3TWMA

Crystal structure of arabidopsis thaliana fpg
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
278
structure length
261
Chain Sequence
b'PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase 1
molecule tags Hydrolase/dna
source organism Arabidopsis thaliana
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
total genus 69
structure length 261
sequence length 278
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twmA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twmA01
4DR7M 1MU5A 2VQEM 3U6PA 4LF5M 4LFAM 1XMQM 3J81S 1XMOM 4X65M 1HNZM 2HHHM 3TWKA 1IBMM 3GPYA 3A45A 4DR5M 1K3WA 1N32M 3A42A 1K3XA 5ITRA 1L2CA 5BR8M 4LF9M 1XNRM 3U6EA 5ITTA 5IT9S 4OX9M 3JR4A 4B3MM 4DV0M 2UUCM 4G4OA 1J5EM 4PCZA 3SAVA 3DOAA 3JR5A 3GQ3A 3A46A 4JYAM 1Z59A 1Z5AA 4JV5M 1XC8A 1FJGM 3J80S 3GQ5A 2UUAM 4DV2M 4JI2M 5ITXE 3GPPA 2ZBKB 3VK8A 1HNXM 4YHHM 1PM5A 5ITUA 1KFVA 2UU9M 3U6LA 4JI8M 2E5LM 4G4NA 2UXDM 1PJJA 5LMUM 4LF8M 4JI7M 4NRWA 2F5SA 3T1HM 4DR1M 5A2QS 2VQFM 2F5PA 1XNQM 3GPXA 4KHPM 4CISA 3SBJA 4JI4M 4DV4M 1I94M 3SARA 4JI5M 3U6QA 1L2DA 4DV5M 2OQ4A 2XZUA 4NXNM 4X64M 4AQYM 3TWLA 1L1TA 3SATA 4DR3M 3SAWA 4LF7M 4PDIA 4B3RM 1L1ZA 5ITXA 4DR6M 3U6SA 4DR4M 1EE8A 4DUZM 1N34M 3VK7A 1PJIA 1HR0M 1Q39A 1NNJA 4ITQA 1N36M 1TDZA 3SASA 2F4VM 2UXBM 4DUYM 4MB7A 1K82A 4DV6M 1Q3CA 2UUBM 4NRVA 2EA0A 3J7AS 1R2ZA 4LF4M 5LMNM 4X62M 4JI1M 2UXCM 1N33M 3GQ4A 4G4QA 1HNWM 1R2YA 3GP1A 3C58A 5FLXS 5IWAM 4YY3M 4B3TM 4GKKM 4LFCM 4PDGA 4B3SM 4JI0M 1Z5CA 2F5QA 4DV3M 4GKJM 1Q3BA 2F5NA 1IBKM 4K0KM 2ZM6M 1Z5BA 2XZFA 4DV7M 4G4RA 3U6DA 2Q2EB 4LF6M 3U6MA 4DV1M 3GPUA 4DR2M 3GO8A 4LFBM 3OTOM 4JI6M 4NXMM 1IBLM 4X66M 4PD2A 1L2BA 3U6OA 4JI3M 3T1YM 5ITQA 2OPFA 3TWMA 1TDHA 3JAMS 2F5OA 5ITYA 3U6CA 3SAUA 2HKJA 3W0FA 1MX0A
chains in the Genus database with same CATH superfamily
1GL6A 3U61B 1D0MA 2LH0A 1UFZA 1GO5A 5FTKA 4LFAM 1XMQM 2C9CA 2HHHM 4F2LA 2LXEA 3SMSA 1WR1B 5EXTA 2HAKA 3GLIA 1K3WA 2Y20A 3A42A 1OAOC 2DWLA 1L2CA 2RRUA 4PT5A 1TF0B 1WXQA 1QUSA 4G3OA 4M9XA 5ITTA 1IN4A 5IT9S 2QPAA 3BBZA 3LVVA 2JY5A 2I7PA 2KEBA 2P5TA 1ZV1A 3KP0E 4KODA 4Z8XA 4EIWA 1XXHA 2C9OA 2R0IA 3AL0C 4NL4H 3HY5A 2DVWB 2RGOA 3L29A 1XC8A 3FTCA 4RF1A 3FKEA 5KO3A 2DNAA 1QDRA 2HWJA 3E4RA 4F1IA 1QZEA 4JI2M 4LJ9A 2VDBB 2ZAOA 1P3QQ 2GQFA 3QAUA 1X37A 4P16A 3VK8A 4WP2A 3U61A 1PM5A 4JI8M 3E46A 4QHSA 3U5ZA 3CF0A 4IBKA 1NSFA 4JI7M 1RU3A 4FCWA 4W5WA 1Q02A 1H6UA 2DZNB 3L26A 5DFLA 3V76A 2VQFM 2F5PA 1XNQM 4KHPM 1F4IA 4CISA 1UM8A 3K92A 2L09A 4KO8A 3U6QA 1IXSB 2J5YA 2OQ4A 3J2PB 4X64M 2M60A 3TWLA 4DR3M 2CHQA 1WGNA 3SAWA 1R4GA 4AZFA 2MH8A 3L2AA 1L1ZA 2DAEA 5ITXA 3E9SA 7CATA 4II7A 4DR6M 3U60A 4GRIA 4OVZB 2F4VM 1TDZA 5JI3E 3KSJA 3MJ5A 5E6JA 1G41A 1HT2E 4GC5A 1QYRA 1HJPA 2EA0A 1ZAEA 3J7AS 4M0DA 3BXWA 1BVSA 4BLCA 2KRKA 3GQ4A 3KS4A 4G4QA 1HNWM 1R2YA 2DAIA 2G3QA 2Z4SA 1OIPA 4BB9A 3EIHA 2G8LA 3AOEC 5KPRA 5FLXS 3PNYA 3C58A 1G3IA 1VEJA 2DWZB 2X49A 4M9ZA 1GABA 3FUTA 2F5QA 1N77A 4B08A 1G4AE 2XZFA 4AW4A 4FCVA 4JN6A 2JY6B 4R7GA 3T38A 3B7QA 4I8OA 2X4AA 1NO1A 3HHXA 4OU7A 2CP8A 3FTFA 3LQQA 2Z4RA 3AJIB 3E21A 3GO8A 4IJEA 2FNAA 2LHGA 2MROB 1HQCA 2R4JA 1SXJA 3KOZE 4X66M 1QZMA 3H4JA 2KNAA 3HX3A 4R71A 1DO0A 4JI3M 5ITQA 3FUVA 1GL7A 2NQ8C 2OPFA 3TWMA 1TDHA 2YNMD 5DYGA 3JAMS 2ZAMA 5ITYA 4LJ6A 3SAUA 1KFVA 1W5TA 2F5OA 2I7NA 3AV0A 4ZPXA 3VFDA 3QYEA 2FOIC 2J7OA 3U60B 1VDDA 1TH3A 2H1RA 2BWBA 2O01F 1IN5A 4B7HA 3U6PA 1IY1A 3GLFB 2CUZA 1XMOM 2XFSA 1DGBA 1IBMM 3GPYA 3D8BA 3I04M 1OAIA 1OQYA 4GIPA 4WW0A 4DR5M 5C18A 5ITRA 2CFOA 2JY8A 1NV9A 3RFWA 4LF9M 1C1KA 2C96A 3HJQA 2OOAA 2CV2A 1V92A 3CTWB 4OX9M 1SXJD 4I4LA 1TTEA 2DZOB 2UUCM 2JZ0A 4G4OA 1J5EM 2XFTA 3ZCBB 3SAVA 3EIEA 3IHPA 3M6AA 3TPZA 1SG9A 3GQ3A 3A46A 1WIVA 4JV5M 1DO2A 1OFHA 3B7ZA 1FJGM 1I4WA 1NNUC 2JZ1A 2V1CA 3VDUA 1VEGA 4BBAA 3GRYA 2FE8A 1Y8GA 4DV2M 1E9SA 2CRUA 2DWNA 1J09A 4IBBA 5EXXA 5ITUA 2VF8A 1G8PA 1JQJC 5DYIA 5EXSA 3U6LA 2UU9M 2E5LM 3RGSA 3K9PA 2OO9A 4G4NA 4IBIA 2UXDM 3KVWA 3RGPA 2R46A 4D82A 4NC6A 3BOSA 2F5SA 3T1HM 1IXSA 1DGGA 1IXRC 2CEAA 2W82A 3W0LB 1ZMUA 3HU3A 4CGYB 4GITA 3R9XB 2L4EA 4L4UA 3SBJA 1FNNA 3J7BA 4JI4M 4JI5M 4AG6A 3KS8A 2KW0A 1D2NA 3VKHA 1NHGC 1PRBA 4NXNM 2KA6B 1OIZA 1L1TA 2X8AA 3SATA 4AI6A 2XEPA 3D8LA 3B89A 4FD2A 4Q7JA 5KPZA 4JXJA 1VQ1A 4GHAA 5GKNA 4R3DA 4B3RM 2JY7A 3U6SA 3FUWA 1PJIA 3C3DA 1T3TA 3DFZA 3CGWA 4ITQA 2LNHC 1WJ7A 3PNVA 1E32A 4DV6M 2LBCA 1ORYB 2WSCF 4LJAA 5LMNM 2LTUA 4JI1M 2UXCM 2JA2A 3KOYE 1LV7A 2B3TA 3DZDA 3GP1A 2DENA 4L6V6 5IWAM 2DAGA 5DNYA 2GNOA 2R4EA 2WZJA 3H4MA 4MGKE 3GLGA 2LVQD 3J27B 1Q3BA 2K47A 2K6BA 1IBKM 2LVAA 2ZM6M 1YUBA 4DV7M 3AOGA 2KNVA 5FTJA 5IREB 2DHYA 3C3EA 4LGYA 4QHTA 5EP4A 3ZC7B 3I01M 2BNKA 2KXEA 4GH9A 4LZZA 3U6MA 1AUAA 5EP3A 2M5ZA 4DV1M 4GMQA 1WHCA 3ZH9B 8CATA 3CF2A 4MH0E 1EFUB 4P17A 2XLJA 4NXMM 5IZ7D 3HJ8A 4OVZA 2RKOA 4PD2A 1OTRA 1S3SA 3L27A 5E26A 3KXEC 3T6PA 3IG5A 4LRTA 3UK6A 2RGHA 2HKJA 4I81A 2YQZA 3TQSA 1IY0A 3M7GA 3W0FA 4IIWA 3HHYA 3B9PA 4FWDA 1GVNA 1MU5A 3GLHB 3I4YA 2R44A 1YSYA 3FRHA 2VQEM 3KFUG 1GJSA 3C9PA 4XK8F 3ZQJA 4LF5M 3VDPA 2XH9A 1V34A 3J81S 3SYKA 1IXZA 2A5YB 2EO2A 2L2DA 3TWKA 4GEWA 1XB2B 5KQ8A 1N32M 3RE8A 2CHGA 4IBEA 2K9DA 1KSFX 3M0EA 4CHTB 4ANRA 4TUWA 1DGHB 2EJSA 5F3WA 3GLIB 3U6EA 2KZUA 1SXJE 1NJGA 5FTNA 1TR8A 3SFZA 4DV0M 5FSWA 2EKFA 2LVOC 3DOAA 3MHVC 4XGIA 4JYAM 3Q8XA 3HZJA 1Z59A 2HL7A 4HL4A 2CV1A 1TGUA 1XXHB 2L7IA 1IM2A 1GKIA 2Z7JA 3GLHE 1HNXM 2VF7A 3THGA 1D0LA 1L8QA 5LMUM 1PJJA 1G59A 4LF8M 3WHLA 4IBJA 3GLFE 2HCBA 4RF0A 2MR9A 2K0BX 3HU1A 5EXPA 4NRWA 3HKPA 4LGMA 1LTMA 1MJGM 3NBIA 2OOBA 4LJ4A 3FTDA 1SXJC 4LG2A 4FWGA 3UGJA 1QAQA 2XF3A 4Y28F 5EQTA 4DV4M 2FS1A 2XGNA 2DZLA 3SC3A 2VIIA 1QQWA 2R62A 2KRUA 2XZUA 1DV0A 2WSFF 2DKLA 3DA1A 4AQYM 4I5SA 2CV0A 1EIJA 1IFYA 1QAMA 5H37D 3HHZA 4LF7M 1JR3A 4PDIA 3SYLA 2O5RA 4IBGA 4QOZC 5EP2A 4DR4M 1HR0M 4CJ6A 4DUZM 3VK7A 3FUUA 4M0WA 1JB0F 1XHBA 4RKUF 2Z3XA 3QYBA 1N36M 2UXBM 4DUYM 4MB7A 2LWXA 1Q3CA 2APLA 3KW6A 5KPTA 3FE3A 1GLNA 1NHWC 1R2ZA 4LF4M 3KOWE 4FVMA 3UJNA 4RNAA 4GC9A 3SMPA 1E94E 3ILKA 2J7NA 1HT1E 3L28A 5FTLA 2ZTDA 4A3VB 2EKKA 3VLFB 4Z6YA 2JWSA 2QSFX 3SHFA 3KP1E 4JI0M 4LY6A 4DV3M 2F5NA 3F92A 1TH4A 1CUKA 3LCVB 4G4RA 1DGHA 1JR3D 1VG5A 2D7HA 4LJ5A 3U6DA 1WGLA 3GLIE 2FH0A 1SXJB 1NY5A 2JXNA 3K8ZA 4CIZA 1A5TA 4D81A 3B7NA 4DR2M 3T15A 4QNRA 2O25A 4LFBM 1T6OA 4QNMA 1OKSA 1IQPA 4AKGA 2KDLA 3PXGA 4L16A 1L2BA 2KNZA 2CHVA 3T1YM 1IN7A 2R45A 1NY6A 3GLGB 3LMMA 2KZSA 1R7RA 2Y21A 1XXHE 2JP7A 4IBDA 2QZ4A 2L7HA 2MGWA 2BJWA 2JUJA 3SHGB 3LW5F 3GLGE 4DR7M 1V33A 2XSZD 1YLAA 2QQ8A 2QP9X 5L8RF 2QCUA 4L15A 1HNZM 1E9RA 4X65M 2QBYA 1QANA 2LVNC 4MM3B 1NVMA 3I4VA 3A45A 1T43A 3K9OA 2N35A 4DBGB 1K3XA 3B74A 5JI2E 1KYIA 3L25A 1ZMVA 4LRSA 2WSEF 2QBYB 5BR8M 1Z6TA 1PJQA 2MJ5B 1XNRM 1HQYE 1PJTA 4FCTA 2DAMA 4HEOA 2C98A 2R18A 5EP1A 3JR4A 3FTEA 3CF6E 2Y0TA 4B3MM 2DAKA 1J7KA 2C99A 3AOEA 4NOOB 2C5RA 4L8RC 2FFJA 1N78A 3IG8A 1GJTA 2QNJA 4PCZA 3HU2A 4LCBA 2D7EA 3JR5A 3MK6A 2CWBA 2AHMA 2KHHA 4XBOA 3FD9A 1Z5AA 3IECA 3K2LA 1PGYA 5FTMA 2ERCA 2XSZA 3J80S 3WHKA 3GQ5A 1XWIA 2UUAM 2DHRA 3A98B 4HLQA 1W5SA 5ITXE 3GPPA 4AKIA 2ZBKB 4WURA 4YHHM 3AFHA 1IN8A 1VEKA 3FUXA 3KDSE 4OW0A 2R65A 1DGFA 2LVPC 4NSRA 2L6OA 3NBXX 3QWLA 5C1BA 4MGZE 3KSXA 2CE7A 1ZMWA 3GRRA 3LVWA 1IY2A 4B7GA 4DR1M 3HGIA 5A2QS 1QAOA 2L4FA 4G6ZA 3GPXA 1R6BX 2LHCA 1I94M 4MGYE 3SARA 3GRVA 1N75A 2R6FA 1L2DA 4DV5M 3W68A 2BJVA 1IN6A 4UN2B 3UZUA 4LJ7A 3HHWA 2ZANA 3K1JA 4QOSA 4FWHA 1MN3A 3TE6A 4LJ8A 1C7YA 1EE8A 3GLHA 1N34M 1Q39A 2YR0A 1NNJA 3HJSA 3Q8GA 3SASA 3FYDA 2EUCA 1K82A 4KT0F 3GLFA 2UUBM 4MGIE 2QENA 2QHOB 2V1UA 4NRVA 1R5LA 3W67A 3LQRA 3KOXE 4X62M 2DWMA 2JNHA 1N33M 2G5GX 1TH2A 4IBCA 3U5ZB 3VKGA 4IBFA 4MGHA 2Z8YM 3FRIA 2ZTCA 1OJLA 1NV8A 4L78A 1QVRA 1AIPC 1VDLA 1NJFA 2D7GA 4YY3M 4B3TM 4LFCM 4GKKM 4PDGA 4B3SM 4GHLA 1G71A 1Z5CA 4NSOB 3FYCA 1QUTA 4FW9A 4GKJM 2YFQA 2DI0A 4D80A 4K0KM 4AKHA 2V6ZM 1Z5BA 4B7FA 1OFIA 1JR3E 3TL4X 1ZQ9A 2Q2EB 3LCUA 4REZA 4LF6M 4IJFA 2BWEA 3AKZA 2H5XA 3UMMA 3GPUA 5BPVA 4LZJA 3OTOM 3R8FA 4JI6M 4AG5A 1IBLM 1QDTA 3I51A 3NWLA 1D0KA 2DXIA 4S12A 3U6OA 4M9SA 5EJCA 3HWSA 3MMPA 3GRUA 3PVSA 5KQDA 2Y0QA 3PFIA 3U6CA 1YE9A 1PJSA 4KLNA 1MX0A
chains in the Genus database with same CATH topology
1GL6A 3U61B 2LH0A 5FTKA 4LFAM 1XMQM 2C9CA 2HHHM 2LXEA 3SMSA 5EXTA 3GLIA 1K3WA 2Y20A 3A42A 2DWLA 1L2CA 4PT5A 1WXQA 4M9XA 5ITTA 1IN4A 5IT9S 2QPAA 3LVVA 2I7PA 2KEBA 2P5TA 3KP0E 4Z8XA 4KODA 4EIWA 1XXHA 2C9OA 3AL0C 4NL4H 2DVWB 2RGOA 3L29A 1XC8A 3FTCA 4RF1A 3FKEA 5KO3A 3E4RA 4JI2M 4LJ9A 2ZAOA 3QAUA 4P16A 3VK8A 1PM5A 1X37A 4JI8M 3U61A 4QHSA 3U5ZA 3CF0A 4IBKA 1NSFA 4JI7M 4FCWA 4W5WA 1H6UA 2DZNB 3L26A 2VQFM 2F5PA 1XNQM 4KHPM 4CISA 1UM8A 3K92A 2L09A 4KO8A 3U6QA 1IXSB 2OQ4A 3J2PB 4X64M 2M60A 3TWLA 4DR3M 2CHQA 3SAWA 4AZFA 3L2AA 1L1ZA 5ITXA 3E9SA 7CATA 4II7A 4DR6M 3U60A 4GRIA 4OVZB 2F4VM 1TDZA 5JI3E 3KSJA 3MJ5A 5E6JA 1G41A 1HT2E 4GC5A 1QYRA 2EA0A 1ZAEA 3J7AS 4M0DA 1YE9A 4BLCA 2KRKA 3GQ4A 3KS4A 4G4QA 1HNWM 1R2YA 2Z4SA 4BB9A 5KPRA 3EIHA 2G8LA 3AOEC 5FLXS 3C58A 3PNYA 1G3IA 2DWZB 4M9ZA 2X49A 3FUTA 2F5QA 1N77A 4B08A 1G4AE 2XZFA 4AW4A 4FCVA 4JN6A 4R7GA 3T38A 4I8OA 2X4AA 3HHXA 4OU7A 3FTFA 3LQQA 2Z4RA 3AJIB 3GO8A 4IJEA 2FNAA 1HQCA 2R4JA 1SXJA 3KOZE 4X66M 1QZMA 1DO0A 4JI3M 5ITQA 3FUVA 1GL7A 2NQ8C 2OPFA 3TWMA 1TDHA 2YNMD 5DYGA 3JAMS 2ZAMA 5ITYA 4LJ6A 3SAUA 1KFVA 1W5TA 2F5OA 2I7NA 3AV0A 4ZPXA 3VFDA 2FOIC 2J7OA 3U60B 1VDDA 1TH3A 2H1RA 3U6PA 1IN5A 4B7HA 1IY1A 3GLFB 2CUZA 1XMOM 2XFSA 1DGBA 1IBMM 3GPYA 3D8BA 4DR5M 4GIPA 4WW0A 5C18A 5ITRA 2CFOA 3RFWA 4LF9M 1C1KA 2C96A 3HJQA 2CV2A 3CTWB 4OX9M 1SXJD 4I4LA 2DZOB 2UUCM 4G4OA 1J5EM 2XFTA 3ZCBB 3SAVA 3EIEA 3M6AA 3TPZA 3GQ3A 3A46A 4JV5M 1DO2A 1OFHA 1FJGM 1I4WA 1NNUC 2V1CA 4BBAA 3VDUA 3GRYA 2FE8A 4DV2M 1E9SA 2DWNA 1J09A 4IBBA 5EXXA 5ITUA 5DYIA 1G8PA 1JQJC 3U6LA 5EXSA 2UU9M 2E5LM 3RGSA 4G4NA 2UXDM 4IBIA 3KVWA 3RGPA 2R46A 4D82A 3BOSA 2F5SA 3T1HM 1DGGA 1IXRC 2CEAA 2W82A 3W0LB 3HU3A 4CGYB 3R9XB 4GITA 4L4UA 3SBJA 1FNNA 3J7BA 4JI4M 4JI5M 4AG6A 3KS8A 2KW0A 1D2NA 3VKHA 1NHGC 4NXNM 2KA6B 1L1TA 2X8AA 3SATA 4AI6A 2XEPA 3D8LA 4FD2A 5KPZA 4JXJA 4GHAA 5GKNA 4R3DA 4B3RM 3U6SA 3FUWA 1PJIA 1T3TA 3DFZA 4ITQA 2LNHC 3PNVA 1E32A 4DV6M 1ORYB 4LJAA 5LMNM 4JI1M 2UXCM 2JA2A 1LV7A 3DZDA 3GP1A 5IWAM 5DNYA 2R4EA 3H4MA 4MGKE 3GLGA 3J27B 1Q3BA 2K47A 1IBKM 2ZM6M 1YUBA 4DV7M 3AOGA 5FTJA 5IREB 4LGYA 4QHTA 5EP4A 3ZC7B 2BNKA 2KXEA 4GH9A 4LZZA 3U6MA 5EP3A 4DV1M 2M5ZA 4GMQA 3ZH9B 8CATA 2XLJA 3CF2A 4MH0E 4NXMM 5IZ7D 3HJ8A 4OVZA 2RKOA 4PD2A 1S3SA 3L27A 5E26A 3KXEC 3IG5A 4LRTA 3UK6A 2RGHA 2HKJA 4I81A 2YQZA 3TQSA 3M7GA 1IY0A 3W0FA 4IIWA 3HHYA 3B9PA 4FWDA 1GVNA 1MU5A 3GLHB 3I4YA 1YSYA 2VQEM 3KFUG 4LF5M 3VDPA 2XH9A 3J81S 3SYKA 1IXZA 2A5YB 2EO2A 3TWKA 5KQ8A 1N32M 3RE8A 2CHGA 4IBEA 4CHTB 1KSFX 3M0EA 4TUWA 1DGHB 5F3WA 3GLIB 3U6EA 2KZUA 1SXJE 1NJGA 5FTNA 3SFZA 4DV0M 5FSWA 3DOAA 3MHVC 4XGIA 4JYAM 3Q8XA 1Z59A 2HL7A 4HL4A 2CV1A 1TGUA 1XXHB 2L7IA 1IM2A 1GKIA 2Z7JA 1HNXM 3THGA 1L8QA 1PJJA 5LMUM 1G59A 4LF8M 3WHLA 4IBJA 2HCBA 4RF0A 4NRWA 3HU1A 5EXPA 3HKPA 4LGMA 3NBIA 4LJ4A 3FTDA 1SXJC 4LG2A 4FWGA 3UGJA 1QAQA 2XF3A 5EQTA 4DV4M 2XGNA 3SC3A 2VIIA 1QQWA 2R62A 2KRUA 2XZUA 3DA1A 4AQYM 4I5SA 2CV0A 1QAMA 5H37D 3HHZA 4LF7M 1JR3A 4PDIA 3SYLA 2O5RA 4IBGA 4QOZC 5EP2A 4DR4M 1HR0M 4DUZM 3VK7A 3FUUA 4M0WA 1XHBA 2Z3XA 1N36M 2UXBM 4DUYM 4MB7A 2LWXA 1Q3CA 3KW6A 5KPTA 1GLNA 1NHWC 1R2ZA 4LF4M 3KOWE 4FVMA 3UJNA 4RNAA 4GC9A 3SMPA 1E94E 3ILKA 2J7NA 1HT1E 3L28A 5FTLA 4A3VB 4Z6YA 3VLFB 3SHFA 3KP1E 4JI0M 4LY6A 4DV3M 2F5NA 1TH4A 4G4RA 1DGHA 1JR3D 4LJ5A 2D7HA 3U6DA 1SXJB 1NY5A 3K8ZA 4D81A 4DR2M 3T15A 4QNRA 4LFBM 4QNMA 4AKGA 1IQPA 3PXGA 4L16A 1L2BA 2CHVA 3T1YM 1IN7A 2R45A 1NY6A 3GLGB 3LMMA 2KZSA 1R7RA 2Y21A 4IBDA 2QZ4A 2L7HA 2BJWA 3SHGB 4DR7M 2XSZD 2QP9X 2QCUA 4L15A 1HNZM 1E9RA 4X65M 2QBYA 1QANA 4MM3B 1NVMA 3I4VA 3A45A 1K3XA 5JI2E 1KYIA 3L25A 4LRSA 2QBYB 5BR8M 1Z6TA 1XNRM 1HQYE 4FCTA 2C98A 2R18A 5EP1A 3JR4A 3FTEA 3CF6E 2Y0TA 4B3MM 3AOEA 1J7KA 2C99A 4NOOB 2C5RA 1N78A 4L8RC 2FFJA 3IG8A 4PCZA 3HU2A 4LCBA 2D7EA 3JR5A 3MK6A 2AHMA 4XBOA 3FD9A 1Z5AA 3K2LA 5FTMA 2ERCA 2XSZA 3J80S 3WHKA 3GQ5A 1XWIA 2UUAM 2DHRA 3A98B 4HLQA 1W5SA 5ITXE 3GPPA 4AKIA 2ZBKB 4WURA 4YHHM 3AFHA 1IN8A 3FUXA 3KDSE 4OW0A 2R65A 1DGFA 4NSRA 2L6OA 3QWLA 5C1BA 4MGZE 3KSXA 2CE7A 3GRRA 3LVWA 1IY2A 4B7GA 4DR1M 3HGIA 5A2QS 1QAOA 4G6ZA 3GPXA 1R6BX 1I94M 4MGYE 3SARA 3GRVA 1N75A 1L2DA 4DV5M 2BJVA 1IN6A 3UZUA 4LJ7A 3HHWA 2ZANA 3K1JA 4QOSA 4FWHA 3TE6A 4LJ8A 1EE8A 3GLHA 1N34M 1Q39A 2YR0A 1NNJA 3HJSA 3SASA 3FYDA 2EUCA 1K82A 3GLFA 2UUBM 4MGIE 2QENA 2V1UA 4NRVA 2DWMA 3LQRA 3KOXE 4X62M 1N33M 2G5GX 1TH2A 4IBCA 3U5ZB 3VKGA 4IBFA 4MGHA 1OJLA 4L78A 1QVRA 4YY3M 2D7GA 1NJFA 4B3TM 4GKKM 4LFCM 4PDGA 4B3SM 4GHLA 4NSOB 1Z5CA 3FYCA 4GKJM 4FW9A 2YFQA 4D80A 4K0KM 4AKHA 2V6ZM 1Z5BA 4B7FA 1OFIA 3TL4X 1ZQ9A 2Q2EB 4REZA 4LF6M 4IJFA 3AKZA 3UMMA 3GPUA 5BPVA 4LZJA 3OTOM 3R8FA 4JI6M 4AG5A 1IBLM 3I51A 3NWLA 2DXIA 4S12A 3U6OA 4M9SA 5EJCA 3HWSA 3GRUA 3PVSA 5KQDA 2Y0QA 3PFIA 3U6CA 3KOYE 4KLNA 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 M;  1MU5 A;  2VQE M;  3U6P A;  4LF5 M;  4LFA M;  1XMQ M;  3J81 S;  1XMO M;  4X65 M;  1HNZ M;  2HHH M;  3TWK A;  1IBM M;  3GPY A;  3A45 A;  4DR5 M;  1K3W A;  1N32 M;  3A42 A;  1K3X A;  5ITR A;  1L2C A;  5BR8 M;  4LF9 M;  1XNR M;  3U6E A;  5ITT A;  5IT9 S;  4OX9 M;  3JR4 A;  4B3M M;  4DV0 M;  2UUC M;  4G4O A;  1J5E M;  4PCZ A;  3SAV A;  3DOA A;  3JR5 A;  3GQ3 A;  3A46 A;  4JYA M;  1Z59 A;  1Z5A A;  4JV5 M;  1XC8 A;  1FJG M;  3J80 S;  3GQ5 A;  2UUA M;  4DV2 M;  4JI2 M;  5ITX E;  3GPP A;  2ZBK B;  3VK8 A;  1HNX M;  4YHH M;  1PM5 A;  5ITU A;  1KFV A;  2UU9 M;  3U6L A;  4JI8 M;  2E5L M;  4G4N A;  2UXD M;  1PJJ A;  5LMU M;  4LF8 M;  4JI7 M;  4NRW A;  2F5S A;  3T1H M;  4DR1 M;  5A2Q S;  2VQF M;  2F5P A;  1XNQ M;  3GPX A;  4KHP M;  4CIS A;  3SBJ A;  4JI4 M;  4DV4 M;  1I94 M;  3SAR A;  4JI5 M;  3U6Q A;  1L2D A;  4DV5 M;  2OQ4 A;  2XZU A;  4NXN M;  4X64 M;  4AQY M;  3TWL A;  1L1T A;  3SAT A;  4DR3 M;  3SAW A;  4LF7 M;  4PDI A;  4B3R M;  1L1Z A;  5ITX A;  4DR6 M;  3U6S A;  4DR4 M;  1EE8 A;  4DUZ M;  1N34 M;  3VK7 A;  1PJI A;  1HR0 M;  1Q39 A;  1NNJ A;  4ITQ A;  1N36 M;  1TDZ A;  3SAS A;  2F4V M;  2UXB M;  4DUY M;  4MB7 A;  1K82 A;  4DV6 M;  1Q3C A;  2UUB M;  4NRV A;  2EA0 A;  3J7A S;  1R2Z A;  4LF4 M;  5LMN M;  4X62 M;  4JI1 M;  2UXC M;  1N33 M;  3GQ4 A;  4G4Q A;  1HNW M;  1R2Y A;  3GP1 A;  3C58 A;  5FLX S;  5IWA M;  4YY3 M;  4B3T M;  4GKK M;  4LFC M;  4PDG A;  4B3S M;  4JI0 M;  1Z5C A;  2F5Q A;  4DV3 M;  4GKJ M;  1Q3B A;  2F5N A;  1IBK M;  4K0K M;  2ZM6 M;  1Z5B A;  2XZF A;  4DV7 M;  4G4R A;  3U6D A;  2Q2E B;  4LF6 M;  3U6M A;  4DV1 M;  3GPU A;  4DR2 M;  3GO8 A;  4LFB M;  3OTO M;  4JI6 M;  4NXM M;  1IBL M;  4X66 M;  4PD2 A;  1L2B A;  3U6O A;  4JI3 M;  3T1Y M;  5ITQ A;  2OPF A;  3TWM A;  1TDH A;  3JAM S;  2F5O A;  5ITY A;  3U6C A;  3SAU A;  2HKJ A;  3W0F A;  1MX0 A; 
#chains in the Genus database with same CATH topology
 1GL6 A;  3U61 B;  1D0M A;  2LH0 A;  1UFZ A;  1GO5 A;  5FTK A;  4LFA M;  1XMQ M;  2C9C A;  2HHH M;  4F2L A;  2LXE A;  3SMS A;  1WR1 B;  5EXT A;  2HAK A;  3GLI A;  1K3W A;  2Y20 A;  3A42 A;  1OAO C;  2DWL A;  1L2C A;  2RRU A;  4PT5 A;  1TF0 B;  1WXQ A;  1QUS A;  4G3O A;  4M9X A;  5ITT A;  1IN4 A;  5IT9 S;  2QPA A;  3BBZ A;  3LVV A;  2JY5 A;  2I7P A;  2KEB A;  2P5T A;  1ZV1 A;  3KP0 E;  4KOD A;  4Z8X A;  4EIW A;  1XXH A;  2C9O A;  2R0I A;  3AL0 C;  4NL4 H;  3HY5 A;  2DVW B;  2RGO A;  3L29 A;  1XC8 A;  3FTC A;  4RF1 A;  3FKE A;  5KO3 A;  2DNA A;  1QDR A;  2HWJ A;  3E4R A;  4F1I A;  1QZE A;  4JI2 M;  4LJ9 A;  2VDB B;  2ZAO A;  1P3Q Q;  2GQF A;  3QAU A;  1X37 A;  4P16 A;  3VK8 A;  4WP2 A;  3U61 A;  1PM5 A;  4JI8 M;  3E46 A;  4QHS A;  3U5Z A;  3CF0 A;  4IBK A;  1NSF A;  4JI7 M;  1RU3 A;  4FCW A;  4W5W A;  1Q02 A;  1H6U A;  2DZN B;  3L26 A;  5DFL A;  3V76 A;  2VQF M;  2F5P A;  1XNQ M;  4KHP M;  1F4I A;  4CIS A;  1UM8 A;  3K92 A;  2L09 A;  4KO8 A;  3U6Q A;  1IXS B;  2J5Y A;  2OQ4 A;  3J2P B;  4X64 M;  2M60 A;  3TWL A;  4DR3 M;  2CHQ A;  1WGN A;  3SAW A;  1R4G A;  4AZF A;  2MH8 A;  3L2A A;  1L1Z A;  2DAE A;  5ITX A;  3E9S A;  7CAT A;  4II7 A;  4DR6 M;  3U60 A;  4GRI A;  4OVZ B;  2F4V M;  1TDZ A;  5JI3 E;  3KSJ A;  3MJ5 A;  5E6J A;  1G41 A;  1HT2 E;  4GC5 A;  1QYR A;  1HJP A;  2EA0 A;  1ZAE A;  3J7A S;  4M0D A;  3BXW A;  1BVS A;  4BLC A;  2KRK A;  3GQ4 A;  3KS4 A;  4G4Q A;  1HNW M;  1R2Y A;  2DAI A;  2G3Q A;  2Z4S A;  1OIP A;  4BB9 A;  3EIH A;  2G8L A;  3AOE C;  5KPR A;  5FLX S;  3PNY A;  3C58 A;  1G3I A;  1VEJ A;  2DWZ B;  2X49 A;  4M9Z A;  1GAB A;  3FUT A;  2F5Q A;  1N77 A;  4B08 A;  1G4A E;  2XZF A;  4AW4 A;  4FCV A;  4JN6 A;  2JY6 B;  4R7G A;  3T38 A;  3B7Q A;  4I8O A;  2X4A A;  1NO1 A;  3HHX A;  4OU7 A;  2CP8 A;  3FTF A;  3LQQ A;  2Z4R A;  3AJI B;  3E21 A;  3GO8 A;  4IJE A;  2FNA A;  2LHG A;  2MRO B;  1HQC A;  2R4J A;  1SXJ A;  3KOZ E;  4X66 M;  1QZM A;  3H4J A;  2KNA A;  3HX3 A;  4R71 A;  1DO0 A;  4JI3 M;  5ITQ A;  3FUV A;  1GL7 A;  2NQ8 C;  2OPF A;  3TWM A;  1TDH A;  2YNM D;  5DYG A;  3JAM S;  2ZAM A;  5ITY A;  4LJ6 A;  3SAU A;  1KFV A;  1W5T A;  2F5O A;  2I7N A;  3AV0 A;  4ZPX A;  3VFD A;  3QYE A;  2FOI C;  2J7O A;  3U60 B;  1VDD A;  1TH3 A;  2H1R A;  2BWB A;  2O01 F;  1IN5 A;  4B7H A;  3U6P A;  1IY1 A;  3GLF B;  2CUZ A;  1XMO M;  2XFS A;  1DGB A;  1IBM M;  3GPY A;  3D8B A;  3I04 M;  1OAI A;  1OQY A;  4GIP A;  4WW0 A;  4DR5 M;  5C18 A;  5ITR A;  2CFO A;  2JY8 A;  1NV9 A;  3RFW A;  4LF9 M;  1C1K A;  2C96 A;  3HJQ A;  2OOA A;  2CV2 A;  1V92 A;  3CTW B;  4OX9 M;  1SXJ D;  4I4L A;  1TTE A;  2DZO B;  2UUC M;  2JZ0 A;  4G4O A;  1J5E M;  2XFT A;  3ZCB B;  3SAV A;  3EIE A;  3IHP A;  3M6A A;  3TPZ A;  1SG9 A;  3GQ3 A;  3A46 A;  1WIV A;  4JV5 M;  1DO2 A;  1OFH A;  3B7Z A;  1FJG M;  1I4W A;  1NNU C;  2JZ1 A;  2V1C A;  3VDU A;  1VEG A;  4BBA A;  3GRY A;  2FE8 A;  1Y8G A;  4DV2 M;  1E9S A;  2CRU A;  2DWN A;  1J09 A;  4IBB A;  5EXX A;  5ITU A;  2VF8 A;  1G8P A;  1JQJ C;  5DYI A;  5EXS A;  3U6L A;  2UU9 M;  2E5L M;  3RGS A;  3K9P A;  2OO9 A;  4G4N A;  4IBI A;  2UXD M;  3KVW A;  3RGP A;  2R46 A;  4D82 A;  4NC6 A;  3BOS A;  2F5S A;  3T1H M;  1IXS A;  1DGG A;  1IXR C;  2CEA A;  2W82 A;  3W0L B;  1ZMU A;  3HU3 A;  4CGY B;  4GIT A;  3R9X B;  2L4E A;  4L4U A;  3SBJ A;  1FNN A;  3J7B A;  4JI4 M;  4JI5 M;  4AG6 A;  3KS8 A;  2KW0 A;  1D2N A;  3VKH A;  1NHG C;  1PRB A;  4NXN M;  2KA6 B;  1OIZ A;  1L1T A;  2X8A A;  3SAT A;  4AI6 A;  2XEP A;  3D8L A;  3B89 A;  4FD2 A;  4Q7J A;  5KPZ A;  4JXJ A;  1VQ1 A;  4GHA A;  5GKN A;  4R3D A;  4B3R M;  2JY7 A;  3U6S A;  3FUW A;  1PJI A;  3C3D A;  1T3T A;  3DFZ A;  3CGW A;  4ITQ A;  2LNH C;  1WJ7 A;  3PNV A;  1E32 A;  4DV6 M;  2LBC A;  1ORY B;  2WSC F;  4LJA A;  5LMN M;  2LTU A;  4JI1 M;  2UXC M;  2JA2 A;  3KOY E;  1LV7 A;  2B3T A;  3DZD A;  3GP1 A;  2DEN A;  4L6V 6;  5IWA M;  2DAG A;  5DNY A;  2GNO A;  2R4E A;  2WZJ A;  3H4M A;  4MGK E;  3GLG A;  2LVQ D;  3J27 B;  1Q3B A;  2K47 A;  2K6B A;  1IBK M;  2LVA A;  2ZM6 M;  1YUB A;  4DV7 M;  3AOG A;  2KNV A;  5FTJ A;  5IRE B;  2DHY A;  3C3E A;  4LGY A;  4QHT A;  5EP4 A;  3ZC7 B;  3I01 M;  2BNK A;  2KXE A;  4GH9 A;  4LZZ A;  3U6M A;  1AUA A;  5EP3 A;  2M5Z A;  4DV1 M;  4GMQ A;  1WHC A;  3ZH9 B;  8CAT A;  3CF2 A;  4MH0 E;  1EFU B;  4P17 A;  2XLJ A;  4NXM M;  5IZ7 D;  3HJ8 A;  4OVZ A;  2RKO A;  4PD2 A;  1OTR A;  1S3S A;  3L27 A;  5E26 A;  3KXE C;  3T6P A;  3IG5 A;  4LRT A;  3UK6 A;  2RGH A;  2HKJ A;  4I81 A;  2YQZ A;  3TQS A;  1IY0 A;  3M7G A;  3W0F A;  4IIW A;  3HHY A;  3B9P A;  4FWD A;  1GVN A;  1MU5 A;  3GLH B;  3I4Y A;  2R44 A;  1YSY A;  3FRH A;  2VQE M;  3KFU G;  1GJS A;  3C9P A;  4XK8 F;  3ZQJ A;  4LF5 M;  3VDP A;  2XH9 A;  1V34 A;  3J81 S;  3SYK A;  1IXZ A;  2A5Y B;  2EO2 A;  2L2D A;  3TWK A;  4GEW A;  1XB2 B;  5KQ8 A;  1N32 M;  3RE8 A;  2CHG A;  4IBE A;  2K9D A;  1KSF X;  3M0E A;  4CHT B;  4ANR A;  4TUW A;  1DGH B;  2EJS A;  5F3W A;  3GLI B;  3U6E A;  2KZU A;  1SXJ E;  1NJG A;  5FTN A;  1TR8 A;  3SFZ A;  4DV0 M;  5FSW A;  2EKF A;  2LVO C;  3DOA A;  3MHV C;  4XGI A;  4JYA M;  3Q8X A;  3HZJ A;  1Z59 A;  2HL7 A;  4HL4 A;  2CV1 A;  1TGU A;  1XXH B;  2L7I A;  1IM2 A;  1GKI A;  2Z7J A;  3GLH E;  1HNX M;  2VF7 A;  3THG A;  1D0L A;  1L8Q A;  5LMU M;  1PJJ A;  1G59 A;  4LF8 M;  3WHL A;  4IBJ A;  3GLF E;  2HCB A;  4RF0 A;  2MR9 A;  2K0B X;  3HU1 A;  5EXP A;  4NRW A;  3HKP A;  4LGM A;  1LTM A;  1MJG M;  3NBI A;  2OOB A;  4LJ4 A;  3FTD A;  1SXJ C;  4LG2 A;  4FWG A;  3UGJ A;  1QAQ A;  2XF3 A;  4Y28 F;  5EQT A;  4DV4 M;  2FS1 A;  2XGN A;  2DZL A;  3SC3 A;  2VII A;  1QQW A;  2R62 A;  2KRU A;  2XZU A;  1DV0 A;  2WSF F;  2DKL A;  3DA1 A;  4AQY M;  4I5S A;  2CV0 A;  1EIJ A;  1IFY A;  1QAM A;  5H37 D;  3HHZ A;  4LF7 M;  1JR3 A;  4PDI A;  3SYL A;  2O5R A;  4IBG A;  4QOZ C;  5EP2 A;  4DR4 M;  1HR0 M;  4CJ6 A;  4DUZ M;  3VK7 A;  3FUU A;  4M0W A;  1JB0 F;  1XHB A;  4RKU F;  2Z3X A;  3QYB A;  1N36 M;  2UXB M;  4DUY M;  4MB7 A;  2LWX A;  1Q3C A;  2APL A;  3KW6 A;  5KPT A;  3FE3 A;  1GLN A;  1NHW C;  1R2Z A;  4LF4 M;  3KOW E;  4FVM A;  3UJN A;  4RNA A;  4GC9 A;  3SMP A;  1E94 E;  3ILK A;  2J7N A;  1HT1 E;  3L28 A;  5FTL A;  2ZTD A;  4A3V B;  2EKK A;  3VLF B;  4Z6Y A;  2JWS A;  2QSF X;  3SHF A;  3KP1 E;  4JI0 M;  4LY6 A;  4DV3 M;  2F5N A;  3F92 A;  1TH4 A;  1CUK A;  3LCV B;  4G4R A;  1DGH A;  1JR3 D;  1VG5 A;  2D7H A;  4LJ5 A;  3U6D A;  1WGL A;  3GLI E;  2FH0 A;  1SXJ B;  1NY5 A;  2JXN A;  3K8Z A;  4CIZ A;  1A5T A;  4D81 A;  3B7N A;  4DR2 M;  3T15 A;  4QNR A;  2O25 A;  4LFB M;  1T6O A;  4QNM A;  1OKS A;  1IQP A;  4AKG A;  2KDL A;  3PXG A;  4L16 A;  1L2B A;  2KNZ A;  2CHV A;  3T1Y M;  1IN7 A;  2R45 A;  1NY6 A;  3GLG B;  3LMM A;  2KZS A;  1R7R A;  2Y21 A;  1XXH E;  2JP7 A;  4IBD A;  2QZ4 A;  2L7H A;  2MGW A;  2BJW A;  2JUJ A;  3SHG B;  3LW5 F;  3GLG E;  4DR7 M;  1V33 A;  2XSZ D;  1YLA A;  2QQ8 A;  2QP9 X;  5L8R F;  2QCU A;  4L15 A;  1HNZ M;  1E9R A;  4X65 M;  2QBY A;  1QAN A;  2LVN C;  4MM3 B;  1NVM A;  3I4V A;  3A45 A;  1T43 A;  3K9O A;  2N35 A;  4DBG B;  1K3X A;  3B74 A;  5JI2 E;  1KYI A;  3L25 A;  1ZMV A;  4LRS A;  2WSE F;  2QBY B;  5BR8 M;  1Z6T A;  1PJQ A;  2MJ5 B;  1XNR M;  1HQY E;  1PJT A;  4FCT A;  2DAM A;  4HEO A;  2C98 A;  2R18 A;  5EP1 A;  3JR4 A;  3FTE A;  3CF6 E;  2Y0T A;  4B3M M;  2DAK A;  1J7K A;  2C99 A;  3AOE A;  4NOO B;  2C5R A;  4L8R C;  2FFJ A;  1N78 A;  3IG8 A;  1GJT A;  2QNJ A;  4PCZ A;  3HU2 A;  4LCB A;  2D7E A;  3JR5 A;  3MK6 A;  2CWB A;  2AHM A;  2KHH A;  4XBO A;  3FD9 A;  1Z5A A;  3IEC A;  3K2L A;  1PGY A;  5FTM A;  2ERC A;  2XSZ A;  3J80 S;  3WHK A;  3GQ5 A;  1XWI A;  2UUA M;  2DHR A;  3A98 B;  4HLQ A;  1W5S A;  5ITX E;  3GPP A;  4AKI A;  2ZBK B;  4WUR A;  4YHH M;  3AFH A;  1IN8 A;  1VEK A;  3FUX A;  3KDS E;  4OW0 A;  2R65 A;  1DGF A;  2LVP C;  4NSR A;  2L6O A;  3NBX X;  3QWL A;  5C1B A;  4MGZ E;  3KSX A;  2CE7 A;  1ZMW A;  3GRR A;  3LVW A;  1IY2 A;  4B7G A;  4DR1 M;  3HGI A;  5A2Q S;  1QAO A;  2L4F A;  4G6Z A;  3GPX A;  1R6B X;  2LHC A;  1I94 M;  4MGY E;  3SAR A;  3GRV A;  1N75 A;  2R6F A;  1L2D A;  4DV5 M;  3W68 A;  2BJV A;  1IN6 A;  4UN2 B;  3UZU A;  4LJ7 A;  3HHW A;  2ZAN A;  3K1J A;  4QOS A;  4FWH A;  1MN3 A;  3TE6 A;  4LJ8 A;  1C7Y A;  1EE8 A;  3GLH A;  1N34 M;  1Q39 A;  2YR0 A;  1NNJ A;  3HJS A;  3Q8G A;  3SAS A;  3FYD A;  2EUC A;  1K82 A;  4KT0 F;  3GLF A;  2UUB M;  4MGI E;  2QEN A;  2QHO B;  2V1U A;  4NRV A;  1R5L A;  3W67 A;  3LQR A;  3KOX E;  4X62 M;  2DWM A;  2JNH A;  1N33 M;  2G5G X;  1TH2 A;  4IBC A;  3U5Z B;  3VKG A;  4IBF A;  4MGH A;  2Z8Y M;  3FRI A;  2ZTC A;  1OJL A;  1NV8 A;  4L78 A;  1QVR A;  1AIP C;  1VDL A;  1NJF A;  2D7G A;  4YY3 M;  4B3T M;  4LFC M;  4GKK M;  4PDG A;  4B3S M;  4GHL A;  1G71 A;  1Z5C A;  4NSO B;  3FYC A;  1QUT A;  4FW9 A;  4GKJ M;  2YFQ A;  2DI0 A;  4D80 A;  4K0K M;  4AKH A;  2V6Z M;  1Z5B A;  4B7F A;  1OFI A;  1JR3 E;  3TL4 X;  1ZQ9 A;  2Q2E B;  3LCU A;  4REZ A;  4LF6 M;  4IJF A;  2BWE A;  3AKZ A;  2H5X A;  3UMM A;  3GPU A;  5BPV A;  4LZJ A;  3OTO M;  3R8F A;  4JI6 M;  4AG5 A;  1IBL M;  1QDT A;  3I51 A;  3NWL A;  1D0K A;  2DXI A;  4S12 A;  3U6O A;  4M9S A;  5EJC A;  3HWS A;  3MMP A;  3GRU A;  3PVS A;  5KQD A;  2Y0Q A;  3PFI A;  3U6C A;  1YE9 A;  1PJS A;  4KLN A;  1MX0 A; 
#chains in the Genus database with same CATH homology
 1GL6 A;  3U61 B;  2LH0 A;  5FTK A;  4LFA M;  1XMQ M;  2C9C A;  2HHH M;  2LXE A;  3SMS A;  5EXT A;  3GLI A;  1K3W A;  2Y20 A;  3A42 A;  2DWL A;  1L2C A;  4PT5 A;  1WXQ A;  4M9X A;  5ITT A;  1IN4 A;  5IT9 S;  2QPA A;  3LVV A;  2I7P A;  2KEB A;  2P5T A;  3KP0 E;  4Z8X A;  4KOD A;  4EIW A;  1XXH A;  2C9O A;  3AL0 C;  4NL4 H;  2DVW B;  2RGO A;  3L29 A;  1XC8 A;  3FTC A;  4RF1 A;  3FKE A;  5KO3 A;  3E4R A;  4JI2 M;  4LJ9 A;  2ZAO A;  3QAU A;  4P16 A;  3VK8 A;  1PM5 A;  1X37 A;  4JI8 M;  3U61 A;  4QHS A;  3U5Z A;  3CF0 A;  4IBK A;  1NSF A;  4JI7 M;  4FCW A;  4W5W A;  1H6U A;  2DZN B;  3L26 A;  2VQF M;  2F5P A;  1XNQ M;  4KHP M;  4CIS A;  1UM8 A;  3K92 A;  2L09 A;  4KO8 A;  3U6Q A;  1IXS B;  2OQ4 A;  3J2P B;  4X64 M;  2M60 A;  3TWL A;  4DR3 M;  2CHQ A;  3SAW A;  4AZF A;  3L2A A;  1L1Z A;  5ITX A;  3E9S A;  7CAT A;  4II7 A;  4DR6 M;  3U60 A;  4GRI A;  4OVZ B;  2F4V M;  1TDZ A;  5JI3 E;  3KSJ A;  3MJ5 A;  5E6J A;  1G41 A;  1HT2 E;  4GC5 A;  1QYR A;  2EA0 A;  1ZAE A;  3J7A S;  4M0D A;  1YE9 A;  4BLC A;  2KRK A;  3GQ4 A;  3KS4 A;  4G4Q A;  1HNW M;  1R2Y A;  2Z4S A;  4BB9 A;  5KPR A;  3EIH A;  2G8L A;  3AOE C;  5FLX S;  3C58 A;  3PNY A;  1G3I A;  2DWZ B;  4M9Z A;  2X49 A;  3FUT A;  2F5Q A;  1N77 A;  4B08 A;  1G4A E;  2XZF A;  4AW4 A;  4FCV A;  4JN6 A;  4R7G A;  3T38 A;  4I8O A;  2X4A A;  3HHX A;  4OU7 A;  3FTF A;  3LQQ A;  2Z4R A;  3AJI B;  3GO8 A;  4IJE A;  2FNA A;  1HQC A;  2R4J A;  1SXJ A;  3KOZ E;  4X66 M;  1QZM A;  1DO0 A;  4JI3 M;  5ITQ A;  3FUV A;  1GL7 A;  2NQ8 C;  2OPF A;  3TWM A;  1TDH A;  2YNM D;  5DYG A;  3JAM S;  2ZAM A;  5ITY A;  4LJ6 A;  3SAU A;  1KFV A;  1W5T A;  2F5O A;  2I7N A;  3AV0 A;  4ZPX A;  3VFD A;  2FOI C;  2J7O A;  3U60 B;  1VDD A;  1TH3 A;  2H1R A;  3U6P A;  1IN5 A;  4B7H A;  1IY1 A;  3GLF B;  2CUZ A;  1XMO M;  2XFS A;  1DGB A;  1IBM M;  3GPY A;  3D8B A;  4DR5 M;  4GIP A;  4WW0 A;  5C18 A;  5ITR A;  2CFO A;  3RFW A;  4LF9 M;  1C1K A;  2C96 A;  3HJQ A;  2CV2 A;  3CTW B;  4OX9 M;  1SXJ D;  4I4L A;  2DZO B;  2UUC M;  4G4O A;  1J5E M;  2XFT A;  3ZCB B;  3SAV A;  3EIE A;  3M6A A;  3TPZ A;  3GQ3 A;  3A46 A;  4JV5 M;  1DO2 A;  1OFH A;  1FJG M;  1I4W A;  1NNU C;  2V1C A;  4BBA A;  3VDU A;  3GRY A;  2FE8 A;  4DV2 M;  1E9S A;  2DWN A;  1J09 A;  4IBB A;  5EXX A;  5ITU A;  5DYI A;  1G8P A;  1JQJ C;  3U6L A;  5EXS A;  2UU9 M;  2E5L M;  3RGS A;  4G4N A;  2UXD M;  4IBI A;  3KVW A;  3RGP A;  2R46 A;  4D82 A;  3BOS A;  2F5S A;  3T1H M;  1DGG A;  1IXR C;  2CEA A;  2W82 A;  3W0L B;  3HU3 A;  4CGY B;  3R9X B;  4GIT A;  4L4U A;  3SBJ A;  1FNN A;  3J7B A;  4JI4 M;  4JI5 M;  4AG6 A;  3KS8 A;  2KW0 A;  1D2N A;  3VKH A;  1NHG C;  4NXN M;  2KA6 B;  1L1T A;  2X8A A;  3SAT A;  4AI6 A;  2XEP A;  3D8L A;  4FD2 A;  5KPZ A;  4JXJ A;  4GHA A;  5GKN A;  4R3D A;  4B3R M;  3U6S A;  3FUW A;  1PJI A;  1T3T A;  3DFZ A;  4ITQ A;  2LNH C;  3PNV A;  1E32 A;  4DV6 M;  1ORY B;  4LJA A;  5LMN M;  4JI1 M;  2UXC M;  2JA2 A;  1LV7 A;  3DZD A;  3GP1 A;  5IWA M;  5DNY A;  2R4E A;  3H4M A;  4MGK E;  3GLG A;  3J27 B;  1Q3B A;  2K47 A;  1IBK M;  2ZM6 M;  1YUB A;  4DV7 M;  3AOG A;  5FTJ A;  5IRE B;  4LGY A;  4QHT A;  5EP4 A;  3ZC7 B;  2BNK A;  2KXE A;  4GH9 A;  4LZZ A;  3U6M A;  5EP3 A;  4DV1 M;  2M5Z A;  4GMQ A;  3ZH9 B;  8CAT A;  2XLJ A;  3CF2 A;  4MH0 E;  4NXM M;  5IZ7 D;  3HJ8 A;  4OVZ A;  2RKO A;  4PD2 A;  1S3S A;  3L27 A;  5E26 A;  3KXE C;  3IG5 A;  4LRT A;  3UK6 A;  2RGH A;  2HKJ A;  4I81 A;  2YQZ A;  3TQS A;  3M7G A;  1IY0 A;  3W0F A;  4IIW A;  3HHY A;  3B9P A;  4FWD A;  1GVN A;  1MU5 A;  3GLH B;  3I4Y A;  1YSY A;  2VQE M;  3KFU G;  4LF5 M;  3VDP A;  2XH9 A;  3J81 S;  3SYK A;  1IXZ A;  2A5Y B;  2EO2 A;  3TWK A;  5KQ8 A;  1N32 M;  3RE8 A;  2CHG A;  4IBE A;  4CHT B;  1KSF X;  3M0E A;  4TUW A;  1DGH B;  5F3W A;  3GLI B;  3U6E A;  2KZU A;  1SXJ E;  1NJG A;  5FTN A;  3SFZ A;  4DV0 M;  5FSW A;  3DOA A;  3MHV C;  4XGI A;  4JYA M;  3Q8X A;  1Z59 A;  2HL7 A;  4HL4 A;  2CV1 A;  1TGU A;  1XXH B;  2L7I A;  1IM2 A;  1GKI A;  2Z7J A;  1HNX M;  3THG A;  1L8Q A;  1PJJ A;  5LMU M;  1G59 A;  4LF8 M;  3WHL A;  4IBJ A;  2HCB A;  4RF0 A;  4NRW A;  3HU1 A;  5EXP A;  3HKP A;  4LGM A;  3NBI A;  4LJ4 A;  3FTD A;  1SXJ C;  4LG2 A;  4FWG A;  3UGJ A;  1QAQ A;  2XF3 A;  5EQT A;  4DV4 M;  2XGN A;  3SC3 A;  2VII A;  1QQW A;  2R62 A;  2KRU A;  2XZU A;  3DA1 A;  4AQY M;  4I5S A;  2CV0 A;  1QAM A;  5H37 D;  3HHZ A;  4LF7 M;  1JR3 A;  4PDI A;  3SYL A;  2O5R A;  4IBG A;  4QOZ C;  5EP2 A;  4DR4 M;  1HR0 M;  4DUZ M;  3VK7 A;  3FUU A;  4M0W A;  1XHB A;  2Z3X A;  1N36 M;  2UXB M;  4DUY M;  4MB7 A;  2LWX A;  1Q3C A;  3KW6 A;  5KPT A;  1GLN A;  1NHW C;  1R2Z A;  4LF4 M;  3KOW E;  4FVM A;  3UJN A;  4RNA A;  4GC9 A;  3SMP A;  1E94 E;  3ILK A;  2J7N A;  1HT1 E;  3L28 A;  5FTL A;  4A3V B;  4Z6Y A;  3VLF B;  3SHF A;  3KP1 E;  4JI0 M;  4LY6 A;  4DV3 M;  2F5N A;  1TH4 A;  4G4R A;  1DGH A;  1JR3 D;  4LJ5 A;  2D7H A;  3U6D A;  1SXJ B;  1NY5 A;  3K8Z A;  4D81 A;  4DR2 M;  3T15 A;  4QNR A;  4LFB M;  4QNM A;  4AKG A;  1IQP A;  3PXG A;  4L16 A;  1L2B A;  2CHV A;  3T1Y M;  1IN7 A;  2R45 A;  1NY6 A;  3GLG B;  3LMM A;  2KZS A;  1R7R A;  2Y21 A;  4IBD A;  2QZ4 A;  2L7H A;  2BJW A;  3SHG B;  4DR7 M;  2XSZ D;  2QP9 X;  2QCU A;  4L15 A;  1HNZ M;  1E9R A;  4X65 M;  2QBY A;  1QAN A;  4MM3 B;  1NVM A;  3I4V A;  3A45 A;  1K3X A;  5JI2 E;  1KYI A;  3L25 A;  4LRS A;  2QBY B;  5BR8 M;  1Z6T A;  1XNR M;  1HQY E;  4FCT A;  2C98 A;  2R18 A;  5EP1 A;  3JR4 A;  3FTE A;  3CF6 E;  2Y0T A;  4B3M M;  3AOE A;  1J7K A;  2C99 A;  4NOO B;  2C5R A;  1N78 A;  4L8R C;  2FFJ A;  3IG8 A;  4PCZ A;  3HU2 A;  4LCB A;  2D7E A;  3JR5 A;  3MK6 A;  2AHM A;  4XBO A;  3FD9 A;  1Z5A A;  3K2L A;  5FTM A;  2ERC A;  2XSZ A;  3J80 S;  3WHK A;  3GQ5 A;  1XWI A;  2UUA M;  2DHR A;  3A98 B;  4HLQ A;  1W5S A;  5ITX E;  3GPP A;  4AKI A;  2ZBK B;  4WUR A;  4YHH M;  3AFH A;  1IN8 A;  3FUX A;  3KDS E;  4OW0 A;  2R65 A;  1DGF A;  4NSR A;  2L6O A;  3QWL A;  5C1B A;  4MGZ E;  3KSX A;  2CE7 A;  3GRR A;  3LVW A;  1IY2 A;  4B7G A;  4DR1 M;  3HGI A;  5A2Q S;  1QAO A;  4G6Z A;  3GPX A;  1R6B X;  1I94 M;  4MGY E;  3SAR A;  3GRV A;  1N75 A;  1L2D A;  4DV5 M;  2BJV A;  1IN6 A;  3UZU A;  4LJ7 A;  3HHW A;  2ZAN A;  3K1J A;  4QOS A;  4FWH A;  3TE6 A;  4LJ8 A;  1EE8 A;  3GLH A;  1N34 M;  1Q39 A;  2YR0 A;  1NNJ A;  3HJS A;  3SAS A;  3FYD A;  2EUC A;  1K82 A;  3GLF A;  2UUB M;  4MGI E;  2QEN A;  2V1U A;  4NRV A;  2DWM A;  3LQR A;  3KOX E;  4X62 M;  1N33 M;  2G5G X;  1TH2 A;  4IBC A;  3U5Z B;  3VKG A;  4IBF A;  4MGH A;  1OJL A;  4L78 A;  1QVR A;  4YY3 M;  2D7G A;  1NJF A;  4B3T M;  4GKK M;  4LFC M;  4PDG A;  4B3S M;  4GHL A;  4NSO B;  1Z5C A;  3FYC A;  4GKJ M;  4FW9 A;  2YFQ A;  4D80 A;  4K0K M;  4AKH A;  2V6Z M;  1Z5B A;  4B7F A;  1OFI A;  3TL4 X;  1ZQ9 A;  2Q2E B;  4REZ A;  4LF6 M;  4IJF A;  3AKZ A;  3UMM A;  3GPU A;  5BPV A;  4LZJ A;  3OTO M;  3R8F A;  4JI6 M;  4AG5 A;  1IBL M;  3I51 A;  3NWL A;  2DXI A;  4S12 A;  3U6O A;  4M9S A;  5EJC A;  3HWS A;  3GRU A;  3PVS A;  5KQD A;  2Y0Q A;  3PFI A;  3U6C A;  3KOY E;  4KLN A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...