3TWKA

Crystal structure of arabidopsis thaliana fpg
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
293
structure length
293
Chain Sequence
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDSEEWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLYGKCVDKLAAALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase 1
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 79
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twkA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twkA01
4LF5M 2UUCM 1PJJA 4NXMM 4JYAM 3GQ5A 4G4QA 5LMUM 4LF9M 5A2QS 4DR2M 3A45A 4DV1M 4JI5M 3J80S 2XZFA 4DUZM 4GKKM 1PM5A 2OPFA 4DV0M 1Z59A 4LFAM 3SAWA 1XMOM 1L1ZA 1K82A 3C58A 3U6SA 4DV2M 3SASA 5LMNM 4DR4M 3OTOM 4X66M 3U6CA 3U6LA 5IT9S 3GPXA 2UXBM 2EA0A 4JI0M 4LF7M 1PJIA 4LF4M 4DR7M 1Q3CA 4JI3M 4JV5M 1EE8A 4CISA 4DV3M 1XC8A 4DR6M 1Q3BA 2VQFM 3J7AS 1N34M 4LF6M 1NNJA 1Z5CA 2VQEM 4B3MM 3A46A 3GP1A 5ITUA 3JR4A 4LFCM 4MB7A 2HHHM 2F5QA 4G4NA 1Z5BA 5ITTA 3DOAA 4DR1M 4X65M 1MX0A 4JI2M 1KFVA 4DV7M 1N33M 3TWLA 4OX9M 3GPPA 3SAUA 2E5LM 5ITXE 3GQ4A 4G4RA 3SAVA 1J5EM 4NRVA 2F5NA 1MU5A 4JI8M 1N32M 1TDHA 4PDIA 3U6OA 1TDZA 1R2YA 3SBJA 2UUAM 4K0KM 3GPUA 4G4OA 1HNZM 2F5SA 4NRWA 1Q39A 2UXCM 5BR8M 1L1TA 4YHHM 3SATA 1XNRM 5ITXA 2F5PA 3U6EA 3GO8A 3J81S 4AQYM 2UXDM 5ITQA 3GPYA 4DR5M 1I94M 4PD2A 2UU9M 4JI6M 5IWAM 2ZBKB 4PDGA 3U6PA 2F4VM 1XMQM 3A42A 4DV6M 1IBMM 1HR0M 4DUYM 3GQ3A 3TWMA 3U6QA 3VK8A 1K3XA 4PCZA 1N36M 1R2ZA 3SARA 1Z5AA 1IBLM 3W0FA 2F5OA 5ITRA 2HKJA 1HNXM 4B3RM 5ITYA 4DV5M 3JAMS 4DR3M 4NXNM 4GKJM 3U6MA 4JI1M 2UUBM 4X62M 1L2BA 4JI7M 2XZUA 2Q2EB 4DV4M 5FLXS 1L2CA 4JI4M 3VK7A 3U6DA 3JR5A 2ZM6M 3T1YM 1XNQM 1IBKM 2OQ4A 4YY3M 4B3TM 3TWKA 1FJGM 3T1HM 4X64M 1HNWM 4B3SM 1L2DA 4LFBM 4ITQA 4KHPM 4LF8M 1K3WA
chains in the Genus database with same CATH superfamily
3T38A 1C1KA 1D2NA 2KNVA 1E9RA 2R45A 4FWHA 2UUCM 1PJJA 3H4MA 4LF5M 3U5ZA 5FTNA 2FE8A 1IXSB 2LH0A 3D8LA 2JZ0A 2X49A 5LMUM 4ZPXA 3T6PA 4I4LA 3CF6E 5A2QS 2YQZA 2X4AA 3U5ZB 1WR1B 2HAKA 3J80S 3SHFA 4G3OA 3VKGA 1QAQA 2K9DA 1JB0F 3D8BA 2RGOA 3HGIA 3LCVB 1XMOM 1L1ZA 4AI6A 1ZMVA 3GLFA 2LVNC 3AL0C 1UM8A 2JY7A 2V1CA 1DO2A 1G71A 1HJPA 3GLGE 5LMNM 3H4JA 1NY6A 3W0LB 4X66M 3U6LA 5IT9S 3MMPA 2EO2A 3GLFB 3GPXA 2O5RA 3GLHB 4M0WA 2EA0A 1WIVA 4L6V6 2R18A 3FUUA 4LF4M 3SC3A 4DR7M 4JI3M 2J7OA 2X8AA 2QBYA 3GLHE 2ZAOA 1XC8A 1Q3BA 3FTCA 3TPZA 1DGFA 1JQJC 2RGHA 4DR6M 3HX3A 1IY1A 3CTWB 2CHQA 4F2LA 2QBYB 4D82A 4LF6M 4OVZA 2LVAA 1DV0A 3UK6A 5KPZA 3A46A 1VG5A 4MH0E 3JR4A 2N35A 1IXRC 4HEOA 2XFSA 2L7IA 3M0EA 4OVZB 5ITTA 3L25A 1ZMUA 3PNVA 4GITA 1TH4A 2FOIC 4M0DA 4R3DA 4L78A 1DO0A 1G4AE 2EKKA 4X65M 1N33M 2ZAMA 4LJ6A 1I4WA 3J27B 4G4RA 3WHKA 4KLNA 4FVMA 2DHRA 4AKIA 3HHWA 1GVNA 1MN3A 3CF2A 3E4RA 1IM2A 3HZJA 2GNOA 1NHWC 1G41A 4IBBA 4CIZA 3AOEA 2ERCA 2H5XA 2OOBA 3GPUA 4FD2A 1X37A 4JN6A 3SYLA 4YHHM 2MGWA 1R7RA 2Y0TA 3I01M 5ITXA 2F5PA 3HY5A 2LNHC 4LRSA 3HHYA 3W67A 3Q8XA 3NWLA 4JI6M 8CATA 5IWAM 2DZOB 3TWMA 2L2DA 2Y20A 3F92A 4IBEA 4P17A 4REZA 4PCZA 3L26A 3U6QA 1R2ZA 3FD9A 2R4JA 1IN5A 5ITRA 2L09A 2KW0A 1R5LA 2R6FA 5JI3E 1HNXM 3SMPA 5ITYA 3MJ5A 3KFUG 4DR3M 1SXJA 4I5SA 4LJ7A 2JY8A 4X62M 2UUBM 4CGYB 2KA6B 4JI7M 4JI1M 2JZ1A 3BOSA 2EKFA 4DV4M 2LVOC 2Z4SA 4L16A 1SXJB 5EJCA 1VEGA 5FTJA 2OQ4A 3GLIB 3THGA 3TWKA 2CP8A 5C18A 3GRYA 1SXJE 1WGLA 3UGJA 1WJ7A 1YSYA 3E9SA 1ZQ9A 4X64M 3W68A 3GLIE 2WZJA 3FUVA 3HU2A 4AW4A 1HNWM 3BXWA 4FCTA 1PGYA 1JR3E 1QZEA 2ZTDA 3HHZA 1NHGC 3TL4X 4IBKA 4NOOB 1L2DA 4LFBM 4TUWA 4AZFA 1HQYE 2OOAA 2W82A 1K3WA 4KO8A 1NNUC 3NBXX 2P5TA 1N75A 4CJ6A 2C98A 4AKHA 1PJSA 3K92A 4LJAA 1ZV1A 4G4QA 2XEPA 1OKSA 3KS4A 2R0IA 4A3VB 1WGNA 3HHXA 2XSZD 3DZDA 3B7NA 2DAEA 3NBIA 3KOXE 4GKKM 3KP0E 4RKUF 2OPFA 1Z6TA 5GKNA 1Z59A 3LQRA 3SAWA 4AKGA 2D7GA 1OQYA 2BWEA 2CV2A 1PJQA 2AHMA 2VF8A 3PNYA 1VQ1A 2B3TA 1QVRA 3OTOM 1ZAEA 1GKIA 2I7PA 3U6CA 1DGGA 2YNMD 4LG2A 2LXEA 5EXSA 3E21A 1IXSA 5DYIA 3TE6A 1ORYB 1P3QQ 3K1JA 4IBIA 1E94E 2QPAA 3UMMA 4FCWA 3B7QA 3BBZA 2VQFM 1W5SA 1TH2A 2JP7A 1IFYA 1GL6A 5EP4A 3ZQJA 4GHAA 2RRUA 3GP1A 2L4EA 3GLGA 4IBFA 4RF1A 4LFCM 3B9PA 4MB7A 4BBAA 2F5QA 2HHHM 3DOAA 4KODA 3HWSA 3GLGB 3QYEA 4JI2M 4GMQA 3GRUA 3KVWA 2KHHA 5EXPA 3GLHA 1QUSA 2WSEF 3KSJA 3LW5F 3PVSA 5EP1A 2C99A 2MR9A 1F4IA 4NRVA 3LVVA 3A98B 3ILKA 2HCBA 4QOSA 2XGNA 3I04M 2C96A 3GRVA 1TDHA 3I51A 2DKLA 5EP3A 1C7YA 1QAOA 4JI8M 1N32M 1R2YA 1OIZA 3KSXA 1GO5A 3FRHA 4K0KM 2Y0QA 4IBCA 2VF7A 2F5SA 4NRWA 4XBOA 1Q39A 3V76A 2WSCF 3KOYE 5BR8M 1YE9A 1XNRM 2JNHA 3U6EA 3J81S 1DGHA 5FSWA 1H6UA 4WURA 3DA1A 3GRRA 2UU9M 3VFDA 1VEJA 2ZBKB 3FTEA 2F4VM 1DGHB 4DV6M 4HL4A 1HR0M 2RKOA 3SARA 2KXEA 2DAMA 3FKEA 1OAOC 1G59A 2L7HA 3KOZE 3QYBA 2HL7A 1NSFA 4IJEA 5EXXA 1TGUA 3JAMS 2O01F 2QNJA 4GKJM 2Z7JA 3M6AA 1MJGM 3U6MA 2DENA 4HLQA 5EXTA 2Q2EB 2R46A 1T6OA 4RF0A 4BB9A 4JI4M 3FUXA 3B7ZA 1HT2E 3KDSE 2ZM6M 3LMMA 4G6ZA 1L8QA 3FYCA 2DZNB 1VDDA 3LVWA 3AJIB 2NQ8C 4NC6A 1GJSA 2BWBA 1NVMA 4QNMA 2CEAA 4MGIE 4L8RC 1IN6A 2R65A 2VDBB 2XH9A 4GH9A 2FS1A 3L29A 1IY2A 1XB2B 1XWIA 4B7GA 5JI2E 4FW9A 4MGZE 3R8FA 4LF8M 2DAKA 4IIWA 4JYAM 4II7A 2DWLA 3VDUA 4LJ8A 2Z8YM 4L4UA 3HU3A 4EIWA 2KNZA 3A45A 1TH3A 2MROB 1V34A 2Y21A 4DV1M 5EP2A 2XF3A 3GLIA 2XZFA 4DUZM 1DGBA 1PM5A 2D7EA 1JR3A 1SG9A 1A5TA 3KS8A 4R7GA 3IECA 4LFAM 1K82A 1HQCA 3U6SA 4DV2M 3SASA 2J7NA 4FWDA 1GL7A 3FTFA 2LVQD 1G8PA 1EIJA 3K9OA 1T3TA 3DFZA 1ZMWA 1SXJD 4LJ5A 2DVWB 1XXHE 3K9PA 2R4EA 5C1BA 2UXBM 1NV9A 4JI0M 4LF7M 1R6BX 4JXJA 2LHGA 1VDLA 2OO9A 2MH8A 4JV5M 2VIIA 1EE8A 4NSRA 2BJWA 3PFIA 3ZC7B 5F3WA 2JA2A 2BNKA 3ZCBB 1R4GA 4Y28F 3J7AS 1GABA 3ZH9B 2J5YA 2KZUA 1IY0A 2CE7A 3FE3A 2L6OA 5ITUA 2L4FA 4OW0A 1PRBA 3K8ZA 3J7BA 4Z8XA 1IN7A 1Z5BA 3SHGB 2JXNA 3E46A 1IN8A 2DWZB 3SAUA 1QDRA 3GQ4A 1Q02A 2JY5A 1GLNA 3KXEC 1QUTA 2F5NA 2KDLA 1MU5A 4PDIA 2C9CA 2DWNA 4NSOB 5KO3A 1PJTA 1IN4A 4LJ9A 3VDPA 2UUAM 2LBCA 2KRUA 1OTRA 4G4OA 1HNZM 2K47A 3L2AA 1TF0B 1L1TA 4AG5A 3C3EA 4Z6YA 3SATA 4D80A 5L8RF 2ZANA 1OFIA 3CGWA 4KT0F 1D0LA 2CHVA 4NL4H 3QWLA 3GO8A 1OIPA 3GPYA 5IZ7D 4DR5M 1I94M 2MJ5B 1LTMA 2DNAA 4PD2A 1QAMA 3CF0A 1XMQM 3A42A 2CV1A 1IBMM 2QP9X 3C3DA 1FNNA 4GIPA 5DNYA 1TTEA 1K3XA 1VEKA 1N36M 1Z5AA 4Q7JA 4MGHA 2K6BA 1S3SA 5FTLA 3I4VA 4DV5M 4NXNM 2JWSA 1XHBA 4MM3B 5FTMA 3PXGA 3U6DA 3JR5A 2YR0A 4B3TM 4CHTB 2DZLA 1FJGM 1KYIA 1E32A 4WP2A 3T1HM 2APLA 5EQTA 4QNRA 1NJFA 2JY6B 1CUKA 2QQ8A 1V92A 4B3SM 1QZMA 2G8LA 1QYRA 4B08A 2XLJA 2Z3XA 1N78A 1NO1A 4KHPM 4GRIA 3WHLA 1NV8A 3GLFE 2CWBA 3AOGA 2EUCA 2BJVA 4NXMM 2XFTA 2EJSA 4MGYE 1IQPA 2LTUA 3GQ5A 2D7HA 2I7NA 4M9ZA 3TQSA 4LF9M 2JUJA 1V33A 4DR2M 4I81A 1RU3A 1HT1E 2A5YB 2QHOB 3FUWA 4JI5M 4R71A 2C9OA 2YFQA 1OAIA 3MK6A 1BVSA 3AV0A 4DV0M 1LV7A 2DHYA 2CV0A 2CUZA 1YLAA 3IHPA 3C58A 1KFVA 3AKZA 2DAIA 1D0KA 2G5GX 3LCUA 4DR4M 7CATA 3AFHA 4P16A 1QQWA 2V6ZM 5KPTA 2GQFA 2FH0A 4I8OA 2CFOA 3KP1E 1PJIA 3UJNA 3HKPA 1Q3CA 3SMSA 4FWGA 1QANA 2QENA 3HJQA 4S12A 4CISA 4DV3M 2FNAA 1YUBA 1OFHA 2HWJA 4B7HA 1G3IA 1GJTA 4GC9A 4WW0A 2KNAA 1N34M 4IBDA 1NNJA 1Z5CA 2G3QA 2LHCA 3MHVC 2VQEM 1AIPC 4B3MM 5DYGA 3R9XB 1NY5A 4G4NA 4OU7A 3HJSA 1XXHA 5KQ8A 3U61A 4DR1M 2M5ZA 3LQQA 2H1RA 1MX0A 1D0MA 3RGSA 3SYKA 2LVPC 2ZTCA 4LZZA 4DV7M 3EIEA 1W5TA 4LZJA 1XXHB 2QSFX 4PT5A 3TWLA 3GPPA 3U61B 2R62A 4OX9M 3KW6A 3I4YA 2E5LM 3B89A 1NJGA 3J2PB 2DAGA 5ITXE 4AG6A 3SAVA 3VLFB 2WSFF 4RNAA 3L28A 4ANRA 3VKHA 2KRKA 3SFZA 3U6OA 5KPRA 1J09A 1JR3D 3KOWE 1TDZA 2K0BX 3SBJA 1UFZA 3M7GA 4IBGA 1TR8A 4L15A 4IJFA 4GC5A 5IREB 4DBGB 1T43A 3AOEC 4LCBA 5H37D 4D81A 2DXIA 1QDTA 5BPVA 2QZ4A 3FYDA 2UXCM 1AUAA 3Q8GA 4XGIA 2C5RA 4QHSA 3HJ8A 5KQDA 5E26A 2QCUA 4AQYM 4MGKE 2UXDM 1WXQA 3FUTA 3K2LA 4UN2B 5ITQA 3UZUA 5FTKA 5DFLA 2XSZA 4LGMA 4PDGA 3U6PA 1E9SA 2KZSA 3FTDA 3L27A 4LJ4A 3HU1A 4DUYM 3GQ3A 2CRUA 3VK8A 3C9PA 3RGPA 1IBLM 1Y8GA 3W0FA 4LY6A 2F5OA 2DI0A 1OJLA 2HKJA 2R44A 4B3RM 2KEBA 1N77A 2FFJA 4F1IA 3FRIA 3IG8A 4LRTA 5E6JA 4M9SA 1L2BA 1SXJC 1WHCA 4W5WA 2XZUA 5FLXS 1L2CA 2LWXA 3VK7A 3T1YM 4FCVA 3B74A 1XNQM 1J7KA 2Z4RA 2DWMA 1IBKM 4LGYA 1EFUB 4YY3M 3U60A 4GHLA 2V1UA 2O25A 4XK8F 1KSFX 3RFWA 4QOZC 1IXZA 3U60B 4GEWA 3T15A 3EIHA 3QAUA 2CHGA 4B7FA 2M60A 3IG5A 4BLCA 4ITQA 4QHTA 4M9XA 1J5EM 3RE8A 4IBJA
chains in the Genus database with same CATH topology
3T38A 1C1KA 1D2NA 1E9RA 2R45A 4FWHA 2UUCM 1PJJA 3H4MA 4LF5M 3U5ZA 5FTNA 2FE8A 1IXSB 2LH0A 3D8LA 2X49A 5LMUM 4ZPXA 4I4LA 3CF6E 5A2QS 2YQZA 2X4AA 3U5ZB 3J80S 3SHFA 3VKGA 1QAQA 3D8BA 3HGIA 2RGOA 1XMOM 1L1ZA 4AI6A 3GLFA 3AL0C 1UM8A 2V1CA 1DO2A 5LMNM 1NY6A 3W0LB 4X66M 3U6LA 5IT9S 2EO2A 3GLFB 3GPXA 2O5RA 3GLHB 4M0WA 2EA0A 2R18A 3FUUA 4LF4M 3SC3A 4DR7M 4JI3M 2J7OA 2X8AA 2QBYA 2ZAOA 1XC8A 1Q3BA 3FTCA 3TPZA 1DGFA 1JQJC 2RGHA 4DR6M 1IY1A 3CTWB 2CHQA 2QBYB 4LF6M 4D82A 4OVZA 3UK6A 5KPZA 3A46A 4MH0E 3JR4A 1IXRC 2XFSA 2L7IA 3M0EA 4OVZB 5ITTA 3L25A 3PNVA 4GITA 4L78A 1TH4A 2FOIC 4M0DA 4R3DA 4X65M 1DO0A 1G4AE 1N33M 2ZAMA 4LJ6A 1I4WA 3J27B 4G4RA 3WHKA 4KLNA 4FVMA 2DHRA 4AKIA 3HHWA 1GVNA 3CF2A 3E4RA 1IM2A 1NHWC 1G41A 4IBBA 3AOEA 2ERCA 3GPUA 4FD2A 1X37A 4JN6A 3SYLA 4YHHM 1R7RA 2Y0TA 5ITXA 2F5PA 2LNHC 4LRSA 3HHYA 3Q8XA 3NWLA 4JI6M 8CATA 5IWAM 2DZOB 3TWMA 3U6QA 2Y20A 4IBEA 4REZA 4PCZA 3L26A 1R2ZA 3FD9A 2R4JA 1IN5A 5ITRA 2L09A 2KW0A 5JI3E 1HNXM 3SMPA 5ITYA 3MJ5A 3KFUG 4DR3M 1SXJA 4I5SA 4LJ7A 2UUBM 4X62M 4JI7M 4CGYB 2KA6B 4JI1M 3BOSA 4DV4M 2Z4SA 4L16A 1SXJB 5EJCA 5FTJA 2OQ4A 3GLIB 3THGA 3TWKA 5C18A 3GRYA 1SXJE 3UGJA 1YSYA 3E9SA 1ZQ9A 4X64M 1HNWM 3FUVA 3HU2A 4AW4A 4FCTA 3HHZA 1NHGC 3TL4X 4IBKA 4NOOB 1L2DA 4LFBM 4TUWA 4AZFA 1HQYE 1K3WA 2W82A 4KO8A 1NNUC 2P5TA 1N75A 2C98A 3K92A 4LJAA 4G4QA 2XEPA 3KS4A 4A3VB 3HHXA 2XSZD 3DZDA 3NBIA 3KOXE 4GKKM 3KP0E 2OPFA 1Z6TA 5GKNA 1Z59A 3LQRA 3SAWA 4AKGA 2D7GA 2CV2A 2AHMA 3PNYA 1QVRA 3OTOM 1ZAEA 1GKIA 2I7PA 3U6CA 1DGGA 2YNMD 4LG2A 2LXEA 5EXSA 5DYIA 3TE6A 1ORYB 3K1JA 4IBIA 1E94E 2QPAA 3UMMA 4FCWA 2VQFM 1W5SA 1TH2A 1GL6A 5EP4A 4GHAA 3GP1A 3GLGA 4LFCM 4IBFA 4RF1A 3B9PA 4MB7A 4BBAA 2F5QA 2HHHM 3DOAA 4KODA 3HWSA 3GLGB 4JI2M 4GMQA 3GRUA 3KVWA 5EXPA 3GLHA 3KSJA 3PVSA 5EP1A 2C99A 4NRVA 3LVVA 3A98B 3ILKA 2HCBA 4QOSA 2XGNA 4JI8M 2C96A 3GRVA 1TDHA 3I51A 5EP3A 1N32M 1QAOA 1R2YA 3KSXA 4K0KM 2Y0QA 4IBCA 2F5SA 4NRWA 4XBOA 1Q39A 3KOYE 5BR8M 1YE9A 1XNRM 3U6EA 3J81S 1DGHA 5FSWA 1H6UA 4WURA 3DA1A 3GRRA 2UU9M 3VFDA 2ZBKB 3FTEA 2F4VM 1DGHB 4DV6M 4HL4A 1HR0M 2RKOA 3SARA 2KXEA 3FKEA 1G59A 2L7HA 3KOZE 2HL7A 1NSFA 4IJEA 5EXXA 1TGUA 3JAMS 4GKJM 2Z7JA 3M6AA 3U6MA 4HLQA 5EXTA 2Q2EB 2R46A 4RF0A 4BB9A 4JI4M 3FUXA 2ZM6M 1HT2E 3KDSE 3LMMA 4G6ZA 1L8QA 3FYCA 2DZNB 1VDDA 3LVWA 3AJIB 2NQ8C 1NVMA 4QNMA 2CEAA 4MGIE 4L8RC 1IN6A 2R65A 2XH9A 4GH9A 3L29A 1IY2A 1XWIA 4B7GA 5JI2E 4FW9A 4MGZE 3R8FA 4LF8M 4IIWA 4JYAM 4II7A 2DWLA 3VDUA 4LJ8A 4L4UA 3HU3A 4EIWA 3A45A 1TH3A 2Y21A 4DV1M 5EP2A 2XF3A 3GLIA 2XZFA 4DUZM 1DGBA 1PM5A 2D7EA 1JR3A 3KS8A 4R7GA 4LFAM 1K82A 1HQCA 3U6SA 4DV2M 3SASA 2J7NA 4FWDA 1GL7A 3FTFA 1G8PA 1T3TA 3DFZA 1SXJD 4LJ5A 2DVWB 5C1BA 2R4EA 2UXBM 4JI0M 4LF7M 1R6BX 4JXJA 4JV5M 2VIIA 1EE8A 4NSRA 2BJWA 3PFIA 3ZC7B 5F3WA 2JA2A 2BNKA 3ZCBB 3J7AS 3ZH9B 2KZUA 1IY0A 2CE7A 2L6OA 5ITUA 4OW0A 3K8ZA 3J7BA 4Z8XA 1IN7A 1Z5BA 3SHGB 1IN8A 2DWZB 3SAUA 3GQ4A 1GLNA 3KXEC 2F5NA 1MU5A 4PDIA 2C9CA 2DWNA 4NSOB 5KO3A 1IN4A 4LJ9A 3VDPA 2UUAM 2KRUA 4G4OA 1HNZM 2K47A 3L2AA 1L1TA 4AG5A 4Z6YA 3SATA 4D80A 2ZANA 1OFIA 2CHVA 4NL4H 3QWLA 3GO8A 3GPYA 5IZ7D 4DR5M 1I94M 4PD2A 1QAMA 3CF0A 1XMQM 3A42A 2CV1A 1IBMM 2QP9X 4GIPA 1FNNA 5DNYA 1K3XA 1N36M 1Z5AA 4MGHA 1S3SA 5FTLA 3I4VA 4DV5M 4NXNM 1XHBA 4MM3B 5FTMA 3PXGA 3U6DA 3JR5A 2YR0A 4B3TM 4CHTB 1FJGM 1KYIA 1E32A 3T1HM 5EQTA 4QNRA 1NJFA 4B3SM 1QZMA 2G8LA 1QYRA 4B08A 2XLJA 2Z3XA 1N78A 4KHPM 4GRIA 3WHLA 3AOGA 2EUCA 2BJVA 4NXMM 2XFTA 4MGYE 1IQPA 3GQ5A 2D7HA 2I7NA 4M9ZA 3TQSA 4LF9M 4DR2M 4I81A 2A5YB 1HT1E 3FUWA 4JI5M 2C9OA 2YFQA 3MK6A 3AV0A 4DV0M 1LV7A 2CV0A 2CUZA 3C58A 3AKZA 2G5GX 4DR4M 7CATA 3AFHA 4P16A 1QQWA 2V6ZM 5KPTA 4I8OA 2CFOA 3KP1E 1PJIA 3UJNA 3HKPA 1Q3CA 3SMSA 4FWGA 1QANA 2QENA 3HJQA 4S12A 4CISA 4DV3M 2FNAA 1YUBA 1OFHA 4B7HA 1G3IA 4GC9A 4WW0A 1N34M 4IBDA 1NNJA 1Z5CA 3MHVC 2VQEM 4B3MM 5DYGA 3R9XB 1NY5A 4G4NA 4OU7A 3HJSA 1XXHA 5KQ8A 3U61A 4DR1M 2M5ZA 3LQQA 2H1RA 1MX0A 3RGSA 3SYKA 4DV7M 1KFVA 4LZZA 4AKHA 3EIEA 1W5TA 4LZJA 1XXHB 4PT5A 3TWLA 3GPPA 3U61B 4OX9M 2R62A 3KW6A 3I4YA 2E5LM 5ITXE 1NJGA 3J2PB 4AG6A 3SAVA 3VLFB 4RNAA 3L28A 3VKHA 2KRKA 3SFZA 3U6OA 5KPRA 1J09A 1JR3D 3KOWE 1TDZA 3SBJA 3M7GA 4IBGA 4L15A 4IJFA 4GC5A 5IREB 3AOEC 4LCBA 2DXIA 5H37D 4D81A 5BPVA 2QZ4A 3FYDA 2UXCM 4XGIA 2C5RA 4QHSA 3HJ8A 5KQDA 5E26A 2QCUA 4AQYM 4MGKE 2UXDM 1WXQA 3FUTA 3K2LA 5ITQA 3UZUA 5FTKA 2XSZA 4LGMA 4PDGA 3U6PA 1E9SA 2KZSA 3FTDA 3L27A 4LJ4A 3HU1A 4DUYM 3GQ3A 3VK8A 3RGPA 1IBLM 3W0FA 2F5OA 4LY6A 1OJLA 2HKJA 4B3RM 2KEBA 1N77A 2FFJA 3IG8A 4LRTA 5E6JA 4M9SA 1L2BA 1SXJC 4W5WA 2XZUA 5FLXS 1L2CA 2LWXA 3VK7A 3T1YM 4FCVA 1XNQM 1J7KA 2Z4RA 2DWMA 1IBKM 4LGYA 4YY3M 3U60A 4GHLA 2V1UA 3RFWA 1KSFX 4QOZC 1IXZA 3U60B 3T15A 3EIHA 3QAUA 2CHGA 4B7FA 2M60A 3IG5A 4BLCA 4ITQA 4QHTA 4M9XA 1J5EM 3RE8A 4IBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 M;  2UUC M;  1PJJ A;  4NXM M;  4JYA M;  3GQ5 A;  4G4Q A;  5LMU M;  4LF9 M;  5A2Q S;  4DR2 M;  3A45 A;  4DV1 M;  4JI5 M;  3J80 S;  2XZF A;  4DUZ M;  4GKK M;  1PM5 A;  2OPF A;  4DV0 M;  1Z59 A;  4LFA M;  3SAW A;  1XMO M;  1L1Z A;  1K82 A;  3C58 A;  3U6S A;  4DV2 M;  3SAS A;  5LMN M;  4DR4 M;  3OTO M;  4X66 M;  3U6C A;  3U6L A;  5IT9 S;  3GPX A;  2UXB M;  2EA0 A;  4JI0 M;  4LF7 M;  1PJI A;  4LF4 M;  4DR7 M;  1Q3C A;  4JI3 M;  4JV5 M;  1EE8 A;  4CIS A;  4DV3 M;  1XC8 A;  4DR6 M;  1Q3B A;  2VQF M;  3J7A S;  1N34 M;  4LF6 M;  1NNJ A;  1Z5C A;  2VQE M;  4B3M M;  3A46 A;  3GP1 A;  5ITU A;  3JR4 A;  4LFC M;  4MB7 A;  2HHH M;  2F5Q A;  4G4N A;  1Z5B A;  5ITT A;  3DOA A;  4DR1 M;  4X65 M;  1MX0 A;  4JI2 M;  1KFV A;  4DV7 M;  1N33 M;  3TWL A;  4OX9 M;  3GPP A;  3SAU A;  2E5L M;  5ITX E;  3GQ4 A;  4G4R A;  3SAV A;  1J5E M;  4NRV A;  2F5N A;  1MU5 A;  4JI8 M;  1N32 M;  1TDH A;  4PDI A;  3U6O A;  1TDZ A;  1R2Y A;  3SBJ A;  2UUA M;  4K0K M;  3GPU A;  4G4O A;  1HNZ M;  2F5S A;  4NRW A;  1Q39 A;  2UXC M;  5BR8 M;  1L1T A;  4YHH M;  3SAT A;  1XNR M;  5ITX A;  2F5P A;  3U6E A;  3GO8 A;  3J81 S;  4AQY M;  2UXD M;  5ITQ A;  3GPY A;  4DR5 M;  1I94 M;  4PD2 A;  2UU9 M;  4JI6 M;  5IWA M;  2ZBK B;  4PDG A;  3U6P A;  2F4V M;  1XMQ M;  3A42 A;  4DV6 M;  1IBM M;  1HR0 M;  4DUY M;  3GQ3 A;  3TWM A;  3U6Q A;  3VK8 A;  1K3X A;  4PCZ A;  1N36 M;  1R2Z A;  3SAR A;  1Z5A A;  1IBL M;  3W0F A;  2F5O A;  5ITR A;  2HKJ A;  1HNX M;  4B3R M;  5ITY A;  4DV5 M;  3JAM S;  4DR3 M;  4NXN M;  4GKJ M;  3U6M A;  4JI1 M;  2UUB M;  4X62 M;  1L2B A;  4JI7 M;  2XZU A;  2Q2E B;  4DV4 M;  5FLX S;  1L2C A;  4JI4 M;  3VK7 A;  3U6D A;  3JR5 A;  2ZM6 M;  3T1Y M;  1XNQ M;  1IBK M;  2OQ4 A;  4YY3 M;  4B3T M;  3TWK A;  1FJG M;  3T1H M;  4X64 M;  1HNW M;  4B3S M;  1L2D A;  4LFB M;  4ITQ A;  4KHP M;  4LF8 M;  1K3W A; 
#chains in the Genus database with same CATH topology
 3T38 A;  1C1K A;  1D2N A;  2KNV A;  1E9R A;  2R45 A;  4FWH A;  2UUC M;  1PJJ A;  3H4M A;  4LF5 M;  3U5Z A;  5FTN A;  2FE8 A;  1IXS B;  2LH0 A;  3D8L A;  2JZ0 A;  2X49 A;  5LMU M;  4ZPX A;  3T6P A;  4I4L A;  3CF6 E;  5A2Q S;  2YQZ A;  2X4A A;  3U5Z B;  1WR1 B;  2HAK A;  3J80 S;  3SHF A;  4G3O A;  3VKG A;  1QAQ A;  2K9D A;  1JB0 F;  3D8B A;  2RGO A;  3HGI A;  3LCV B;  1XMO M;  1L1Z A;  4AI6 A;  1ZMV A;  3GLF A;  2LVN C;  3AL0 C;  1UM8 A;  2JY7 A;  2V1C A;  1DO2 A;  1G71 A;  1HJP A;  3GLG E;  5LMN M;  3H4J A;  1NY6 A;  3W0L B;  4X66 M;  3U6L A;  5IT9 S;  3MMP A;  2EO2 A;  3GLF B;  3GPX A;  2O5R A;  3GLH B;  4M0W A;  2EA0 A;  1WIV A;  4L6V 6;  2R18 A;  3FUU A;  4LF4 M;  3SC3 A;  4DR7 M;  4JI3 M;  2J7O A;  2X8A A;  2QBY A;  3GLH E;  2ZAO A;  1XC8 A;  1Q3B A;  3FTC A;  3TPZ A;  1DGF A;  1JQJ C;  2RGH A;  4DR6 M;  3HX3 A;  1IY1 A;  3CTW B;  2CHQ A;  4F2L A;  2QBY B;  4D82 A;  4LF6 M;  4OVZ A;  2LVA A;  1DV0 A;  3UK6 A;  5KPZ A;  3A46 A;  1VG5 A;  4MH0 E;  3JR4 A;  2N35 A;  1IXR C;  4HEO A;  2XFS A;  2L7I A;  3M0E A;  4OVZ B;  5ITT A;  3L25 A;  1ZMU A;  3PNV A;  4GIT A;  1TH4 A;  2FOI C;  4M0D A;  4R3D A;  4L78 A;  1DO0 A;  1G4A E;  2EKK A;  4X65 M;  1N33 M;  2ZAM A;  4LJ6 A;  1I4W A;  3J27 B;  4G4R A;  3WHK A;  4KLN A;  4FVM A;  2DHR A;  4AKI A;  3HHW A;  1GVN A;  1MN3 A;  3CF2 A;  3E4R A;  1IM2 A;  3HZJ A;  2GNO A;  1NHW C;  1G41 A;  4IBB A;  4CIZ A;  3AOE A;  2ERC A;  2H5X A;  2OOB A;  3GPU A;  4FD2 A;  1X37 A;  4JN6 A;  3SYL A;  4YHH M;  2MGW A;  1R7R A;  2Y0T A;  3I01 M;  5ITX A;  2F5P A;  3HY5 A;  2LNH C;  4LRS A;  3HHY A;  3W67 A;  3Q8X A;  3NWL A;  4JI6 M;  8CAT A;  5IWA M;  2DZO B;  3TWM A;  2L2D A;  2Y20 A;  3F92 A;  4IBE A;  4P17 A;  4REZ A;  4PCZ A;  3L26 A;  3U6Q A;  1R2Z A;  3FD9 A;  2R4J A;  1IN5 A;  5ITR A;  2L09 A;  2KW0 A;  1R5L A;  2R6F A;  5JI3 E;  1HNX M;  3SMP A;  5ITY A;  3MJ5 A;  3KFU G;  4DR3 M;  1SXJ A;  4I5S A;  4LJ7 A;  2JY8 A;  4X62 M;  2UUB M;  4CGY B;  2KA6 B;  4JI7 M;  4JI1 M;  2JZ1 A;  3BOS A;  2EKF A;  4DV4 M;  2LVO C;  2Z4S A;  4L16 A;  1SXJ B;  5EJC A;  1VEG A;  5FTJ A;  2OQ4 A;  3GLI B;  3THG A;  3TWK A;  2CP8 A;  5C18 A;  3GRY A;  1SXJ E;  1WGL A;  3UGJ A;  1WJ7 A;  1YSY A;  3E9S A;  1ZQ9 A;  4X64 M;  3W68 A;  3GLI E;  2WZJ A;  3FUV A;  3HU2 A;  4AW4 A;  1HNW M;  3BXW A;  4FCT A;  1PGY A;  1JR3 E;  1QZE A;  2ZTD A;  3HHZ A;  1NHG C;  3TL4 X;  4IBK A;  4NOO B;  1L2D A;  4LFB M;  4TUW A;  4AZF A;  1HQY E;  2OOA A;  2W82 A;  1K3W A;  4KO8 A;  1NNU C;  3NBX X;  2P5T A;  1N75 A;  4CJ6 A;  2C98 A;  4AKH A;  1PJS A;  3K92 A;  4LJA A;  1ZV1 A;  4G4Q A;  2XEP A;  1OKS A;  3KS4 A;  2R0I A;  4A3V B;  1WGN A;  3HHX A;  2XSZ D;  3DZD A;  3B7N A;  2DAE A;  3NBI A;  3KOX E;  4GKK M;  3KP0 E;  4RKU F;  2OPF A;  1Z6T A;  5GKN A;  1Z59 A;  3LQR A;  3SAW A;  4AKG A;  2D7G A;  1OQY A;  2BWE A;  2CV2 A;  1PJQ A;  2AHM A;  2VF8 A;  3PNY A;  1VQ1 A;  2B3T A;  1QVR A;  3OTO M;  1ZAE A;  1GKI A;  2I7P A;  3U6C A;  1DGG A;  2YNM D;  4LG2 A;  2LXE A;  5EXS A;  3E21 A;  1IXS A;  5DYI A;  3TE6 A;  1ORY B;  1P3Q Q;  3K1J A;  4IBI A;  1E94 E;  2QPA A;  3UMM A;  4FCW A;  3B7Q A;  3BBZ A;  2VQF M;  1W5S A;  1TH2 A;  2JP7 A;  1IFY A;  1GL6 A;  5EP4 A;  3ZQJ A;  4GHA A;  2RRU A;  3GP1 A;  2L4E A;  3GLG A;  4IBF A;  4RF1 A;  4LFC M;  3B9P A;  4MB7 A;  4BBA A;  2F5Q A;  2HHH M;  3DOA A;  4KOD A;  3HWS A;  3GLG B;  3QYE A;  4JI2 M;  4GMQ A;  3GRU A;  3KVW A;  2KHH A;  5EXP A;  3GLH A;  1QUS A;  2WSE F;  3KSJ A;  3LW5 F;  3PVS A;  5EP1 A;  2C99 A;  2MR9 A;  1F4I A;  4NRV A;  3LVV A;  3A98 B;  3ILK A;  2HCB A;  4QOS A;  2XGN A;  3I04 M;  2C96 A;  3GRV A;  1TDH A;  3I51 A;  2DKL A;  5EP3 A;  1C7Y A;  1QAO A;  4JI8 M;  1N32 M;  1R2Y A;  1OIZ A;  3KSX A;  1GO5 A;  3FRH A;  4K0K M;  2Y0Q A;  4IBC A;  2VF7 A;  2F5S A;  4NRW A;  4XBO A;  1Q39 A;  3V76 A;  2WSC F;  3KOY E;  5BR8 M;  1YE9 A;  1XNR M;  2JNH A;  3U6E A;  3J81 S;  1DGH A;  5FSW A;  1H6U A;  4WUR A;  3DA1 A;  3GRR A;  2UU9 M;  3VFD A;  1VEJ A;  2ZBK B;  3FTE A;  2F4V M;  1DGH B;  4DV6 M;  4HL4 A;  1HR0 M;  2RKO A;  3SAR A;  2KXE A;  2DAM A;  3FKE A;  1OAO C;  1G59 A;  2L7H A;  3KOZ E;  3QYB A;  2HL7 A;  1NSF A;  4IJE A;  5EXX A;  1TGU A;  3JAM S;  2O01 F;  2QNJ A;  4GKJ M;  2Z7J A;  3M6A A;  1MJG M;  3U6M A;  2DEN A;  4HLQ A;  5EXT A;  2Q2E B;  2R46 A;  1T6O A;  4RF0 A;  4BB9 A;  4JI4 M;  3FUX A;  3B7Z A;  1HT2 E;  3KDS E;  2ZM6 M;  3LMM A;  4G6Z A;  1L8Q A;  3FYC A;  2DZN B;  1VDD A;  3LVW A;  3AJI B;  2NQ8 C;  4NC6 A;  1GJS A;  2BWB A;  1NVM A;  4QNM A;  2CEA A;  4MGI E;  4L8R C;  1IN6 A;  2R65 A;  2VDB B;  2XH9 A;  4GH9 A;  2FS1 A;  3L29 A;  1IY2 A;  1XB2 B;  1XWI A;  4B7G A;  5JI2 E;  4FW9 A;  4MGZ E;  3R8F A;  4LF8 M;  2DAK A;  4IIW A;  4JYA M;  4II7 A;  2DWL A;  3VDU A;  4LJ8 A;  2Z8Y M;  4L4U A;  3HU3 A;  4EIW A;  2KNZ A;  3A45 A;  1TH3 A;  2MRO B;  1V34 A;  2Y21 A;  4DV1 M;  5EP2 A;  2XF3 A;  3GLI A;  2XZF A;  4DUZ M;  1DGB A;  1PM5 A;  2D7E A;  1JR3 A;  1SG9 A;  1A5T A;  3KS8 A;  4R7G A;  3IEC A;  4LFA M;  1K82 A;  1HQC A;  3U6S A;  4DV2 M;  3SAS A;  2J7N A;  4FWD A;  1GL7 A;  3FTF A;  2LVQ D;  1G8P A;  1EIJ A;  3K9O A;  1T3T A;  3DFZ A;  1ZMW A;  1SXJ D;  4LJ5 A;  2DVW B;  1XXH E;  3K9P A;  2R4E A;  5C1B A;  2UXB M;  1NV9 A;  4JI0 M;  4LF7 M;  1R6B X;  4JXJ A;  2LHG A;  1VDL A;  2OO9 A;  2MH8 A;  4JV5 M;  2VII A;  1EE8 A;  4NSR A;  2BJW A;  3PFI A;  3ZC7 B;  5F3W A;  2JA2 A;  2BNK A;  3ZCB B;  1R4G A;  4Y28 F;  3J7A S;  1GAB A;  3ZH9 B;  2J5Y A;  2KZU A;  1IY0 A;  2CE7 A;  3FE3 A;  2L6O A;  5ITU A;  2L4F A;  4OW0 A;  1PRB A;  3K8Z A;  3J7B A;  4Z8X A;  1IN7 A;  1Z5B A;  3SHG B;  2JXN A;  3E46 A;  1IN8 A;  2DWZ B;  3SAU A;  1QDR A;  3GQ4 A;  1Q02 A;  2JY5 A;  1GLN A;  3KXE C;  1QUT A;  2F5N A;  2KDL A;  1MU5 A;  4PDI A;  2C9C A;  2DWN A;  4NSO B;  5KO3 A;  1PJT A;  1IN4 A;  4LJ9 A;  3VDP A;  2UUA M;  2LBC A;  2KRU A;  1OTR A;  4G4O A;  1HNZ M;  2K47 A;  3L2A A;  1TF0 B;  1L1T A;  4AG5 A;  3C3E A;  4Z6Y A;  3SAT A;  4D80 A;  5L8R F;  2ZAN A;  1OFI A;  3CGW A;  4KT0 F;  1D0L A;  2CHV A;  4NL4 H;  3QWL A;  3GO8 A;  1OIP A;  3GPY A;  5IZ7 D;  4DR5 M;  1I94 M;  2MJ5 B;  1LTM A;  2DNA A;  4PD2 A;  1QAM A;  3CF0 A;  1XMQ M;  3A42 A;  2CV1 A;  1IBM M;  2QP9 X;  3C3D A;  1FNN A;  4GIP A;  5DNY A;  1TTE A;  1K3X A;  1VEK A;  1N36 M;  1Z5A A;  4Q7J A;  4MGH A;  2K6B A;  1S3S A;  5FTL A;  3I4V A;  4DV5 M;  4NXN M;  2JWS A;  1XHB A;  4MM3 B;  5FTM A;  3PXG A;  3U6D A;  3JR5 A;  2YR0 A;  4B3T M;  4CHT B;  2DZL A;  1FJG M;  1KYI A;  1E32 A;  4WP2 A;  3T1H M;  2APL A;  5EQT A;  4QNR A;  1NJF A;  2JY6 B;  1CUK A;  2QQ8 A;  1V92 A;  4B3S M;  1QZM A;  2G8L A;  1QYR A;  4B08 A;  2XLJ A;  2Z3X A;  1N78 A;  1NO1 A;  4KHP M;  4GRI A;  3WHL A;  1NV8 A;  3GLF E;  2CWB A;  3AOG A;  2EUC A;  2BJV A;  4NXM M;  2XFT A;  2EJS A;  4MGY E;  1IQP A;  2LTU A;  3GQ5 A;  2D7H A;  2I7N A;  4M9Z A;  3TQS A;  4LF9 M;  2JUJ A;  1V33 A;  4DR2 M;  4I81 A;  1RU3 A;  1HT1 E;  2A5Y B;  2QHO B;  3FUW A;  4JI5 M;  4R71 A;  2C9O A;  2YFQ A;  1OAI A;  3MK6 A;  1BVS A;  3AV0 A;  4DV0 M;  1LV7 A;  2DHY A;  2CV0 A;  2CUZ A;  1YLA A;  3IHP A;  3C58 A;  1KFV A;  3AKZ A;  2DAI A;  1D0K A;  2G5G X;  3LCU A;  4DR4 M;  7CAT A;  3AFH A;  4P16 A;  1QQW A;  2V6Z M;  5KPT A;  2GQF A;  2FH0 A;  4I8O A;  2CFO A;  3KP1 E;  1PJI A;  3UJN A;  3HKP A;  1Q3C A;  3SMS A;  4FWG A;  1QAN A;  2QEN A;  3HJQ A;  4S12 A;  4CIS A;  4DV3 M;  2FNA A;  1YUB A;  1OFH A;  2HWJ A;  4B7H A;  1G3I A;  1GJT A;  4GC9 A;  4WW0 A;  2KNA A;  1N34 M;  4IBD A;  1NNJ A;  1Z5C A;  2G3Q A;  2LHC A;  3MHV C;  2VQE M;  1AIP C;  4B3M M;  5DYG A;  3R9X B;  1NY5 A;  4G4N A;  4OU7 A;  3HJS A;  1XXH A;  5KQ8 A;  3U61 A;  4DR1 M;  2M5Z A;  3LQQ A;  2H1R A;  1MX0 A;  1D0M A;  3RGS A;  3SYK A;  2LVP C;  2ZTC A;  4LZZ A;  4DV7 M;  3EIE A;  1W5T A;  4LZJ A;  1XXH B;  2QSF X;  4PT5 A;  3TWL A;  3GPP A;  3U61 B;  2R62 A;  4OX9 M;  3KW6 A;  3I4Y A;  2E5L M;  3B89 A;  1NJG A;  3J2P B;  2DAG A;  5ITX E;  4AG6 A;  3SAV A;  3VLF B;  2WSF F;  4RNA A;  3L28 A;  4ANR A;  3VKH A;  2KRK A;  3SFZ A;  3U6O A;  5KPR A;  1J09 A;  1JR3 D;  3KOW E;  1TDZ A;  2K0B X;  3SBJ A;  1UFZ A;  3M7G A;  4IBG A;  1TR8 A;  4L15 A;  4IJF A;  4GC5 A;  5IRE B;  4DBG B;  1T43 A;  3AOE C;  4LCB A;  5H37 D;  4D81 A;  2DXI A;  1QDT A;  5BPV A;  2QZ4 A;  3FYD A;  2UXC M;  1AUA A;  3Q8G A;  4XGI A;  2C5R A;  4QHS A;  3HJ8 A;  5KQD A;  5E26 A;  2QCU A;  4AQY M;  4MGK E;  2UXD M;  1WXQ A;  3FUT A;  3K2L A;  4UN2 B;  5ITQ A;  3UZU A;  5FTK A;  5DFL A;  2XSZ A;  4LGM A;  4PDG A;  3U6P A;  1E9S A;  2KZS A;  3FTD A;  3L27 A;  4LJ4 A;  3HU1 A;  4DUY M;  3GQ3 A;  2CRU A;  3VK8 A;  3C9P A;  3RGP A;  1IBL M;  1Y8G A;  3W0F A;  4LY6 A;  2F5O A;  2DI0 A;  1OJL A;  2HKJ A;  2R44 A;  4B3R M;  2KEB A;  1N77 A;  2FFJ A;  4F1I A;  3FRI A;  3IG8 A;  4LRT A;  5E6J A;  4M9S A;  1L2B A;  1SXJ C;  1WHC A;  4W5W A;  2XZU A;  5FLX S;  1L2C A;  2LWX A;  3VK7 A;  3T1Y M;  4FCV A;  3B74 A;  1XNQ M;  1J7K A;  2Z4R A;  2DWM A;  1IBK M;  4LGY A;  1EFU B;  4YY3 M;  3U60 A;  4GHL A;  2V1U A;  2O25 A;  4XK8 F;  1KSF X;  3RFW A;  4QOZ C;  1IXZ A;  3U60 B;  4GEW A;  3T15 A;  3EIH A;  3QAU A;  2CHG A;  4B7F A;  2M60 A;  3IG5 A;  4BLC A;  4ITQ A;  4QHT A;  4M9X A;  1J5E M;  3RE8 A;  4IBJ A; 
#chains in the Genus database with same CATH homology
 3T38 A;  1C1K A;  1D2N A;  1E9R A;  2R45 A;  4FWH A;  2UUC M;  1PJJ A;  3H4M A;  4LF5 M;  3U5Z A;  5FTN A;  2FE8 A;  1IXS B;  2LH0 A;  3D8L A;  2X49 A;  5LMU M;  4ZPX A;  4I4L A;  3CF6 E;  5A2Q S;  2YQZ A;  2X4A A;  3U5Z B;  3J80 S;  3SHF A;  3VKG A;  1QAQ A;  3D8B A;  3HGI A;  2RGO A;  1XMO M;  1L1Z A;  4AI6 A;  3GLF A;  3AL0 C;  1UM8 A;  2V1C A;  1DO2 A;  5LMN M;  1NY6 A;  3W0L B;  4X66 M;  3U6L A;  5IT9 S;  2EO2 A;  3GLF B;  3GPX A;  2O5R A;  3GLH B;  4M0W A;  2EA0 A;  2R18 A;  3FUU A;  4LF4 M;  3SC3 A;  4DR7 M;  4JI3 M;  2J7O A;  2X8A A;  2QBY A;  2ZAO A;  1XC8 A;  1Q3B A;  3FTC A;  3TPZ A;  1DGF A;  1JQJ C;  2RGH A;  4DR6 M;  1IY1 A;  3CTW B;  2CHQ A;  2QBY B;  4LF6 M;  4D82 A;  4OVZ A;  3UK6 A;  5KPZ A;  3A46 A;  4MH0 E;  3JR4 A;  1IXR C;  2XFS A;  2L7I A;  3M0E A;  4OVZ B;  5ITT A;  3L25 A;  3PNV A;  4GIT A;  4L78 A;  1TH4 A;  2FOI C;  4M0D A;  4R3D A;  4X65 M;  1DO0 A;  1G4A E;  1N33 M;  2ZAM A;  4LJ6 A;  1I4W A;  3J27 B;  4G4R A;  3WHK A;  4KLN A;  4FVM A;  2DHR A;  4AKI A;  3HHW A;  1GVN A;  3CF2 A;  3E4R A;  1IM2 A;  1NHW C;  1G41 A;  4IBB A;  3AOE A;  2ERC A;  3GPU A;  4FD2 A;  1X37 A;  4JN6 A;  3SYL A;  4YHH M;  1R7R A;  2Y0T A;  5ITX A;  2F5P A;  2LNH C;  4LRS A;  3HHY A;  3Q8X A;  3NWL A;  4JI6 M;  8CAT A;  5IWA M;  2DZO B;  3TWM A;  3U6Q A;  2Y20 A;  4IBE A;  4REZ A;  4PCZ A;  3L26 A;  1R2Z A;  3FD9 A;  2R4J A;  1IN5 A;  5ITR A;  2L09 A;  2KW0 A;  5JI3 E;  1HNX M;  3SMP A;  5ITY A;  3MJ5 A;  3KFU G;  4DR3 M;  1SXJ A;  4I5S A;  4LJ7 A;  2UUB M;  4X62 M;  4JI7 M;  4CGY B;  2KA6 B;  4JI1 M;  3BOS A;  4DV4 M;  2Z4S A;  4L16 A;  1SXJ B;  5EJC A;  5FTJ A;  2OQ4 A;  3GLI B;  3THG A;  3TWK A;  5C18 A;  3GRY A;  1SXJ E;  3UGJ A;  1YSY A;  3E9S A;  1ZQ9 A;  4X64 M;  1HNW M;  3FUV A;  3HU2 A;  4AW4 A;  4FCT A;  3HHZ A;  1NHG C;  3TL4 X;  4IBK A;  4NOO B;  1L2D A;  4LFB M;  4TUW A;  4AZF A;  1HQY E;  1K3W A;  2W82 A;  4KO8 A;  1NNU C;  2P5T A;  1N75 A;  2C98 A;  3K92 A;  4LJA A;  4G4Q A;  2XEP A;  3KS4 A;  4A3V B;  3HHX A;  2XSZ D;  3DZD A;  3NBI A;  3KOX E;  4GKK M;  3KP0 E;  2OPF A;  1Z6T A;  5GKN A;  1Z59 A;  3LQR A;  3SAW A;  4AKG A;  2D7G A;  2CV2 A;  2AHM A;  3PNY A;  1QVR A;  3OTO M;  1ZAE A;  1GKI A;  2I7P A;  3U6C A;  1DGG A;  2YNM D;  4LG2 A;  2LXE A;  5EXS A;  5DYI A;  3TE6 A;  1ORY B;  3K1J A;  4IBI A;  1E94 E;  2QPA A;  3UMM A;  4FCW A;  2VQF M;  1W5S A;  1TH2 A;  1GL6 A;  5EP4 A;  4GHA A;  3GP1 A;  3GLG A;  4LFC M;  4IBF A;  4RF1 A;  3B9P A;  4MB7 A;  4BBA A;  2F5Q A;  2HHH M;  3DOA A;  4KOD A;  3HWS A;  3GLG B;  4JI2 M;  4GMQ A;  3GRU A;  3KVW A;  5EXP A;  3GLH A;  3KSJ A;  3PVS A;  5EP1 A;  2C99 A;  4NRV A;  3LVV A;  3A98 B;  3ILK A;  2HCB A;  4QOS A;  2XGN A;  4JI8 M;  2C96 A;  3GRV A;  1TDH A;  3I51 A;  5EP3 A;  1N32 M;  1QAO A;  1R2Y A;  3KSX A;  4K0K M;  2Y0Q A;  4IBC A;  2F5S A;  4NRW A;  4XBO A;  1Q39 A;  3KOY E;  5BR8 M;  1YE9 A;  1XNR M;  3U6E A;  3J81 S;  1DGH A;  5FSW A;  1H6U A;  4WUR A;  3DA1 A;  3GRR A;  2UU9 M;  3VFD A;  2ZBK B;  3FTE A;  2F4V M;  1DGH B;  4DV6 M;  4HL4 A;  1HR0 M;  2RKO A;  3SAR A;  2KXE A;  3FKE A;  1G59 A;  2L7H A;  3KOZ E;  2HL7 A;  1NSF A;  4IJE A;  5EXX A;  1TGU A;  3JAM S;  4GKJ M;  2Z7J A;  3M6A A;  3U6M A;  4HLQ A;  5EXT A;  2Q2E B;  2R46 A;  4RF0 A;  4BB9 A;  4JI4 M;  3FUX A;  2ZM6 M;  1HT2 E;  3KDS E;  3LMM A;  4G6Z A;  1L8Q A;  3FYC A;  2DZN B;  1VDD A;  3LVW A;  3AJI B;  2NQ8 C;  1NVM A;  4QNM A;  2CEA A;  4MGI E;  4L8R C;  1IN6 A;  2R65 A;  2XH9 A;  4GH9 A;  3L29 A;  1IY2 A;  1XWI A;  4B7G A;  5JI2 E;  4FW9 A;  4MGZ E;  3R8F A;  4LF8 M;  4IIW A;  4JYA M;  4II7 A;  2DWL A;  3VDU A;  4LJ8 A;  4L4U A;  3HU3 A;  4EIW A;  3A45 A;  1TH3 A;  2Y21 A;  4DV1 M;  5EP2 A;  2XF3 A;  3GLI A;  2XZF A;  4DUZ M;  1DGB A;  1PM5 A;  2D7E A;  1JR3 A;  3KS8 A;  4R7G A;  4LFA M;  1K82 A;  1HQC A;  3U6S A;  4DV2 M;  3SAS A;  2J7N A;  4FWD A;  1GL7 A;  3FTF A;  1G8P A;  1T3T A;  3DFZ A;  1SXJ D;  4LJ5 A;  2DVW B;  5C1B A;  2R4E A;  2UXB M;  4JI0 M;  4LF7 M;  1R6B X;  4JXJ A;  4JV5 M;  2VII A;  1EE8 A;  4NSR A;  2BJW A;  3PFI A;  3ZC7 B;  5F3W A;  2JA2 A;  2BNK A;  3ZCB B;  3J7A S;  3ZH9 B;  2KZU A;  1IY0 A;  2CE7 A;  2L6O A;  5ITU A;  4OW0 A;  3K8Z A;  3J7B A;  4Z8X A;  1IN7 A;  1Z5B A;  3SHG B;  1IN8 A;  2DWZ B;  3SAU A;  3GQ4 A;  1GLN A;  3KXE C;  2F5N A;  1MU5 A;  4PDI A;  2C9C A;  2DWN A;  4NSO B;  5KO3 A;  1IN4 A;  4LJ9 A;  3VDP A;  2UUA M;  2KRU A;  4G4O A;  1HNZ M;  2K47 A;  3L2A A;  1L1T A;  4AG5 A;  4Z6Y A;  3SAT A;  4D80 A;  2ZAN A;  1OFI A;  2CHV A;  4NL4 H;  3QWL A;  3GO8 A;  3GPY A;  5IZ7 D;  4DR5 M;  1I94 M;  4PD2 A;  1QAM A;  3CF0 A;  1XMQ M;  3A42 A;  2CV1 A;  1IBM M;  2QP9 X;  4GIP A;  1FNN A;  5DNY A;  1K3X A;  1N36 M;  1Z5A A;  4MGH A;  1S3S A;  5FTL A;  3I4V A;  4DV5 M;  4NXN M;  1XHB A;  4MM3 B;  5FTM A;  3PXG A;  3U6D A;  3JR5 A;  2YR0 A;  4B3T M;  4CHT B;  1FJG M;  1KYI A;  1E32 A;  3T1H M;  5EQT A;  4QNR A;  1NJF A;  4B3S M;  1QZM A;  2G8L A;  1QYR A;  4B08 A;  2XLJ A;  2Z3X A;  1N78 A;  4KHP M;  4GRI A;  3WHL A;  3AOG A;  2EUC A;  2BJV A;  4NXM M;  2XFT A;  4MGY E;  1IQP A;  3GQ5 A;  2D7H A;  2I7N A;  4M9Z A;  3TQS A;  4LF9 M;  4DR2 M;  4I81 A;  2A5Y B;  1HT1 E;  3FUW A;  4JI5 M;  2C9O A;  2YFQ A;  3MK6 A;  3AV0 A;  4DV0 M;  1LV7 A;  2CV0 A;  2CUZ A;  3C58 A;  3AKZ A;  2G5G X;  4DR4 M;  7CAT A;  3AFH A;  4P16 A;  1QQW A;  2V6Z M;  5KPT A;  4I8O A;  2CFO A;  3KP1 E;  1PJI A;  3UJN A;  3HKP A;  1Q3C A;  3SMS A;  4FWG A;  1QAN A;  2QEN A;  3HJQ A;  4S12 A;  4CIS A;  4DV3 M;  2FNA A;  1YUB A;  1OFH A;  4B7H A;  1G3I A;  4GC9 A;  4WW0 A;  1N34 M;  4IBD A;  1NNJ A;  1Z5C A;  3MHV C;  2VQE M;  4B3M M;  5DYG A;  3R9X B;  1NY5 A;  4G4N A;  4OU7 A;  3HJS A;  1XXH A;  5KQ8 A;  3U61 A;  4DR1 M;  2M5Z A;  3LQQ A;  2H1R A;  1MX0 A;  3RGS A;  3SYK A;  4DV7 M;  1KFV A;  4LZZ A;  4AKH A;  3EIE A;  1W5T A;  4LZJ A;  1XXH B;  4PT5 A;  3TWL A;  3GPP A;  3U61 B;  4OX9 M;  2R62 A;  3KW6 A;  3I4Y A;  2E5L M;  5ITX E;  1NJG A;  3J2P B;  4AG6 A;  3SAV A;  3VLF B;  4RNA A;  3L28 A;  3VKH A;  2KRK A;  3SFZ A;  3U6O A;  5KPR A;  1J09 A;  1JR3 D;  3KOW E;  1TDZ A;  3SBJ A;  3M7G A;  4IBG A;  4L15 A;  4IJF A;  4GC5 A;  5IRE B;  3AOE C;  4LCB A;  2DXI A;  5H37 D;  4D81 A;  5BPV A;  2QZ4 A;  3FYD A;  2UXC M;  4XGI A;  2C5R A;  4QHS A;  3HJ8 A;  5KQD A;  5E26 A;  2QCU A;  4AQY M;  4MGK E;  2UXD M;  1WXQ A;  3FUT A;  3K2L A;  5ITQ A;  3UZU A;  5FTK A;  2XSZ A;  4LGM A;  4PDG A;  3U6P A;  1E9S A;  2KZS A;  3FTD A;  3L27 A;  4LJ4 A;  3HU1 A;  4DUY M;  3GQ3 A;  3VK8 A;  3RGP A;  1IBL M;  3W0F A;  2F5O A;  4LY6 A;  1OJL A;  2HKJ A;  4B3R M;  2KEB A;  1N77 A;  2FFJ A;  3IG8 A;  4LRT A;  5E6J A;  4M9S A;  1L2B A;  1SXJ C;  4W5W A;  2XZU A;  5FLX S;  1L2C A;  2LWX A;  3VK7 A;  3T1Y M;  4FCV A;  1XNQ M;  1J7K A;  2Z4R A;  2DWM A;  1IBK M;  4LGY A;  4YY3 M;  3U60 A;  4GHL A;  2V1U A;  3RFW A;  1KSF X;  4QOZ C;  1IXZ A;  3U60 B;  3T15 A;  3EIH A;  3QAU A;  2CHG A;  4B7F A;  2M60 A;  3IG5 A;  4BLC A;  4ITQ A;  4QHT A;  4M9X A;  1J5E M;  3RE8 A;  4IBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...