKSGSTASLTVSGLQADDEGVYYCSSLVGNWDVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PGT127 light chain, Ig lambda-2 chain C regions
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3twcL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3twcL02
3ABZA 2FX8H 2XY2A 4NT6B 4YK4B 4GLRI 4L4VB 1JF1B 2HKHL 4WW1A 1DL7H 3K81A 3QQ9D 3MRRA 3SDDA 3SDCB 4RWYL 5FO8A 1KJVB 1E4XI 2VLMD 3KXFE 5DVLA 3B9KC 4JO1L 4UU9B 4X6BB 5I0DA 4IDLA 3RKDD 3BP4B 5KS9F 1FSKC 1ZEAL 2PO6D 1KYOJ 3HPLA 5EU5B 3OAZH 4MXWH 1EAPA 5HHMB 5TQ0H 4MS8C 1FZMB 3RVUD 3IDYB 5LGJA 3BDBA 1LO0L 1A9BA 2KH2B 4F37F 4MD0B 1AI1H 2NY4C 3QDHA 1KB9K 5TE7H 1BEYL 3VFNB 4JM2D 4N1EA 1MFCH 1IGTB 3TPUA 3SCMD 3MOBL 5IB1B 3I50L 1U3HD 2VZTA 2HWZL 3QIUC 4XZUB 3ULUF 4DEPB 1CICC 3RBGA 2C3VB 3QEUA 4Y4HC 5FGRA 5I8EA 4JAMA 3WNMA 4CMMA 3T8XA 3QXAA 1PY4A 4JRYE 1FO0B 3WUWG 2YC1A 5B38B 4GW4B 3D9AL 3GSOA 2D31A 4PJDE 3CD4A 5FHAH 1M7IB 4AT6B 3BHBB 1PYWA 3I9GL 3ARVA 4TVPD 1UZ8B 2F15A 4FQ1L 1AIFB 4XC3H 2A73A 5IFJB 3NAAL 5D2LF 1NH6A 1UJTA 5C8JB 4UTAL 4G8EB 3C60A 2FO4B 2O5ZL 5DHVA 1EAJA 1GZQB 5FHBL 3FB8B 4F57L 5JORB 1BREA 4ODTH 2GY5A 4JFYB 3A0OA 4QRTB 5IJKC 1JGVL 3S9DB 4Z76B 3KJ4C 3KPRE 4LHQB 1QSZA 1NDMA 1JMXA 3QZWG 4B50A 1QSFA 1WIUA 3D18B 4NO3A 2O5XL 4S0SD 4O51A 2R69L 4NRYA 3OKOA 1Q94B 4LSVL 1UVQA 2Y7QA 4PYGA 4MQSB 4QOKA 4LIQH 3KPSB 4NHUB 1C5DA 1XIWD 3F7VA 5EU6B 2B2XL 2P5WA 1XMWA 2HJFB 2XWTA 2P49B 2V17L 3I3BA 5DF0A 1F6FB 1HEZA 2NNAA 4Y2DC 2F54B 4U3XA 1HCVA 1NLBH 1NAMA 1MI5B 4KMTH 1LEKA 3S35L 4EIZC 1MHHA 1N0XH 2CXKA 5ENWB 4YDLB 2FLRT 5JO5A 1W0YT 4YHOH 2I26N 5AWNH 1A21A 3HC0B 4MB4A 2P47B 1CZ8H 2WV3A 5IMMA 2HKFH 1FFRA 2Y6SD 4HIEA 3PJSA 4BM7A 3EOBB 2ITDA 5DEGA 1T83C 4X6DA 1U8MB 4JJ5A 1CWVA 5KSBE 2QADC 5BRZB 4OF7A 4NQDB 2H26B 4YHML 1KTLA 1IRAY 3LKNA 3BZEB 5T3XE 3HC3H 4OLVL 5ITBH 1U8PA 2EDBA 2PYFB 3EOTL 5JXAH 1CGSH 4S0TD 2VXUL 2X6MA 5JHLL 4PJFE 1HYSD 5C09D 2YXMA 4QXTA 5FIEA 5I6XB 4GBXB 2J5LC 5I9QB 1JNJA 5DJ2A 4KK9D 4QXUH 3KYMB 3DI2B 4FQHA 2F8VA 5SX5K 5SWSE 2EXYD 4U3CA 4UZGA 1XGYH 5DFVC 1D9KD 1F3DJ 4KRPB 5T1DH 4UV7L 1EVUA 2E7CA 3ZKQD 3KR3L 5D1QA 4NZTL 4NKIL 1NGXB 1NCCL 2EYTB 1FNEA 1OGAA 3RWHB 3UTTD 2GK0B 5CUSH 4YH6A 3ZL4H 4JGUA 2MQ0A 5JOEA 3O2VH 5E8EA 3V6OE 1I8LA 2EC9T 1A7NH 1IEHA 5IFHL 1OAYH 2VDRH 4HUUB 4HCRH 3DWTA 5FM5M 1TMCB 5E9DE 5IGXL 4JDZA 1LP9E 5J3HD 3WJJC 3NOIA 4KK5D 2YD1A 4JPVL 4H8WH 1IL1B 2F8OA 1A14L 4RWHA 2NW3A 2YN3A 4JGJA 4Y89A 4GSDL 5KOMC 1AFVL 4KDTC 4C56D 3F5WA 5KANI 12E8L 1HHJB 1RZJL 1BX2B 4WI2A 4M4RA 1QSVA 4PGDA 1RAMA 3FQTB 4LCYA 1KELL 3QDMB 5CAYB 3RVXC 4R4ND 5FYKH 2WBKA 4O5LL 3ARDA 1KCRL 3MRIB 4NZDA 4GKZA 1GOFA 1KIRA 3NACL 3M17A 4TUKL 1G7HB 1KFAH 5H94A 1JPSH 4HFUL 4P2OD 3SOBH 4Y4KD 4M61A 4WFEE 4E41A 5E8OB 1BGXL 2XNAB 1H3TA 3IGAB 3NIFF 3MRCB 3DV4A 5J4MA 4HGWA 1SYVB 1RU9L 2IADB 5I73B 2VQ1B 2EIBA 5KG9A 2NY2B 5D7LE 2NX5B 4IS6B 2GEEA 4GRLA 4P59H 1I85C 4FG6D 2J4WH 5I1LA 1NAML 2VLKA 3TJHC 4D9RD 3L7FA 4R7DA 1M7DA 3K4ZA 2A9MH 3HRZB 3ULVL 1N5YL 3BAEL 2WUCH 2DQDH 2CXGA 3MRGB 5KSAA 1GPOL 3EO9H 1LEGA 1PSKL 5BXFA 3LPFA 3TIDA 1AGBA 5HGAA 3BE1L 3DX8B 4U4BA 3T1FA 4X4XA 3U1SL 3U2SB 1I1AC 4F9LC 4Y16A 3MV9E 3UO1L 1PG7X 5H8DA 1A1NB 4J4PC 5DWUL 1TPXB 1IEBA 5C07A 2UWEE 4JKPH 3DVGB 1UYWL 4TNVK 1HOCB 4Q6IB 4QTHA 3TO4A 3VFWA 3H2WA 1KJMB 3L3KB 2ZG2A 4NQEB 1KCUL 4U1LB 4XP5H 1R5WB 4FQLL 3AXLB 1J10A 4KTYA 2YPLE 2MKWA 4OZHB 3ZSTA 1BIIB 3U9PL 4Z0XB 1FL5A 5SX4H 1EEYB 4JANA 2NY0D 1CFSB 4HS6B 5CD3B 5CP7B 3EZJB 5IG7B 5J12C 1JWSA 1GC1C 2JCCA 3RL1B 1KLGA 1X5LA 1FN4A 3ZHLA 3T65A 4UNUA 1PDKA 4PP2B 4U1HB 5F89A 3JTSB 1G7QB 4U6VL 4H1LG 3OKLB 2BC4B 5J6GA 1HDMA 1UM4L 3VXUD 2EH8H 3VFTA 4PUBH 1QRNB 3BP6A 3ORJA 3EOAB 3B9KD 1A22B 1CE6A 3MOAH 2VIRA 4MJIE 3KS0J 3ARBC 3IFPA 5F7MC 1KEGL 2VDNL 1UG9A 4AEHL 4MS8D 4RAUB 3HFML 4RMQA 4BZ2H 2BVOB 4QHKI 5DLMH 3UPRA 5B39A 4HIIA 3L5JA 4OGXL 2YUZA 4JFFB 1MF2H 2ENYA 3HKFA 4HT1L 2NY4D 5DYOB 5EIIB 3U9UB 4W6XB 3TBTA 1ZGLP 2YR3A 4PRPA 3ZTNH 1CE1L 2ZSWB 5D8JL 4MNGA 4XNUL 5F3BA 2R1XB 4OD3H 1BM3H 4YE4L 3ZKMD 1VPOH 1MRDH 3QIUD 3O3AB 1OB1B 4WENB 1CICD 4JCMA 1K5NA 4NRZA 5E5MA 4IJ3B 4Y4HD 4DCQA 4LRNH 4TULH 2XYCA 4GT7A 4L8SB 3BPOB 2UY7A 2CKBH 3RGVA 4R9HA 5HI4C 4X9HA 4YEFA 4ZPVB 2F5BL 3LZFL 2XPGA 1JZ6A 1RUMH 4L4TD 1NSNH 4NP4H 4R7NB 2HVKA 3K0WA 4BELD 3QDGE 3UTSB 1IAIL 4RCAA 1R3JA 1U8QB 1B90A 1Z9LA 2GUOA 5D2NB 3G08A 1RD6A 4OUOA 5A40E 4JFXA 1DLFL 1RUQL 4ETQA 1VACB 3QFDB 4OZIA 1H15B 3FT4B 1MJ8H 1KT2B 3SDAA 4K55A 1TJIH 1ZAGA 5EBWA 4A2LA 4EIGB 1Y18A 4PRHE 1KB9J 1KJ2A 2X9XA 1EUTA 1IC4H 3RWJA 1LO3H 2XXCB 4FZEH 4ZXBC 3IXTA 4PTUB 3T3PF 1KLUA 4J23A 3VXQB 5JDJA 3V5DA 5CLWA 2FSEB 2E7BA 1JTPA 3WDHA 2VDPL 2IH3B 2EXWD 2HTLC 4K3EH 1QACA 1ULVA 3WMSA 1H3VA 1BD2D 1D5BB 1TVBA 4LVNC 4MA7L 3TA3B 7CGTA 1JIBA 2YD7A 4NKMB 2GT9B 5E2JA 4Y2DD 1EDQA 3MRNA 1ED3B 3PE9A 3VFVB 4DZ8B 3ZT7A 1K3ZA 3C08L 5I1HL 4HWZB 1MVUA 3OAZK 4OZGE 1I1YB 1X7QA 2OJEB 5F1OB 5BOZG 3MCLH 2WQ8A 4Q0XL 4LF3A 5I1GL 3QUXA 3NCCB 3MV7D 3CIQA 1FH5H 1HILA 1YEKH 1VEPA 4MB5A 5T1KD 3DRQB 2EZ0C 4KAQH 4PJIF 4IRJC 3KLAA 4LCWE 4O00A 1A7QH 1KPRB 5BS0D 5GS2D 2X4NA 5L8JB 5E00A 4YHNA 2QADD 3HR5B 3JWOL 1X4XA 4K71B 4TUOB 1EFXA 2PNDA 1EHAA 3OPZL 2K3TA 3VXRB 3QDJD 1XF5B 4FQXA 1KULA 1VB9A 3R0NA 4Y7MA 2E9IA 4X9IA 2E6JA 3OL2A 1IGJA 1CIDA 3DMMB 2JB5H 4AEEA 3C6LC 1WZMA 5GISL 5H35B 3PWLB 4J3VA 3O4OB 4O4YL 5F6HJ 1NBVH 1C5BL 5CINL 4PR5B 1B3JA 1KXVC 3AAZA 5FM8A 4DZBA 4P5TA 2DI8A 4P46A 5DFVD 4OZFH 4MSWB 1FO0H 2WBJA 3VW3L 2DYPA 4PS4H 3JV4A 2KQNA 3QEGH 4ZAKC 3QI9B 1Q9WA 3QIBA 5DJCA 5F96L 5F8RC 1T5WB 2RCSH 1J8HB 4GLRH 2IBZY 2DD8L 2YPKB 1W72B 4M02A 2XZAH 4TPRH 4LFHG 2NY7H 1G6RL 2QSQA 4HGKC 2QTEA 4XNYH 5D7SH 2ICCA 2OS7A 4J3TA 1JCKA 1JGLL 4PRBA 5JW3H 2FJHB 4Z7VB 1RZKH 3RNQA 1S7VB 1VSCA 1T2QL 4P5MA 4S11A 4QRPB 3GSXA 1NGYB 4CU6A 3T0EC 5J06A 1YN7B 2FJFA 3C5ZC 2YA0A 3TYFB 1FYTA 5CEXB 4PJGB 3V79C 1RHFA 5FKPA 3UAJC 3C2AL 1BPVA 1GGTA 2ESVE 1BVLB 1O7SA 2V9RA 3CZJA 1FHGA 5DHXB 1OM3L 3VFMA 3BWAA 1KC5L 3BKYH 3KPNA 3R4DA 4JZJC 4H26B 2R8SH 4JRXA 5C0BA 4U33A 5DGRA 1JWUB 1KJ3L 3GSRA 4YDJA 1LEIB 3T2PA 5FYLD 5KS9E 5AUMB 4FNLL 4FQ2H 3BDXA 3MV8B 2BOBB 5IMKB 2FWOA 2FZ3B 1DN0B 1PKQE 1DQLH 1JWMB 5B8CC 4M6NL 4AJ0A 1MCOH 4IOIA 4L9DA 1FZKA 4R0LB 1TTUA 1IMHC 2ADJA 1NL0H 4YJZL 4Z7WA 3TYGH 3FN3A 2VN4A 2Y23A 2G5BA 4X6FA 2D7OA 4JN1H 1T03L 4EUPB 4ETYA 2XG5A 2W9DL 4HXAL 3PQYB 3FQUA 3JWDH 3ULUE 4MA8H 2EE9A 2NXYC 4OV5A 5I1IL 3EFDL 5EIVA 1KN2H 1YPZB 3R8QA 1TNMA 3CDYA 1DBBL 4XBEH 4FQJL 3VDCA 4A6YA 2DIJA 1XCQA 4LASL 4PRDB 4Y19B 1EUUA 4O58H 4YNYA 5CSBA 4D3CH 2ZJSH 4OF0A 5MENA 2XZQL 5T5NF 3I6KB 4JGMA 4D0DA 1I1AD 3BSZH 2A0LD 3CCHB 3T2NH 1G9MH 43C9A 1ZT1A 3G5XB 1EHLL 4J4PD 4UOW1 4P5KA 3C60C 4DOHE 1CF8H 3PGFL 1KB5A 5D2LE 2WP3T 5ICXA 4NC2B 4Y5YA 4X0KB 3SKMB 4UT7H 2DBLL 3MLUL 1XFPA 4B0MM 3VJ6B 4XBPB 4OKVB 4M5ZH 3IDIA 3V8CA 2LFGA 4XCNA 3VFGL 3RNKA 5HPMA 4JFDA 3LKPB 4WEUD 1JPTL 2VZ3A 4ODWB 4MZ2A 2VZUA 4N8PA 4JHAL 5IW1A 4L29A 1W0VA 5IMOB 3AY4A 3HI1A 5JHDB 5DO2C 3LKOB 5MI0C 1T20A 1CTOA 5BV7H 3X3FH 4WTWA 2PXYA 3E3QE 4HWBH 2P42B 4YZFF 1BFVH 3CDFA 5DT1H 3W2DH 4FTVB 3TVMB 1T1XB 3W81A 5GRXG 4J2XA 1ZGLM 1R3IH 1I8IA 4ZFZB 2G75B 1ACYL 4P23A 3JUYA 1RMFH 4ZO8A 5HHQA 5I8CB 3AB0C 4MLSA 4OAWB 3VWJA 3ARBD 1YEIH 2R2HB 5ISZA 2NZ9C 3ZMRA 4LHUB 1X4ZA 4LIQE 3GO1H 4R4FL 1U8LB 3HPJB 5JUEL 5ID1A 3WHE1 3MNZB 3P2TA 5DJ8B 2XRAH 3Q1SL 1A9EA 3U0PB 5HHOD 43CAB 3O3UN 1MWAA 2HRLA 5FUZH 1AGFB 4MNQE 2OI9C 5D7JA 1P2CA 3GRWA 3W9DB 1FZOA 3D85B 4RX4D 4ZSOE 2P44B 4FQIH 4GG6A 4LCCB 4YX2L 4D9LL 4PBWD 1L7TL 4P2RE 3QQ4B 5CWSB 1MFNA 1ZGLA 2R15A 3RDTB 3JZ7A 4Z78A 2YEZA 4EN3B 5HI4D 3CU1A 3OKMA 4MQTB 1LHZA 3BH9B 5EA0L 1QG3A 2GY7B 2WNGA 5JQ6L 5IBTH 3NA9H 1IGIH 4APQB 3FQXA 2WMPA 5DD0H 5A16A 4HIXL 1NANI 1JHKH 3UYRL 4BZ1H 5AZEH 3L9RB 2P7TA 3RWFB 5TFSH 2DQIL 5J6HB 3DOSA 1X5IA 4XMKH 1MJUL 3RIFK 3OHXA 1QQDA 1ZLSH 5ITFB 2GCYB 1HH6A 2Q1EA 3VXSB 5J13B 4XVTL 3CFEB 3L95A 2Z31C 1SMOA 2A6IA 5K9QI 3VWKB 3RTQA 4L3ED 4A6YL 1KCVL 4QRRA 2MCPL 4F7CB 1LK3H 2AW2A 4MD5B 4P57B 4L5FL 5CBAB 2N7BA 5IMLB 1UZ6F 4ZYKA 1C12A 1HKLL 4TRPL 4W4OC 5E2TL 2EDRA 1BBDL 4XWOD 1ORQB 5SWZA 2BNQD 1S78C 4BH8A 2WWMC 3V4UH 4U0RC 1KB5L 4CVZB 5E6ZA 2X4UA 5C6TL 5F7KC 3BN9D 2Z0BA 1T7VA 1S7RB 3FFCB 4FZ8H 5ADPL 1WITA 2C3XA 2G9HB 3V6ZB 1UB6A 5T1MB 1HI6A 3ZDZF 3GSNA 4PJ9B 1UB5A 1IJ9A 5HY9B 5E4IA 5D5MF 1OP3K 1DLHB 2YUVA 4PFEA 4PTTA 2CK0L 2YPVH 3IB4A 4KV5F 1V7NL 3RWDB 1E4KA 3NFPB 3WLBB 3QO0B 3PHSA 5AYUL 3FB6B 3C8DA 3RVWC 2EZ0D 5GGUA 4NBZB 2X7LA 3PP4L 4AQOA 1MHPH 1JGDB 2QKIB 3L3IA 5GS1B 1JHTB 3G6JB 3DRTB 1P6FA 3U7YH 3NIFE 3U83A 3KHQA 5LQBH 4LLYA 2LV4A 2BRQA 1NEZB 4RGMC 4N0FA 1BJMA 2KZ1B 4NO2A 1PX4A 1QBLL 4Z8FL 3DSFL 1RUAL 4S1RL 1OAXL 5IVXB 3QJHA 3QQ3B 2DDQL 2HVJB 1KTKE 2WWKO 2VXVH 4UTBH 4R97B 1FGNH 3QCTL 4UIKH 1AD9B 2DQJL 1XGUA 5EC2A 4ZD3H 2V9QA 4ZS7L 1MWAL 1X5AA 1KTRL 3W5NA 1R3LA 1VFUA 5DHYA 3MLWH 5I2IA 3G5VA 4N0YH 3TWCH 1F5WA 1MREH 2VR9A 1PLGH 1CR9H 4ZAKD 4PPTA 3TO4C 4FRWA 4OCWH 3O6LL 3QXTA 2CKNA 1NFIA 3I85A 4K07A 3TCXA 4KRNA 1U6AH 3KWWA 1BOGB 3PUCA 3INUL 5D7IB 5HYSG 2A6JB 3MA9L 4JPKL 2JB6B 1X6NA 4PBVC 3B9VA 2OR9H 2GI7A 4OFYA 2LTQC 1ZWIB 3RJDA 1SQ2N 4PRID 2R23A 1P4IH 4JKLA 5D9SB 3MRKA 4L8DA 4UNTA 3HUJA 5BZWB 1U92B 3L5XL 3T0ED 2FR4B 1GIGH 4BK5A 3Q5TA 4JVWA 4KTEL 2XWJA 3D69B 4LCUB 3C5ZD 1NBYA 3UCRA 3PG2A 4JY4A 3O4LE 4NN5C 3WEXA 1AGCB 1VGKA 5D96B 1ZSDB 1ZVYA 2MKLC 2VERN 4PJCF 4TVPH 5FF6A 5IEHA 5IBUB 1YYMH 2MPAL 3UAJD 3JWOC 5DA4A 5C0AB 5D6DA 3X3GH 1D5IL 4ZUTB 4WTXA 1S8DA 3D3VA 4CADB 3K3QA 2QR0A 3I3DA 3M1BA 4KUCF 4WUUE 3GHBH 3NZ8A 2RR3A 4MA1C 2NZIA 4F7PB 1QNZH 4FFZL 1G7PB 3VI4F 5ICZA 3PV6B 4G8FB 5C0CD 5JZ7C 1PY9A 3DVNA 2J7LA 3D0LA 5TF0A 4M7ZC 3STZA 1IGYA 5F7WC 3BISA 4P3CH 15C8H 3LDBC 5GSVB 2YMXL 3OR6B 1FVCA 5I1CH 4DWHA 2VWEE 3FOLB 1NUDA 2HH0H 2X1QA 5IIEA 3IVKA 4PJBA 3U82B 4NC1C 2VXTH 2X40A 4R2GB 2J1KA 4R3SA 3V6BR 2Y5EA 1DQMH 1S7XB 2AERT 1YNTA 1YNKH 1ZLUH 1EEZA 3V7AG 4OM1L 4B7IA 2IPUG 3Q2CA 5CKGA 1A6TB 4Y8DC 3IFLH 5JW5A 5EUOF 2NXYD 3GSNL 1W8NA 1OCWH 3MA7A 4O2CB 2IAND 3L3DB 3V0WH 3QFJE 1DUZB 1ETZA 5T5FH 3DO7B 2XTJB 4CNIB 1E28A 1NC2B 3SGJC 3UXFA 5C86A 4X98A 1RFDH 4KRMB 3CVHH 1JTOA 3BH8A 4JY6A 3GHEL 1FPTH 5E6IB 1TQCB 1T89A 5T1LA 5F6IB 3RHWF 5ESQA 3F62A 4GQ9H 3QUZB 3AS1A 3U4BH 3BKCH 5B3NA 4GXUM 2AVGA 5LBSL 4LSTH 3JUZA 5J1TC 1NCBH 4K23L 1RIUH 4P2YA 4LEOA 3WHXB 4EVNB 4RGNB 2NR6C 4DKDC 4JDTL 3DGGA 2VRAA 3SHSA 1ZLVK 3HZMA 2N4IA 5C2BL 2H45A 2EDJA 3B2VL 3IAGC 3T3PE 1IQWH 1W72H 1G7JB 1B2WH 4KJYB 5HD8C 4OIIL 4ALAL 2BP3A 1DBML 2X1WL 3EO0B 3WYRA 5I30L 1F13A 1VFBB 2P5EB 1AO7A 2BVPA 5HGDA 4F2MA 1T1ZA 1SJHA 4IOFC 3QG6A 1KBGH 4IRSC 2AV1A 3Q3GB 3RWIB 4Z95L 5GGQH 3RL2A 3MRJA 1T7XA 5IROA 2CDFA 5HYJD 4X6CA 2XWBA 6CGTA 2EC8A 5DMKB 2ZP0T 2XV6B 3SKNA 4MCZA 3WD5L 3KYOB 3LN5B 5C71A 3VMPA 3W11C 3QRGL 1IAMA 3GMPB 1YDPA 4NNYB 4Q2ZB 1FRGH 1YMHA 4PJ5A 3ZSSA 2XZZA 2B4CL 3RBSA 1N2RA 5E1HB 5D1ZB 2F53B 1FE8H 5FKAA 4UOW0 5C0EB 2Z93B 4Q7DA 1M05A 3KAAA 4PJIE 4OT1H 1QLEH 2W60A 1QSEE 3RIAF 4YDVB 1KENL 1J1OH 3HNSH 3QA3A 2BSSB 4NBXB 3QHZH 5F9JA 2HG5B 3DUUA 3B5HA 2YRLA 3BOVA 3V2AR 3VFRB 4PV8B 2IQAA 4JLRA 1FNGB 1BJ1J 3ETBF 4LU5L 3LMJH 2DB8A 3LV3A 4AIXA 1QO3B 5FO9A 4AYFA 4GUPB 2XN9A 4NM8L 2XKNB 2EKSA 4EUPH 1XF2B 5K9JL 1EIBA 1RQ5A 2V7HB 1K3IA 4D0CB 1WT5A 3TN0B 4BA8A 2OL3A 4U6XB 3SY0B 4U1GC 1HINH 2X1XR 4DN4L 4TSCH 3TZVA 1MFEH 2KPNA 4W6YB 1VKXA 4OQTH 1G0YR 2IPTH 2IEPA 3O9WA 1JUFB 3CC5A 2JK5A 1TENA 4HJ0C 3BKJH 3SEPA 5IQ7L 1MIML 3UPCA 4KK6C 2W07A 4NZJA 1ERNA 3E2HB 1YMME 2Z31D 5L2KA 3PWPB 5IQ9A 3WHE0 2B20A 5CMAA 3QULB 4W70A 3T77B 4ODSL 3BP7B 1C16A 5TE6H 3WLWC 4L9LA 1H0DA 2A77L 4OCXL 1MNUH 4HPYH 4N0CC 3QSKB 4PJXA 1U95A 1XF4B 2R0ZL 3BDYH 4LSDA 3U6RB 2VAAB 2PYED 1Q9LB 3VDAA 5KTEL 1S78D 1OSZB 1OY3B 3DBXB 4ZUSA 1WZLA 2WWMD 4DJMA 4XP1H 4QLRA 1I3VA 2ILLA 5A2KH 2XZCL 1MH5A 2A6DB 5KZCB 3NCYP 4QO1A 2AAVA 4R8WH 4G6JH 5C3LD 3C5SA 3IDGA 4I77L 1S9YB 4HUWA 3O8XC 1CFNA 4H1LA 4XCEB 4ZQKA 4LARL 1TZIB 3MRQB 2CDGB 4ZTOL 1WFOA 5M94B 1JN6B 5MERA 4WY7H 2F19L 2ZSVA 2JIXD 1UA6H 5CJXC 5C6PB 4QRSB 3NPSC 3HMXH 2I07B 4HHAA 3RVWD 3B6SA 5KSUB 1IBGH 4U6HA 5I76A 1J5OH 1CTNA 5FCUL 3HHRB 3QXDA 5E8DH 3SDXA 3V6FA 1XF3B 5FUOH 5IJVA 2Z91B 1NAKH 2BVTA 3C8KB 3WE6A 2W0FA 5EU6E 1UH2A 1JRHL 1LDPL 4XP9H 1M1SA 3OAUL 4ZUUA 1ZOXA 1SHMA 1MSPA 4TSBH 4BSWA 4ORGB 2VE6B 1QFOA 4RQQB 4WIQA 5FEBA 3WN5B 4DVBA 1HH9A 3MC0A 1KPVA 5LGKA 3MRHA 1OARH 4S1QH 5HGBB 4C4KO 3VGAB 3HE6B 3N50A 1MEXH 3ZYOA 5M95B 4MDIB 2MOVA 4MCYA 2PTTB 3V4PH 1S5IL 1P4LB 2DBJA 4JRYD 4OCLC 2OR7A 4TVSa 4K3DL 2A1WL 1FG2B 2EO1A 1EV2E 1YNLH 5E2WL 3CFDB 1VFMA 4MQ7B 2NYYC 1UKQA 3BQUA 4GAFB 5HDQL 4YBLB 3O6FA 5F71A 1U8KA 2ATPA 1AQDB 3PGDA 2ARWA 4ZMAT 4YUEH 1RIHH 3BPNC 3K46A 5EBLA 4NN7B 3GFUA 5B21A 3D39E 1T0PB 1R3HA 5ICYB 1LMKA 1X44A 1CXEA 4YXHL 3OB0H 2RGSA 1FV1A 1VEMA 2SEBB 4TN9A 1UM5H 3S34H 3S8WA 3H9YA 5ESAA 1XZ0B 2F5AL 4NDMA 3T3MF 1MCRA 1RY7B 2OL3L 4LFHD 5EC1B 3TBWA 3HA0A 1OAZL 4MGXA 4V1DB 4NO0A 3BX7C 3QIWA 5HHXH 4O9HL 3B5GA 4YZFE 1IKFL 1F4WH 1YYLH 4RFOH 3VRIB 1J18A 1F2XK 1YY8B 3IETA 2X4SB 3S36L 4AL8H 5INDA 4CUCA 2FH8A 1TVHA 5IF0A 3PP3H 5EO0A 2CLRB 1R0AL 3EDDA 3A67H 4GXUN 3KXFA 2VH5L 2CIKB 2FB4L 2P8LB 5ADOL 1I9IL 3FQWB 4I3RH 5JZ7D 3EYFB 4YHYB 2W9EH 3LVEA 1S9WA 5ALCH 5KBNC 3TEUA 3PIQA 4I48A 3SDDB 3MRRB 3AS0A 4XP6H 3WUZA 3MR9B 4HZAA 5EN2A 2Q8AL 1GGIL 3E8UL 1A47A 4MQXC 1A6UH 3HPLB 3SGKA 3LQZA 2DTSA 4JG0L 5KJRL 1X5XA 3GMOA 5EWIL 4P3WA 4LNRA 5JPMB 2BHZA 2PUQT 4JG1L 1OTSC 2IAMC 1A9BB 4JFEA 1EERB 2BNRB 3LQAC 3RAJL 4L3CB 3TPUB 4X80H 2DQEH 3HE7C 4DK6A 5TPWL 1JF1A 2CDEB 4M62L 5F93C 2QSCH 2ZKHH 4JFOA 4PJDA 4WWKC 4XPGH 3QEUB 3BP4A 5I8EB 1A7PH 2E6PA 3NCYS 4X5XB 4CMMB 5CGTA 5E5UB 3QXAB 1KXTB 2BCKB 5EU5A 3T8XB 1JI1A 3T2QA 1UWGL 2YC1B 4WW2A 3GI9H 5F9OL 1RSFA 2AK4D 2OX5A 4WJ5B 5F9AC 5SWSD 4QHMB 3MYJA 1TQBC 3DXAE 2AJXL 2YD2A 2NR6D 1PYWB 1PFCA 5GRJH 1RK1A 3UBXG 4G5ZL 1MRFL 1SEQL 1IGTA 3RTQC 3CSGA 3ES6A 3QAZB 3R8BB 4G3YH 4KHXH 3KPRA 3VCLB 3JVGA 5DHVB 3SDYL 1KCLA 1RURL 1YEHL 1KEMH 2CJUH 2C3VA 3IU4H 4OFKA 1MCFA 2DIBA 2H32H 3DJ9A 2Y25A 2BDNH 4IOFD 1JZ2A 2ADFL 4IRSD 4LEXL 5F21B 2ADIA 3VU2A 5B38A 4GW4A 2ZUQC 3VMOA 1QSFB 4NO3B 1K2DB 4O51B 2D7TL 3OKOB 1UVQB 4WEBL 2Y7QB 3MLXL 3C2SA 4JREC 3UTPE 1C5DB 3F7VB 4QT5A 2B5IC 3ZDZE 2P5WB 1PW3A 5HVWA 5C8JA 5FYJD 4G8EA 3W11D 2FO4A 4HUNB 4P3DA 2DQTL 2I5YL 4UIMA 2HRPL 2NNAB 4OLYL 1SVZA 3FB8A 4KV5E 3HTLX 3HG1E 4WV1C 5DD3H 2AI0H 4QRTA 1YJDC 1NAMB 3GI8H 1LEKB 5ELIA 5B4MC 2B1AH 4KRLB 3WBDA 1XT5A 1MHHB 1INEL 1Z5LA 5H2BB 4F3FA 4LSRH 5JO5B 3D18A 3MUY1 1CDBA 1ZA3A 3UC0H 5DJYA 2OLDA 3BMVA 1Q94A 2Q7YA 3HI5H 3D6GA 3TP4A 5FECA 2WUBL 4JM2B 3ARXA 4NHUA 1A5FL 1U58A 4HIEB 1EHNA 1IGML 2H9GA 5GGTL 3PJSB 5FK9A 4ZUWB 3GKWL 4X6DB 4G8GD 3OXRA 2EO9A 2MMXA 2VAJA 4Y4FC 4GS7B 4K9EH 2F54A 2VSCA 4GRMA 3GBNH 2E8YA 3LKNB 4PJFA 1VFAA 1KGCD 3H9HA 5IB4A 1MI5A 2GQHA 3H8NA 2X9YA 1P7QA 2OK0L 2W1NA 4P9HL 3F6IA 3GK8L 3CSPA 5GS3A 1U8OA 3MV9D 1FBIH 3HC0A 3P0VH 4QXTB 4KK6D 3OBAA 3P9LA 4NKDA 1HSAA 3PWJB 5L7XL 5DJ2B 3VXTA 4DVRL 5DQ9A 4NYLB 1KOAA 3CLFH 3EOBA 5EIQA 1D6VL 3FMGH 2DQCH 1U8MA 2XQBH 1JNNH 3WLWD 4XX1G 1J0ZA 1JJUA 5BRZA 3VMNA 4N0CD 5D1QB 1C8PA 1IAII 2YHGA 3V6OA 2YPLD 5I71B 3OAYH 1FNEB 4HC1A 3UTSE 1GHFH 2AEWA 1F8TH 2X4RB 5E9DA 3MCG1 2VDKH 4OJFL 4PJCE 1L0XA 3UJTL 4POYA 5E8EB 5I1EH 5DJ6A 2D9QB 5CEYB 5I16A 4GBXA 4KKCC 5DRXA 2CGRL 3WKML 5K9OB 4JDZB 3QEQE 3O8XD 4WGWB 4NJAL 3ROOA 4XPAL 2XOTA 3VI4E 3MJ6A 4TVPE 4MJID 1EJOH 4XPFL 3F5WB 1GC1H 3LS4L 1Q72H 5TDPA 5FM5O 2APTA 1DANU 4LCYB 4OTXL 5EOCH 4XMLH 4OSUL 2BSRA 4LPCA 3BI9X 3ARDB 4I18A 2WLZA 4ONFH 3BGFC 2ORBL 4GKZB 1KIRB 2GKIA 3M17B 2DS4A 2JELL 4PGBA 1A1OB 5CLTA 3CLEH 4HUUA 4MAYC 4NQXB 5H94B 5JOPD 1E4XL 5D7LA 4LLDA 1BZ7B 4E41B 4M61B 1VDGA 4ZFOA 3GM8A 3GGWA 5I15L 4G7YH 3DV4B 4PLKC 4HGWB 5KG9B 4XCCH 3MRMA 4UT9L 5I17B 3C5JA 3S4SG 2Q7NA 4ENEC 1SY6A 1HZHL 5I1LB 2VUYA 3L7FB 4K8RL 4R7DB 2NYYD 3CSBA 5L88H 1JNLH 2X1OA 2D03H 5GS0L 3QCVH 4I13B 5KSAB 1NBQA 2FECI 3L5IA 2IGFH 3N85L 5BXFB 2UWEA 3TIDB 1AGBB 4OLWL 5HGAB 3W9EA 4X4XB 1VADA 2ZUTA 5FDWA 5I18L 1D9KB 1S7QB 4Y16B 2AK1H 4OZFG 4BKLA 2XNAA 1WBXB 3IGAA 3AREC 1FVDA 2V2TA 1IM9D 1BWWA 4PRHD 1PG7W 4QTHB 1SEBA 2MSPA 3VFWB 5KAQF 4Z9KB 1KIPA 3H42H 4HD9A 4JZNA 1MPAH 3CXDL 4IIQA 4HPOL 2HJLA 3UTTB 5DTFB 2CMRH 2Q8BH 1AKJA 5TDNA 3RVVC 4GRWB 5DMIL 3C09C 1EGJH 2UZIL 1U9KA 1CXFA 3OZ9H 3KNBA 4PG9B 5DC4B 1FL5B 2HKHH 3DX8A 1JWSB 4RWYH 5JOFA 2JCCB 1KLGB 4CW1A 4U2ZA 4YHLL 3S88L 4JO1H 5C09E 1FN4B 1TJGL 3RGHA 3T65B 1UT9A 1F58L 2DMBA 1JYXA 2YK1L 5F89B 3VGGA 1JHLL 3DVGA 3CDGA 4Q6IA 5HYQA 5J6GB 1HDMB 4WVRA 3L3KA 3VFTB 2DI7A 5F1IB 5AG9A 3MGOA 3BP6B 1QFUL 4NN6B 5I1JL 5GGSA 1LO0H 1CXIA 1CE6B 3V5HA 1R5WA 4V2BA 1V7ML 4HC1L 4MQXD 3AXLA 1HKFA 3IFPB 5A2LH 1BEYH 4H8WC 4ZS6C 5GGVY 5ACLA 4I2XB 3NIGF 4Z0XA 5MEOB 3MOBH 4AH2B 3MUGA 3IAQA 3I50H 3UPRB 5B39B 4P2OB 1CQYA 2HWZH 4HIIB 4Y4KB 4LCWD 2O5YL 1OTSD 1KV3A 1NFDF 3AMLA 5D7KD 2DICA 4QCIA 3TBTB 4PRPB 2NLJB 4PP2A 4U1HA 1NGPL 3JTSA 2CRMA 3HE7D 2IPKB 2BC4A 2ZPKL 3D9AH 2CUHA 2BY1A 1QRNA 3MV8E 1BECA 1K5NB 4WWKD 3H7BA 1AR1C 2NY1D 4NRZB 5C0JA 3BYYA 1RJCA 4DCQB 4N8VA 4EQ3A 4HLJA 3I9GH 2EE3A 1E4JA 1EBPA 3QDGA 4FQ1H 4NQSA 3RGVB 4Y1AE 3NAAH 5A2IH 4UTAH 3ARUA 3MNWA 2O5ZH 1N3NA 2XPGB 5E4EB 1HK6A 5FHBH 1H5BC 5D6CA 4F57H 1MFDL 4LLVB 1RPQA 2DJUA 3MODL 1R3JB 2EDTA 3ZHDA 1IM9A 1JGVH 3G08B 3SE3C 1HHGA 3U9UA 3L6FB 4P49A 1NKOA 4IEFB 4QNPF 2W9LA 4F9PA 1VFOA 1N59A 4OZIB 3NH7H 1NMAL 3CX5K 4A2MA 1UH4A 3SDAB 5EBWB 2O5XH 4JCLA 4OI9A 1TIUA 2R69H 2YD5A 1Y18B 4KROB 4LSVH 1B0WA 1DVFA 1KJ2B 1SY6L 3FQRA 3OJVC 5KVGL 4UILL 2XIDA 2B2XH 3IXTB 4HEME 5DUML 4ZPVA 3V5DB 4D9RE 2V17H 1BQSA 1WTLA 3WO4B 1BQHA 4HAGA 1Q0XL 3PP3K 4OBRA 4M93B 3FN9A 3HMWL 1XH3B 2YWZA 4N0UE 5D2NA 1P7HL 2NXZC 4AEFA 1TVBB 4KUZL 2ESVD 2A74A 4MDJA 1HIML 5F6HI 1H15A 2GITA 1KT2A 2PKDA 1KIQA 2NY3C 5TF1L 4YHZL 3EOYG 3MQIA 4LKXA 5B4MD 5I8OL 3O45A 1A4JB 1X7QB 4OFIA 4PTUA 5CEZL 3X17A 1ZKAA 2GSIA 4O2EA 4QWWC 4QHUA 4LF3B 4XNMA 2IH3A 3BW9A 3QUXB 5EUKA 4PJ8A 3S7GA 1AP2B 2VLJA 4YHMH 1CGWA 1HILB 1JYVA 3DHMA 4XXCA 1OLLA 4JVUA 4OLVH 5CP3A 3KLAB 3EOTH 2R56L 3QIUB 4NKMA 2VXUH 1AH1A 5E00B 4YHNB 3OKDA 2GT9A 4Y4FD 5JHLH 2CO6B 1ED3A 4KKLC 3P40A 2Y5TA 1EFXB 1IGCL 4X7FC 1CFVL 3VXUE 4FQXB 1G7IA 3VI3F 1QHOA 1UENA 5HDLA 1KN4L 4UV7H 1FFPB 1I7TA 3KR3H 4NZTH 4NKIH 1OTTC 2K9UA 3ZKNC 1NCCH 8CGTA 1YC7A 2R1WB 4KQ3L 1UJ3A 1AXTL 3RWEA 3ZE2F 4DZBB 4X7TA 5DFWH 4P5TB 3OGOE 1KPRA 3L3JA 4U1KA 2WBJB 1OAUL 3QIBB 1Q9WB 5DJCB 3SJVD 5IFHH 3A6BL 3RI5K 5IGXH 1CYGA 3GKZA 3QHFL 4QYOA 3VXRA 5HVFB 4OGAC 3LS5L 3T3ME 1KLFA 2XY1A 5CJ5A 1MFBL 4JPVH 1CN4A 3GIVB 2P8MA 5C3TA 4X4YA 5DEFA 1A14H 2CLZB 2CSPA 2GJ6D 3RNQB 3PWLA 5DHVH 4GSDH 5ERWA 1AFVH 5E99L 12E8H 4KKCD 1RZJH 5C7XL 4L4TE 3I3EA 4P9ML 2FJFB 1KELH 5T33L 1F4XL 5EO9A 1X3DA 1Q38A 4O5LH 4XPBL 1KCRH 3ZYJA 3EJYC 3QI9A 1TDQA 3NACH 4TUKH 4DW2L 5KS9A 3VFMB 3WFEL 3ALXA 3DPBA 3BWAB 3AM8A 3KPNB 4RGOL 4HFUH 1LVEA 4HWUA 1HNFA 1PKQA 3J8F7 4JRXB 5F9DC 1BGXH 2VB5A 4JFQA 4CBPA 4C83B 4YDJB 4Z7VA 4N68A 3S96B 1RU9H 4LVOC 5HI5C 4QRPA 4MAYD 2FWOB 5FGBA 1DBAL 4ACPA 1U8IA 4EXKA 2FX9L 1NAMH 5K93A 5BS0B 1FZKB 3T09A 4HS3A 2ADJB 2BY0A 5IOPA 1BD2E 4Z7WB 3ULVH 3BAEH 1N5YH 2G5BB 4PLKD 2FATL 4X6FB 1BVLA 4YK4C 1GPOH 1PSKH 3SDCC 3UJJL 1T0MB 3BE1H 4M6ML 4MJ4A 1IC5L 4ZG1A 4EEEA 3NABL 3U1SH 5CSGA 1AHWA 4PJAB 1A4KB 3GBLA 3UO1H 2RQ8A 4OV5B 2MHAA 1M6OB 5DWUH 3VXMD 2XKUA 1HXMA 2WK2A 4S2SA 1LEIA 1XCQB 2WW8A 4WI7A 1JWMA 5MENB 4P2QD 1KCUH 2DQGL 3DUHA 4R0LA 43C9B 4FQLH 3MV7E 2AXGA 1ZT1B 1JPGB 4H20L 3ARED 4P5KB 1UACL 4UOJA 3DO3A 3OR7A 1KB5B 5JIKA 3JVGC 2DTML 3EBAA 4Y5YB 4DEPC 2Q76A 4KI1A 2JF1A 5LAXA 3RFZC 1BWMA 1F3DH 5CBEA 3RVVD 3VH8G 3NZHL 4XCNB 4LSPL 3RNKB 3TJEL 3REWA 4JFDB 3O3BB 4KY1L 2VC2L 4U6VH 3G9VA 1XCTA 2EEBA 5IW1B 1W0VB 1ZHBA 2KBGA 2OP4L 2DF3A 1UM4H 4G9FD 3HS0A 1T20B 4QGTA 5CCKL 4RNRA 3CCHA 2PXYB 3G5XA 1X5KA 1KEGH 2VDNH 1E4WL 4NWUL 4AEHH 1RZKC 4JHZA 3HFMH 3LAFA 5LG1A 4M7LL 2UVFA 4P23B 2W38A 4I9WD 4X0KA 3SKMA 3DV6A 4J6RL 3P4MA 5HHQB 4OGXH 3H9SD 3U7AA 1JV5B 5DJAA 4HT1H 3VWJB 3EYSL 5ISZB 1IM3B 4ZS6D 5DGQA 1T0NA 3LKPA 1CE1H 1YEDA 4MNQA 5D8JH 3PXHA 5ID1B 4XNUH 1HNGA 1KF9B 2VDML 3HAEA 4YE4H 1N5AA 3WFCL 1A9EB 4OLXL 4ZSOA 5C0AE 4P2RA 1MWAB 2L0DA 2APBA 4YGAB 2Q6WB 4G6FD 3RA7L 5D7JB 5FYKD 5I0ZA 1P2CB 5ABDE 1T1XA 1TCRA 1FZOB 1MUJB 2F5BH 2C3WA 3LZFH 4GG6B 3HZYA 4NUGL 2LQRA 2CIIA 1ZGLB 1QD0A 1IAIH 4Z78B 1YQ2A 2YEZB 2DLFH 2R2HA 5M7QA 4DK3A 2IC2A 4LHUA 1DLFH 1RUQH 3CZFA 3LH2L 4IM8A 4XHJC 1FC1A 1U8LA 3HPJA 3OKMB 1RZGA 3LEXA 2G5RA 5GGRA 4YDLC 5JNYA 4KU1A 1OW0C 1NLDL 5BMFL 1OP5K 1Q1JL 4BFGA 2WIIB 4WO4C 5HGHA 1N6VA 5A16B 1L6XA 3MBEC 3MO1A 3ULUL 4WDIA 3D85A 2A9NL 3T0AA 1PAMA 1UXSB 2P7TB 4M43L 1R6VA 4WWID 2VDPH 4I0KA 1BHGA 1QQDB 1HH6B 3MLTA 1G9MC 4MA7H 4LHJB 1HXYB 2A6IB 2KUTA 4EI5D 1N0LA 4PGZA 4X6EB 4OZ4B 3W5MA 4QRRB 4ELKA 3ROLB 4LQ1A 4GBXC 5E5RB 5I9QC 4APQA 1C12B 2C4XA 3C08H 4GRWH 5I1HH 1QLRB 3HZKB 4KPHL 5FA4A 4JO4L 5SWZB 3HR6A 4KRPC 3UJIL 2WINA 2J88L 2X4UB 2NY3D 4Q0XH 5I1GH 1AQKL 1H8NA 3G6DL 2V5YA 5FM4A 3ULSB 2VQUA 1J88A 1UB6B 5J57B 1HI6B 4FXGA 3GSNB 1UB5B 3CFEA 1PEWA 1A3LL 3CX5J 4QRUB 3SKUD 5CGMA 1FLRL 4JZOB 2IG2L 4QWWD 3IKCB 2H3NA 4PTTB 3JWOH 4CMHB 3KS0H 5HHOB 4EI6A 5IMLA 1PX3A 1OWWA 3OPZH 5GGUB 1SBSL 5DS8B 1I3RB 3L3IB 5GISH 3GMRA 1A0QL 4LIQL 4M5YL 4LLYB 5BZDA 4KKLD 4O4YH 4N0FB 4YAQA 4NO2B 2G9HA 1C5BH 5CINH 4OV6F 3QJHB 4YEEA 2F53E 5FDYA 2VOTA 4AG4L 4EUPG 1NC4A 3VW3H 4Y0GA 3U0WL 4PP1C 4JQXC 5F96H 2DQUL 1ZHKA 3QO1A 1XGUB 5EC2B 2DD8H 1O7VA 3ZKND 5E03A 1G6RH 3OMZA 3RVTC 4CVXB 5I2IB 3NFSL 1MCWM 3G5VB 5DQJA 1A7RL 1JGLH 4OGYL 1WEJL 1ZHLA 2YD4A 2WSKA 3G6JA 4AEIL 1I8MB 4NNPH 4KZDL 5I73C 4HV8A 1T2QH 2NY2C 3SKJL 4AY0A 3BD4A 3KWWB 1WFTA 1FFQA 5LXGL 2X4PA 4OGAD 4K7PY 1MLCA 2QQKL 3Q0HA 3QQ3A 4L3EB 2VLRD 2BVUA 4LQFL 3BN3B 3O4LA 3C2AH 5L9DL 1INDL 1BIHA 3ECBA 3MRKB 4L8DB 1OM3H 2FH6A 3HUJB 2RJMA 4XCYA 1KC5H 3O0RL 3S98A 5EZLA 4X83A 1NBYB 4JY4B 4JHWL 5FF6B 1TPXC 4K3GA 5F7NC 1KJ3H 3QISA 4WTZG 4WUUA 4Q6IC 3EJYD 2B0SL 2OMNA 2QQLL 4FNLH 4J1UB 1B9ZA 4R26L 1NCNA 4NQVB 2J2ZA 2VXSL 2W91A 4M6NH 1S8DB 3D3VB 5JIHA 1PKOA 2HLFC 1HSBA 5D7IA 3M1BB 4J3SA 4I3SL 4P2CG 3NZ8B 1JBJA 5DK0A 1T03H 3K2UL 3NIGE 5HI5D 2I25N 3STZB 2JKXA 2W9DH 1U41A 5JXEC 2IJ0C 2FO1A 5KSVB 1FVCB 4KMLB 4LCUA 3TBSA 5I1IH 3WDJA 3EFDH 4M48L 1AGCA 1NFDE 5IIEB 2IMNA 3IVKB 1DBBH 4PJBB 5IBLC 4HH9B 4FQJH 4OF6A 4LASH 4L4VD 3QFJA 3MFGB 4G8IA 3OJMB 2BNQE 3GM0A 1YNTB 4ZUTA 3SDCD 1QVOA 32C2A 1EEZB 3VG0L 2XZQH 1INQB 4ELMB 7FABL 5JW5B 1W2KT 2ARJQ 1QFWL 2EDHA 3MA7B 5A3IC 1EHLH 1ADQL 2XG4A 1E28B 3PGFH 3PHQB 5L0QB 4X98B 1NCWL 4U1NB 2D7MA 2DBLH 3MLUH 1MJJA 3LEYL 2EH7L 2LU7A 1REIA 3JBG7 3BH8B 3SGEI 3W0WE 4RSVA 5ETUA 1CG9B 3QDAA 3GEWB 4ZAKB 3VFGH 3VD7A 1AC6A 1JPTH 1TETL 5DZLA 4N9GB 4JHAH 2JJTC 4QNPE 4LSUL 3LPGA 2PCPB 4QHLB 3VD4A 4IJ3C 1MY7A 4LEOB 1NJ9A 3OF6A 4L8SC 3BPOC 4MLIA 2QEJA 1DUZA 3CFKA 3DGGB 3NCBB 4B5EA 2KL6A 2R0KL 1I7RA 1NC2A 1GOGA 2ZUVA 3D2UA 4UQ2A 1ACYH 4KQ4L 3WNPA 4KDWA 4ONGL 2O93L 1IARB 3PF2A 1AO7B 1WWCA 2BVPB 5HGDB 3QUZA 4R4FH 4F2MB 5IB5A 1T1ZB 1SJHB 5JUEH 2AKRA 3QG6B 2AV1B 2IF7A 2YUXA 1HWGB 3RL2B 3Q1SH 3MRJB 5HYEA 1SBBA 1PJ9A 5E0QA 2CDFB 3K1DA 4X6CB 2XWBB 4Q9QL 3W82A 5EU7E 5C9JA 2CRIA 3ESUF 1E6JL 4XC1L 5C0CB 3S5LG 3FRPA 2F74A 4MCZB 5SX5H 1FZJA 4GG8A 5JW4M 4YX2H 2UUDK 4D9LH 1L7TH 4PJIA 1YDPB 1QSEA 1YMHB 4PJ5B 3S3PA 3U36A 3G5ZA 4PRIE 3KPSD 4B7LA 1N2RB 2OM5A 5EU6D 3TA3C 5GZNC 4WNQA 1CVSC 1VFBA 3T0EE 1KCSL 1M05B 3QWRD 1Q9OA 1T04B 4JKMA 3Q3GA 3RWIA 3R1GL 3QA3B 5F9JB 1X9QA 5JQ6H 5DVKA 2I9TA 4U49A 5TJWK 1ZT7A 2IQAB 3IDJA 1DQJB 4JLRB 4AMKL 3WS6A 2OBGA 4HIXH 1I3GL 3O11A 2EYSA 4N9OB 4XHJD 3UYRH 1Z6JT 3LV3B 1XGRB 3VI3E 3LN5A 5FO9B 2JJSA 2XN9B 3GUTB 1NEZG 2DQIH 3S4SA 4KWUA 1MJUH 2X4QA 3RJQB 5C0IA 4C57C 3FO9B 4HKXA 4WO4D 3BRGC 3NCEB 2OL3B 2XFXA 5C0EA 3LD8B 4HMEA 4XVTH 3TZVB 3MBED 1UKSA 3ZE2E 1QPXA 1VKXB 4N8CL 1WQVT 3F7QA 4A6YH 1YMMA 1KCVH 1CFBA 2MCPH 3BGMA 2JK5B 4S1SL 4L5FH 2Y9RT 1FDLL 2X44D 4K71C 5CHNB 2X09A 4PV8A 5HJ3A 1GL4B 1GCFA 1QA9B 1HKLH 4TRPH 5E2TH 5L2KB 1P5UA 1BBDH 5HSFA 3H9ZA 3DMMC 2VDLL 1BBJA 3RZCA 3NFNB 4GUPA 1KB5H 2IANE 5C6TH 2XKNA 3CJJA 4L9LB 5T3ZL 1H0DB 3O4OC 4OIAA 2V7HA 4HJGA 3BWUC 3TN0A 5ADPH 1Q0YL 1U95B 2DM7A 4HIHA 4WI8A 4EDWL 3PL6A 2HA1A 4ZUSB 4BK4A 5DSCB 1R24A 2OQJA 2CK0H 3QI9C 1LO5A 4WFGE 1V7NH 1OQXA 3U30B 3QRFM 3LRHA 5DD6B 2KQMA 5AYUH 1F3JA 3FFDA 1X5HA 4M00A 3PP4H 4H25A 3IDGB 3PWPA 4HUWB 4H1LB 1BFTA 1G7LA 3BP7A 3ZKSD 3KPOA 5MERB 2DIAA 2ZSVB 3N1FC 2K7QA 4FZEL 4HHAB 2FD6L 3B6SB 1QBLH 4Z8FH 3DSFH 1RUAH 4S1RH 1OAXH 2AJYL 1Q9LA 4U6HB 2FDBP 2DDQH 1PBYA 2DN7A 4QOKE 4UQ3A 3V6FB 5D1XA 4JDVA 4K3EL 4IOSD 4UNVA 2VUOA 2VKWA 2W0FB 1EJ6A 3QCTH 1H9VA 3ARFA 2DQJH 4JFHE 2A6DA 1I1CA 4ZUUB 4G6AC 3ZDYF 4ZS7H 1MWAH 3AC0A 4BSWB 3QDMD 3EGSB 5A43C 3OJDA 1BF8A 5HYJE 2ZNXA 4DVBB 1HH9B 3RPIA 1KPVB 1JN6A 5LKNA 4PP1D 3MJ7B 3O6LH 3ULVE 1BAFL 4UB0L 4CJ1A 2I07A 1MFAL 4MCYB 5GRUL 3RVTD 2E7LA 3INUH 3MA9H 4JPKH 1MCPL 3X12B 3ARWA 3BQUB 3D39A 5AD0A 2NY2D 4CDHA 5CIPA 2NX5D 3DXAD 4QTIL 1T1WA 4UAOB 1F97A 3O6FB 1U8KB 2ATPB 3L5XH 3PGDB 2DRUA 3FHQA 4PV9A 4KTEH 2VE6A 5EBLB 4RQQA 2H6PA 1WGOA 1R3HB 2MPAH 2H1PL 1FV1B 2OJZL 1FQ9C 4WHTA 3HE6A 1DP0A 4RMVA 3HC4L 5ESAB 1RHHA 1D5IH 4JB9L 5CSZA 3TIEA 2PYEB 4NDMB 3KVQA 4RMSA 4IMKA 4FN0A 2A83B 5DC9B 3TC9A 2Z8RA 4OCRL 3TBWB 4G6ML 4NO0B 3QIWB 4FFZH 5FYKU 3CMOL 1D5XA 1KUMA 3F6LA 4GMSL 4LRIC 4RRPA 1IZKA 3IETB 4NQED 5IB2A 4HBQA 5INDB 2HLFD 3DVIA 2YMXH 2Y36L 5EO0B 3IKKA 5ICYA 1A3QA 1IAOA 3KXFB 4ESKA 4XNZC 1OGAE 4PB9L 3QUYC 5DDHA 1LO2L 3WO3B 1XR8A 1S9WB 5C08A 4NQCA 2X42A 3LKRA 4OM1H 2X70B 3PIQB 5JXED 4I48B 3LSOA 4NKQB 2C4FU 5EC1A 1KPUA 3GSNH 3GSUA 5EN2B 4XMPL 1Z2KA 3AS2A 3TVMC 4RGMB 3LQZB 3HNVL 3S97C 2X4SA 1CLYL 3GMOB 4LGRB 4LK4A 2NY6B 3B8YA 4I0PA 5IB3B 1IILE 3DI3B 4R96B 1IAKA 2W92A 3C9NA 4ISVA 3GHEH 5HGGS 2IALB 3CFJB 4OLUL 5E2UL 4MXVF 3M8OL 1L0QA 4XP4L 1WTGT 3CNKA 2ITCB 4ZO7A 4F80A 4NQTA 2VL4A 3GJFB 1YY9C 3BVNA 5LBSH 3IS1X 2EDNA 4JFFD 1RZ7L 3V0AC 5L6YL 4K23H 3AU1A 4JFOB 3MR9A 4PJDB 1FORL 1FNSL 1CBVL 4JDTH 2D3VA 4ONHA 4E41E 2MFNA 3VGDA 2AJUL 5C2BH 5KAQG 3B2VH 1N64L 4LCCC 4WW2B 5IT2L 4EOWL 4MMZC 3VG9B 2EDEA 4U6TA 2PN5A 5JPMA 4OIIH 4ALAH 4GAGL 3MYJB 1T7YA 3RDTC 1DBMH 3S6CA 5JLZA 4EN3C 5IESL 5I30H 4JN1L 1A6ZB 2BNRA 1RK1B 3O3EB 4Q97A 5TQ2L 2VLKE 4L3CA 1WWBX 4AIOA 3ES6B 4N90D 1IKNA 2Z92A 2J3SA 4Z95H 1LNUB 4ERSL 2CDEA 3KPRB 5DA0B 4DFHA 4P4KA 4HZLB 3GMQB 3UTSD 3EAKA 3P30L 3UDWC 5FA3B 1F42A 5FGCE 3I75A 3FONA 3TO2A 4X5XA 3VDBA 3Q48A 2BCKA 4LPUA 3T4YA 2ADIB 3ARGA 1WISA 5C07E 3QRGH 3QEQD 5E1AB 4WJ5A 2B4CH 4QHMA 4U1MA 1G7MA 5D5MA 3ILPB 4KUCD 5J13C 2QQNL 3QH3A 3HG1A 2ZCLH 2X89A 2EDXA 2CH8A 1U8JB 4QT5B 3VWKC 4RAVB 4M7ZB 1X4YA 4K3JL 1KENH 4P3DB 3VCLA 4AIZB 4UV4L 4UIMB 1FCCA 4W4NA 2ZOKA 3TA3D 1A7BA 3JXAA 3EUUA 4LU5H 1RUPL 1MQKL 1Z5LB 4F3FB 4NM8H 3EFFB 5K9JH 1K2DA 1ZA3B 5DJYB 3SO3B 2EE6A 2Q7YB 5KSBB 2HT2C 4PJ9C 4AM0B 4GKSB 5FECB 4DN4H 3N1QC 2UYLA 1U58B 2H9GB 3MLPA 5FK9B 3TBYB 1MAJA 3AROA 1B4RA 3OXRB 3ME0A 1ZHNA 5IQ7H 5HVHB 4ZO6A 1MIMH 4GRMB 2PO6A 4PJFB 1VFAB 4AENA 4M1CC 3H9HB 3STLA 2DWDB 5IB4B 3Q5YA 4WFFE 2IQ9L 3F8UB 5GS1C 4ODSH 5H2BA 1P7QB 5SWSB 4WI4A 1CLOL 4MNGE 4NC1E 2ATKA 2A77H 4OCXH 1U8OB 5HI3C 3P9LB 2R0ZH 4NKDB 1HSAB 3KHOA 2ICEB 4JM2A 5DD1L 1CDGA 4LPWA 3VXTB 1XGQB 3SCMA 4BH7A 4HKBA 5KTEH 5DQ9B 3DMMD 5MEQA 4ZUWA 2JTDA 4PJ7F 1U3HA 4R97C 1GGBL 4GMTL 2XZCH 4PJCA 3VH8A 1NMCB 2ZUSA 1E6OL 5F7HA 4I77H 1NGQL 2XQYK 4LARH 5E9DB 2ED7A 3FKUS 4OKDA 1LP9B 2BX5A 1LO4L 3CVIL 1J8HD 5DJ6B 2C1PB 4X7SL 5I16B 2Z35A 5DMJB 4UUJA 3PWJA 5DRXB 2Z4QA 2FX7L 4OLEA 2VLLB 2AK4E 3GSVB 5FCUH 4NYLA 3WV0A 4GW5A 3MRPB 3ROOB 1JRHH 1LDPH 4XB8A 3OAUH 2AJVL 2ZZUT 2VL5A 3QYCA 3ILQC 4XXDA 3VD9A 2EIEA 5TDPB 3DX6A 4X9BA 1K9TA 1XR9A 2GSGA 3F7RA 5D96C 4DKAA 2X4RA 3EJZC 2BSRB 4M7LT 1A02N 4I18B 5CGYC 5EUOA 4KHTL 3NTCL 1DZBA 1QYGL 5CEYA 3N1PC 4PGBB 1GGYA 4ZUVA 1XIWA 1AXSB 3A6CL 4X7DC 3DECA 5K9OA 1S5IH 5D7LB 4LLDB 4K3DH 2A1WH 2MJWA 5E2WH 3BRFA 1G6VK 4FZ8L 4ZFOB 3GGWB 2GTWA 3MV8D 4PGJA 4WUKL 1A2YB 5HDQH 5GGVL 1WWWX 4HJJL 1BJ1H 3ZT5A 4UT6L 5FYJE 4EDXB 3MRMB 2ARJA 1OPGL 3C5JB 1RUKL 1EXUB 5E8NA 4Y1AD 4LAQL 2WLYA 4XPTL 5I1KL 1CD9B 2C3HA 2HTKC 4YXHH 3MV9B 4PY7A 1MQ8A 2ADGA 3KPLA 3DHJA 4HMCA 1I9JL 2DLGA 4HX1A 2V5MA 2F5AH 3ZKXB 1MHPL 3PQYD 4H88L 4K9EC 1A1OA 2UWEB 4NQXA 2UVEA 2L7JA 3W9EB 3BRDA 2OL3H 1VADB 5FDWB 4R6UA 1BZ7A 3FZUC 3RY6C 2VZOA 1OAZH 4BKLB 4POZC 1U3ZA 4O9HH 4U1IA 5DQDL 1IKFH 4KJPC 2XTJC 4Y19D 1FVDB 2V2TB 4Y5XC 3S36H 1SEBB 2YPLB 1KIPB 3TF7C 4JZNB 5I17A 3BFOA 4IIQB 2HJLB 4G8GE 4YWGL 2EDLA 3VXOB 3R06B 5E6IC 3QT2A 1TQCC 3JTTA 1AKJB 5TDNB 1S9KC 4M1GL 1R0AH 2LAGB 5F6IC 2VH5H 2FB4H 5ADOH 5C09A 1KGCE 1I9IH 4JN2B 4XVUC 3KNBB 1VGEL 1JZ5A 4XPHL 5E7FA 2Q3ZA 3ZZ1A 4YFLI 1ZTXL 3TWCL 5IWLA 5JOFB 3TGXA 4CW1B 4HUKB 3KLHC 1D9KA 1S7QA 3FHAA 1GGIH 4RGNC 3E8UH 2Q8AH 1WBXA 3FB5B 4ZFGL 3D25A 3QUYD 5JMOC 4IDJL 3NPSB 4JG0H 5JHDD 3CDGB 4MJ6B 5BVPL 5KJRH 2AJ3A 5HYQB 5EWIH 3UTTA 3MGOB 5DTFA 4PJXF 5GGSB 4JG1H 2P46B 3V5HB 4Y5VA 4FTVD 3TVMD 5E8PA 3RAJH 4PG9A 5B3JF 1FYTE 3MUGB 5TPWH 2AGJL 4F33B 1UQSB 2D4DA 1TLKA 2AXFB 4XCFL 5DXWA 4QCIB 4LMQE 5GIRB 5C0BE 2BFVL 4C56A 2WANA 1CDUA 1UWGH 4QXWA 1YY9D 5F9OH 4M1DL 3TH2T 1G0DA 5F1IA 3PDOA 1ZVHA 2VO5A 4JO2L 5D1ZC 3H7BB 2AJXH 4MA3A 5C0JB 4FS0A 3KG5A 4N8VB 2C1OA 3QDGB 3SDXF 4G5ZH 1MRFH 3MV01 1RULL 4NQSB 1SEQH 4I2XA 4PY8I 3EZ8A 3MLVL 5MEOA 4UDUA 4AH2A 2RBLA 3MNWB 1OP3H 1N3NB 4P2OA 5C92A 3RUGF 1FNHA 1QBBA 4Y4KA 3SDYH 3RDTD 5D6CB 2YA2A 1NDGA 4EN3D 1RURH 1J1XL 1YEHH 4OQTA 4Z7OF 2AV7B 1IM9B 1HHGB 2NLJA 5JOPE 2ADFH 3D48R 4LEXH 1N59B 2IPKA 4PJEA 5HYSB 2D7TH 3B9AA 1DVFB 4WEBH 3FQRB 1S7SA 3MLXH 3B83A 2EIZA 3IU3A 2VDQL 3SN6N 4N0UA 1FL3A 3FTGA 5IFAL 2DQTH 3VD5A 2I5YH 2HRPH 4OLYH 1BQHB 3CGTA 4HKZA 4LLVA 3WFHA 5GPRA 3VXSD 1WVZA 1EEQA 3E2HC 3WFBL 3V4VL 3VWKD 3L6FA 1RVFL 3CPLB 2A74B 5TE4L 4MDJB 1E0OB 1INEH 4JFDE 2GITB 3NA4A 4OZGB 4U1SA 1KIQB 1EK3A 1JF6A 3FRUA 4X8XA 3CSYA 4NNXA 4LKXB 2WUBH 2J8UF 3WFZA 1A5FH 5GGTH 1IGMH 5DJZB 5ANME 3O45B 3HMXA 3GKWH 2AJSL 3BESR 4LVHB 2YKLL 5F72S 4O2EB 2GSIB 4LCWB 2FL5B 4QHUB 1O5DT 3FFCD 4XNMB 3BW9B 5EUKB 4PJ8B 3GZKA 2VLJB 4PD4K 2HT2D 3N9GL 1RJZA 4PJ9D 1XH3A 3ZDYE 4HEPG 2DLEA 5I1DA 5KOVC 1CXKA 4MJ2A 3VXUA 5ISZE 4D9QD 4PG2C 2OK0H 4P9HH 1H8OA 3OKDB 3GK8H 3B9KA 4CRPA 4WWKB 2NY1B 1H3WM 4GKNA 1P69B 1AGDA 4NOFA 2Y5TB 2PTUA 1JVKA 4M1CD 5L7XH 3RY5A 1TZHB 3ZDXF 4DVRH 1BQLL 1G7IB 3SE4C 1UM6L 2BOCA 1D6VH 1A4JA 1NUGA 2GK2A 5LWYL 5F7EH 1MRCL 3FT2A 4MXQC 3KPPA 1YZZA 2K1MA 1I7TB 5HI3D 3ZE1F 1A8JH 1AP2A 1FNAA 2E27L 1QKZL 4FXKA 1UJ3B 3RWEB 4X7TB 3QJFB 3TT3L 3WN5C 3BD5A 1LE9B 4OJFH 3QIUA 3L3JB 4U1KB 4G6KL 5D7KE 3UJTH 3VGAC 4M4PA 1CICA 3IFNL 1C08A 2FECL 4HBCL 4D0BA 3KPMB 4Y4HA 2C5DC 2CGRH 4QYOB 3WKMH 2EYRB 3V7AE 3G5YB 1MCCA 4ZTPL 4RIRA 1MCQA 1WZKA 4L4TA 4NJAH 1IT9L 4XPAH 2P8MB 4X4YB 2H41A 2APXA 5DEFB 3WNOA 1FFPA 5ERWB 3BXNA 4XPFH 3ZLQC 2B5IB 2X4OA 3LS4H 2ESVB 5DK2B 1W8OA 4NN7C 2R1WA 2NY5L 1D3CA 5D70L 4OTXH 4OSUH 5EO9B 3TNNA 3BT2L 2ORBH 1Q8MA 1D5ZA 4LGPB 4OLZL 1X5GA 2JELH 5KS9B 5EU7C 1HQRB 3O41B 4TYUA 4JY5L 1E4XH 3S5LA 3EDEA 3ALPA 1A64A 2RHEA 4HULB 1PKQB 5HVGB 2I24N 3EJZD 3MPCA 3MUJA 4JFQB 5DEZA 3GIVA 2AJZA 1U93A 5I15H 2CLZA 5CGYD 5C0AD 5SWZE 2LU3A 4PREA 3FAXA 1ZLVH 1PEZA 1BD2A 1A1MA 2ZUUA 2ICWA 4UT9H 4L1HA 5F8QC 1U8IB 1OLZA 1FLTX 2C9AA 1HZHH 5BW7A 4XH2B 4JQVC 3HB3C 1GAFL 4HS3B 2ICWJ 4K8RH 5IOPB 3IJSB 3OSKA 4Y2DA 5ALBL 4YHYC 4MXVE 5GS0H 5B39G 2W0PA 3G04A 1PQZB 1SM3L 1JPFA 3N85H 4MZ3A 4XAWL 3SDDC 4OLWH 1KJ2L 1QR4A 1DR9A 1AHWB 5I18H 5KW9L 4BFBD 5HXMA 1HHHA 2WWKT 1K4DA 1KIUA 3N0PB 3RVXD 1WZ1L 2MHAB 2HTKD 4C83A 1HXMB 4S2SB 2NW2A 3MV7A 2O61A 2D9CA 3S96A 4F7TA 1NMBL 5GGSY 3GMNB 5T1KA 1Y6MR 2A38A 3CXDH 5DK3A 4DOHB 1B0RA 2G2RA 1R5IA 5D2LB 1T21B 4OI8A 3FZUD 3E6HA 5BS0A 3P11L 2AXGB 4POZD 5DMIH 2DM3A 4KJPD 5EZOL 2UZIH 4X99A 4TSBL 1J0KA 3OR7B 3WSQL 3L7EB 3QDJA 5F1KC 1T0MA 2Q76B 3LKQA 3HI6L 4C59B 5LAXB 5E6ID 3WIIL 2H2SC 4YHLH 5IUSA 5CBEB 3S88H 1AY1L 4TTGA 1TJGH 4PJAA 4RMWA 3TJHD 1A4KA 3V7MA 2UY6A 1F58H 2VKXA 3O2WL 1M6OA 3REWB 4AK1A 4DUVA 2YK1H 3GIZL 4XVUD 1WC7A 1JHLH 1R3KA 1XCTB 3T1WA 3LY6A 5IHBA 4YHPB 1ZHBB 5DRZA 5EDXA 1QBML 4UINL 1HQ4A 3HS0B 4RNRB 5DI8A 3TNMA 3BPCA 5I1JH 5FOBA 3KLHD 4RGND 4GFTB 1V7MH 4HC1H 1JPGA 4P0DA 2J6EA 3QAZC 1DBKL 1F4YL 1NUNB 2GFBA 4CKVX 3WS3A 4NO5A 1EZVY 1RZJC 3FT3A 3DV6B 5TH2A 3P4MB 2O5YH 3MSPA 5DJAB 2P5ED 3SJVE 3ARPA 1M71A 5I74C 1T0NB 1NGPH 3O3BA 4V2CB 1YEDB 4MNQB 5J1AA 2Y06L 2ZPKH 3OV6A 4NZUL 3HAEB 4HQQL 5IM7A 1N5AB 3WJJA 1J0HA 4ZSOB 1CVRA 2GJ6E 3QNXA 4P2RB 3IF1A 5CJQL 5ECJE 5BVJB 3DX9A 4KDTA 1TCRB 2X05A 3SKOA 2X2YA 3HZYB 4XBGB 3LKSB 2CIIB 3REVA 3EYOA 1MFDH 3CH8A 4CU7A 2F53D 1GYAA 1MELA 1JV5A 3MODH 4RMTA 1IM3A 1QZ1A 5D93B 1TJHL 3CZFB 3RVUC 3ULVC 4TNWK 4LSQL 1RZGB 2DMKA 3LEXB 5GGRB 1NMAH 5JNYB 4KGLA 1FIEA 1WK0A 4RMUA 3CFBA 4LVEA 4UDTA 4KFZC 1SY6H 5KVGH 5D72L 1EH9A 1QFWI 3D0VB 4UILH 5HGHB 3DYMA 4G7VL 5ACMA 2Q6WA 2CLVA 2R4SL 3S36X 3MO1B 2FJGA 4WDIB 5DUMH 1MUJA 1I85A 4LLUA 4PJ7E 2DOCA 2I60L 4YHKL 1Q0XH 1EO5A 3HMWH 3MLTB 4KUZH 5HHVL 1F11A 3WIHA 5IW3A 1P7KB 4LDOB 1LWRA 1HIMH 4ODXA 3RX8A 1CXLA 1I8KB 4ELKB 1I1AA 4F9LA 3VXME 3I84A 1LE5B 4L8CA 3RZWA 3HRPA 4J4PA 3PWNA 2CRYA 4YHZH 1A7OL 4HF5L 2WIIA 4KI5C 3OKNA 4P2QE 5FA4B 1MCHA 4K7PL 5CEZH 4Z5RA 4HKJB 1UXSA 1YEGH 2WINB 3KYNB 1QEWA 1ZT4A 1NCUA 5D1QC 2VN7A 4WI6A 3B43A 1TTFA 4YXLL 3EO1A 4FXGB 4LDLB 5J11B 1HXYA 1UCBL 4ZXBD 3BPLB 2DJ4A 2R56H 4X6EA 4OZ4A 5HDBF 4X9FA 3MLRL 4LLAA 1I8LC 4X8JB 2H3NB 3ROLA 1UC6A 4RFNB 5EU3A 2HTLD 4XNXL 4QXGL 4EI6B 4Q9BA 3BIAX 1T7ZA 4ZOAA 5FXCH 1DQQA 4G6FB 1IGCH 4G9FE 1CFVH 1QLRA 3HZKA 5J9PA 2NTFA 2J6EL 4M7KH 3IAPA 1I75A 1KN4H 3GMRB 3WDIA 1D7FA 3I6GA 4KKBC 1A6AA 5BZDB 2BVEA 3ARBA 3ULSA 1OL0A 4YAQB 1JGUL 4DGYL 3SO5A 1K6QL 1AXTH 5SX4I 4I9WE 1ND0B 4OD1L 4QRUA 4KJWC 3H9SE 4OZHF 3X13B 4JZOA 3ARDC 3PV7A 4OB5L 4YPJA 1NC4B 3IKCA 3SBWA 4MXQD 3BEVA 4NM4L 4PRNB 5HHOA 1OAUH 3W0WD 3QO1B 1ZHKB 2Y6SC 3A6BH 3NCFB 3RWCB 4J8RA 3QHFH 3L1OL 4IRJD 3LS5H 4RX4A 3EYQC 1FL6B 5DS8A 3JV5A 3SQOL 1MFBH 3VXPA 5DQJB 1I3RA 1ZHLB 5DJ0B 3B3IA 2BVQB 1S7UB 2DMCA 4PD4J 4HV8B 5FYKE 4FQQB 4GRLC 2XN9E 5TGBB 2VNCA 5E99H 3JWNC 5EFIA 2D7QA 5C7XH 2IFFL 2XTLA 2X4PB 4EI5B 1MLCB 5ESVA 5FYLL 4P9MH 3VFUB 4TUJA 5T33H 3T0XA 3C6LD 1F4XH 3FO1A 3TV3L 4XPBH 5KSAC 3O4LB 4NOBA 1S5HB 4M8QA 3ECBB 3OWEA 4DW2H 4D2NA 3WFEH 5JMRA 1MCLA 4XCYB 3H6JA 1EGJA 4MHHI 4RGOH 3VXNA 4Y16C 3N1GC 5EZLB 3WUWA 4CVXA 1A3RL 3FN0L 3GRWL 2BNUA 2NY3B 4LKCB 1I8MA 4WUUB 3TCLA 5I19L 4KVCL 3SGDI 1G84A 1DEEB 1J11A 3BJLA 1DBAH 3QB7C 3KPTA 4V1DD 1HSBB 2FX9H 3LPWA 1RJYA 4L3EA 4PJXE 2W65A 3UTOA 3WIHL 2A6KA 4ZO9A 5FO7B 1U91A 4RFEB 1NQBA 2RIKA 5DK0B 2FATH 4U6YB 3VRJA 4FFWC 5B3JE 4Y8AA 4ODVL 5FUCC 3UJJH 4M6MH 1IC5H 3AMKA 3S37L 3NABH 2BNQA 5DR5L 3O6KL 3HB3D 4LLWB 3TBSB 1WUNT 4N0RA 1VENA 2BHUA 2YSSB 3QZWA 1TZGL 4HUXB 2IWGA 2XKSA 4J1UA 3QFJB 4G8IB 3SDDD 4NQVA 1QVOB 32C2B 4NN6C 4PJHA 3P73B 3L3HB 1EA9C 5EZJB 5EORL 2DQGH 1YUHA 3FQNA 5CP3H 2RAMA 3MBXL 4H20H 4LLMA 4WFHE 1EJOL 3GJFK 4GKOA 4C4KT 1UACH 4BZYA 3SDXE 2NPLX 2V2WB 5IV2A 4P2OC 2DTMH 1RJLA 1A6WL 1MJJB 3RUGE 3QHTC 5KSVA 1GGCL 2OXGA 4WI3A 5ETUB 5CZVL 1DUYA 3NZHH 4LSPH 3TJEH 4Z7OE 1AGEA 4F58L 1J8KA 4KY1H 2VC2H 4HH9A 2OP4H 5EH1A 1S7TA 5LCVL 3ARTA 5IP4A 1INQA 5CCKH 4ELMA 2VR5A 4F8TA 1NJ9B 1QFPA 1F6LL 5IEKA 3RGVC 5IR1A 3CFKB 1E4WH 2PW2A 4NWUH 3D5OF 5E70A 5EU4A 3T08A 4Q9CA 4ZDHA 1I7RB 3PHQA 2R0LL 5E4EC 3D2UB 4OCYL 4M7LH 4UQ2B 1TCMA 2AEQL 4QRQB 4U1NA 5DMYA 1FNFA 4J6RH 1NKRA 1B4JL 1KTDB 1OAKL 5EB9A 2X10A 3EYSH 1CG9A 2GHWB 5GGRY 4ZAKA 5TDOA 4WFGD 4KXZI 5IB5B 4PRAA 3C60D 3B2UC 4N9GA 2AKRB 4NUJB 3SDAC 4YBQC 2VDMH 3WFCH 2P8PA 3QPQC 4OLXH 2PCPA 4KROC 4QHLA 4P4RA 3BIKB 4K94L 4N5UA 1K85A 1KCKA 5I8KL 5C9JB 1OF2A 3FB7B 4I5BB 4M7JL 4PRIA 3RA7H 4LVOB 3HZVB 2J8UE 2F74B 3V8OA 3O2DA 1FZJB 2CMRL 4GG8B 4E9LA 1OQOA 2VLRE 1QSFD 3OJ2C 3T0EA 5DO2D 3WO4C 1X6LA 2XT1B 4PJIB 1FNLA 4NUGH 2B39A 1QSEB 3C5ZA 4M93C 3U36B 3G5ZB 4QOKD 1JI2A 2WQRA 2HP4A 4XX1E 4YQXL 4WNQB 2P5WD 2DM4A 3LH2H 1BLNA 4JFHD 1Q9OB 3AS3A 3H7LA 1AR2A 1KG0A 4JZJA 3MCKA 4KZEL 1NLDH 5BMFH 2I9TB 2QQQA 1Q1JH 4PB0L 1U8HA 3CK0L 1ZT7B 5I75C 2NZ9D 3IDJB 5AG8A 5C0CA 1YEFL 2OTWA 2EYSB 3O11B 3ULVD 3ULUH 3ZDXE 5DVMA 5C9KA 4LSSL 4X4MA 4Z7VF 2A9NH 5B8CA 2IH1A 4Z0BL 4LCIL 4M43H 3QUXC 2G60L 3S4SB 4E42A 2X4QB 5C0IB 4HKXB 1NBZA 2DWEB 5C0DA 3ZE1E 3MROA 2M8XA 3KPQB 4EKXA 2XFXB 4RISL 3MRFA 3ZKMC 5E2VL 3FCTA 1T04A 1N4XL 4K2UL 3IDNB 4PJGF 4JFEE 3WXVL 1YMMB 4FHBD 3VRLF 4YXKL 3BGMB 4FFYL 4JFPA 2F58H 3UP1A 5GSRB 1MAML 2IANA 4L4VE 4OZFB 1ZMYA 5HJ3B 4FQXC 2FIKA 2VZ1A 3V5KA 1DQJA 4KPHH 3EDKA 4JO4H 2EDWA 1XGRA 1AJ7L 1BBJB 3RZCB 3UJIH 4Q9RL 2DM2A 4Z7UA 2J88H 3BKML 3GUTA 1AQKH 3G6DH 1SMAA 3QUKB 1GOHA 1JK8B 5HHME 3FO9A 4HJGB 4KI5D 4PGEA 3MUZ1 1FCGA 4HIHB 4P5TC 4OM0L 1A3LH 2BSED 4P46C 3PL6B 5C0FB 1B0GA 1FLRH 3M45A 1Z0MA 2IG2H 2WBJC 5DRNB 5IVNA 1R24B 2OQJB 3QIBC 1LO5B 5IHUL 5D1QD 1FGVL 4I8DA 5CHNA 1NGZA 3P9WB 1OGAD 3NH7L 4YLQT 1F3JB 3FFDB 4YPGB 1QA9A 1SBSH 3UX9B 1GZPA 4F15B 2Y4SA 4H25B 1TTGA 1YPZF 4DKEL 5JPNA 1G7LB 1U0QA 3NFNA 1WV7T 2EXWC 3KPOB 4M6OL 1CDCA 1A0QH 4M5YH 1N6QL 4MVBC 3ELAT 4NSKA 3F65A 2VXQL 4FABL 1S3KL 1WF5A 5BW7C 3HCVA 1WAAA 2AABL 4UQ3B 5D1XB 4AG4H 5DSCA 4JDVB 4Z7NF 2B8OT 1CS6A 3U0WH 3BZFA 3HAEH 4KKBD 5HYJA 2DQUH 3ARFB 2V7NA 1F02I 5DD6A 2NCMA 4U31A 5EULV 1EVTC 1JGEA 4KJWD 5BO1L 3OJDB 3IYLW 3NFSH 3P0YL 1A7RH 3ARDD 4OGYH 3S3JA 1WEJH 3O2DL 4AEIH 3RPIB 4KZDH 4GOSA 4XGZA 4WO4B 3SKJH 1CFTB 1VEOA 3OX8A 3PXJA 1F90L 3MBEB 2CR3A 5LXGH 4E41D 1ZVSB 3EYQD 2QQKH 4U7KA 1CD0A 1WIOA 3KPSE 5JW4R 4LQFH 3U4AA 2HN7A 3UZVB 3D39B 5AD0B 4IHOA 5CIPB 1K4CA 4GRLD 5L9DH 1INDH 1T1WB 5I1AB 2VZSA 2IBZX 5C0RL 5DUBA 5KVFL 1CGYA 3O0RH 2F54E 2VLKD 4NPYB 3QNZB 4PV9B 3EGSA 4JHWH 2H6PB 4PGCA 1JF5A 5F7FA 1JZ7A 5I66A 1LQSR 5KSAD 1J12A 1MI5E 1QFHA 2B0SH 4WHTB 3MJ7A 2QQLH 2HFGL 3AGVA 1QLFA 1RHHB 4R26H 4FP8L 5CSZB 3TIEB 2VXSH 1GRWA 2AQ2A 5DMGC 1I1FA 1B88A 4Y16D 1A6VL 3ARQA 4LPXA 1UWXK 1IVLA 1MJ7L 4I3SH 4MD4A 5C07D 5LVEA 1E27A 3X12A 1D5XB 2OCFD 3TO4D 5BV7B 1BQUA 1ZANL 4DN3L 3K2UH 5IB2B 4Y5YC 4NWTL 4H0GA 2Z31A 5BRZE 4YR6A 2I9LA 3T0WA 3KLSA 3EHBC 4NQDE 2R9HC 3DLQR 1H3PL 4M48H 1IAIM 1T1YB 4JR9L 1IAOB 2R29L 3E6FA 3FO0L 4PIRF 4HIJA 1EMTL 4E0RA 3NGBB 5DDHB 4O02L 1MHEB 3AY4C 4KDVA 5DZOA 2QSTA 4FFWD 1QTYT 1MCEA 1XR8B 5C08B 3L3OA 4NQCB 3MLYL 4W4OA 2PYEA 3LKRB 1HHKA 3VG0H 5E6YA 2PXYC 3LSOB 1GSMA 2A83A 7FABH 1KPUB 3IXAA 3GSUB 1QFWH 1QPPA 2DL9A 3U7WL 5IKCB 4JPWL 1ADQH 4XVSL 1KXQE 2DJSA 3L5WA 5L8LB 3OGCA 1MAKA 4P23C 1NCWH 2Z8WC 3P9MB 5F7LB 4I0PB 3LEYH 2EH7H 1PZ5A 1IAKB 1BZ9A 5AAMA 3VWJC 3C9NB 2OYPA 4ISVB 1C1EL 3IJHA 1FAIL 3KYAA 5EOQH 2JIXA 1TETH 3IJYA 2GAZB 1H3XA 4NRXA 3MXVL 2HLAA 1RIVL 5K33A 3C6SB 4LSUH 3BVNB 2KDGA 4XAKE 4DGVL 2X70A 2ICES 4KTDL 4WFFD 3AU1B 5GJSL 2X4TA 5DZNA 5BQ7B 4PRPD 4UI2A 5DJDA 1UWEL 5D7JC 1T7WA 3VFOB 1NANH 4LNVA 3DXAB 1MCJA 4ONHB 2R0KH 2XA8L 3GMMA 4URTB 1N8ZA 2VDOL 4J3OC 4OD2A 3Q6FA 3PHOB 4KQ4H 5IB3A 1EZVX 1XGPB 3MLZL 4R96A 2PR4L 2ZCKL 4HWEL 1DTUA 2QV2A 4ZOEA 5JLZB 4ONGH 2IALA 3CFJA 3RGVD 3L5HA 3Q5OA 3GBML 3UMTA 2ITCA 3IS0X 3QDME 1XGTA 1IC1A 2Z92B 3GJFA 2A0LC 1Q9KA 3CX2A 4JRYA 4P4KB 3PNWA 1F2QA 2PTVA 4YFDB 4Q9QH 1BJ8A 5ILTL 5JR1L 1D6EA 2AEPL 3I75B 1E6JH 4XC1H 3FONB 3TLRA 1RZFL 5EG6C 3TO2B 2BXYA 3B2UD 1Y0LA 3U48A 3G6JF 3T4YB 3SDAD 4YBQD 4CGTA 3ARGB 4NZRL 3V52L 3ISWA 3QPQD 4J3UA 2RB8A 4KROD 1S7WA 4HXBL 1B6UA 4U1MB 1G7MB 2NX5E 5D5MB 3UROR 5D71L 5IVXF 3QH3B 1A6ZA 3HG1B 5DJXA 2KKQA 3O3EA 3P77A 1KCSH 5DFTA 3GB7B 4U7MA 3R1GH 2FEEI 5F1NB 4B41A 1LNUA 2Y07L 3SE9L 5HDBE 5HDOA 5CEZE 1IC7L 4HZLA 5HD8D 3BD3A 3GMQA 4HK0B 3TT1L 2ZOKB 2RFXB 5FA3A 3LHPL 4AMKH 5BJTA 1I3GH 3MXWL 3KJ6L 3RX5A 3K8KA 5E1AA 1CGXA 2R0WL 2D0HA 4HAFA 5GJTH 4M3JA 2R2BB 1F6AB 3ILPA 4NQEE 2H8PA 5D7IF 3T0VA 3RI5F 4JO3L 2UYLB 1U8JA 2IPUK 1L6ZA 4RAVA 4N8CH 4NJ9L 1J0JA 3SBWC 4CMHC 5DD5L 4OZHE 3K4DA 3QUXD 4AIZA 1E4KC 3IDMB 3IRPX 1WSST 3LRSA 4S1SH 3UYOD 5F88A 1FDLH 1ZHNB 4NKOA 2PO6B 4JKKA 5EPMA 2V2XA 3LQMA 4AENB 3STLB 3BZ4B 3Q6GL 1P5VA 4FFVC 1L7IL 1UEYA 2VDLH 4NQUA 3V0VB 1QBAA 4FQCL 4UMGA 3WFDL 4NGHL 4QY8B 4OCSL 4JVPA 1G6RA 3EFFA 5T3ZH 2ATKB 1EFXD 3SGDH 4YDIL 4FQXD 4K94C 5KSBA 1Q0YH 2D2OA 1QRNE 4RBPK 4AM0A 4GKSA 2BY3A 2L7UA 4EDWH 3SGJA 4CN1A 3SCMB 4BH7B 4HKBB 5MEQB 5F9WB 3TBYA 4I0CC 1U3HB 4ZPTA 2R39A 4KGJA 1OGTB 1AXIB 3TFKC 2DLFL 1NCDL 4PJCB 3VH8B 4ZFFA 3KLDA 4XNQA 1DBJL 4YO0A 1G9EA 2WBWB 2YD6A 4P5TD 2DWDA 2E9WA 4P46D 4JFFE 1SVCP 4DKFL 1T2JA 3IRZA 2WBJD 1NUFA 2DYPD 2AK4A 4EBQL 3QEQB 3I6LD 1Y6NR 3QIBD 5SWSA 4HJ0D 3M07A 1MCDA 3H3BC 4XRCB 3UTZA 4BQ8A 1OSPL 2Z35B 1YEEL 4UUJB 2FD6H 2VJXA 4QHNA 2ICEA 2Z4QB 3K2MC 2AJYH