3TWIA

Variable lymphocyte receptor recognition of the immunodominant glycoprotein of bacillus anthracis spores
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
136
structure length
136
Chain Sequence
GLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTNPSLVEVIVTGLGLSLALGTSASIIIEKVAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variable Lymphocyte Receptor Recognition of the Immunodominant Glycoprotein of Bacillus anthracis Spores.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Immune system
molecule keywords BclA protein
total genus 23
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18573 BclA_C BclA C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3twiA00
2E7AA 4KGGA 1IQAA 1I9RA 1JH5A 5KWRA 1PK6C 1U5XA 5CIRA 1TNRA 5HBAA 1RJ7A 1DU3D 2Z5WA 1WCKA 2JG9C 4RSUA 2RE9A 2WNVA 2WNUA 1JTZX 2RJKA 4DB5A 4GIQA 1DG6A 3ALQA 2JG9B 2KA3A 4EN0A 1OSGA 5L19A 4G3YC 3L9JT 2JG8B 2QE3A 4N90A 1KD7A 3QBQA 1RJ8A 4TSVA 4QQLA 2JG8A 1XU2A 1OQEA 3LKJA 4OUMA 2Q8OA 3WD5A 4QPYA 1D0GA 1U5ZA 4F3JA 3IT8A 5BNQA 1C28A 1A8MA 3TWIA 1C3HA 2TUNA 5KC6A 3K48A 2WNUC 3V56A 2R6QA 1U5YA 3B94A 4E4SA 4QQHA 3FC0A 1GR3A 4QQOA 5KC5A 1XU1A 2O0OA 4HT1T 3B9IA 4QQ2A 2X29A 4TWTA 2WNVB 3AB0A 1D2QA 2RJLA 4NN0A 4OUSA 4E4DX 2R30A 1S55A 4D7YA 1D4VB 1OQDA 2TNFA 5L36A 4MXWA 4J6GA 2ZPXA 5TSWA 2QDNA 1PK6A 2HEVF 2HEWF 2R32A 4MXVA 4DOUA 2JG9A 3QD6A 2WNVC 2AZ5A 4KGQA 4G4FA 2Q1MA 4OULA 4MXWB 2HEYF 1O91A 4MSVA 4QQPA 2ZJCA 2WNUB 3ME2A 4KG8A 3URFA 3TYJA 1KXGA 3MI8A 2JG8C 3K51A 1PK6B 1ALYA 2OIIA 1TNFA 3B93A
chains in the Genus database with same CATH superfamily
2E7AA 3MPBA 5A3LA 3VBFC 2ZGTA 3SLIA 4JRAA 4ASKA 1I9RA 2ZHMA 5FZDA 1NUKA 4DRVA 3RZGA 1UNBA 3K4ZA 4Y22A 2SBAA 4CDXB 3HPNA 1UYYA 3EB7A 1BBT3 3POGA 4JHTA 1BJQA 4DINB 3FUOA 2PHFA 4AFCA 2BZDA 1ULDA 1YQCA 4O61A 4J25A 5FLHA 3ZFGB 4AEDC 3NAPB 2CGPA 2EF6A 4XFAA 5L7OC 1AF9A 5LZ6A 1CAXB 5F2WA 3BOPA 1VBE3 1FNYA 3H7JA 1IKQA 4N53B 3ZN4A 4CZSA 4S2HA 1OA2A 4UBGA 4CCDA 1G86A 1WBLA 2G19A 3KSCA 3M7AA 2JD9A 1WMDA 4ITCA 1CAUB 4LKFA 3I3DA 2D5FA 4TSVA 3SEEA 5FJHA 5FZ0A 4XUPA 3SKVA 3I2FA 3HBZA 2Z42A 3WNMA 4DZGA 1AR72 4GAZA 2A71A 3AMPA 3WD5A 4NRMA 1ZBE1 4Y33A 2EXHA 2NN8A 5BNQA 3KHCA 5IJRA 2J22A 1GOFA 2RR13 2VNVA 2XGXA 3AZVA 5LBFA 2ZEYA 4QB1A 3V56A 1ZVFA 2JB4A 2G1MA 5F3IA 2ILMA 1ZNPA 4FPOB 1K3IA 2Y33A 5T5LA 5FBJA 3ZSJA 1ND3A 5CFDC 1YUDA 1RUJ3 4L9BA 1OMIA 3JBG3 4QX3A 3UGGA 3CJIC 2WZEA 3TN93 1AZDA 1JHNA 1OF3A 4KWKA 2XJRA 4E8DA 3T0BA 3N9NA 2PQQA 2QUOA 4AOCA 1HXS1 4YARA 1EAH1 3BIEA 3WF1A 1HB4A 5C4WC 1RUH2 1VB4A 3BOWA 3AFGA 4TTGA 4XJ8A 1Z0HA 3ZFEB 4A3ZA 2ZABA 4PCRA 1V70A 4BLJA 5JMOA 1EP0A 3ZYPA 4J6GA 4K21A 1PVC2 5CAZA 1IS3A 3F2ZA 4DEQA 1OLQA 2DTWA 5FZIA 1LOGA 3MYXA 4BQXA 5F6LB 1W6MA 2NMOA 5GLWA 4I3PA 5IK8A 1JYNA 1FYUA 2W92A 2YC0A 1NLSA 2WNVC 3KMHA 1UOFA 1W90A 4UFKA 2QQUA 1UY1A 2R071 2W2IA 3PVEA 4OQ8A 5DPNA 4WM8B 2ZGQA 3ZIWA 2JIGA 4O7XA 1SBDA 5A3WA 2VQ0A 3FX3A 4P5HA 3KVBA 1D4M1 2HEYF 3I59A 4Y22B 3VD3A 5KHJA 2P3YA 5F2SA 1QOOA 3J8F1 3S5AA 3USUB 2VCCA 1NZIA 3ME2A 1O3RA 1O7FA 4XVHA 3VHNA 3ZSLA 4L11A 3PUHA 1DQ2A 2UWBA 4XDOA 4D3WA 2JG8C 4GD4A 4YM1A 2HH9A 2HKXA 3VKNA 4HBNA 4KGGA 5K7PA 1RUC2 1W2OA 3ACHA 3FWEA 3PL0A 4K6BA 4XF1A 4AWDA 3ETQA 3MIDA 2J1VA 1GLHA 3VBHA 4YZ3A 1RUI1 3AP4A 3I49A 4Q4Y2 3VDAA 1RJ7A 3BALA 4BCUA 5IFTA 1OKOA 5J09A 1ND2A 4A6OA 2Z5WA 5FPLA 2FDGA 3S5QA 3AMQA 5KXCA 4NHKA 2CWMA 3TBDA 1P8JA 1AYM3 5JOXA 2VZOA 3JD73 1QJZA 1G6NA 2WAAA 2P3JA 3M3IA 4HL0A 5A7QA 3VDCA 1G9BA 2EXIA 2JXAA 1Y9MA 2X53S 4IDZA 1N47A 2JDAA 1SLLA 3KM5A 3LOIA 1RMU2 3WNKA 3BCWA 4BMBA 1AR93 4AQ6A 1NOVA 2R49A 1X33A 5J96B 2XHKA 5LY2A 4XJ9A 5ERLA 5BNPA 4FSJA 2VPVA 1SQ4A 3OF1A 3WXPA 1RHI1 4CEYA 3SCHA 1DGWA 2P6HA 2JWPA 2VM9A 4I0BA 1ZZCA 2QFEA 4Z82A 3AMHA 4GWNA 2RR11 4P00B 1CGPA 2HWE2 1WMFA 3H9AA 3P3PA 4QPYA 2VUJA 3KCYA 1URXA 2VZSA 3UT0A 2VE1A 3MIFA 4GB31 2OW4A 3HNYM 4JGYA 1H8TC 3PMSA 4AVVA 2JDPA 3IN9A 4QXBA 1C5IA 4Y3OA 1MS3A 3K48A 1MR5A 2WNUC 4JX0A 1L7QA 4K1ZA 4K40A 1UPSA 1VBB3 4HONA 3PU8A 4XQWA 5FXVA 5FZ7A 2VZVA 1PO12 3DXTA 4CCMA 4RGGA 3JQXA 5FYZA 1VBC2 1VBA1 4QDRA 3NQHA 4N9HA 3BTYA 1JZ4A 2EIGA 1K45A 5FYBA 5LASA 5LA0A 1YQ5A 4AEKA 4DY5A 1NLQA 1GZTA 2E51A 2OUHA 1QQP3 2PHXA 3ZYRA 1BKZA 5LW9A 2ZX0A 2DCKA 4LNVA 5ACA2 1ZYBA 2D3PA 2VOTA 1WA6X 3PHMA 4A3XA 1FOD2 1QGLA 1UW8A 1VRH1 2VOKA 2GC2A 1NQJA 3VL9A 2BWCA 4ATFA 5FPUA 5A7NA 2GMEA 1PK6A 4CDQB 4XACA 3NAPA 4WBBA 5D8AB 3KD4A 1OI6A 4LJHA 2XR4A 4OMDA 3IMMA 1WMXA 2JE9A 3OUHA 2FBEA 1B09A 4UYBA 1VBD2 3HEIA 1RUG2 1KQRA 1MS4A 4I30A 4KGQA 1HQNA 1ONAA 2GH2A 4G4FA 4QX0A 4XHBA 5ABJC 1K42A 3WCSA 2Q0AA 4HG6B 5A6ZA 4HKLA 5JVVA 3W9AA 4KU7A 2Q4SA 3AZXA 4QU1A 1ZBA2 2BOIA 2DVAA 3LZZA 1TMF2 5FPVA 4XJUA 1YJKA 4OUEA 1QJY2 1S2KA 1ULOA 1V00A 3DUIA 4XXPA 1TNFA 1LHWA 3N7JA 4N9IA 1FXZA 4Q4X2 4C8DA 4BE3A 3OGVA 1HRV2 3E5UA 3ZR6A 4YLZA 5D21A 5FZFA 1U5XA 4KQ7A 3QACA 4LOTA 3CIHA 1KDKA 4AVBA 3HNMA 4BM8A 1VRBA 2QBXA 5EJ3A 2JG9C 3IMNA 4W50A 2RE9A 5FMBA 3VN4A 1NKGA 3GBFA 4YZ1A 2PLV3 2YFUA 2ZACA 1EY2A 4CDXC 1OOPB 4QX8A 1XBFA 2RMU2 1DG6A 3BPSA 3N9OA 5GLZA 4HK9A 1GP4A 3H8UA 3ACGA 4HVRA 1N1VA 4D6RA 2WO3A 4Q4Y3 4C0HA 3J7MA 2ZCWA 4P9WA 3MBWA 1T6GC 4YVSB 2VZ3A 5I93A 5GLVA 4DY3A 4AZZA 4N43C 2NPIA 4N53C 4UW6A 3WNOA 4W6YA 5C7GA 2PA7A 1GUIA 2C6SA 3ASIA 5FZAA 3WDWA 2VQUA 5FUIA 5DG2A 3WW1A 3B3QE 3ZN5A 1W2TA 3RYKA 3WUCA 3A0KA 3HQXA 4YW5A 3C3VA 1K5MC 2V72A 4OQ9A 4AQTA 3ETPA 2DUPA 5E16A 1O3QA 1VBC1 1WWYA 3POWA 5FO9B 4Y1UA 2VGDA 3WCRA 2GSYA 5JIUA 4CDUC 4QQHA 3L2HA 2PYTA 2IXKA 2HWE3 1GR3A 4JTNA 3VV1A 1H4HA 4RQPB 5JSPA 3EHKA 3VBSC 1M4WA 1OQ1A 3USUA 5C3OA 1JYTA 2Y64A 4I0WB 2XOMA 4IEYA 1EUUA 5GLTA 3TNQA 1MS9A 1LTEA 4KU8A 4UXAA 2BWAA 4DNYA 3EQEA 4EJRA 3AP6A 3MIBA 3I8TA 5ANNA 5H9SA 5IHRA 1SDWA 2KM2A 3ZSMA 3WOGA 1HB1A 1WCDJ 3AKSA 4BISA 1QJFA 3RGBA 4E8CA 1GWLA 3VHRA 3J8F3 3ZVXA 4CCOA 5DUXA 4QKNA 4N7IA 5A3OA 5HI0A 4YZ4A 5FO7B 4BQ5A 3RJRA 3KV4A 1WLCA 3WHTA 3OCPA 4LA3A 2DUOA 1LHNA 1W2AX 5DMYA 1S2BA 4D6QA 5FYMA 4AK3A 2RM23 4CP9B 3OOXA 1H2MA 4ZY9A 2ZGOA 3AX4A 1FOD3 1NCQC 3NV2A 4D8MA 2Z79A 4FPHA 1OLMA 3AC0A 4Y5Z0 5FUNA 4CU6A 3O1OA 4IEQA 4DXZA 4AI1A 1I6XA 3FBMA 4XE9A 1UOGA 4XFBA 3VZJA 4M3CA 2J1RA 5CFCB 1CIYA 5IVYA 4NWWA 2PAEA 2ZKLA 3LPGA 1JYCA 2WT2A 2B8MA 2V5YA 2OIIA 1X7NA 2WSUA 4RHV3 3KT7A 2XJUA 3MLLA 4BOWA 5C5TA 4CDUB 1SG3A 3OJBA 1DZRA 4PIYA 5I8SA 1O4YA 1CESA 5CFDB 5FZOA 3VD4A 1BCXA 4FFGA 5F1RA 2PLV1 1QJU2 2JDHA 2EIBA 1FPN3 2GDFA 3ZKUA 2VD7A 1SCRA 5BUVA 1IPSA 1BVVA 4R9DA 3FUQA 3DPRA 5FMCA 4AHXA 4XDPA 4LIUA 1CZVA 4CSWA 3IDBB 1QJY3 4JHZA 4IQPA 1WLWA 2JDKA 4H7MA 4AHYA 3U4SA 5A3NA 1X50A 4XUNA 2GNMA 1Z7S2 2DWRA 2Y6KA 3LCPA 4GMP0 4NE9A 1HRV3 3GHMA 3HVDA 4S2DA 3SC7X 3T4VA 2W39A 5IVVA 1Y9GA 3D5OA 2OQ7A 1H30A 5BNNC 1ZBE3 1ODMA 2WZR1 2WFPA 2IFWA 4OHXA 5C8CB 3FHQA 3PIJA 3VKFC 4Z8BA 1REEA 3IBMA 1HXS2 1V6LA 5EHDA 3KS7A 2IXLA 2BYVE 2WO1A 1NT0A 2RS13 5FXXA 4RFRB 5FY9A 3ES1A 4AAXA 3AKPA 2FCVA 4LITA 1MEC2 1UU5A 3MW3A 5F9TA 3S30A 1KITA 1UYXA 3RQ0A 2ZXQA 1PMHX 1XYOA 1OT5A 3CDZB 2WYSA 5CKMA 3TWIA 1C3HA 1VIWB 3PMEA 3WQ1A 5EFUA 3RI8A 1VLNA 5CFCC 5IFPA 3FE5A 2R6QA 1CAVA 4NAMA 4R8HA 2FHRA 1GOHA 4HETA 4LO5B 1EV12 1R083 4IE5A 3RJ2X 3VBFB 4IEPA 5L7OA 3AYCA 1JUIA 1LHVA 3LPFA 2WLPA 2O0OA 4XTPA 5GZCA 3ZMOA 2HWF3 3APBA 4YVWB 3O1PA 2YB7A 1N1SA 2R042 3PUIA 5A3TA 2RM21 2D97A 2JEMA 2Y26A 4E4DX 2WQ4A 4HN0A 4LUKA 2D6NA 4EN9B 2GNDA 3WNXA 2YPJA 4BQ1A 3VKLA 4XUQA 1DLCA 3QLQA 4AAPA 2VMIA 1HLCA 1GP6A 2Q1FA 4D94A 4AFBA 1ZZBA 1QDCA 5FQ0B 2BFUS 4X8PA 1AR81 1J84A 1ULEA 2DCJA 5LEKA 4GB33 2JE7A 1SFNA 1G9DA 5C9AB 1TQ5A 1QKQA 3M4FA 1JZ2A 3O1VA 1Q5OA 3DGTA 3W58A 2K2SA 4BMEA 5CYYA 1G9FA 4AE2A 2AYHA 3VBRA 3WG4A 3ZKYA 4AQ2A 3FLPA 4AI2A 1ULGA 4BU2A 3N7MA 4Y5SA 1HX6A 2V5DA 5HV4A 4AEDA 4BWOA 4M01A 3SKJE 2Q1MA 4Q4V1 2RDSA 4RD7A 5HCAA 4CU7A 4MV2A 2D6KA 2VMFA 5DDJ3 4MYEA 2WO7A 1ND3B 1C4RA 1GNZA 5F5IA 1NE6A 3G7DA 2RS33 3R0RA 3LA2A 2E7TA 2XWJB 1STMA 5CZKA 4AVTA 5CKNA 4UFJA 1LU1A 2Z2SB 4S2FA 5KXDA 1AR62 1SMVA 5G04L 4HSJA 1OXCA 2RVAA 2O8QA 1JMUB 3JD71 1IQAA 1UY4A 5C3QA 2ARBA 2XJSA 3U78A 1LJ7A 2VH9A 1IPJA 5FZ3A 3WDTA 4CUGA 4E2SA 3W5NA 2ERFA 2B9VA 5K8SA 4M3CE 4NRQA 4XFFA 4LHSA 3VKOA 3WF4A 1IQDC 2JJ6A 1YEWA 4UFHA 1X9TA 2BEOA 3RWNA 3BN6A 5FR3A 5JPMB 2WQ8A 2YY1A 1GYKA 3JBG2 1OUSA 2L9LA 1H1IA 3T09A 5LA1A 2FDJA 1O4TA 5DAWA 2VUDA 2WZ8A 1J58A 5JI9A 1ZREA 2KD7A 2GH8A 4A42A 2VL4A 2ZX2A 5EIYB 4LEJA 1D4M3 4YM0A 2BP6A 4UOJA 1OC1A 1Z7S1 2P34A 4LA2A 1TG7A 2OX0A 3WP6A 2DFBA 5A3UA 1HIXA 1UAIA 4YFWA 5FZ8A 3RYRA 3FL7A 5IVBA 1UKRA 1AR71 1WW7A 3KHBA 4BIFA 2ZKNA 3NNJA 4RGKA 4GKXA 1JOJA 5FYTA 1UU6A 4BQ3A 1XU2A 2QQMA 4CDWC 3VDBA 2VXJA 1JS9A 2VBPA 3ENRA 4IETA 2Q8OA 4LBNA 1LECA 3WW3A 1IZ3A 1DGLA 1XPWA 2BFUL 1NX9A 3O1RA 5EXOA 2W1QA 1LODA 3NJXA 3NO8A 3J7HA 4CXWA 4HOOA 5C71A 1NA1C 1U5IA 3B00A 3MFAA 3HJRA 5I0SA 1DYPA 1QXPA 3CL1A 5FYIA 1YFXA 4TZDA 1XNTA 2VMGA 4YFZA 4AVSA 1JU3A 1O5UA 3RZJA 5EP9A 4HFSA 2F4PA 2YGMA 4CA9A 4UBHA 4AR2A 2VOXA 5K9YA 3NV1A 3J26N 4ZONA 4KI5M 4QQ2A 2CDOA 4IGQA 3KWVA 3WR0A 3ILRA 3RMYA 2P2KA 4G9SB 4BQ4A 3M2MA 1RUJ1 3ZYIB 2WSVA 1C8M1 3LA7A 1E5IA 2XMLA 3HQRA 3T3YA 1PVC1 1W39A 3VDDB 3P3NA 4NPMA 4K8FA 4P9XA 3ZXEA 1GWMA 2B46X 1OVPA 2P1BA 4X8NA 4CPBA 1PIV3 3GF6A 4NR1A 2FDFA 1Q3EA 3THDA 2HWC1 4AEDB 4Z2WA 1ZM1A 1XRUA 3O1UA 4PI2A 1DYOA 2XVGA 1O3TA 1GZ9A 3VBRB 1MZ6A 2LTNA 5FWEA 2XBO3 3S6PA 5A1LA 2OPWA 4DOUA 1AJKA 1XYPA 1ZRIA 2E6VA 2GP3A 3AKRA 1LU2A 1YYNA 4AGRA 4CE8A 2GN7A 2AZ5A 2FDIA 5JZGC 4LBQA 5J98B 3M3QA 1PMIA 2YXSA 4COUA 2YGLA 4Q8KA 3KGZA 4QPIA 2BJSA 4MXWB 5K0UA 1W6OA 1O91A 1ZRRA 5F6KA 2WNOA 4OHZA 3ZX7A 3CQOA 2IXHA 3I59B 1U0AA 4QQPA 3UK9A 1O4ZA 1LOAA 2PQSA 4BK4A 3H1MA 3D0JA 3POIA 5T52A 4IGPA 4UW4A 4XJWA 4B1MA 3USSA 1FMD3 4ES9A 3HQUA 3RZLA 4FFFA 4BLIA 1BVP1 1KJRA 2FQPA 2P37A 1J3PA 1OVSA 3K51A 4M3CB 4UFLA 5E6HA 4BK5A 5JXGA 1E57A 2A3WA 2B9UA 1IPKA 4Q26A 2VXRA 4LBJA 3CZUA 3UGHA 3OSDA 1RHI3 1PNFA 4JGYC 3EBRA 1GBGA 4GXLA 1MS0A 1UD1A 3OD0A 4IEXA 2D6PA 1PIV1 1H2KA 4ZXEA 1RUI2 4CCEA 1HV0A 1W0OA 3A4UA 3KV5A 5H9RA 1GQGA 2F17A 5T54A 1CX1A 1C8NA 5ABJA 1OSGA 1QQP2 3IIIA 1JXNA 5K0UC 2CYFA 4GKYA 5A1AA 1AYN2 5FZ1A 2CL2A 1FNZA 2VBDA 4LO6B 3VBSB 3PLQA 2EALA 2IVIB 1IHMA 3ZFEA 4M3CF 4Q0PA 2XKPA 4WVZA 4LMFA 5ISLA 4K8RB 2I74A 1LOEA 4QQLA 1YQ6A 4HSLA 4ARXA 1TME2 1S0GA 3WHUA 4BB3A 1OBNA 5FRAA 4GULA 1SLAA 4FPKA 4Q4W3 1HB2A 2B42B 4OZOA 4YW6A 1VBE2 1CVNA 4R9BA 3I3QA 1A8MA 1PO22 1FI2A 2P4EA 3DV8A 4GH4C 3VL8A 3ZFGA 3O0VA 4EN7B 4EV0A 1ZRFA 2IXCA 1A34A 5I0TA 1RUG3 4YGCA 2Q8EA 3SCGA 4ZU7A 3GALA 4CEWA 4IGOA 1RVF2 1GP5A 3HD8B 4AHZA 2W08A 2D6MA 3J9SA 2F4LA 2XUMA 1AR73 4AFDA 1RC6A 2EXJA 4FPCA 5GJ6A 4B1LA 1KGYA 3ZXJA 2A6YA 2ADEA 2QQWA 2R073 4OHVA 1L7LA 3AVSA 3LIGA 1TMF3 3ON7A 1ENRA 2I45A 2ZEWA 3BODA 1F5FA 4FTSA 1O8PA 1W04A 1PO11 1GZWA 4BQ2A 3AK0A 3N9LA 4LLFA 2W52A 4XXAA 2DDUA 2BNMA 4OUSA 2HWD3 2AACA 2WAOA 5C8WA 5A33B 3Q8EA 1OD5A 2ENRA 1RUE3 3N9PA 3VBHB 4ASLA 4ET7A 5L7OB 2AENA 2A5ZA 2QQNA 2ZPXA 3EXUA 1PO21 1W3VA 2AC1A 1B35A 1Q56A 3OTFA 3A7QA 4YPJA 3AKTA 4F7ZA 2PLV2 3LDBA 1IS4A 5DAPA 2HEWF 4YG6A 4LKDA 3OUJA 1E5HA 5LK5A 3DPRC 3DEMA 3E1F1 1KFXL 4V2VA 5JXHA 1ZZ6A 3GHNA 1F8VA 5DZFA 4KG0A 4GZ9A 3NWKA 3RYPA 5FZBA 3ZN6B 1PM7A 2C0ZA 2JDZA 1ZBA1 4XF9A 4BZ4A 2DU1A 2WWUA 1W6NB 2OQ6A 5BNNA 3MV11 4EWEA 1ZX5A 1CIWA 2EAKA 2VVFA 2VZ1A 2Y6HA 4KG8A 4MH0E 1H8TB 4OI2A 2ARCA 2SLIA 3Q8BA 1WCQA 3GJBA 1QXJA 5FPZA 2QQLA 2YMZA 3WP3A 5EJ1B 1JZ6A 3O12A 4LBOA 3MUZ1 3H3ZA 1N3QA 2YV8A 5SV8A 1SFPA 3B93A 1Q8PA 3N7LA 4PJYA 4DEVA 3N36A 1KJLA 1XSQA 3H3UA 4MLOA 3WNNA 3I2OA 1DBNA 4QXHA 1TMF1 2WUHA 3I2DA 3U4XA 4QKFA 1EPWA 3IPVA 1REFA 1LR5A 1POV3 2C4XA 1L3JA 2XLGA 2C5DA 1DZTA 1YWKA 2W68A 1EAH3 1TE1B 3C8XA 3K77A 3Q8CA 1V9U3 3GDBA 4Q4X1 2WRAA 3MF9A 2ZMKA 4L97A 4AI8A 3P5BA 4WM7C 3U75A 3OPTA 3LFMA 1VAMA 1YQ8A 3IDEA 3MLKA 2JG9B 4NPLA 4EQVA 3VZMA 1ND3C 2ORXA 2PAKA 4YZ5A 3VBUB 3LDKA 3EJKA 1CD3G 4Q0VA 5C6CA 1FV3A 5ANQA 1AUYA 2VNOA 3DCQA 4UI9L 3LEIA 2P3KA 1LULA 5FYUA 1W05A 4F83A 4XUOA 4U2AA 3UKVA 4K7JA 5HCBA 1Z78A 5HCFA 1UKGA 3HT2A 3JD72 3RDIA 3H7YA 1OQEA 4JC1A 3LKJA 2D3SA 1VJ2A 1O59A 4GMP1 1RMU3 1U12A 4F3JA 1JU4A 1T6BX 4L8QA 2PMWB 3RFRA 4LK6A 2DCYA 2IXJA 3KT1A 1POQA 2BBAA 3MUY1 4IV1A 1ASJ3 3DYOA 4V2WA 3ZXDA 1VBE1 3QCWA 4WM7A 1K12A 1UMHA 3U07A 5J1XA 1TME3 2B39A 4MOAA 1DQ0A 3DPRB 4RN5A 1X8MA 3P6BA 5BNOC 4Y20B 2WC2A 1QH6A 2CY6A 3H8OA 4ZZ8A 3PJYA 4K9SA 3UL2A 1DQ5A 1N3OA 5FZKA 3ZM8A 4HT1T 2CNAA 1SLIA 1I5PA 3NL1A 2X29A 3A0NA 3SNMA 5FP9A 3UESA 2WZR3 5BXXA 2DV9A 2Y6FA 5GKAC 5FPAA 1BBT1 1COV2 1LOFA 5A33A 4PDWA 1NE4A 2HWC3 2OZJA 4HANA 5BYNA 2YZ4A 4PIXA 1RVF3 5A7WB 2WKKA 4XQ4A 3B5LB 1QJU3 1ACCA 2CGNA 2YC2A 4XC9A 4NUBA 1QJY1 4IL7A 5L36A 4LT5A 5FZ4A 1WUVA 2BGPA 5DN2A 3KB5A 2R1BA 4PT6A 1JOPA 1REDA 3DN7A 4IV3B 1JYVA 4JZRA 3M3OA 2V73A 5C8CC 2YROA 3O14A 4XBLA 3AP9A 1XOYA 3VZNA 1F15A 5FCCA 4TLGA 1R093 3TEWA 1W99A 2VUCA 1EV11 1X36A 2RV9A 1JW6A 2MPFA 2AEZA 1RUE2 2Q30A 1AX0A 2D3RA 3MFCA 1W8TA 2CSGA 3M3CA 4PF5A 1XNCA 3HAGA 4L99A 4YVWC 4QMAA 3POYA 5A32B 5J3UA 2BNOA 2UU8A 4OULA 1BK0A 2FCUA 4P9LA 3AZWA 4XJZA 5GZGA 1V6MA 2ZMNA 1MS1A 3O0WA 1CJPA 2BQPA 4QXCA 1R1A3 3T1LA 1MEC3 2X10A 4HPKA 1S4CA 3I54A 3K46A 4XCAA 1US2A 3NNGA 4DS0A 1N1TA 1ALYA 1VBD3 2YBKA 1VRH2 2ZX1A 1JI6A 2AUYA 3FFQA 2NQYA 2D43A 5IVCA 4IESA 4M0HA 4OVEA 1F5JA 2F6BA 1GOGA 1RUD2 3KV9A 1OPMA 4HKOA 4COYA 5JDBA 3ILFA 5DG1A 3S7EA 1D7PM 3SMHA 5SV5A 5KR7A 3KQ4B 4UW3A 3ELNA 2A1XA 2WDBA 4CVUA 2YFZA 3RPQA 4ZHNA 3R05A 3BYWA 2A3YA 3B01A 3RZMA 5JWPA 1OH4A 1NA1A 4MZUA 4C0BA 2WNUA 1JTZX 2O14A 1PZ9A 2A6VA 2HWF2 2W46A 3OYWB 4RS5A 4GIQA 1S1AA 2HBTA 2WS91 2XJVA 3GYDA 4Q4V2 1CWPA 1S0CA 4OZXA 5AFBA 2E63A 3GJAA 3OBAA 2WA4A 3VZKA 2VZPA 2XQXA 2JDMA 2D98A 2Q1ZB 1JYIA 1CPMA 2H0VA 4ASMB 1UZYA 1OH3A 2YBSA 2YYOA 3Q8FA 1KS4A 1UPIA 4AL9A 3PTRB 1RUOA 3M8LA 3GBWA 3V0AA 3OEAA 2UWAA 4X6RB 3UKNA 2HWE1 4EROA 4PQQA 2JG8A 4FPLA 5F32A 3VUOA 2Z4FA 4GB32 5LA2A 3VZOA 1JZ8A 5F7UA 4GWIA 2ORZA 3MO4A 2NYYA 5APAA 2JECA 2D93A 1K5JA 3OBTA 2ZZQA 1XNAA 1DIWA 1UU4A 5JIAA 2QJVA 4NHXA 3D6EA 3OBRA 4E9KA 2NLRA 3I2IA 2XLAA 5BV6A 3RRDA 2VAUA 4KH9A 3AL5A 2FZ2A 5LBCA 3ZN6A 4BPZA 1ND2B 5LY1A 4HK8A 3RZHA 5GZFA 3I4IA 3FC0A 3LEKA 2WFF2 1HJGA 2Q5TA 5JXIA 2VY0A 3M70A 1RL3A 5F3CA 3THCA 4ARYA 1AVBA 4XF3A 1QIQA 3CNAA 3OB8A 4XJAA 2J1AA 2YC4A 1AR63 3BVCA 5KHKA 2RJLA 4Z2AA 4H2AA 1AXZA 2PFWA 2R0HA 1CAWB 1ZA4A 2EIEA 3R4UA 2R041 5FIXA 5I0RA 3TRSB 1YI9A 1D4VB 1H9WA 1OQDA 3WP5A 4TLFA 1SCSA 4NRPA 2PN5A 2BGOA 2O1QA 1OPOA 3N3HA 3PTYA 4MADA 1Q8VA 1W8HA 3HOBA 3GZTB 3KCCA 3VBHC 2E9QA 1O3SA 2FMDA 5FZLA 2XL9A 1AX2A 4FFIA 3LB9A 1X9PA 2IC1A 2A6XA 2VOWA 2O8OA 3H0OA 3ZXAC 2WT1A 4PHZA 4QX2A 1D4M2 3WDVA 4AQSA 3OY8A 3AYDA 1V0AA 5CKQA 1ZZ8A 3J8F2 4CDXA 1UZWA 5FOBB 3BI3A 3SH5A 1BEV2 3BU7A 1YO8A 2KR2A 2V4AA 4EWAA 1SACA 1XE8A 4UF0A 2C24A 2DFCA 3IZOA 1W9TA 5FZHA 4GJYA 4Q2FA 1WW4A 2BW8A 5A3PA 5D1IA 1QWRA 3SH4A 3U37A 3BTZA 2XPJA 4N53A 3PJQA 1DYKA 2XUEA 4QD2A 3ITQA 1MS8A 4TXWA 1NQDA 2MEV3 4CP9A 3ZPOA 2DUQA 4YSFA 4L0PA 2YPDA 3HWJA 5HV0A 4RYDA 2VCAA 4XBQA 3JU9A 3C7GA 3ORJA 5HBAA 3J7NA 4LQRA 4LXLA 5LRRA 4SBVA 3KVAA 1JUHA 4QHBA 5LBBA 1V6JA 2Y38A 3WSOA 1QHDA 4FQ4A 3WG2A 4AVCA 3KQRA 2JX9A 4DQAA 3Q8AA 4LO4B 4JGZB 4YW3A 4DXTA 1BEV1 1RUD3 2UYBA 5T3NA 4HMZA 5I91A 1DQ1A 2AGSA 3BB6A 5KHIA 2D6LX 1O5LA 2ARXA 1JZ7A 1YFWA 2WINB 4COVA 1GNYA 2IVJA 4FVVA 1RUH3 3OY8B 2D6OX 4G3YC 1R091 4XMIA 5FXWA 3WINE 3E6CC 3N9MA 4GWJA 4AFAA 1HN1A 3CLPA 3LSEA 1W6OB 2J1TA 2GZWA 4QPIB 3D8CA 4D69A 4ONUA 1YFYA 5C70A 4AI9A 4MGYE 4RQPA 1ENXA 1AL21 1VAVA 1W9SA 2XL7A 2HWB1 1KFUL 2X5IC 3O1MA 4RGAA 5KXEA 4YWAA 1W6MB 2D40A 5EV7A 4FTEA 4FAGA 1B35C 1ZZ7A 2VZRA 1XXNA 2Y34A 4MG2A 1W2UA 1W06A 3HT1A 2Q8DA 2VZQA 4GALA 2RS12 1E5SA 2PHRA 4QAWA 2EA7A 1LENA 2VZTA 2NZ9A 4I02A 4Y24A 1QQP1 5FMDA 4QT6A 1RYYA 4E4SA 4JKKA 2CV6A 1HV1A 2YDEA 1FX5A 3L2YA 2WZPP 3OPZA 1W3XA 4LPLA 5DAXA 3B9IA 1GV9A 4IERA 5A3MA 4E2QA 1Y7BA 4S2GA 4JGZA 2VO5A 1AR91 4QX1A 4XUTA 4MGZE 3ZMNA 4CCLA 1DP0A 1VBA2 1V9U1 3MHZA 2WLQA 2XJQA 4NHLA 2QQPA 1AYM1 1R64A 1R082 1UF2C 2C9KA 2R30A 1S55A 3FBYA 3JB8A 2G4IA 4MO3M 1LOBA 4EE2A 4QWNA 4D7YA 4Y20A 1AR61 1NYWA 5ACA1 1UX6A 4LHLA 1VB2A 1DZQA 4GWMA 1N1YA 1H8TA 3B69A 1RUI3 3NMBA 3DF0A 1D0HA 2DCZA 2QCSB 3BPZA 1FOD1 3PUQA 4QX7A 4LBQD 3ZYGA 3ILNA 4CP0A 1J1TA 3AP5A 3K4AA 2JB8A 5LA9A 3ZFFB 4CDUA 1SZBA 5D8AA 3SQOA 2UURA 1AYN3 1HRI2 1QOTA 3LWCA 1W8OA 2PHTA 2OPKA 2VVEA 5JOZA 1S0IA 3M3EA 4JGZC 4XYXA 1S0DA 2VOVA 3R4SA 4QDSA 1G9AA 1QOSA 5T5JA 3BKZA 4RA0A 5FK8A 3ZSKA 1JZ5A 1OF4A 3O7OA 3TN92 1DLLA 1PGW1 2GALA 5CEHA 4KMQA 3GZEA 2VMDA 1PO23 3WW4A 3NJVA 3D3AA 4P9GA 2E31A 3MF6A 5DQ0A 4QKBA 2W0XA 2YG0A 3WF0A 4XFCA 3CF6E 4OFGA 3ZDVA 2BOJA 2XDVA 1WCSA 2YBPA 4I09A 5DAVA 5B4NA 1PO13 2GP5A 3K2OA 2PHLA 2ZEZA 1VBC3 4K1YA 4CEWC 2R072 4LE3A 1DFQA 2JIJA 2CAVA 4JGYB 2OKXA 5JCTA 5JR2A 1OOPA 4KWJA 4B7KA 5KBFA 4BH9A 1CAWA 1KS5A 2ET7A 4JQTA 3TEXA 3H8XA 3LAGA 4TN7A 3LIHA 3LOBA 2WO2A 3TN91 5A6XA 1CONA 1DGRA 2JD4A 3AMNA 4U36A 4SLIA 4YGBA 1QDOA 1C1FA 2WA3A 1QH7A 3QBQA 1RJ8A 1Y4WA 5GALA 5T5PA 3AYAA 3RSJA 2WS93 2ADDA 2CGOA 2C1FA 2VULA 3VBFA 5FPXA 4OUMA 4XAEA 3S0MA 2VW0A 3HNBM 5C3RA 4J1WA 4Q4Y1 1U5ZA 1JZ3A 3T2TA 1HJFA 5EYYA 4EWDA 3OD4A 3GZUC 2H6BA 3SITA 5L9VA 3MW4A 3UKTA 4KL1A 2ZHNA 2HWB3 1A78A 1AX1A 3C2UA 4LKSA 3ACLA 4Y5TA 3WUDA 4XZPA 2NM1A 5FZCA 1UZ0A 4YZ2A 1IG0A 2D5HA 5FP4A 5CBLA 2Q8CA 4B4QA 5BNPB 4H7LA 5FP7A 4LBKA 1RUH1 3ATGA 4CP1A 1AYM2 4E4ZA 4HXCA 4YW4A 5FV3A 4HN1A 1X82A 5FDBA 1NCRA 1W8ZA 1CQ9A 2JE8A 2RDQA 5E8AA 5A80A 2J42A 1AR92 1O6UA 3NKTA 5GLUA 2W87A 3WEZA 4JKMA 1PZ7A 3TEZA 5JMCA 2VVDA 4OLLA 2BVBA 2TNFA 1EAH2 2WBKA 1F35A 1V9U2 2C26A 2ZAHA 4WM8A 5FKBA 3FHIB 4AG4A 2WNEA 2RHPA 5CU1A 2PAMA 4A2UA 1K5MA 3JUUA 3ES4A 4IEVA 2HEVF 5EYXA 4AVAA 3ZYFA 1A3KA 1VBA3 4XQDA 2WL1A 5K4LA 4XFHA 4I2OA 4MX3A 1UOBA 4Q1PA 5C3PA 3GXUA 1PIV2 1ZZ9A 2DVGA 1Q8SA 4Y1VA 5J7MA 3RMXA 1CAVB 3LEGA 1NCRB 1DGWX 5CVRA 1APNA 3H42B 4E2GA 5CADA 1NAEA 5FKCA 1OLRA 1KDMA 1LOFC 4LE4A 1JHJA 4GMP3 3DYMA 2G9ZA 5IAXA 4JRLA 2ZJCA 1LGBA 3RS6A 1I1EA 4D7TA 4P9IA 3TYJA 1GZCA 1JYXA 1KXGA 1ZRCA 3H1YA 5DUVA 3PUAA 2AREA 3LSDA 4GA9A 1AXYA 4P02B 4WV8A 1MS5A 1LCLA 1WA4A 1C1LA 1FV2A 2RS52 1HB3A 3NV3A 4IV3C 4BXFA 1TME1 4Y1ZA 2YU2A 4XIOA 1ASJ2 1F9KA 1W9YA 5CIRA 1QJX2 4A45A 5FPBA 2VTXA 2PHDA 3AMMA 1HW5A 4HKWA 4CUCA 3E5QA 2LS6A 1JBCA 1WCKA 1FMD2 3WW2A 3D4KA 4IEWA 3KF3A 4OI1A 5FY5A 1SHWB 4JVAA 1NG0A 2WZR2 3O0XA 2KA3A 3ZXKA 1COV3 4O65A 4YM3A 5I8YA 3ST7A 1CJDA 3GZAA 4QKDA 1GZWB 1POV1 2P17A 3B02A 2QZ2A 1RHI2 5FP3A 1O8SA 2QE3A 4Q0SA 2K0GA 4K3UA 2BBVA 4CDWB 3I2HA 4ISRA 5HCHA 2I07B 3DKQA 1NZCA 1SEFA 3IWZA 5CG8A 1LKNA 2YHJA 4XF0A 4M00A 1ZBA3 1B35B 2PXJA 2A6WA 4IEUA 4XBNA 3IT8A 1C8M3 1GANA 1W0PA 4UFIA 1C28A 3ZIXA 4XMAA 2OA2A 4MGKE 1XNDA 1PX3A 5AVPA 4Q4X3 5IAVA 4EZ4A 4NAOA 3U0ZA 1UZVA 4KWLA 2R062 5IVEA 4XABA 1WBFA 2GAUA 3VZLA 2V09A 3U11A 2QQOA 2WS92 4QHOA 3RZZA 5EQUA 1OLME 4IW3A 4A7YA 2GU9A 4QQOA 4Q4W2 5BNNB 3W21A 3MDPA 4KBBA 3WDXA 2J1UA 1UMIA 2XJPA 2ZHKA 3U1XA 3ZO0B 4UAPA 3WDUA 3WV6A 4LR4A 4NIDA 3JQWA 4RHV2 1PZ8A 1YIFA 1WLTA 2XJTA 5FMOL 4WVWA 5J37A 1RB8G 2UY8A 3NNMA 1ENQA 4FOWA 2D7FA 2R16A 3LD8A 2RJ2A 1UIKA 3IPVB 4CU8A 3FHAA 4MXWA 5K0UB 1JODA 3OGGA 5TSWA 4YGDA 2PTMA 2W95A 1DQ4A 4FOVA 2OS2A 4AEMA 1KRIA 3POJA 4FOYA 2WQZC 1Z7S3 1RUG1 4MXVA 1AR82 1V6NA 1Y43B 3PVNA 4H3WA 3SHRA 2JG9A 4QM9A 2ATFA 1GNHA 4ZU5A 4ZS2A 1M06G 2KXLA 1DGRN 4A7KA 4RS5C 3VD9A 2Y8KA 3AL6A 3OGRA 2LUWA 2EVXA 3AXDA 4UFMA 3VDDC 3O1TA 5FZ6A 4MVTA 2ZGNA 5EWSA 1PGL1 2WYFA 5JZGB 3ACIA 5LK7B 4LHKA 2VQTA 2OZ6A 2RS51 2XQRA 3W5MA 1J1LA 4XEZA 3MI8A 2E32A 1C5HA 4INDA 5A7OA 5AVAA 1Q8OA 3EMRA 4N43A 3HMYA 4ES8A 1YIPA 4FP2A 3ZR5A 4AFMA 3WNLA 4BXSV 2WR9A 5DZEA 4CU9A 1XB9A 1PGW2 2CTVA 2X5IA 3PVOA 4B3NA 4R9AA 4M0NA 4FPJA 4IE7A 1ZA7A 3JBG1 4NVPA 4B29A 3WG3A 2ES3A 3FFZA 2ARAA 1LRHA 4GH4A 4DO0A 1YNAA 1VAKA 2WFF3 1VE0A 2H6CA 5FY7A 3UYJA 2IWGB 1MACA 4RR3C 2QQKA 3HIFA 5JZGA 2DBNA 1RVF1 4NIGA 1RXFA 1LB2A 1RUF1 1TEIA 2J1SA 4FXKB 4Q27A 2EXKA 5FYVA 3BTXA 4CXYA 4P14A 2VMEA 5DAQA 1H1AA 1YQ2A 2NMNA 2VUAA 2HYXA 2VC9A 4PDWB 5EJZB 3R6SA 5L19A 1QU0A 4I01A 1UCXA 2RMU1 2W47A 1UL9A 1LGCA 3BGAA 3FN9A 1CZTA 4N90A 4JCKA 5FQ0A 3AJYA 3B7MA 2FCTA 5J48A 4EN8B 3CU7A 1NY72 1KEXA 4LKEA 3VD5A 3J7LA 4GH4B 3GNEA 4H55A 4PIZA 4CYDA 1SDDB 2JDUA 1RGSA 5E88A 3MIEA 1D0GA 5IUQA 4B4PA 3WQ7A 4JQRA 4XZUG 5L73A 4XURA 4C1WA 2OYZA 5JPNB 4D6SA 1PNGA 2XBO1 3ABZA 2ZS6B 4CP2A 3AP7A 4RR3A 4TYSA 2QQVA 1IOAA 5CA6A 5IT6A 1RUNA 1CX4A 2WWSA 3QOPA 1UIJA 1UN1A 3CBNA 4FOQA 4ZXKA 4QHZA 3UETA 1RUF3 4ZU4A 2W1WA 2A3XA 2B7YA 1C8M2 1XU1A 3PURA 1EUTA 2E7QA 3KF5A 2VR4A 1G8WA 4TWTA 1LESA 1PVC3 4IEZA 4XOGA 1HN0A 4ISQA 4Z1VA 2VZUA 2WFF1 3MICA 3WDYA 1I3HA 4NOTA 1BXHA 1CAXA 1XC6A 3RWKX 4OHYA 1UX7A 4CEYC 3HN3A 3E6BA 3B9CA 3J4UH 2Y6LA 5LEJA 4ZZ5A 5M0TA 1W6QB 3K3OA 1VP6A 5DUWA 4CDQC 3N4MA 4LIVA 3AJZA 3Q9OA 5LATA 3TOJA 4YG3A 1FT9A 2RG4A 2EIDA 4P5YA 2R0FA 3HN1A 4QPWA 3ZXFA 4LO8A 4QGNA 2QDNA 1RUC1 4WVMB 4L92A 4Y1XA 2VCBA 4QGMA 1UMZA 3R4DB 2FMYA 4ZS3A 3VB9A 3NRUA 4DFSA 4JDOA 3AYEA 5C9AC 2W3JA 3FZ3A 2QNKA 2TBVA 3JXSA 2FZ1A 4BQWA 2BUKA 3BUCA 3C7EA 2DTYA 2ZAAA 2UYAA 3GGLA 4LBMA 3S7IA 1W8UA 4RR3B 1G7YA 1IG3A 5JSOA 5IK5A 2CHHA 4DRRA 1PX4A 1YLLA 4LUMA 5I0UA 2ZMLA 4B7EA 4YGEA 1J59A 3V0AB 1EYBA 2QTWB 1Y3TA 3I2GA 1W6PB 4MGIE 4MSVA 4ORFA 3BIWE 5FOJB 5FTTC 1H2LA 1F4HA 1D2SA 3AZZA 4I3GA 4P9JA 5A6QA 4QGLA 2DVFA 2R043 4Y4RA 1OFSA 1RINA 1ENSA 2WWJA 5HPOA 3K3NA 4YVSC 1DHKB 4CXXA 4QXKA 5FLIA 3WY6A 2XWBB 3BTAA 3CHXA 1YI7A 2XG3A 3O5SA 1GU3A 3T08A 4URAA 3F95A 1W8NA 3VHOA 3IB3A 4IE0A 1MZFA 1J83A 4WZCA 1OURA 5FBZA 5FZGA 3ZFGC 2BVVA 1RUE1 2QZ3A 1HRI1 2B5HA 5AC91 1XJAA 1QJX1 3IIAA 1UXXX 3MPPG 3PIGA 1Q8QA 4DB5A 5JXJA 2HWD1 5FZ9A 3T1MA 4B4RA 1UY2A 2BRTA 3ZFFA 4DMIA 3DKWA 3P1IA 4BQYA 4EN0A 5I0DA 3FMGA 2DURA 5CNAA 1LEMA 3MEPA 4HPKB 4C1XA 5JSRA 5A1FA 4Q0QA 3LDRA 2ZGMA 5G05L 5BNOB 5KHGA 1HQWA 3C7HA 2I2SA 3V0BA 3MW2A 3WLUA 3KZ4C 3WG1A 1AYN1 4QU2A 1DCSA 4JV4A 5DDJ2 1W6PA 3OGJA 4YVSA 4HVOA 3VBOA 1BQPA 2GC0A 3IAPA 4Q4V3 2Y6GA 4XW3A 1OFNA 1XSRA 2JKBA 3WF2A 4OI0A 3S57A 3I2KA 1XYNA 4Q0UA 4OI4A 2RS32 1QY4A 4L2NA 2XBO2 3GCXA 1RIRA 5GZDA 1MQTB 1LHOA 1NY71 3WVJA 1CZSA 2JKXA 4O9GA 2ZOEB 3SH3A 3ZXGA 2JDNA 3VBUC 1W2NA 1WD4A 1J3RA 3W20A 4A41A 3H3LA 3VKMA 5ACA3 5IYYA 1K5MB 2A70A 4LK7A 3VBRC 3GCWA 1BBT2 1COV1 3LGRA 4LULA 4YW7A 3MLJA 4UF0B 4V1PA 3IAQA 2LROA 5KC5A 1LGNA 1WKYA 2RDRA 3TB0A 3UGFA 4XFIA 5A7WA 2DBIA 1MVEA 2QDRA 2B45X 4IXLA 1W8FA 2WNVB 3AB0A 3HBKA 4W4ZA 2G9FA 2ZZJA 4JDNA 1QJEA 1IGOA 1D2QA 2LALA 2W1UA 5DDJ1 3ZOIA 1PHMA 4FPFA 3WP4A 1W9WA 4FI9A 1BMV2 2A73B 1R1A1 5F39A 1GICA 5IVJA 2GC3A 1R081 3I97A 5C33A 1RUD1 3DXUA 1H6YA 3N9QA 1J3QA 3KCXA 2R32A 4LLOA 5KXBA 4FPYA 2IZWA 1AHSA 1S0BA 1FMD1 2W1SA 1DF0A 1YCIA 2BERA 1SBFA 2B4KA 3VBSA 5FREA 4CUAA 1MPXA 1VMJA 3CJIA 1OOPC 4GJZA 1AL23 2MEV1 4IV1B 4QX5A 2ZGLA 4META 4LO7A 1OUXA 1RUJ2 1NCQB 2Y6JA 4WVVA 4N8MA 2HBUA 2X8KA 5F3EA 5FLJA 5C4WA 4C90A 2WNUB 3AVRA 5T55A 4D0QA 4C91A 2VNGA 1VMFA 1DDLA 4DUWA 5IWFA 3E97A 4XDQA 3FJSA 5CISA 2G9GA 1R1ZA 3D82A 4RFT0 3C7FA 2HYKA 2ZEXA 2X05A 3CKHA 2VTXJ 3LF7A 1BEV3 1XE7A 3AKQA 2W9XA 2LW8A 5LCWL 4W65A 4Q5OA 5KWRA 2HWB2 4E4HA 2GNBA 1JN2P 3WQBA 4IEOA 4AEJA 4AW7A 5FO8B 1W03A 5EPAA 5D2AA 1SLBA 1VR3A 2ET1A 4QPGB 2ETEA 5I8TA 4RSUA 4YRDA 3POFA 1XNKA 2GMPA 4IV1C 4R52A 5CFCA 4XILA 1QF3A 1SPPA 3ROUA 2RJKA 1FPN1 1NCQA 4DPNA 3POSA 2MEV2 2RS11 3ALQA 4NROA 4YNIA 2EAAA 2PHWA 3MIGA 3ZLIA 3V0BB 1HQLA 3DYPA 3EYPA 3WQ0A 2W94A 3T0AA 2HWD2 2BTVC 1BHGA 1OHFA 3L9JT 2XVKA 4LBQB 1UQXA 1GSLA 1S0EA 2HJIA 2JG8B 5ABJB 3VBOB 4EN6B 4PDWC 2Y0OA 4NPRA 3AFKA 1H1MA 1WD3A 4RHV1 1PGSA 3NNFA 1JYWA 4LOSA 1HRV1 4XHXA 4AI3A 2PELA 4KBZA 1YXWA 1NXMA 2J1EA 1H2NA 1WLDA 3RZKA 3LFIA 2HLEA 4PLOA 4WM8C 3N7KA 1ND2C 3K75B 3KLSA 5FYYA 3RNSA 5B2GB 2ZGUA 1EPZA 5FZEA 1AL0G 3OEBA 5IATA 4PBOA 4AYUA 2VW1A 4A4AA 2Y0IA 2AH2A 1U5YA 2FD8A 4ZKTB 1S0JA 1H0BA 3B94A 2J7MA 2VCMA 4CTEA 4JKLA 4NHYA 2Y60A 2MHFA 3SEPA 5H9PA 1MZEA 4FCAA 1SPPB 3NVCA 3OBZA 4QPIC 4FP3A 3VDDA 1A8DA 4CCNA 1LHUA 1PGL2 5BNPC 2WJSA 5FMOS 1XQNA 3LEMA 5A7SA 2DU0A 4URTA 5FXZA 5JUVA 2FDKA 3T4HB 3E6DA 4PLNA 3I2JA 4XETA 3X29B 2RM22 4CDWA 1QJX3 3C7OA 2CWSA 5AC93 4OYUA 4UT5A 1SLCA 4A6SA 4BA6A 4AHWA 4COWA 1A6CA 1F2NA 3PU3A 3I7DA 4UWDA 4BYYA 1BMV1 2YU1A 2FDHA 1YRZA 3WF3A 3PUSA 4K20A 2XB6C 4W6XA 3NJZA 4YM2A 2VW2A 5F5QA 2BV4A 1V6OA 1V6IA 3MV01 5IK7A 3T2PA 5C3SA 3WNPA 4YW1A 5CFDA 5BNOA 3NSTA 1F31A 4R9CA 4UW5A 3KT4A 4Y26A 4CEWB 3GBGA 2QVSB 4CEYB 1VBB2 2VECA 3T30A 2JENA 2UY9A 3NW4A 2BU9A 2XLFA 1VBD1 4HLTA 5JAXA 1ZRDA 1VMHA 2H0BA 2ZGRA 4EYUA 3KV6A 4NHMA 2DVBA 4QDQA 4CCCA 2ZGPA 4FXGB 5F3GA 2PHUA 3AZYA 4BDVB 1HRI3 3RG0A 4AF9A 1UZZA 4RQPC 1FATA 1AL22 3VGIA 2WT0A 5FZMA 1GMMA 3T2OA 4CUBA 3LQCA 5C8CA 2E26A 1PM4A 1TNRA 4BIOA 4NMIA 3NKGA 1ZBE2 2ZGSA 4W6WA 1YJLA 2GC1A 1MVQA 2X09A 4YG0A 3O1SA 1GWKA 2P6CA 3I3BA 4NWVA 4B8EA 2WNVA 3H8RA 5LB6A 4PLMA 1X8EA 1JOBA 4MGQA 1PMJX 2OVUA 1NA1B 4NIAA 5FY8A 4PBPA 3RI9A 3VHPA 2XH6A 1NXD1 2ZX4A 4LORA 2D44A 2K46A 4WM7B 3CEWA 1TZOA 2HWF1 2LRPA 2OXBA 4IUGA 4MGTA 4YYOA 4A7ZA 5FUPA 4CRQA 1CAUA 3JZVA 3POBA 5GM0A 1LAJA 1L7RA 2ZBJA 4FAHA 3HR9A 1C57A 3V65A 2BNNA 2XVLA 4AGGA 1GKBA 1WGPA 3NJYA 4AXOA 1S2EA 3URFA 1EV13 5T50A 4AI0A 1WZXA 2BGCA 3CMGA 4YVWA 3U10A 1ULPA 3OUIA 1LNSA 3MGUA 2P3IA 5FFOC 4KNCA 2IXIA 3A23A 5DXDA 3DL3A 4JTOA 3SXWA 1HKDA 5AFEA 4J1XA 5BY5A 2OT7A 2YUEA 3NAPC 3K4DA 3E5XA 4W8JA 2W91A 2UWCA 4QM8A 4X6QB 5JLVA 3WT3A 5A32A 2AR6A 3CJIB 3SCFA 1QNWA 5A7PA 5C9AA 2VBBA 4NO4A 1OD3A 1PVXA 3ZPYA 2CAUA 1RMU1 2GNTA 2DVDA 4NJ4A 4NIHA 4JAAA 4CCJA 2Z69A 1LEDA 4XAAA 2E33A 2XONA 5FY4A 2RMU3 1T2XA 5FYCA 4E27A 1QXRA 2ZTNA 3ZFEC 1MQTA 5A6YA 1VRH3 1UWWA 5LWBA 5LRSA 1TVGA 2V4VA 5J36A 4D7SA 3JCIA 4YW2A 1WMEA 2NP0A 1LOCA 2QKDA 3JB4C 2VG9A 3IDAA 1US3A 4LBLA 2RDNA 1UY3A 1XNBA 3UJOA 5DUUA 4FPEA 2VMCA 4FPGA 2QQJA 4QPGA 5GZEA 5HXVA 3OG2A 3VLBB 4M4PA 1ASJ1 2VNRA 1SLTA 5F5AA 1S0FA 4WZFA 5JOWA 4XF4A 1ODNA 1DQ6A 3NV4A 1VBB1 2W5FA 5C5UA 2R7EB 1BK1A 1Q43A 5AC92 1W6NA 1I5ZA 3T0DA 2N7GA 1UYZA 4LTAA 2XHNA 5CB7A 3LE0A 4ATEA 3ZFFC 1ULCA 5FY1A 4OHWA 1VALA 2BDRA 2ZX3A 3IDCB 4Q29A 3ZYHA 4DUVA 1OA4A 4H14A 1GFF2 3FLRA 1MQTC 2LM3A 2CU5A 5FYHA 4R4XA 4P08A 1CN1A 1SBEA 4XFGA 1IS5A 3MZHA 3UNPA 3M1HA 3THTA 4ZPIA 1UY0A 4DUXA 2AEYA 2VU9A 1WW6A 3EO6A 4HZFA 1PK6B 3PNAA 5FJKA 3ZSEA 3H50A 1UXZA 4CDQA 2HWC2 3A22A 5HXMA 1YC61 3VBOC 2VTFA 4KWUA 4CPBD 2K9ZA 2WN2A 1BLZA 4QPGC 5LBEA 1JH5A 3ZDSA 1ST8A 3ACFA 2C9AA 1PK6C 1W8WA 5FZOB 1W6QA 1YFUA 5DABA 1CR7A 1UO9A 2BPA2 4JDMA 3PVBB 3CO2A 3INAA 1DU3D 5IVFA 3FLTA 1RUF2 4WVMA 4XIKA 1V6KA 2R061 2VMHA 3OGSA 4FO9A 3VBUA 1H4GA 5JI7A 5C4WB 3MIHA 2RS53 1R092 2ID4A 2XKOA 1G9CA 2VQAA 2ZA9A 5FP8A 1WCUA 3I3EA 2ZGKA 5B4XA 2IFRA 4PQ9A 2E53A 2JDYA 3U14A 4Y1YA 3QH6A 5IK4A 4QB2A 2WABA 2GN3A 5KHHA 3THPA 4BHPA 2RR12 1KD7A 3DECA 4MHRA 1AJOA 1AXKA 5L9RA 1POV0 5BPXA 3W59A 5F5CA 1GQPA 2MNGA 1UOJA 1R1A2 1OKQA 1QEXA 4Q8LA 4FTBA 1NLRA 2IUWA 2A7AA 4R4ZA 2DYCA 2DF7A 2XXZA 3BU0A 4FFHA 4N7UA 3G6JB 3LA3A 3OPWA 3D0SA 2R1DA 2TUNA 4GQ7A 3TAYA 1OA3A 3WX5A 1MEC1 5KC6A 2ZHLA 3UV9A 2WN3A 2VJXA 3I3MA 1YHFA 1FPN2 5L9BA 5E89A 3ZYBA 3KGLA 4FT8A 4IE6A 4OCTA 4QB6A 1ULFA 1IKPA 5D8AC 1N3PA 4O9EA 4AGVA 4MUVA 1F4AA 4HVQA 4I0AA 3OYWA 4RS5B 3ZXLA 1UYPA 4PF1A 5A70A 2P5BA 2R063 4OMCA 3TEYA 4N43B 4LHNA 3VD7A 1SFYA 2JICA 3IM0A 4EZHA 4NN0A 4Z07A 1BZWA 4DXRA 1RTVA 3AM2A 4COZA 2X5IB 3A21A 2A75A 3POEA 3N35A 3IKWA 1WW5A 2RS31 4PI0A 4RL7A 4NIIA 1RXGA 5CG9A 3GM8A 1RITA 4XTMA 4Y4YA 1H9PA 5E1RA 4DIQA 1GQHA 1H6XA 1HXS3 1E5RA 4IV3A 4F8AA 2TEPA 4M4RA 5IW0A 1MZ5A 5EZWA 3UJQA 4IE4A 1BYHA 2DCTA 1QJU1 3CZJA 1CPNA 5F37A 5FWJA 4FQZA 3QH7A 1H8VA 1W28A 1W0NA 2WIIB 2CDPA 1IS6A 5JOYA 1QNYA 2GMMA 3AXEA 3QD6A 2A6ZA 1FAYA 5FK7A 4Q4W1 1Y9QA 4Q1RA 4MGSA 5DZGA 3V64A 4BJ0A 5H9QA 1W9FA 1VPHA 2QQIA 4P9YA 1RUC3 3T2QA 3SISA 3WZ1A 1HDKA 3ZYJB 3RVHA 3H1WA 4MHUA 3ECQA 4A44A 1AR83 2OUJA 3NNLA 1NCRC 3PDQA 5JR7B 4CCKA 5F8PA 4Z92B 4XCBA 5FYSA 3CJXA 5FAXA 2EICA 1XE0A 5FY0A 4XPVA 3TNPB 5T5OA 1QMJA 4FBFA 4DXSA
chains in the Genus database with same CATH topology
2E7AA 3MPBA 5A3LA 3VBFC 2ZGTA 3SLIA 4JRAA 1I9RA 2ZHMA 4DRVA 4Y22A 2SBAA 4CDXB 1BBT3 1BJQA 4DINB 3FUOA 2PHFA 4AFCA 1ULDA 5FLHA 3ZFGB 4AEDC 3NAPB 2CGPA 2EF6A 4XFAA 5L7OC 1AF9A 1CAXB 3BOPA 1VBE3 1FNYA 3H7JA 1IKQA 4N53B 3ZN4A 4CZSA 4S2HA 1OA2A 4UBGA 1G86A 1WBLA 3KSCA 3M7AA 4ITCA 1WMDA 4TSVA 1CAUB 2D5FA 3HBZA 2Z42A 4DZGA 1AR72 2A71A 3AMPA 3WD5A 1ZBE1 2EXHA 2NN8A 5BNQA 2RR13 2XGXA 3AZVA 3V56A 1ZVFA 2ILMA 1ZNPA 4FPOB 5T5LA 3ZSJA 1ND3A 5CFDC 1YUDA 1RUJ3 4L9BA 1OMIA 3JBG3 3CJIC 3TN93 1AZDA 1JHNA 4KWKA 2XJRA 2PQQA 2QUOA 1HXS1 4YARA 1EAH1 5C4WC 1RUH2 1VB4A 3BOWA 3AFGA 4XJ8A 1Z0HA 3ZFEB 2ZABA 4PCRA 1V70A 4BLJA 1EP0A 3ZYPA 4J6GA 4K21A 1PVC2 5CAZA 1IS3A 1OLQA 2DTWA 1LOGA 3MYXA 5F6LB 1W6MA 2NMOA 5GLWA 4I3PA 5IK8A 1FYUA 2YC0A 1NLSA 2WNVC 3KMHA 2R071 3PVEA 4WM8B 2ZGQA 3ZIWA 1SBDA 2VQ0A 3FX3A 4P5HA 1D4M1 2HEYF 3I59A 4Y22B 5KHJA 1QOOA 3J8F1 3USUB 3ME2A 1O3RA 1O7FA 3VHNA 3ZSLA 4L11A 1DQ2A 2UWBA 4D3WA 2JG8C 4YM1A 3VKNA 2HKXA 4HBNA 4KGGA 5K7PA 1RUC2 4AWDA 3FWEA 4K6BA 4XF1A 3ETQA 3MIDA 1GLHA 3VBHA 4YZ3A 1RUI1 3AP4A 4Q4Y2 4BCUA 1RJ7A 3BALA 5J09A 1ND2A 2Z5WA 5KXCA 3AMQA 4NHKA 2CWMA 3TBDA 1AYM3 5JOXA 3JD73 1G9BA 1QJZA 1G6NA 2P3JA 3M3IA 4HL0A 2EXIA 2JXAA 2X53S 1N47A 1SLLA 3KM5A 3LOIA 1RMU2 3BCWA 4BMBA 1AR93 4AQ6A 1NOVA 2R49A 1X33A 5J96B 2XHKA 4XJ9A 5BNPA 4FSJA 2VPVA 1SQ4A 3OF1A 3WXPA 1RHI1 4CEYA 3SCHA 1DGWA 4I0BA 1ZZCA 2QFEA 4Z82A 3AMHA 4GWNA 2RR11 1CGPA 2HWE2 1WMFA 3H9AA 3P3PA 4QPYA 2VUJA 3KCYA 1URXA 4GB31 3MIFA 2OW4A 4JGYA 1H8TC 3PMSA 4AVVA 3IN9A 1C5IA 1MS3A 3K48A 1MR5A 2WNUC 4K1ZA 4K40A 1UPSA 1VBB3 4XQWA 1PO12 4RGGA 3JQXA 1VBC2 1VBA1 4N9HA 2EIGA 4AEKA 4DY5A 2E51A 2OUHA 3ZYRA 1QQP3 2PHXA 1BKZA 2ZX0A 2DCKA 4LNVA 5ACA2 1ZYBA 2D3PA 3PHMA 4A3XA 1FOD2 1QGLA 1UW8A 1VRH1 2VOKA 2GC2A 1NQJA 3VL9A 2BWCA 4ATFA 2GMEA 1PK6A 4CDQB 3NAPA 4WBBA 5D8AB 3KD4A 1OI6A 2JE9A 2FBEA 1B09A 1VBD2 1RUG2 1KQRA 1MS4A 4I30A 4KGQA 1HQNA 1ONAA 2GH2A 4G4FA 4XHBA 5ABJC 2Q0AA 4HKLA 5JVVA 3W9AA 4KU7A 2Q4SA 3AZXA 1ZBA2 2DVAA 3LZZA 1TMF2 4XJUA 1YJKA 1QJY2 1S2KA 4XXPA 1V00A 3DUIA 1TNFA 1LHWA 3N7JA 4N9IA 1FXZA 4Q4X2 4BE3A 1HRV2 3E5UA 4YLZA 1U5XA 4KQ7A 3QACA 4BM8A 1KDKA 4AVBA 5EJ3A 2JG9C 3IMNA 2RE9A 3VN4A 3GBFA 4YZ1A 2PLV3 2ZACA 1EY2A 4CDXC 1OOPB 2RMU2 1DG6A 5GLZA 4HK9A 4HVRA 3H8UA 1N1VA 4Q4Y3 4C0HA 2ZCWA 4P9WA 1T6GC 4YVSB 5I93A 5GLVA 4DY3A 4N43C 2NPIA 4N53C 4UW6A 4W6YA 2PA7A 3WDWA 3ASIA 5DG2A 3WW1A 3B3QE 3ZN5A 3WUCA 3RYKA 3A0KA 3HQXA 4YW5A 3C3VA 1K5MC 4AQTA 2DUPA 5E16A 1O3QA 1VBC1 5FO9B 3POWA 4Y1UA 2VGDA 3WCRA 2GSYA 5JIUA 4CDUC 4QQHA 3L2HA 2PYTA 2IXKA 2HWE3 1GR3A 4JTNA 3VV1A 1H4HA 4RQPB 5JSPA 3EHKA 3VBSC 1M4WA 1OQ1A 3USUA 4I0WB 4IEYA 5GLTA 3TNQA 1MS9A 1LTEA 4KU8A 4UXAA 2BWAA 4DNYA 3EQEA 4EJRA 3AP6A 3MIBA 3I8TA 5H9SA 1SDWA 2KM2A 3ZSMA 3WOGA 1WCDJ 3AKSA 3VHRA 3J8F3 3ZVXA 5DUXA 4N7IA 5HI0A 4YZ4A 5FO7B 3RJRA 1WLCA 3WHTA 3OCPA 4LA3A 1LHNA 2DUOA 1S2BA 4AK3A 2RM23 1H2MA 2ZGOA 3AX4A 1FOD3 1NCQC 3NV2A 2Z79A 4FPHA 4Y5Z0 4IEQA 4DXZA 4AI1A 1I6XA 3FBMA 4XE9A 5CFCB 3VZJA 4M3CA 4NWWA 2PAEA 2ZKLA 1JYCA 2WT2A 2B8MA 2V5YA 2OIIA 1X7NA 2WSUA 4RHV3 3KT7A 2XJUA 3MLLA 4BOWA 4CDUB 3OJBA 1DZRA 4PIYA 5I8SA 1O4YA 1CESA 5CFDB 1BCXA 5F1RA 2PLV1 1QJU2 1FPN3 2GDFA 1SCRA 5BUVA 1BVVA 4R9DA 3FUQA 3DPRA 4AHXA 3IDBB 1QJY3 4IQPA 1WLWA 4H7MA 4AHYA 1X50A 2GNMA 1Z7S2 2DWRA 3LCPA 4S2DA 4GMP0 4YVWA 1HRV3 3GHMA 2W39A 3D5OA 1H30A 5BNNC 1ZBE3 2WZR1 2WFPA 2IFWA 4OHXA 5C8CB 3VKFC 4Z8BA 1REEA 3IBMA 1HXS2 1V6LA 3KS7A 2IXLA 2BYVE 2RS13 3ES1A 3AKPA 1MEC2 1UU5A 3MW3A 5F9TA 3S30A 1KITA 3RQ0A 1XYOA 3TWIA 1C3HA 1VIWB 3PMEA 3WQ1A 5EFUA 3RI8A 1VLNA 5CFCC 3FE5A 2R6QA 1CAVA 4R8HA 2FHRA 4HETA 4LO5B 1EV12 1R083 3RJ2X 3VBFB 4IEPA 5L7OA 3AYCA 1JUIA 1LHVA 2WLPA 2O0OA 4XTPA 5GZCA 3ZMOA 2HWF3 3APBA 4YVWB 1N1SA 2R042 2RM21 2D97A 2JEMA 2Y26A 4E4DX 2WQ4A 4HN0A 4LUKA 2D6NA 4EN9B 2GNDA 3WNXA 2YPJA 4BQ1A 3VKLA 3QLQA 2VMIA 1HLCA 4D94A 4AFBA 1ZZBA 1QDCA 5FQ0B 2BFUS 4X8PA 1AR81 1ULEA 2DCJA 5LEKA 4GB33 2JE7A 1SFNA 1G9DA 5C9AB 1TQ5A 1QKQA 3M4FA 1Q5OA 3DGTA 3W58A 2K2SA 4BMEA 1G9FA 4AE2A 2AYHA 3VBRA 3WG4A 4AQ2A 3FLPA 4AI2A 1ULGA 3N7MA 1HX6A 4AEDA 4BWOA 4M01A 2Q1MA 4Q4V1 4RD7A 5HCAA 4MV2A 2D6KA 5DDJ3 4MYEA 1ND3B 1C4RA 1GNZA 1NE6A 3G7DA 2RS33 3R0RA 3LA2A 2E7TA 2XWJB 4AVTA 5KXDA 1LU1A 2Z2SB 4S2FA 1AR62 1SMVA 4HSJA 2O8QA 3JD71 1IQAA 2ARBA 2XJSA 3WDTA 1LJ7A 2VH9A 1IPJA 4E2SA 2ERFA 5K8SA 4M3CE 4XFFA 3VKOA 2JJ6A 2BEOA 3RWNA 5JPMB 2YY1A 1GYKA 3JBG2 1H1IA 1O4TA 5JI9A 1ZREA 1J58A 2GH8A 2ZX2A 4LEJA 1D4M3 4YM0A 1Z7S1 2P34A 4LA2A 3WP6A 2DFBA 1HIXA 1UAIA 4YFWA 3RYRA 1UKRA 1AR71 1WW7A 4BIFA 2ZKNA 4GKXA 1JOJA 1UU6A 1XU2A 4CDWC 3ENRA 4IETA 2Q8OA 4LBNA 1LECA 3WW3A 1IZ3A 1DGLA 2BFUL 5EXOA 1LODA 3NO8A 1NA1C 1U5IA 3B00A 3MFAA 5I0SA 1DYPA 1QXPA 3CL1A 1YFXA 4TZDA 2VMGA 4YFZA 4AVSA 1O5UA 4HFSA 2F4PA 2YGMA 4UBHA 2VOXA 5K9YA 3NV1A 3J26N 4QQ2A 3WR0A 3ILRA 3RMYA 2P2KA 4G9SB 3M2MA 1RUJ1 3ZYIB 2WSVA 1C8M1 3LA7A 3ZXEA 3VDDB 1PVC1 1W39A 3P3NA 4P9XA 4K8FA 2B46X 4X8NA 1PIV3 3GF6A 4NR1A 1Q3EA 4AEDB 2HWC1 4Z2WA 1ZM1A 1XRUA 2XVGA 1O3TA 1GZ9A 3VBRB 1MZ6A 2LTNA 2XBO3 3S6PA 4DOUA 1AJKA 1XYPA 2E6VA 3AKRA 1LU2A 1YYNA 4AGRA 2GN7A 2AZ5A 5JZGC 4LBQA 5J98B 3M3QA 1PMIA 2YXSA 4COUA 2YGLA 4Q8KA 3KGZA 4QPIA 4MXWB 5K0UA 1W6OA 1O91A 1ZRRA 5F6KA 4COZA 4OHZA 3ZX7A 2IXHA 3I59B 1U0AA 4QQPA 3UK9A 1O4ZA 1LOAA 3H1MA 3D0JA 5T52A 4UW4A 4XJWA 3USSA 1FMD3 4ES9A 4BLIA 1BVP1 1KJRA 2FQPA 2P37A 1J3PA 3K51A 4M3CB 1E57A 2A3WA 2B9UA 1IPKA 4Q26A 2VXRA 4LBJA 1RHI3 1PNFA 4JGYC 3EBRA 1GBGA 4GXLA 1MS0A 1UD1A 3OD0A 4IEXA 2D6PA 1PIV1 1H2KA 1RUI2 1HV0A 1W0OA 3A4UA 5H9RA 1GQGA 5T54A 1C8NA 5ABJA 1OSGA 1QQP2 1JXNA 5K0UC 2CYFA 4GKYA 1AYN2 2CL2A 1FNZA 4LO6B 3VBSB 3PLQA 2EALA 1IHMA 3ZFEA 4M3CF 4Q0PA 2XKPA 4WVZA 2I74A 1LOEA 4QQLA 4HSLA 1TME2 1S0GA 3WHUA 5FRAA 4GULA 1SLAA 4FPKA 4Q4W3 2B42B 1VBE2 1CVNA 4R9BA 1A8MA 1PO22 1FI2A 3DV8A 4GH4C 3VL8A 4EN7B 3ZFGA 3O0VA 4EV0A 1ZRFA 2IXCA 5I0TA 1RUG3 4YGCA 3SCGA 4ZU7A 3GALA 4CEWA 1RVF2 3HD8B 4AHZA 2W08A 2D6MA 3J9SA 2XUMA 1AR73 4AFDA 1RC6A 2EXJA 4FPCA 5GJ6A 3ZXJA 2A6YA 2R073 4OHVA 1TMF3 1ENRA 2I45A 3BODA 1F5FA 4FTSA 1PO11 1GZWA 3AK0A 4LLFA 2W52A 4XXAA 2BNMA 4OUSA 2HWD3 5C8WA 5A33B 1OD5A 2ENRA 1RUE3 4ASLA 3VBHB 5L7OB 2AENA 2A5ZA 2ZPXA 3EXUA 1PO21 3OTFA 1B35A 1Q56A 3AKTA 4F7ZA 2PLV2 1IS4A 2HEWF 4YG6A 5LK5A 3DPRC 1KFXL 1ZZ6A 3GHNA 1F8VA 5DZFA 4KG0A 3RYPA 3NWKA 3ZN6B 1PM7A 2C0ZA 2JDZA 1ZBA1 4XF9A 4BZ4A 2DU1A 1W6NB 5BNNA 4EWEA 1ZX5A 1CIWA 2EAKA 2VVFA 4MH0E 4OI2A 4KG8A 3URFA 1H8TB 5FPZA 2SLIA 1QXJA 2YMZA 3WP3A 3O12A 4LBOA 3H3ZA 2YV8A 1N3QA 5SV8A 3B93A 3N7LA 1Q8PA 4PJYA 3N36A 1KJLA 3H3UA 4MLOA 1DBNA 1TMF1 3I2DA 3U4XA 1EPWA 3IPVA 1REFA 1LR5A 2XLGA 1POV3 1L3JA 2C5DA 1DZTA 1YWKA 2W68A 1EAH3 1TE1B 4Q4X1 1V9U3 3MF9A 2ZMKA 4L97A 4AI8A 4WM7C 1VAMA 3IDEA 3MLKA 2JG9B 3VZMA 1ND3C 2PAKA 4YZ5A 3VBUB 3EJKA 1CD3G 4Q0VA 5C6CA 1FV3A 1AUYA 2VNOA 2P3KA 1LULA 4F83A 4U2AA 3UKVA 4K7JA 5HCBA 1Z78A 5HCFA 1UKGA 3HT2A 3JD72 3RDIA 3H7YA 1OQEA 4JC1A 3LKJA 2D3SA 1VJ2A 4GMP1 1RMU3 1U12A 4F3JA 4L8QA 2DCYA 2IXJA 3KT1A 3ZXDA 4IV1A 1ASJ3 1VBE1 3QCWA 4WM7A 3U07A 1TME3 2B39A 1DQ0A 3DPRB 1X8MA 5BNOC 4Y20B 2WC2A 1QH6A 2CY6A 3PJYA 4K9SA 3UL2A 1DQ5A 1N3OA 4HT1T 2CNAA 1SLIA 3NL1A 3SNMA 2X29A 3A0NA 2WZR3 5BXXA 2DV9A 5GKAC 1BBT1 1COV2 1LOFA 5A33A 4PDWA 1NE4A 2HWC3 2OZJA 4HANA 5BYNA 2YZ4A 4PIXA 1RVF3 2WKKA 4XQ4A 3B5LB 1QJU3 2CGNA 1QJY1 4IL7A 5L36A 4LT5A 1WUVA 3KB5A 2R1BA 1REDA 3DN7A 4IV3B 3M3OA 2V73A 5C8CC 2YROA 3O14A 4XBLA 3AP9A 3VZNA 5FCCA 1R093 1EV11 1X36A 1JW6A 2MPFA 1RUE2 2Q30A 1AX0A 2D3RA 3MFCA 3M3CA 4PF5A 1XNCA 3HAGA 4L99A 4YVWC 4QMAA 3POYA 5A32B 5J3UA 2BNOA 2UU8A 4OULA 4P9LA 3AZWA 4XJZA 5GZGA 1V6MA 2ZMNA 1MS1A 3O0WA 1CJPA 2BQPA 1R1A3 3T1LA 1MEC3 4HPKA 3I54A 4DS0A 1N1TA 1ALYA 1VBD3 2ZX1A 1VRH2 3FFQA 2AUYA 2NQYA 2D43A 4IESA 4M0HA 4OVEA 1F5JA 2F6BA 4COYA 1RUD2 1OPMA 4HKOA 5JDBA 3ILFA 5DG1A 3S7EA 3SMHA 5SV5A 4UW3A 3ELNA 3RPQA 3R05A 2A3YA 3B01A 5JWPA 1NA1A 4MZUA 4C0BA 2WNUA 1JTZX 1PZ9A 2A6VA 2HWF2 3OYWB 4RS5A 4GIQA 1S1AA 2WS91 2XJVA 3GYDA 4Q4V2 1S0CA 4OZXA 5AFBA 2E63A 2WA4A 3VZKA 2D98A 2Q1ZB 1JYIA 1CPMA 2H0VA 4ASMB 1UZYA 2YYOA 1KS4A 1UPIA 1RUOA 3M8LA 3GBWA 3V0AA 4X6RB 2UWAA 3UKNA 2HWE1 4EROA 2JG8A 4FPLA 3VUOA 4GB32 3VZOA 2NYYA 2D93A 2JECA 3OBTA 2ZZQA 1DIWA 1UU4A 5JIAA 2QJVA 3D6EA 3OBRA 4E9KA 2NLRA 2XLAA 5BV6A 3RRDA 4KH9A 2FZ2A 3ZN6A 4BPZA 1ND2B 4HK8A 5GZFA 3I4IA 3FC0A 2WFF2 2Q5TA 2VY0A 3M70A 1RL3A 1AVBA 4XF3A 3CNAA 4XJAA 1AR63 5KHKA 2RJLA 1AXZA 2PFWA 2R0HA 1CAWB 1ZA4A 3R4UA 2R041 5I0RA 3TRSB 1YI9A 1D4VB 1H9WA 1OQDA 3WP5A 4TLFA 1SCSA 2PN5A 2O1QA 1OPOA 3N3HA 3PTYA 1Q8VA 3GZTB 3KCCA 3VBHC 2E9QA 1O3SA 2FMDA 2XL9A 1AX2A 3LB9A 2IC1A 2A6XA 2VOWA 2O8OA 3H0OA 3ZXAC 2WT1A 1D4M2 3WDVA 4AQSA 3OY8A 3AYDA 4CDXA 1ZZ8A 3J8F2 5FOBB 3SH5A 1BEV2 3BU7A 1YO8A 4EWAA 1SACA 1XE8A 2DFCA 4Q2FA 1WW4A 2BW8A 5D1IA 1QWRA 3SH4A 2XPJA 4N53A 3PJQA 1DYKA 4QD2A 1MS8A 4YSFA 1NQDA 2MEV3 2DUQA 3HWJA 4XBQA 3JU9A 5HBAA 5LRRA 4SBVA 4QHBA 1JUHA 1V6JA 2Y38A 1QHDA 4FQ4A 3WG2A 4AVCA 3KQRA 2JX9A 4DQAA 4LO4B 4JGZB 4YW3A 1BEV1 1RUD3 2UYBA 5T3NA 4HMZA 5I91A 1DQ1A 2AGSA 3BB6A 5KHIA 2D6LX 1O5LA 2ARXA 1YFWA 2WINB 4COVA 4FVVA 1RUH3 3OY8B 2D6OX 4G3YC 1R091 4XMIA 3WINE 3E6CC 4AFAA 3CLPA 3LSEA 1W6OB 2GZWA 4QPIB 3D8CA 4D69A 4ONUA 1YFYA 4MGYE 4RQPA 1ENXA 1AL21 1VAVA 2XL7A 2HWB1 1KFUL 2X5IC 4RGAA 5KXEA 1W6MB 2D40A 5EV7A 4FTEA 4FAGA 1B35C 1ZZ7A 1XXNA 1W2UA 3HT1A 4GALA 2RS12 2PHRA 2EA7A 1LENA 2NZ9A 4I02A 4Y24A 1QQP1 4E4SA 4QT6A 2CV6A 1HV1A 2YDEA 1FX5A 3L2YA 2WZPP 3OPZA 3B9IA 1GV9A 4IERA 5A3MA 4E2QA 1Y7BA 4S2GA 4JGZA 1AR91 4MGZE 3ZMNA 1VBA2 1V9U1 2WLQA 2XJQA 4NHLA 2QQPA 1AYM1 3FBYA 1R082 1UF2C 2R30A 3LA3A 1S55A 3JB8A 4XFBA 2G4IA 5JR7B 1LOBA 4D7YA 4Y20A 1AR61 1NYWA 5ACA1 1UX6A 4LHLA 1VB2A 1DZQA 4GWMA 1N1YA 1H8TA 3B69A 1RUI3 3DF0A 1D0HA 2DCZA 2QCSB 3BPZA 1FOD1 4LBQD 3ZYGA 3ILNA 4CP0A 1J1TA 3AP5A 3ZFFB 4CDUA 5D8AA 2UURA 1AYN3 1HRI2 1QOTA 3LWCA 2PHTA 2OPKA 2VVEA 5JOZA 1S0IA 3M3EA 4JGZC 4XYXA 1S0DA 2VOVA 3R4SA 1G9AA 1QOSA 5T5JA 4RA0A 3ZSKA 3O7OA 3TN92 1DLLA 1PGW1 2GALA 1PO23 3WW4A 4P9GA 3MF6A 2W0XA 4XFCA 3CF6E 4OFGA 1WCSA 4I09A 1PO13 2PHLA 1VBC3 4K1YA 4CEWC 2R072 4LE3A 1DFQA 2CAVA 4JGYB 5JCTA 1OOPA 4KWJA 4B7KA 5KBFA 4BH9A 1CAWA 1KS5A 2ET7A 3LAGA 3LOBA 3TN91 1CONA 1DGRA 2JD4A 3AMNA 4U36A 4SLIA 4YGBA 1QDOA 1C1FA 2WA3A 1QH7A 3QBQA 1RJ8A 5GALA 5T5PA 3AYAA 3RSJA 2WS93 2CGOA 3VBFA 2C1FA 2VULA 5FPXA 4OUMA 3S0MA 2VW0A 4J1WA 4Q4Y1 1U5ZA 3T2TA 5EYYA 4EWDA 3OD4A 3GZUC 2H6BA 3SITA 3MW4A 3UKTA 4KL1A 2ZHNA 2HWB3 1A78A 1AX1A 3C2UA 3ACLA 3WUDA 4XZPA 2NM1A 4YZ2A 2D5HA 5CBLA 4B4QA 5BNPB 4H7LA 4LBKA 1RUH1 3ATGA 4CP1A 1AYM2 4E4ZA 4YW4A 4HN1A 1X82A 5FDBA 1NCRA 1CQ9A 5E8AA 5GLUA 1AR92 3NKTA 1PZ7A 5JMCA 2VVDA 4OLLA 2BVBA 2TNFA 1EAH2 1V9U2 2ZAHA 4WM8A 3FHIB 4AG4A 2WNEA 2RHPA 5CU1A 2PAMA 4A2UA 1K5MA 3JUUA 3ES4A 4IEVA 2HEVF 5EYXA 4AVAA 1A3KA 1VBA3 4XQDA 2WL1A 4XFHA 4I2OA 4MX3A 4Q1PA 1PIV2 1ZZ9A 2DVGA 1Q8SA 4Y1VA 5J7MA 3RMXA 1CAVB 1NCRB 1DGWX 5CVRA 1APNA 4E2GA 5CADA 1OLRA 1KDMA 1LOFC 4LE4A 4GMP3 4JRLA 2ZJCA 1LGBA 3RS6A 1I1EA 4D7TA 4P9IA 3TYJA 1GZCA 1ZRCA 1KXGA 3H1YA 5DUVA 2AREA 3LSDA 4GA9A 1AXYA 4WV8A 1MS5A 1LCLA 1WA4A 1C1LA 1FV2A 2RS52 3NV3A 4IV3C 1TME1 4Y1ZA 4XIOA 1ASJ2 1F9KA 5CIRA 1QJX2 2PHDA 3AMMA 1HW5A 4HKWA 3E5QA 1JBCA 1WCKA 1FMD2 3WW2A 3D4KA 4IEWA 4OI1A 4JVAA 1NG0A 2WZR2 3O0XA 2KA3A 3ZXKA 1COV3 4YM3A 5I8YA 3ST7A 1CJDA 3GZAA 1GZWB 1POV1 2P17A 3B02A 2QZ2A 1RHI2 4Q0SA 2QE3A 2K0GA 4K3UA 2BBVA 4CDWB 4ISRA 2I07B 1NZCA 1SEFA 3IWZA 5CG8A 1LKNA 2YHJA 4XF0A 4M00A 1ZBA3 1B35B 2A6WA 4IEUA 4XBNA 3IT8A 1C8M3 1GANA 1W0PA 3ZIXA 1C28A 5ABJB 4XMAA 2OA2A 4MGKE 1XNDA 5AVPA 4Q4X3 3U0ZA 4KWLA 2R062 1WBFA 2GAUA 3VZLA 2V09A 3U11A 2WS92 3RZZA 4A7YA 2GU9A 4QQOA 4Q4W2 5BNNB 3MDPA 4KBBA 3WDXA 2XJPA 2ZHKA 3ZO0B 3WDUA 3WV6A 4LR4A 3JQWA 4RHV2 1PZ8A 1YIFA 1WLTA 2XJTA 5FMOL 4WVWA 5J37A 1RB8G 2UY8A 1ENQA 4FOWA 2D7FA 2R16A 1UIKA 3IPVB 4MXWA 5K0UB 3OGGA 5TSWA 4YGDA 2PTMA 1DQ4A 4FOVA 4AEMA 1KRIA 4FOYA 2WQZC 1Z7S3 1RUG1 4MXVA 1AR82 1V6NA 1Y43B 3PVNA 4H3WA 3SHRA 2JG9A 4QM9A 2ATFA 1GNHA 4ZU5A 1M06G 2KXLA 1DGRN 4A7KA 4RS5C 2LUWA 2EVXA 3AXDA 3VDDC 4MVTA 2ZGNA 5EWSA 1PGL1 5JZGB 5LK7B 4LHKA 2OZ6A 2RS51 1J1LA 4XEZA 3MI8A 1C5HA 4INDA 5AVAA 1Q8OA 4N43A 3HMYA 4ES8A 1YIPA 4FP2A 4AFMA 5DZEA 1PGW2 2CTVA 2X5IA 3PVOA 4B3NA 4R9AA 4M0NA 4FPJA 3JBG1 4NVPA 4B29A 3WG3A 2ES3A 3FFZA 1LRHA 4GH4A 1YNAA 1VAKA 2WFF3 2H6CA 2IWGB 1MACA 4RR3C 3HIFA 5JZGA 1RVF1 1LB2A 1RUF1 1TEIA 4FXKB 4Q27A 2EXKA 4P14A 1H1AA 2NMNA 2VUAA 4PDWB 3R6SA 5L19A 1QU0A 4I01A 1UCXA 2RMU1 1UL9A 1LGCA 4N90A 4JCKA 5FQ0A 3AJYA 3B7MA 5J48A 4EN8B 3CU7A 1NY72 4GH4B 3GNEA 4H55A 4PIZA 4CYDA 1RGSA 5E88A 3MIEA 1D0GA 5IUQA 4B4PA 3WQ7A 4JQRA 5L73A 4C1WA 2OYZA 5JPNB 1PNGA 2XBO1 4CP2A 2ZS6B 3AP7A 4RR3A 4TYSA 1IOAA 5CA6A 5IT6A 1RUNA 1CX4A 2WWSA 3QOPA 1UIJA 1UN1A 4FOQA 4ZXKA 1RUF3 4ZU4A 2A3XA 2B7YA 1C8M2 1XU1A 2E7QA 1G8WA 4TWTA 1LESA 1PVC3 4IEZA 4XOGA 4Z1VA 4ISQA 2WFF1 3MICA 3WDYA 1I3HA 4NOTA 1BXHA 1CAXA 4OHYA 4CEYC 3E6BA 3B9CA 3J4UH 5LEJA 1W6QB 1VP6A 5DUWA 4CDQC 3N4MA 3AJZA 3Q9OA 3TOJA 4YG3A 1FT9A 3ZXFA 2R0FA 3HN1A 4LO8A 4QGNA