3TWKA

Crystal structure of arabidopsis thaliana fpg
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
293
structure length
293
Chain Sequence
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDSEEWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLYGKCVDKLAAALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase 1
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 79
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twkA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twkA01
4MB7A 4B3MM 4JI0M 1Z5CA 4DV4M 5ITRA 2VQFM 1Q39A 4G4NA 4DR2M 3SAVA 5ITXE 3JAMS 4DR5M 3OTOM 4JYAM 1K3WA 5ITQA 4NRWA 3W0FA 3TWKA 4JI6M 3A45A 3VK8A 2F5SA 1XC8A 4DV6M 4DV2M 4GKKM 4JI4M 2EA0A 2UU9M 2F5OA 1HNWM 2UXBM 3TWMA 4JI1M 2UUBM 3GQ5A 1XMOM 1IBKM 4PDIA 3GQ3A 4ITQA 1L2BA 1EE8A 3GQ4A 2ZM6M 2Q2EB 3J81S 3U6LA 3SBJA 1HNZM 4LFAM 5IT9S 4LFCM 4G4OA 4DV7M 1Z5BA 3VK7A 4JI5M 1R2ZA 1N32M 2XZUA 4X64M 1MX0A 3SARA 2F5NA 3DOAA 4PCZA 4LF6M 3A42A 1L2DA 4B3RM 4DUYM 1PM5A 4LF9M 4YHHM 2HHHM 5BR8M 4JI8M 1L2CA 4DR4M 2VQEM 2UUAM 1IBMM 3TWLA 4LF5M 3SASA 3U6QA 2UXCM 3GP1A 4B3TM 3U6CA 4JI3M 3J7AS 1MU5A 4LF4M 5ITTA 4DV3M 4DUZM 1L1ZA 1TDHA 1N36M 4LFBM 3GPPA 2F4VM 4GKJM 4DV0M 5LMUM 1HNXM 4X65M 4JI7M 4YY3M 2UXDM 5ITXA 1XNRM 3T1YM 4DV1M 3SAWA 3GPYA 2UUCM 3U6OA 5ITYA 4JV5M 4PD2A 4CISA 4DR7M 4K0KM 5ITUA 3GPUA 1Z59A 4DR3M 2XZFA 3T1HM 1K82A 2F5QA 1TDZA 1I94M 1R2YA 4LF7M 3JR5A 4B3SM 1XNQM 3SATA 3SAUA 4NXMM 5IWAM 4G4RA 1XMQM 3C58A 2OQ4A 4NRVA 3U6MA 4PDGA 4JI2M 3U6DA 1HR0M 1PJIA 1K3XA 2ZBKB 1FJGM 3JR4A 2HKJA 5FLXS 3A46A 4LF8M 4OX9M 1L1TA 1N34M 1N33M 4KHPM 3U6EA 3J80S 1Q3BA 2E5LM 3GO8A 4G4QA 4X62M 1KFVA 2F5PA 2OPFA 3U6PA 5LMNM 1PJJA 3U6SA 4X66M 1J5EM 1NNJA 4DR6M 4NXNM 1IBLM 1Q3CA 3GPXA 4AQYM 1Z5AA 5A2QS 4DR1M 4DV5M
chains in the Genus database with same CATH superfamily
2KA6B 3KOWE 5EP1A 3AFHA 4PT5A 1DGGA 1ZV1A 1G8PA 2APLA 3BXWA 2VQFM 4DR2M 4LCBA 4FD2A 2QCUA 3SAVA 3T15A 3KDSE 1E94E 2ERCA 2DNAA 2Z4RA 3GRVA 1VG5A 3B7NA 3BBZA 4JYAM 4DBGB 4AG6A 5DYGA 1YSYA 1IFYA 1A5TA 4IIWA 4I4LA 2G3QA 2JY8A 3LCUA 1SG9A 4JI6M 4L4UA 2F5SA 1R5LA 1IXZA 2KNAA 5KQDA 1WGNA 1QYRA 3TL4X 1Q02A 4L16A 1JR3E 2MROB 5EP4A 2F5OA 4D81A 4S12A 4MH0E 1C1KA 4OW0A 3SFZA 1QDTA 4BB9A 5KPZA 3GLFA 3CF0A 3J7BA 1UFZA 3EIHA 4XGIA 1IBKM 2UUBM 4PDIA 1OFHA 3GLFB 1GLNA 4ITQA 1L2BA 2DAGA 1D0KA 2CUZA 5DNYA 2ZM6M 1IY0A 3GLHA 3V76A 3BOSA 3AKZA 3M0EA 1XXHA 3SBJA 2C9CA 3GLHB 3MJ5A 1NNUC 4LFCM 1XXHB 1AIPC 3KVWA 5EXTA 2R62A 3SYKA 5KPRA 4DV7M 3VK7A 1DGBA 2P5TA 1N77A 3L25A 4PCZA 4LF6M 4B7FA 2LVQD 3FTDA 3SHFA 3D8LA 1PM5A 3SYLA 1C7YA 4YHHM 2HHHM 2W82A 3TQSA 1NJGA 2UUAM 2DZNB 1MJGM 2JNHA 3MK6A 4IBCA 3SASA 4LF5M 3FYDA 1GO5A 4R71A 2HL7A 2JWSA 7CATA 2UXCM 2Y0QA 2CHGA 4CIZA 1DO0A 1OJLA 2LVPC 3J7AS 1MU5A 4FWDA 3CF2A 3LQQA 4LF4M 2ZAMA 3HHYA 3U5ZB 2R44A 3L29A 4DUZM 4LJ4A 3GPPA 2EO2A 1E32A 4AZFA 3AL0C 4GKJM 3KS8A 1IN5A 4IBIA 3KXEC 2XF3A 3SAWA 1UM8A 5E6JA 5H37D 3DA1A 1HQYE 2LHGA 5EP2A 5ITUA 4K0KM 2JY7A 4B7GA 4LJ7A 1NHWC 3HGIA 4DR3M 3T1HM 3LVVA 3T6PA 1SXJD 2HAKA 2XGNA 1QZEA 1R2YA 2MR9A 3KW6A 1EIJA 1XHBA 3QYEA 1NJFA 4L8RC 5IWAM 4NXMM 2I7NA 3FUWA 4G4RA 1XMQM 1Z6TA 4QNRA 3CTWB 2XFTA 4M9ZA 5F3WA 2EJSA 3PFIA 3U6MA 4PDGA 4G3OA 2M5ZA 1YUBA 4II7A 1QUTA 2WSFF 4G4QA 4FWHA 3KSXA 2L09A 2YQZA 4X62M 3GLIB 2F5PA 2FS1A 4FVMA 3U6PA 1W5TA 3A98B 3VDPA 5LMNM 1J5EM 1NNJA 3M7GA 2KZSA 5KQ8A 4FW9A 1E9RA 4NXNM 4L6V6 1Q3CA 3K92A 4AQYM 1IBLM 4DR6M 4IBJA 3FUTA 2GNOA 2CV2A 1OQYA 1SXJC 3FRIA 4DV4M 1VEGA 3IHPA 4IBDA 1WIVA 4GHLA 1HJPA 5JI3E 4A3VB 2JY6B 5ITXE 4GEWA 4QHSA 1N75A 2QHOB 1R4GA 1VQ1A 2XFSA 5KPTA 4Q7JA 3GLIE 1IY2A 5EXXA 4CJ6A 1J09A 1K3WA 5ITQA 2KHHA 3UJNA 4GHAA 1T43A 4LZJA 3TWKA 3GLGB 8CATA 1GL7A 4Y28F 1PGYA 4NOOB 1IXRC 1SXJE 1G41A 4DV6M 3FYCA 4HL4A 1NSFA 3FTCA 4MGIE 3W68A 3I4VA 5FTMA 4I5SA 2EA0A 5EXSA 3HHZA 1D0LA 3IG8A 3LVWA 2JY5A 3HU2A 3TWMA 4REZA 1H6UA 2D7HA 3AOGA 3J27B 3GLGE 4JI1M 3AJIB 2JZ0A 4XBOA 2JA2A 2ZTCA 4ANRA 3HHXA 3GQ5A 2X49A 2FH0A 2FNAA 2CHQA 3HU1A 3LMMA 2H5XA 3HJ8A 4RF1A 3HX3A 3U6LA 1NHGC 1HNZM 5IT9S 1V92A 2MGWA 1PJTA 2LVAA 1Z5BA 1N32M 3CF6E 3K8ZA 2XZUA 2QENA 4MM3B 3UZUA 3SARA 4KO8A 3A42A 1L2DA 3ZQJA 4QNMA 4AI6A 4DUYM 4LF9M 4OVZA 1HQCA 2CV1A 2OO9A 4LJ6A 2KW0A 3RGSA 1L2CA 4DR4M 3E21A 4IBFA 2O5RA 1GL6A 3WHLA 3B89A 4GC5A 2WSCF 1PJSA 1P3QQ 5EJCA 4B3TM 2K0BX 3U6CA 1IXSA 3H4JA 2J7NA 3K9PA 2Z8YM 5DFLA 4GITA 1OIPA 2CE7A 5ITTA 2J5YA 1R7RA 2B3TA 1IXSB 1OAIA 1ZMVA 2DAEA 1TDHA 4LJ8A 1G71A 1N36M 1L8QA 1GJTA 2DZOB 3U61A 3M6AA 2K47A 2VF7A 4I8OA 3W67A 4X65M 4YY3M 4JI7M 5FTKA 3U61B 2UXDM 4AKIA 2D7GA 3B9PA 1LTMA 3PVSA 4IBKA 3T1YM 3HHWA 3U6OA 1YE9A 2C99A 2DENA 2BWEA 1QQWA 3GLFE 1QDRA 1Z59A 1QAMA 3GRRA 3VDUA 2QP9X 1K82A 3KP0E 2VDBB 1PRBA 2F5QA 2R45A 2LVOC 2LNHC 2C98A 1V33A 2EKFA 2OOBA 3KOZE 3GLHE 4CGYB 2CV0A 3JR5A 2LBCA 5C1BA 3I04M 1XXHE 4M0DA 2XLJA 3L26A 4NL4H 3B7QA 2JXNA 2V6ZM 1VDLA 3VLFB 4NRVA 2DKLA 4Z6YA 2C96A 2DAMA 4GMQA 1HR0M 2DWZB 1K3XA 4AKGA 2G8LA 1FJGM 5EXPA 2LHCA 3K2LA 1L1TA 1N33M 4GIPA 1ORYB 1Q3BA 1XB2B 4XK8F 3GO8A 3SHGB 2H1RA 4LZZA 1E9SA 2R6FA 2X4AA 3B74A 1TF0B 3Q8GA 2V1UA 3U60A 4LJ9A 1VEJA 3QYBA 2OPFA 3LW5F 1Y8GA 1PJJA 3RFWA 3U60B 1IQPA 3E4RA 5A2QS 4KT0F 4DV5M 2QBYA 1IM2A 4LRTA 4JI0M 1Z5CA 2QBYB 1Q39A 3SMPA 3SMSA 4DR5M 4BBAA 3OTOM 1G4AE 2RGOA 1VDDA 2DWNA 3VK8A 1ZQ9A 2R46A 2CWBA 2VIIA 5KO3A 4DV2M 2QSFX 4L15A 3Q8XA 1WGLA 4GKKM 4LRSA 4JI4M 3HY5A 4UN2B 1G3IA 2UU9M 2O01F 1HNWM 1GKIA 4MGKE 2L2DA 4IBGA 2KEBA 4M0WA 3B7ZA 2K6BA 3EIEA 2ZTDA 2G5GX 3LCVB 1T3TA 1NY6A 3L27A 4R3DA 1G59A 3ZC7B 2YFQA 3QAUA 2DWLA 3FTEA 2LVNC 3GQ4A 3L28A 1QAOA 2BJWA 1NV9A 3KSJA 5FTLA 1PJQA 3C9PA 2XEPA 4NSRA 4LFAM 4BLCA 1ZMUA 4G4OA 2L7IA 3HKPA 1R2ZA 4X64M 3I51A 5FTNA 2F5NA 2MH8A 2FOIC 3ILKA 2VF8A 4B3RM 4NC6A 1QAQA 2OOAA 3UGJA 5L8RF 5BR8M 4JI8M 3D8BA 1WXQA 2L7HA 2Y21A 3DFZA 1WJ7A 3WHKA 3SC3A 2EKKA 2FE8A 3HU3A 3TWLA 4F1IA 5BPVA 1IBMM 4FWGA 4WURA 3AOEC 2KZUA 3U6QA 4LG2A 4WW0A 3NBXX 2KRKA 4B7HA 1MN3A 4FCWA 2DHYA 1QVRA 1L1ZA 5EQTA 1GABA 1DGFA 4AG5A 2CP8A 2LH0A 1HNXM 1JB0F 4RKUF 1XNRM 2JP7A 2QNJA 4TUWA 1OIZA 1TGUA 4Z8XA 3HJQA 3GPYA 1X37A 4JV5M 1NVMA 4PD2A 4CISA 4RF0A 4DR7M 1KSFX 1IY1A 1IN8A 3GPUA 3I01M 4KLNA 1IN4A 5IREB 5C18A 3IG5A 4LGYA 4OVZB 2QQ8A 1TDZA 1ZMWA 2KNVA 4LF7M 1JR3A 2ZANA 3AV0A 2L6OA 3SATA 3SAUA 5GKNA 2Z7JA 2DZLA 3I4YA 5IZ7D 2OQ4A 2N35A 2GQFA 2KRUA 3T38A 2D7EA 2WSEF 2RKOA 2LWXA 3MHVC 2Y20A 4GH9A 2CRUA 1W5SA 3ZCBB 1PJIA 3UK6A 4D80A 1F4IA 4I81A 1TH4A 5FLXS 2I7PA 3FKEA 3U6EA 3GRYA 3J80S 3PXGA 2E5LM 4MGHA 1NO1A 3HJSA 1KFVA 2XSZA 3FUVA 1NV8A 4AW4A 4LGMA 4HEOA 4X66M 4GC9A 2R4EA 4M9SA 3THGA 1Z5AA 1XC8A 2BJVA 4W5WA 3CGWA 4MB7A 4B3MM 4G6ZA 2L4EA 2O25A 3FRHA 1IN6A 1TH2A 1HT1E 2JZ1A 5ITRA 3GRUA 4G4NA 4QHTA 3HZJA 3FUXA 2KDLA 4F2LA 3JAMS 3J2PB 2LTUA 3R9XB 3IECA 4FCVA 1TH3A 4NRWA 1FNNA 2R18A 3W0FA 1D0MA 3C3DA 1GVNA 4IBEA 2X8AA 3LQRA 3A45A 4LJAA 2R0IA 1RU3A 3PNYA 3PNVA 2LXEA 4NSOB 2DWMA 3E9SA 2XH9A 1IN7A 1DO2A 1KYIA 3UMMA 1OAOC 5DYIA 2CEAA 2JUJA 3K1JA 3MMPA 2BWBA 4P17A 1TTEA 2UXBM 1TR8A 4CHTB 2KXEA 1OFIA 2CHVA 1QZMA 4IJFA 2DI0A 4KODA 3RE8A 1XWIA 2WZJA 3U5ZA 1XMOM 1S3SA 3KOXE 2Z3XA 2QPAA 3GQ3A 1R6BX 3W0LB 1EE8A 2FFJA 2Q2EB 4IBBA 4JN6A 3RGPA 5FSWA 3J81S 4ZPXA 4B08A 4AKHA 4P16A 4QOSA 2R65A 4JI5M 4QOZC 4GRIA 1MX0A 5EP3A 1NY5A 4EIWA 3DOAA 3KS4A 2MJ5B 2EUCA 2RGHA 2DAIA 5E26A 4IJEA 2V1CA 3NBIA 3FD9A 2VQEM 4R7GA 1HT2E 3DZDA 2J7OA 3VKHA 4MGYE 3KOYE 5FTJA 2K9DA 3ZH9B 3FTFA 1DV0A 3VKGA 3GP1A 1QANA 1JQJC 1I4WA 4JI3M 4M9XA 4JXJA 3FUUA 4DV3M 1GJSA 3TE6A 2RRUA 2C5RA 2NQ8C 5JI2E 4LFBM 2F4VM 3VFDA 1WHCA 4HLQA 5LMUM 4DV0M 1CUKA 2CFOA 2DXIA 3H4MA 5ITXA 3GLIA 4DV1M 2UUCM 3L2AA 4L78A 5ITYA 1V34A 1QUSA 4LY6A 1D2NA 4DR1M 1T6OA 3R8FA 1SXJA 2XZFA 2ZAOA 3QWLA 1EFUB 3C3EA 4WP2A 4MGZE 2AHMA 3K9OA 1SXJB 1I94M 1OKSA 2M60A 1BVSA 4B3SM 1XNQM 4OU7A 1JR3D 2L4FA 2YNMD 3C58A 2HWJA 3GLGA 1J7KA 1N78A 4JI2M 3U6DA 1VEKA 2Z4SA 2HCBA 2QZ4A 2Y0TA 2ZBKB 3JR4A 2HKJA 4LF8M 3A46A 4OX9M 1OTRA 1AUAA 2A5YB 1ZAEA 1N34M 4KHPM 4LJ5A 2DVWB 1WR1B 3KP1E 2C9OA 2YR0A 3HWSA 3FE3A 1YLAA 3KFUG 1LV7A 3AOEA 1DGHA 2DAKA 2BNKA 2XSZD 2DHRA 3F92A 4FCTA 4RNAA 3TPZA 2KNZA 3U6SA 3E46A 1DGHB 4D82A 3GPXA 3NWLA 2R4JA
chains in the Genus database with same CATH topology
2KA6B 3KOWE 5EP1A 3AFHA 4PT5A 1DGGA 1G8PA 2VQFM 4DR2M 4LCBA 4FD2A 2QCUA 3SAVA 3T15A 3KDSE 1E94E 2ERCA 2Z4RA 3GRVA 4JYAM 4AG6A 5DYGA 1YSYA 4IIWA 4I4LA 4JI6M 4L4UA 2F5SA 1IXZA 5KQDA 1QYRA 3TL4X 4L16A 5EP4A 2F5OA 4D81A 4S12A 4MH0E 1C1KA 4OW0A 3SFZA 4BB9A 5KPZA 3GLFA 3CF0A 3J7BA 3EIHA 4XGIA 1IBKM 2UUBM 4PDIA 1OFHA 3GLFB 1GLNA 4ITQA 1L2BA 2CUZA 5DNYA 2ZM6M 1IY0A 3GLHA 3BOSA 3AKZA 3M0EA 1XXHA 3SBJA 2C9CA 3GLHB 3MJ5A 1NNUC 4LFCM 1XXHB 3KVWA 5EXTA 3SYKA 2R62A 5KPRA 4DV7M 3VK7A 1DGBA 2P5TA 1N77A 3L25A 4PCZA 4LF6M 4B7FA 3FTDA 3SHFA 3D8LA 1PM5A 3SYLA 4YHHM 2HHHM 2W82A 3TQSA 1NJGA 2UUAM 2DZNB 4IBCA 3MK6A 4LF5M 3SASA 3FYDA 2HL7A 7CATA 2UXCM 2Y0QA 2CHGA 1DO0A 1OJLA 3J7AS 1MU5A 4FWDA 3CF2A 3LQQA 4LF4M 2ZAMA 3HHYA 3U5ZB 3L29A 4DUZM 4LJ4A 3GPPA 2EO2A 1E32A 4AZFA 3AL0C 4GKJM 3KS8A 1IN5A 4IBIA 3KXEC 2XF3A 3SAWA 1UM8A 5E6JA 5H37D 3DA1A 1HQYE 5EP2A 4K0KM 5ITUA 4B7GA 4LJ7A 1NHWC 3HGIA 4DR3M 3T1HM 3LVVA 1SXJD 2XGNA 1R2YA 3KW6A 1XHBA 1NJFA 4L8RC 5IWAM 4NXMM 2I7NA 3FUWA 4G4RA 1XMQM 1Z6TA 4QNRA 3CTWB 2XFTA 4M9ZA 5F3WA 3PFIA 3U6MA 4PDGA 2M5ZA 1YUBA 4II7A 4G4QA 4FWHA 3KSXA 2L09A 2YQZA 4X62M 3GLIB 2F5PA 4FVMA 3U6PA 1W5TA 3A98B 3VDPA 5LMNM 1J5EM 1NNJA 3M7GA 2KZSA 5KQ8A 4FW9A 1E9RA 4NXNM 1IBLM 1Q3CA 3K92A 4AQYM 4DR6M 4IBJA 3FUTA 2CV2A 1SXJC 4DV4M 4IBDA 4GHLA 5JI3E 4A3VB 5ITXE 4QHSA 1N75A 5KPTA 2XFSA 1IY2A 5EXXA 1K3WA 1J09A 5ITQA 3UJNA 4GHAA 4LZJA 3GLGB 3TWKA 8CATA 1GL7A 4NOOB 1IXRC 1SXJE 1G41A 4DV6M 3FYCA 4HL4A 1NSFA 3FTCA 4MGIE 3I4VA 5FTMA 4I5SA 2EA0A 5EXSA 3HHZA 3IG8A 3LVWA 3HU2A 3TWMA 4REZA 1H6UA 2D7HA 3AOGA 3J27B 4JI1M 3AJIB 4XBOA 2JA2A 3GQ5A 3HHXA 2X49A 2FNAA 2CHQA 3HU1A 3LMMA 3HJ8A 4RF1A 3U6LA 1NHGC 1HNZM 5IT9S 1Z5BA 1N32M 3CF6E 3K8ZA 2XZUA 2QENA 4MM3B 3UZUA 3SARA 4KO8A 3A42A 1L2DA 4QNMA 4AI6A 4DUYM 4LF9M 4OVZA 1HQCA 2CV1A 4LJ6A 2KW0A 3RGSA 1L2CA 4DR4M 4IBFA 2O5RA 1GL6A 3WHLA 4GC5A 5EJCA 4B3TM 3U6CA 2J7NA 4GITA 2CE7A 5ITTA 1R7RA 4LJ8A 1IXSB 1TDHA 1N36M 1L8QA 2DZOB 3U61A 3M6AA 2K47A 4I8OA 4AKIA 4X65M 4JI7M 4YY3M 2UXDM 5FTKA 3U61B 2D7GA 3B9PA 3PVSA 4IBKA 3T1YM 3HHWA 3U6OA 1YE9A 2C99A 1QQWA 1Z59A 1QAMA 3GRRA 3VDUA 2QP9X 1K82A 3KP0E 2F5QA 2R45A 2LNHC 2C98A 3KOZE 4CGYB 2CV0A 3JR5A 5C1BA 4M0DA 3L26A 2XLJA 4NL4H 2V6ZM 3VLFB 4NRVA 4Z6YA 2C96A 4GMQA 1HR0M 2DWZB 1K3XA 4AKGA 2G8LA 1FJGM 5EXPA 3K2LA 1L1TA 1N33M 4GIPA 1ORYB 1Q3BA 3GO8A 3SHGB 2H1RA 4LZZA 1E9SA 2X4AA 2V1UA 3U60A 4LJ9A 2OPFA 1PJJA 3RFWA 3U60B 1IQPA 3E4RA 5A2QS 4DV5M 2QBYA 1IM2A 4LRTA 4JI0M 1Z5CA 2QBYB 1Q39A 3SMPA 3SMSA 4DR5M 4BBAA 3OTOM 1G4AE 2RGOA 1VDDA 2DWNA 3VK8A 1ZQ9A 2R46A 2VIIA 5KO3A 4DV2M 4L15A 3Q8XA 4GKKM 4LRSA 4JI4M 1G3IA 2UU9M 1HNWM 1GKIA 4MGKE 4IBGA 2KEBA 4M0WA 3EIEA 2G5GX 1T3TA 1NY6A 3L27A 4R3DA 1G59A 3ZC7B 2YFQA 3QAUA 2DWLA 3FTEA 3GQ4A 3L28A 1QAOA 2BJWA 3KSJA 5FTLA 4NSRA 2XEPA 4LFAM 4BLCA 4G4OA 2L7IA 3HKPA 1R2ZA 4X64M 3I51A 5FTNA 2F5NA 2FOIC 3ILKA 4B3RM 3UGJA 1QAQA 5BR8M 4JI8M 3D8BA 1WXQA 2L7HA 2Y21A 3DFZA 3WHKA 3SC3A 1IBMM 2FE8A 3HU3A 3TWLA 5BPVA 4FWGA 4WURA 3AOEC 2KZUA 3U6QA 4LG2A 4WW0A 2KRKA 4B7HA 4FCWA 1QVRA 1L1ZA 5EQTA 1DGFA 4AG5A 2LH0A 1HNXM 1XNRM 4TUWA 1TGUA 4Z8XA 3HJQA 3GPYA 1X37A 4JV5M 1NVMA 4PD2A 4CISA 4RF0A 4DR7M 1KSFX 1IY1A 1IN8A 3GPUA 4KLNA 1IN4A 5IREB 5C18A 3IG5A 4LGYA 4OVZB 1TDZA 4LF7M 1JR3A 2ZANA 3AV0A 2L6OA 3SATA 3SAUA 5GKNA 2Z7JA 3I4YA 5IZ7D 2OQ4A 2KRUA 3T38A 2D7EA 2RKOA 2LWXA 3MHVC 2Y20A 4GH9A 3ZCBB 1W5SA 1PJIA 3UK6A 4D80A 4I81A 1TH4A 5FLXS 2I7PA 3FKEA 3U6EA 3GRYA 3J80S 3PXGA 2E5LM 4MGHA 3HJSA 1KFVA 2XSZA 3FUVA 4AW4A 4LGMA 4X66M 4GC9A 2R4EA 4M9SA 3THGA 1Z5AA 1XC8A 2BJVA 4W5WA 4MB7A 4B3MM 4G6ZA 1IN6A 1TH2A 1HT1E 5ITRA 3GRUA 4G4NA 4QHTA 3FUXA 3JAMS 3J2PB 3R9XB 4FCVA 1TH3A 4NRWA 1FNNA 2R18A 3W0FA 4IBEA 1GVNA 2X8AA 3LQRA 3A45A 4LJAA 3PNYA 3PNVA 2LXEA 4NSOB 2DWMA 3E9SA 2XH9A 1IN7A 1DO2A 1KYIA 3UMMA 5DYIA 2CEAA 3K1JA 2UXBM 4CHTB 2KXEA 1OFIA 2CHVA 1QZMA 4IJFA 4KODA 3RE8A 1XWIA 3U5ZA 1XMOM 1S3SA 3KOXE 2Z3XA 2QPAA 3GQ3A 1R6BX 3W0LB 1EE8A 2FFJA 2Q2EB 4IBBA 4JN6A 3RGPA 5FSWA 3J81S 4ZPXA 4B08A 4AKHA 4P16A 4QOSA 2R65A 4JI5M 4QOZC 4GRIA 1MX0A 5EP3A 1NY5A 4EIWA 3DOAA 3KS4A 2EUCA 2RGHA 5E26A 4IJEA 2V1CA 3NBIA 3FD9A 2VQEM 4R7GA 1HT2E 3DZDA 2J7OA 3VKHA 4MGYE 3KOYE 5FTJA 3ZH9B 3FTFA 3VKGA 3GP1A 1QANA 1JQJC 1I4WA 4JI3M 4M9XA 4JXJA 3FUUA 4DV3M 3TE6A 2C5RA 2NQ8C 5JI2E 4LFBM 2F4VM 3VFDA 4HLQA 5LMUM 4DV0M 2CFOA 2DXIA 3H4MA 5ITXA 3GLIA 4DV1M 2UUCM 3L2AA 4L78A 5ITYA 4LY6A 1D2NA 4DR1M 3R8FA 1SXJA 2XZFA 2ZAOA 3QWLA 4MGZE 2AHMA 1I94M 1SXJB 2M60A 4B3SM 1XNQM 4OU7A 1JR3D 2YNMD 3C58A 3GLGA 1J7KA 1N78A 4JI2M 3U6DA 2Z4SA 2HCBA 2QZ4A 2Y0TA 2ZBKB 3JR4A 2HKJA 4LF8M 3A46A 4OX9M 2A5YB 1ZAEA 1N34M 4KHPM 4LJ5A 2DVWB 3KP1E 2C9OA 2YR0A 3HWSA 3KFUG 1LV7A 3AOEA 1DGHA 3TPZA 2BNKA 2XSZD 2DHRA 4FCTA 4RNAA 3U6SA 1DGHB 4D82A 3GPXA 3NWLA 2R4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MB7 A;  4B3M M;  4JI0 M;  1Z5C A;  4DV4 M;  5ITR A;  2VQF M;  1Q39 A;  4G4N A;  4DR2 M;  3SAV A;  5ITX E;  3JAM S;  4DR5 M;  3OTO M;  4JYA M;  1K3W A;  5ITQ A;  4NRW A;  3W0F A;  3TWK A;  4JI6 M;  3A45 A;  3VK8 A;  2F5S A;  1XC8 A;  4DV6 M;  4DV2 M;  4GKK M;  4JI4 M;  2EA0 A;  2UU9 M;  2F5O A;  1HNW M;  2UXB M;  3TWM A;  4JI1 M;  2UUB M;  3GQ5 A;  1XMO M;  1IBK M;  4PDI A;  3GQ3 A;  4ITQ A;  1L2B A;  1EE8 A;  3GQ4 A;  2ZM6 M;  2Q2E B;  3J81 S;  3U6L A;  3SBJ A;  1HNZ M;  4LFA M;  5IT9 S;  4LFC M;  4G4O A;  4DV7 M;  1Z5B A;  3VK7 A;  4JI5 M;  1R2Z A;  1N32 M;  2XZU A;  4X64 M;  1MX0 A;  3SAR A;  2F5N A;  3DOA A;  4PCZ A;  4LF6 M;  3A42 A;  1L2D A;  4B3R M;  4DUY M;  1PM5 A;  4LF9 M;  4YHH M;  2HHH M;  5BR8 M;  4JI8 M;  1L2C A;  4DR4 M;  2VQE M;  2UUA M;  1IBM M;  3TWL A;  4LF5 M;  3SAS A;  3U6Q A;  2UXC M;  3GP1 A;  4B3T M;  3U6C A;  4JI3 M;  3J7A S;  1MU5 A;  4LF4 M;  5ITT A;  4DV3 M;  4DUZ M;  1L1Z A;  1TDH A;  1N36 M;  4LFB M;  3GPP A;  2F4V M;  4GKJ M;  4DV0 M;  5LMU M;  1HNX M;  4X65 M;  4JI7 M;  4YY3 M;  2UXD M;  5ITX A;  1XNR M;  3T1Y M;  4DV1 M;  3SAW A;  3GPY A;  2UUC M;  3U6O A;  5ITY A;  4JV5 M;  4PD2 A;  4CIS A;  4DR7 M;  4K0K M;  5ITU A;  3GPU A;  1Z59 A;  4DR3 M;  2XZF A;  3T1H M;  1K82 A;  2F5Q A;  1TDZ A;  1I94 M;  1R2Y A;  4LF7 M;  3JR5 A;  4B3S M;  1XNQ M;  3SAT A;  3SAU A;  4NXM M;  5IWA M;  4G4R A;  1XMQ M;  3C58 A;  2OQ4 A;  4NRV A;  3U6M A;  4PDG A;  4JI2 M;  3U6D A;  1HR0 M;  1PJI A;  1K3X A;  2ZBK B;  1FJG M;  3JR4 A;  2HKJ A;  5FLX S;  3A46 A;  4LF8 M;  4OX9 M;  1L1T A;  1N34 M;  1N33 M;  4KHP M;  3U6E A;  3J80 S;  1Q3B A;  2E5L M;  3GO8 A;  4G4Q A;  4X62 M;  1KFV A;  2F5P A;  2OPF A;  3U6P A;  5LMN M;  1PJJ A;  3U6S A;  4X66 M;  1J5E M;  1NNJ A;  4DR6 M;  4NXN M;  1IBL M;  1Q3C A;  3GPX A;  4AQY M;  1Z5A A;  5A2Q S;  4DR1 M;  4DV5 M; 
#chains in the Genus database with same CATH topology
 2KA6 B;  3KOW E;  5EP1 A;  3AFH A;  4PT5 A;  1DGG A;  1ZV1 A;  1G8P A;  2APL A;  3BXW A;  2VQF M;  4DR2 M;  4LCB A;  4FD2 A;  2QCU A;  3SAV A;  3T15 A;  3KDS E;  1E94 E;  2ERC A;  2DNA A;  2Z4R A;  3GRV A;  1VG5 A;  3B7N A;  3BBZ A;  4JYA M;  4DBG B;  4AG6 A;  5DYG A;  1YSY A;  1IFY A;  1A5T A;  4IIW A;  4I4L A;  2G3Q A;  2JY8 A;  3LCU A;  1SG9 A;  4JI6 M;  4L4U A;  2F5S A;  1R5L A;  1IXZ A;  2KNA A;  5KQD A;  1WGN A;  1QYR A;  3TL4 X;  1Q02 A;  4L16 A;  1JR3 E;  2MRO B;  5EP4 A;  2F5O A;  4D81 A;  4S12 A;  4MH0 E;  1C1K A;  4OW0 A;  3SFZ A;  1QDT A;  4BB9 A;  5KPZ A;  3GLF A;  3CF0 A;  3J7B A;  1UFZ A;  3EIH A;  4XGI A;  1IBK M;  2UUB M;  4PDI A;  1OFH A;  3GLF B;  1GLN A;  4ITQ A;  1L2B A;  2DAG A;  1D0K A;  2CUZ A;  5DNY A;  2ZM6 M;  1IY0 A;  3GLH A;  3V76 A;  3BOS A;  3AKZ A;  3M0E A;  1XXH A;  3SBJ A;  2C9C A;  3GLH B;  3MJ5 A;  1NNU C;  4LFC M;  1XXH B;  1AIP C;  3KVW A;  5EXT A;  2R62 A;  3SYK A;  5KPR A;  4DV7 M;  3VK7 A;  1DGB A;  2P5T A;  1N77 A;  3L25 A;  4PCZ A;  4LF6 M;  4B7F A;  2LVQ D;  3FTD A;  3SHF A;  3D8L A;  1PM5 A;  3SYL A;  1C7Y A;  4YHH M;  2HHH M;  2W82 A;  3TQS A;  1NJG A;  2UUA M;  2DZN B;  1MJG M;  2JNH A;  3MK6 A;  4IBC A;  3SAS A;  4LF5 M;  3FYD A;  1GO5 A;  4R71 A;  2HL7 A;  2JWS A;  7CAT A;  2UXC M;  2Y0Q A;  2CHG A;  4CIZ A;  1DO0 A;  1OJL A;  2LVP C;  3J7A S;  1MU5 A;  4FWD A;  3CF2 A;  3LQQ A;  4LF4 M;  2ZAM A;  3HHY A;  3U5Z B;  2R44 A;  3L29 A;  4DUZ M;  4LJ4 A;  3GPP A;  2EO2 A;  1E32 A;  4AZF A;  3AL0 C;  4GKJ M;  3KS8 A;  1IN5 A;  4IBI A;  3KXE C;  2XF3 A;  3SAW A;  1UM8 A;  5E6J A;  5H37 D;  3DA1 A;  1HQY E;  2LHG A;  5EP2 A;  5ITU A;  4K0K M;  2JY7 A;  4B7G A;  4LJ7 A;  1NHW C;  3HGI A;  4DR3 M;  3T1H M;  3LVV A;  3T6P A;  1SXJ D;  2HAK A;  2XGN A;  1QZE A;  1R2Y A;  2MR9 A;  3KW6 A;  1EIJ A;  1XHB A;  3QYE A;  1NJF A;  4L8R C;  5IWA M;  4NXM M;  2I7N A;  3FUW A;  4G4R A;  1XMQ M;  1Z6T A;  4QNR A;  3CTW B;  2XFT A;  4M9Z A;  5F3W A;  2EJS A;  3PFI A;  3U6M A;  4PDG A;  4G3O A;  2M5Z A;  1YUB A;  4II7 A;  1QUT A;  2WSF F;  4G4Q A;  4FWH A;  3KSX A;  2L09 A;  2YQZ A;  4X62 M;  3GLI B;  2F5P A;  2FS1 A;  4FVM A;  3U6P A;  1W5T A;  3A98 B;  3VDP A;  5LMN M;  1J5E M;  1NNJ A;  3M7G A;  2KZS A;  5KQ8 A;  4FW9 A;  1E9R A;  4NXN M;  4L6V 6;  1Q3C A;  3K92 A;  4AQY M;  1IBL M;  4DR6 M;  4IBJ A;  3FUT A;  2GNO A;  2CV2 A;  1OQY A;  1SXJ C;  3FRI A;  4DV4 M;  1VEG A;  3IHP A;  4IBD A;  1WIV A;  4GHL A;  1HJP A;  5JI3 E;  4A3V B;  2JY6 B;  5ITX E;  4GEW A;  4QHS A;  1N75 A;  2QHO B;  1R4G A;  1VQ1 A;  2XFS A;  5KPT A;  4Q7J A;  3GLI E;  1IY2 A;  5EXX A;  4CJ6 A;  1J09 A;  1K3W A;  5ITQ A;  2KHH A;  3UJN A;  4GHA A;  1T43 A;  4LZJ A;  3TWK A;  3GLG B;  8CAT A;  1GL7 A;  4Y28 F;  1PGY A;  4NOO B;  1IXR C;  1SXJ E;  1G41 A;  4DV6 M;  3FYC A;  4HL4 A;  1NSF A;  3FTC A;  4MGI E;  3W68 A;  3I4V A;  5FTM A;  4I5S A;  2EA0 A;  5EXS A;  3HHZ A;  1D0L A;  3IG8 A;  3LVW A;  2JY5 A;  3HU2 A;  3TWM A;  4REZ A;  1H6U A;  2D7H A;  3AOG A;  3J27 B;  3GLG E;  4JI1 M;  3AJI B;  2JZ0 A;  4XBO A;  2JA2 A;  2ZTC A;  4ANR A;  3HHX A;  3GQ5 A;  2X49 A;  2FH0 A;  2FNA A;  2CHQ A;  3HU1 A;  3LMM A;  2H5X A;  3HJ8 A;  4RF1 A;  3HX3 A;  3U6L A;  1NHG C;  1HNZ M;  5IT9 S;  1V92 A;  2MGW A;  1PJT A;  2LVA A;  1Z5B A;  1N32 M;  3CF6 E;  3K8Z A;  2XZU A;  2QEN A;  4MM3 B;  3UZU A;  3SAR A;  4KO8 A;  3A42 A;  1L2D A;  3ZQJ A;  4QNM A;  4AI6 A;  4DUY M;  4LF9 M;  4OVZ A;  1HQC A;  2CV1 A;  2OO9 A;  4LJ6 A;  2KW0 A;  3RGS A;  1L2C A;  4DR4 M;  3E21 A;  4IBF A;  2O5R A;  1GL6 A;  3WHL A;  3B89 A;  4GC5 A;  2WSC F;  1PJS A;  1P3Q Q;  5EJC A;  4B3T M;  2K0B X;  3U6C A;  1IXS A;  3H4J A;  2J7N A;  3K9P A;  2Z8Y M;  5DFL A;  4GIT A;  1OIP A;  2CE7 A;  5ITT A;  2J5Y A;  1R7R A;  2B3T A;  1IXS B;  1OAI A;  1ZMV A;  2DAE A;  1TDH A;  4LJ8 A;  1G71 A;  1N36 M;  1L8Q A;  1GJT A;  2DZO B;  3U61 A;  3M6A A;  2K47 A;  2VF7 A;  4I8O A;  3W67 A;  4X65 M;  4YY3 M;  4JI7 M;  5FTK A;  3U61 B;  2UXD M;  4AKI A;  2D7G A;  3B9P A;  1LTM A;  3PVS A;  4IBK A;  3T1Y M;  3HHW A;  3U6O A;  1YE9 A;  2C99 A;  2DEN A;  2BWE A;  1QQW A;  3GLF E;  1QDR A;  1Z59 A;  1QAM A;  3GRR A;  3VDU A;  2QP9 X;  1K82 A;  3KP0 E;  2VDB B;  1PRB A;  2F5Q A;  2R45 A;  2LVO C;  2LNH C;  2C98 A;  1V33 A;  2EKF A;  2OOB A;  3KOZ E;  3GLH E;  4CGY B;  2CV0 A;  3JR5 A;  2LBC A;  5C1B A;  3I04 M;  1XXH E;  4M0D A;  2XLJ A;  3L26 A;  4NL4 H;  3B7Q A;  2JXN A;  2V6Z M;  1VDL A;  3VLF B;  4NRV A;  2DKL A;  4Z6Y A;  2C96 A;  2DAM A;  4GMQ A;  1HR0 M;  2DWZ B;  1K3X A;  4AKG A;  2G8L A;  1FJG M;  5EXP A;  2LHC A;  3K2L A;  1L1T A;  1N33 M;  4GIP A;  1ORY B;  1Q3B A;  1XB2 B;  4XK8 F;  3GO8 A;  3SHG B;  2H1R A;  4LZZ A;  1E9S A;  2R6F A;  2X4A A;  3B74 A;  1TF0 B;  3Q8G A;  2V1U A;  3U60 A;  4LJ9 A;  1VEJ A;  3QYB A;  2OPF A;  3LW5 F;  1Y8G A;  1PJJ A;  3RFW A;  3U60 B;  1IQP A;  3E4R A;  5A2Q S;  4KT0 F;  4DV5 M;  2QBY A;  1IM2 A;  4LRT A;  4JI0 M;  1Z5C A;  2QBY B;  1Q39 A;  3SMP A;  3SMS A;  4DR5 M;  4BBA A;  3OTO M;  1G4A E;  2RGO A;  1VDD A;  2DWN A;  3VK8 A;  1ZQ9 A;  2R46 A;  2CWB A;  2VII A;  5KO3 A;  4DV2 M;  2QSF X;  4L15 A;  3Q8X A;  1WGL A;  4GKK M;  4LRS A;  4JI4 M;  3HY5 A;  4UN2 B;  1G3I A;  2UU9 M;  2O01 F;  1HNW M;  1GKI A;  4MGK E;  2L2D A;  4IBG A;  2KEB A;  4M0W A;  3B7Z A;  2K6B A;  3EIE A;  2ZTD A;  2G5G X;  3LCV B;  1T3T A;  1NY6 A;  3L27 A;  4R3D A;  1G59 A;  3ZC7 B;  2YFQ A;  3QAU A;  2DWL A;  3FTE A;  2LVN C;  3GQ4 A;  3L28 A;  1QAO A;  2BJW A;  1NV9 A;  3KSJ A;  5FTL A;  1PJQ A;  3C9P A;  2XEP A;  4NSR A;  4LFA M;  4BLC A;  1ZMU A;  4G4O A;  2L7I A;  3HKP A;  1R2Z A;  4X64 M;  3I51 A;  5FTN A;  2F5N A;  2MH8 A;  2FOI C;  3ILK A;  2VF8 A;  4B3R M;  4NC6 A;  1QAQ A;  2OOA A;  3UGJ A;  5L8R F;  5BR8 M;  4JI8 M;  3D8B A;  1WXQ A;  2L7H A;  2Y21 A;  3DFZ A;  1WJ7 A;  3WHK A;  3SC3 A;  2EKK A;  2FE8 A;  3HU3 A;  3TWL A;  4F1I A;  5BPV A;  1IBM M;  4FWG A;  4WUR A;  3AOE C;  2KZU A;  3U6Q A;  4LG2 A;  4WW0 A;  3NBX X;  2KRK A;  4B7H A;  1MN3 A;  4FCW A;  2DHY A;  1QVR A;  1L1Z A;  5EQT A;  1GAB A;  1DGF A;  4AG5 A;  2CP8 A;  2LH0 A;  1HNX M;  1JB0 F;  4RKU F;  1XNR M;  2JP7 A;  2QNJ A;  4TUW A;  1OIZ A;  1TGU A;  4Z8X A;  3HJQ A;  3GPY A;  1X37 A;  4JV5 M;  1NVM A;  4PD2 A;  4CIS A;  4RF0 A;  4DR7 M;  1KSF X;  1IY1 A;  1IN8 A;  3GPU A;  3I01 M;  4KLN A;  1IN4 A;  5IRE B;  5C18 A;  3IG5 A;  4LGY A;  4OVZ B;  2QQ8 A;  1TDZ A;  1ZMW A;  2KNV A;  4LF7 M;  1JR3 A;  2ZAN A;  3AV0 A;  2L6O A;  3SAT A;  3SAU A;  5GKN A;  2Z7J A;  2DZL A;  3I4Y A;  5IZ7 D;  2OQ4 A;  2N35 A;  2GQF A;  2KRU A;  3T38 A;  2D7E A;  2WSE F;  2RKO A;  2LWX A;  3MHV C;  2Y20 A;  4GH9 A;  2CRU A;  1W5S A;  3ZCB B;  1PJI A;  3UK6 A;  4D80 A;  1F4I A;  4I81 A;  1TH4 A;  5FLX S;  2I7P A;  3FKE A;  3U6E A;  3GRY A;  3J80 S;  3PXG A;  2E5L M;  4MGH A;  1NO1 A;  3HJS A;  1KFV A;  2XSZ A;  3FUV A;  1NV8 A;  4AW4 A;  4LGM A;  4HEO A;  4X66 M;  4GC9 A;  2R4E A;  4M9S A;  3THG A;  1Z5A A;  1XC8 A;  2BJV A;  4W5W A;  3CGW A;  4MB7 A;  4B3M M;  4G6Z A;  2L4E A;  2O25 A;  3FRH A;  1IN6 A;  1TH2 A;  1HT1 E;  2JZ1 A;  5ITR A;  3GRU A;  4G4N A;  4QHT A;  3HZJ A;  3FUX A;  2KDL A;  4F2L A;  3JAM S;  3J2P B;  2LTU A;  3R9X B;  3IEC A;  4FCV A;  1TH3 A;  4NRW A;  1FNN A;  2R18 A;  3W0F A;  1D0M A;  3C3D A;  1GVN A;  4IBE A;  2X8A A;  3LQR A;  3A45 A;  4LJA A;  2R0I A;  1RU3 A;  3PNY A;  3PNV A;  2LXE A;  4NSO B;  2DWM A;  3E9S A;  2XH9 A;  1IN7 A;  1DO2 A;  1KYI A;  3UMM A;  1OAO C;  5DYI A;  2CEA A;  2JUJ A;  3K1J A;  3MMP A;  2BWB A;  4P17 A;  1TTE A;  2UXB M;  1TR8 A;  4CHT B;  2KXE A;  1OFI A;  2CHV A;  1QZM A;  4IJF A;  2DI0 A;  4KOD A;  3RE8 A;  1XWI A;  2WZJ A;  3U5Z A;  1XMO M;  1S3S A;  3KOX E;  2Z3X A;  2QPA A;  3GQ3 A;  1R6B X;  3W0L B;  1EE8 A;  2FFJ A;  2Q2E B;  4IBB A;  4JN6 A;  3RGP A;  5FSW A;  3J81 S;  4ZPX A;  4B08 A;  4AKH A;  4P16 A;  4QOS A;  2R65 A;  4JI5 M;  4QOZ C;  4GRI A;  1MX0 A;  5EP3 A;  1NY5 A;  4EIW A;  3DOA A;  3KS4 A;  2MJ5 B;  2EUC A;  2RGH A;  2DAI A;  5E26 A;  4IJE A;  2V1C A;  3NBI A;  3FD9 A;  2VQE M;  4R7G A;  1HT2 E;  3DZD A;  2J7O A;  3VKH A;  4MGY E;  3KOY E;  5FTJ A;  2K9D A;  3ZH9 B;  3FTF A;  1DV0 A;  3VKG A;  3GP1 A;  1QAN A;  1JQJ C;  1I4W A;  4JI3 M;  4M9X A;  4JXJ A;  3FUU A;  4DV3 M;  1GJS A;  3TE6 A;  2RRU A;  2C5R A;  2NQ8 C;  5JI2 E;  4LFB M;  2F4V M;  3VFD A;  1WHC A;  4HLQ A;  5LMU M;  4DV0 M;  1CUK A;  2CFO A;  2DXI A;  3H4M A;  5ITX A;  3GLI A;  4DV1 M;  2UUC M;  3L2A A;  4L78 A;  5ITY A;  1V34 A;  1QUS A;  4LY6 A;  1D2N A;  4DR1 M;  1T6O A;  3R8F A;  1SXJ A;  2XZF A;  2ZAO A;  3QWL A;  1EFU B;  3C3E A;  4WP2 A;  4MGZ E;  2AHM A;  3K9O A;  1SXJ B;  1I94 M;  1OKS A;  2M60 A;  1BVS A;  4B3S M;  1XNQ M;  4OU7 A;  1JR3 D;  2L4F A;  2YNM D;  3C58 A;  2HWJ A;  3GLG A;  1J7K A;  1N78 A;  4JI2 M;  3U6D A;  1VEK A;  2Z4S A;  2HCB A;  2QZ4 A;  2Y0T A;  2ZBK B;  3JR4 A;  2HKJ A;  4LF8 M;  3A46 A;  4OX9 M;  1OTR A;  1AUA A;  2A5Y B;  1ZAE A;  1N34 M;  4KHP M;  4LJ5 A;  2DVW B;  1WR1 B;  3KP1 E;  2C9O A;  2YR0 A;  3HWS A;  3FE3 A;  1YLA A;  3KFU G;  1LV7 A;  3AOE A;  1DGH A;  2DAK A;  2BNK A;  2XSZ D;  2DHR A;  3F92 A;  4FCT A;  4RNA A;  3TPZ A;  2KNZ A;  3U6S A;  3E46 A;  1DGH B;  4D82 A;  3GPX A;  3NWL A;  2R4J A; 
#chains in the Genus database with same CATH homology
 2KA6 B;  3KOW E;  5EP1 A;  3AFH A;  4PT5 A;  1DGG A;  1G8P A;  2VQF M;  4DR2 M;  4LCB A;  4FD2 A;  2QCU A;  3SAV A;  3T15 A;  3KDS E;  1E94 E;  2ERC A;  2Z4R A;  3GRV A;  4JYA M;  4AG6 A;  5DYG A;  1YSY A;  4IIW A;  4I4L A;  4JI6 M;  4L4U A;  2F5S A;  1IXZ A;  5KQD A;  1QYR A;  3TL4 X;  4L16 A;  5EP4 A;  2F5O A;  4D81 A;  4S12 A;  4MH0 E;  1C1K A;  4OW0 A;  3SFZ A;  4BB9 A;  5KPZ A;  3GLF A;  3CF0 A;  3J7B A;  3EIH A;  4XGI A;  1IBK M;  2UUB M;  4PDI A;  1OFH A;  3GLF B;  1GLN A;  4ITQ A;  1L2B A;  2CUZ A;  5DNY A;  2ZM6 M;  1IY0 A;  3GLH A;  3BOS A;  3AKZ A;  3M0E A;  1XXH A;  3SBJ A;  2C9C A;  3GLH B;  3MJ5 A;  1NNU C;  4LFC M;  1XXH B;  3KVW A;  5EXT A;  3SYK A;  2R62 A;  5KPR A;  4DV7 M;  3VK7 A;  1DGB A;  2P5T A;  1N77 A;  3L25 A;  4PCZ A;  4LF6 M;  4B7F A;  3FTD A;  3SHF A;  3D8L A;  1PM5 A;  3SYL A;  4YHH M;  2HHH M;  2W82 A;  3TQS A;  1NJG A;  2UUA M;  2DZN B;  4IBC A;  3MK6 A;  4LF5 M;  3SAS A;  3FYD A;  2HL7 A;  7CAT A;  2UXC M;  2Y0Q A;  2CHG A;  1DO0 A;  1OJL A;  3J7A S;  1MU5 A;  4FWD A;  3CF2 A;  3LQQ A;  4LF4 M;  2ZAM A;  3HHY A;  3U5Z B;  3L29 A;  4DUZ M;  4LJ4 A;  3GPP A;  2EO2 A;  1E32 A;  4AZF A;  3AL0 C;  4GKJ M;  3KS8 A;  1IN5 A;  4IBI A;  3KXE C;  2XF3 A;  3SAW A;  1UM8 A;  5E6J A;  5H37 D;  3DA1 A;  1HQY E;  5EP2 A;  4K0K M;  5ITU A;  4B7G A;  4LJ7 A;  1NHW C;  3HGI A;  4DR3 M;  3T1H M;  3LVV A;  1SXJ D;  2XGN A;  1R2Y A;  3KW6 A;  1XHB A;  1NJF A;  4L8R C;  5IWA M;  4NXM M;  2I7N A;  3FUW A;  4G4R A;  1XMQ M;  1Z6T A;  4QNR A;  3CTW B;  2XFT A;  4M9Z A;  5F3W A;  3PFI A;  3U6M A;  4PDG A;  2M5Z A;  1YUB A;  4II7 A;  4G4Q A;  4FWH A;  3KSX A;  2L09 A;  2YQZ A;  4X62 M;  3GLI B;  2F5P A;  4FVM A;  3U6P A;  1W5T A;  3A98 B;  3VDP A;  5LMN M;  1J5E M;  1NNJ A;  3M7G A;  2KZS A;  5KQ8 A;  4FW9 A;  1E9R A;  4NXN M;  1IBL M;  1Q3C A;  3K92 A;  4AQY M;  4DR6 M;  4IBJ A;  3FUT A;  2CV2 A;  1SXJ C;  4DV4 M;  4IBD A;  4GHL A;  5JI3 E;  4A3V B;  5ITX E;  4QHS A;  1N75 A;  5KPT A;  2XFS A;  1IY2 A;  5EXX A;  1K3W A;  1J09 A;  5ITQ A;  3UJN A;  4GHA A;  4LZJ A;  3GLG B;  3TWK A;  8CAT A;  1GL7 A;  4NOO B;  1IXR C;  1SXJ E;  1G41 A;  4DV6 M;  3FYC A;  4HL4 A;  1NSF A;  3FTC A;  4MGI E;  3I4V A;  5FTM A;  4I5S A;  2EA0 A;  5EXS A;  3HHZ A;  3IG8 A;  3LVW A;  3HU2 A;  3TWM A;  4REZ A;  1H6U A;  2D7H A;  3AOG A;  3J27 B;  4JI1 M;  3AJI B;  4XBO A;  2JA2 A;  3GQ5 A;  3HHX A;  2X49 A;  2FNA A;  2CHQ A;  3HU1 A;  3LMM A;  3HJ8 A;  4RF1 A;  3U6L A;  1NHG C;  1HNZ M;  5IT9 S;  1Z5B A;  1N32 M;  3CF6 E;  3K8Z A;  2XZU A;  2QEN A;  4MM3 B;  3UZU A;  3SAR A;  4KO8 A;  3A42 A;  1L2D A;  4QNM A;  4AI6 A;  4DUY M;  4LF9 M;  4OVZ A;  1HQC A;  2CV1 A;  4LJ6 A;  2KW0 A;  3RGS A;  1L2C A;  4DR4 M;  4IBF A;  2O5R A;  1GL6 A;  3WHL A;  4GC5 A;  5EJC A;  4B3T M;  3U6C A;  2J7N A;  4GIT A;  2CE7 A;  5ITT A;  1R7R A;  4LJ8 A;  1IXS B;  1TDH A;  1N36 M;  1L8Q A;  2DZO B;  3U61 A;  3M6A A;  2K47 A;  4I8O A;  4AKI A;  4X65 M;  4JI7 M;  4YY3 M;  2UXD M;  5FTK A;  3U61 B;  2D7G A;  3B9P A;  3PVS A;  4IBK A;  3T1Y M;  3HHW A;  3U6O A;  1YE9 A;  2C99 A;  1QQW A;  1Z59 A;  1QAM A;  3GRR A;  3VDU A;  2QP9 X;  1K82 A;  3KP0 E;  2F5Q A;  2R45 A;  2LNH C;  2C98 A;  3KOZ E;  4CGY B;  2CV0 A;  3JR5 A;  5C1B A;  4M0D A;  3L26 A;  2XLJ A;  4NL4 H;  2V6Z M;  3VLF B;  4NRV A;  4Z6Y A;  2C96 A;  4GMQ A;  1HR0 M;  2DWZ B;  1K3X A;  4AKG A;  2G8L A;  1FJG M;  5EXP A;  3K2L A;  1L1T A;  1N33 M;  4GIP A;  1ORY B;  1Q3B A;  3GO8 A;  3SHG B;  2H1R A;  4LZZ A;  1E9S A;  2X4A A;  2V1U A;  3U60 A;  4LJ9 A;  2OPF A;  1PJJ A;  3RFW A;  3U60 B;  1IQP A;  3E4R A;  5A2Q S;  4DV5 M;  2QBY A;  1IM2 A;  4LRT A;  4JI0 M;  1Z5C A;  2QBY B;  1Q39 A;  3SMP A;  3SMS A;  4DR5 M;  4BBA A;  3OTO M;  1G4A E;  2RGO A;  1VDD A;  2DWN A;  3VK8 A;  1ZQ9 A;  2R46 A;  2VII A;  5KO3 A;  4DV2 M;  4L15 A;  3Q8X A;  4GKK M;  4LRS A;  4JI4 M;  1G3I A;  2UU9 M;  1HNW M;  1GKI A;  4MGK E;  4IBG A;  2KEB A;  4M0W A;  3EIE A;  2G5G X;  1T3T A;  1NY6 A;  3L27 A;  4R3D A;  1G59 A;  3ZC7 B;  2YFQ A;  3QAU A;  2DWL A;  3FTE A;  3GQ4 A;  3L28 A;  1QAO A;  2BJW A;  3KSJ A;  5FTL A;  4NSR A;  2XEP A;  4LFA M;  4BLC A;  4G4O A;  2L7I A;  3HKP A;  1R2Z A;  4X64 M;  3I51 A;  5FTN A;  2F5N A;  2FOI C;  3ILK A;  4B3R M;  3UGJ A;  1QAQ A;  5BR8 M;  4JI8 M;  3D8B A;  1WXQ A;  2L7H A;  2Y21 A;  3DFZ A;  3WHK A;  3SC3 A;  1IBM M;  2FE8 A;  3HU3 A;  3TWL A;  5BPV A;  4FWG A;  4WUR A;  3AOE C;  2KZU A;  3U6Q A;  4LG2 A;  4WW0 A;  2KRK A;  4B7H A;  4FCW A;  1QVR A;  1L1Z A;  5EQT A;  1DGF A;  4AG5 A;  2LH0 A;  1HNX M;  1XNR M;  4TUW A;  1TGU A;  4Z8X A;  3HJQ A;  3GPY A;  1X37 A;  4JV5 M;  1NVM A;  4PD2 A;  4CIS A;  4RF0 A;  4DR7 M;  1KSF X;  1IY1 A;  1IN8 A;  3GPU A;  4KLN A;  1IN4 A;  5IRE B;  5C18 A;  3IG5 A;  4LGY A;  4OVZ B;  1TDZ A;  4LF7 M;  1JR3 A;  2ZAN A;  3AV0 A;  2L6O A;  3SAT A;  3SAU A;  5GKN A;  2Z7J A;  3I4Y A;  5IZ7 D;  2OQ4 A;  2KRU A;  3T38 A;  2D7E A;  2RKO A;  2LWX A;  3MHV C;  2Y20 A;  4GH9 A;  3ZCB B;  1W5S A;  1PJI A;  3UK6 A;  4D80 A;  4I81 A;  1TH4 A;  5FLX S;  2I7P A;  3FKE A;  3U6E A;  3GRY A;  3J80 S;  3PXG A;  2E5L M;  4MGH A;  3HJS A;  1KFV A;  2XSZ A;  3FUV A;  4AW4 A;  4LGM A;  4X66 M;  4GC9 A;  2R4E A;  4M9S A;  3THG A;  1Z5A A;  1XC8 A;  2BJV A;  4W5W A;  4MB7 A;  4B3M M;  4G6Z A;  1IN6 A;  1TH2 A;  1HT1 E;  5ITR A;  3GRU A;  4G4N A;  4QHT A;  3FUX A;  3JAM S;  3J2P B;  3R9X B;  4FCV A;  1TH3 A;  4NRW A;  1FNN A;  2R18 A;  3W0F A;  4IBE A;  1GVN A;  2X8A A;  3LQR A;  3A45 A;  4LJA A;  3PNY A;  3PNV A;  2LXE A;  4NSO B;  2DWM A;  3E9S A;  2XH9 A;  1IN7 A;  1DO2 A;  1KYI A;  3UMM A;  5DYI A;  2CEA A;  3K1J A;  2UXB M;  4CHT B;  2KXE A;  1OFI A;  2CHV A;  1QZM A;  4IJF A;  4KOD A;  3RE8 A;  1XWI A;  3U5Z A;  1XMO M;  1S3S A;  3KOX E;  2Z3X A;  2QPA A;  3GQ3 A;  1R6B X;  3W0L B;  1EE8 A;  2FFJ A;  2Q2E B;  4IBB A;  4JN6 A;  3RGP A;  5FSW A;  3J81 S;  4ZPX A;  4B08 A;  4AKH A;  4P16 A;  4QOS A;  2R65 A;  4JI5 M;  4QOZ C;  4GRI A;  1MX0 A;  5EP3 A;  1NY5 A;  4EIW A;  3DOA A;  3KS4 A;  2EUC A;  2RGH A;  5E26 A;  4IJE A;  2V1C A;  3NBI A;  3FD9 A;  2VQE M;  4R7G A;  1HT2 E;  3DZD A;  2J7O A;  3VKH A;  4MGY E;  3KOY E;  5FTJ A;  3ZH9 B;  3FTF A;  3VKG A;  3GP1 A;  1QAN A;  1JQJ C;  1I4W A;  4JI3 M;  4M9X A;  4JXJ A;  3FUU A;  4DV3 M;  3TE6 A;  2C5R A;  2NQ8 C;  5JI2 E;  4LFB M;  2F4V M;  3VFD A;  4HLQ A;  5LMU M;  4DV0 M;  2CFO A;  2DXI A;  3H4M A;  5ITX A;  3GLI A;  4DV1 M;  2UUC M;  3L2A A;  4L78 A;  5ITY A;  4LY6 A;  1D2N A;  4DR1 M;  3R8F A;  1SXJ A;  2XZF A;  2ZAO A;  3QWL A;  4MGZ E;  2AHM A;  1I94 M;  1SXJ B;  2M60 A;  4B3S M;  1XNQ M;  4OU7 A;  1JR3 D;  2YNM D;  3C58 A;  3GLG A;  1J7K A;  1N78 A;  4JI2 M;  3U6D A;  2Z4S A;  2HCB A;  2QZ4 A;  2Y0T A;  2ZBK B;  3JR4 A;  2HKJ A;  4LF8 M;  3A46 A;  4OX9 M;  2A5Y B;  1ZAE A;  1N34 M;  4KHP M;  4LJ5 A;  2DVW B;  3KP1 E;  2C9O A;  2YR0 A;  3HWS A;  3KFU G;  1LV7 A;  3AOE A;  1DGH A;  3TPZ A;  2BNK A;  2XSZ D;  2DHR A;  4FCT A;  4RNA A;  3U6S A;  1DGH B;  4D82 A;  3GPX A;  3NWL A;  2R4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...