3TWMA

Crystal structure of arabidopsis thaliana fpg
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
278
structure length
261
Chain Sequence
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase 1
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/dna
total genus 69
structure length 261
sequence length 278
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twmA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twmA01
5ITXA 1R2YA 1Q39A 3SAVA 2UUCM 1L1ZA 3SARA 5ITXE 1Z59A 3U6CA 1Z5BA 3GPYA 3GQ4A 1IBMM 4DV2M 1L1TA 3GO8A 4DR5M 3JR4A 3SBJA 4DV6M 5ITTA 3C58A 3GPUA 5BR8M 1HR0M 4G4QA 1N32M 3GPPA 3J80S 2UXBM 4B3SM 4DUZM 1N33M 3TWMA 1EE8A 3JR5A 1HNXM 4DR4M 2UXCM 4PCZA 5LMUM 1Z5CA 5A2QS 2UU9M 4JI6M 4GKJM 4LFBM 1L2DA 3T1HM 4LF9M 4DV0M 4LF6M 3GQ5A 1PJIA 4X65M 2HKJA 4JI0M 4DR7M 1Q3CA 3OTOM 1K82A 2OPFA 4JI8M 1I94M 2HHHM 2XZFA 2F5NA 3DOAA 4LFAM 1K3XA 1J5EM 4DR3M 4JI1M 5IT9S 2XZUA 2UUAM 3U6SA 1TDZA 1XC8A 4JI5M 4LF8M 2ZBKB 1MX0A 4YHHM 3A42A 4LF7M 4G4RA 4NRVA 3U6MA 3W0FA 5FLXS 4JV5M 3A45A 5LMNM 4PD2A 4B3TM 2Q2EB 2OQ4A 4X62M 4NRWA 3SAUA 4DV5M 4DR1M 2F5PA 5ITQA 2VQEM 1N34M 4PDGA 1FJGM 3U6EA 4DUYM 1K3WA 4LFCM 4JI3M 4GKKM 4JI4M 3T1YM 4JYAM 1IBKM 4NXNM 3JAMS 1TDHA 4DV3M 3U6PA 5ITYA 3U6LA 3J81S 1KFVA 1XMQM 3J7AS 3SAWA 2F5OA 4DV1M 4NXMM 1NNJA 1PJJA 4CISA 1HNWM 4X64M 4KHPM 4DR6M 3U6DA 2F5SA 2F5QA 4JI7M 5ITUA 3U6QA 3TWKA 3TWLA 1XNQM 4K0KM 5IWAM 4DV4M 1L2BA 2UXDM 1MU5A 1IBLM 1Q3BA 1XMOM 3SATA 1Z5AA 5ITRA 3U6OA 1PM5A 4ITQA 4MB7A 1XNRM 4G4NA 4LF4M 4OX9M 2ZM6M 4LF5M 4X66M 2E5LM 3GPXA 4AQYM 1R2ZA 2UUBM 4DR2M 2F4VM 2EA0A 4JI2M 4DV7M 3GQ3A 4YY3M 3A46A 3VK7A 1N36M 3GP1A 1HNZM 4G4OA 4B3MM 3SASA 2VQFM 1L2CA 4B3RM 3VK8A 4PDIA
chains in the Genus database with same CATH superfamily
3K1JA 1R2YA 1QDRA 4MGZE 2VF8A 4KO8A 3IG5A 3QWLA 5EP3A 5ITXE 1LTMA 2ZANA 2CHQA 5KQDA 1WGNA 1GL6A 3LVVA 3GPYA 3T15A 3MHVC 2V6ZM 2QPAA 4NC6A 4B08A 4DR5M 3JR4A 4CJ6A 4DV6M 4D82A 2JWSA 3KS4A 2DI0A 2J5YA 4FD2A 1JQJC 1G59A 3HHZA 1N32M 4IBBA 3R8FA 3SMPA 4BB9A 4EIWA 3LQRA 1N75A 1OIZA 4XK8F 4DUZM 3KXEC 3PVSA 3TWMA 2VF7A 3JR5A 2JXNA 3HJ8A 3FUXA 3SHFA 4DR4M 2R4JA 5FTKA 2UXCM 4LGMA 3UK6A 3AJIB 1Z5CA 2FNAA 3I4YA 4JI6M 4GKJM 3T1HM 4I81A 3J27B 4IBIA 1TR8A 3U61A 3K9PA 1QAOA 3HHXA 4IJFA 3GLGE 1ORYB 3U60B 2QCUA 1I94M 4NSRA 2HHHM 2F5NA 1XHBA 3DOAA 4FW9A 1UM8A 1HQYE 4LFAM 1QVRA 3FUUA 5IT9S 2ZAOA 3UZUA 4FCTA 1JB0F 3WHLA 2J7NA 1D0MA 1XXHE 1NJGA 3HWSA 3FD9A 4LZJA 4JI5M 4AI6A 5H37D 1KYIA 2LXEA 3KSJA 2JY7A 2Z4SA 3U6MA 2MJ5B 2R18A 2YR0A 2LVAA 3D8BA 4OVZA 5EJCA 5LMNM 1WJ7A 1C7YA 3WHKA 4B3TM 1XXHB 3K8ZA 3LVWA 2F5PA 4QHTA 4M0WA 2A5YB 3U6EA 2KZSA 2O25A 4LRSA 1G41A 1DGHA 3AOEC 1QZMA 4HEOA 1QANA 2XSZA 2QQ8A 1IXZA 2LBCA 4L16A 4DV3M 2BJVA 1OTRA 1OAOC 3I01M 3KVWA 3A98B 2D7EA 3FTEA 1WR1B 2XLJA 1SXJE 1KFVA 2D7HA 2DKLA 4Z6YA 5EXSA 3SAWA 3MJ5A 3HU1A 4MGKE 4LJAA 4QNRA 1HNWM 3KOXE 2C96A 4X64M 1PJSA 1VQ1A 4D81A 5DFLA 2EJSA 1SXJD 2CEAA 2L4EA 3IECA 4FWGA 4Z8XA 3SFZA 3D8LA 3W67A 4JI7M 5ITUA 3U6QA 1SG9A 4LJ4A 3TWKA 1Z6TA 2R65A 3TWLA 1ZMUA 2QBYA 1IY0A 1IN6A 1L2BA 3NWLA 4LY6A 1IBLM 3NBIA 1NJFA 3LMMA 4P16A 4B7HA 5DNYA 1Z5AA 2JA2A 3RFWA 3ZQJA 1KSFX 1QQWA 2JY5A 4LF5M 1IXSB 4XGIA 3I04M 4LZZA 3AFHA 4DV7M 3U5ZB 4GC5A 1VDLA 3BXWA 3EIEA 4I5SA 4G4OA 4B3MM 3L26A 3SASA 3B9PA 1L2CA 3HX3A 1D0KA 1QDTA 2L7HA 3VK8A 4REZA 5ITXA 1VEGA 4OU7A 1AIPC 2XEPA 3SAVA 1TH2A 4AKGA 3C3EA 2OO9A 3FYDA 3SARA 4LCBA 2R6FA 2EO2A 2C9CA 3R9XB 1DGBA 3GQ4A 1YSYA 3LCUA 1OKSA 1V33A 3GLFE 3QYEA 4DV2M 1L1TA 5KO3A 3GO8A 4P17A 5ITTA 1G8PA 4Q7JA 1T6OA 4HLQA 1H6UA 5JI3E 4GHAA 5BR8M 3PXGA 2MROB 2CV2A 2K6BA 3HHWA 2DXIA 2R45A 4KT0F 3FTFA 1NNUC 2Y0QA 3K92A 3MMPA 4IJEA 3TQSA 1GJTA 1NO1A 4R71A 1N33M 2L2DA 4QNMA 4F2LA 1UFZA 4PCZA 2C9OA 2Z3XA 2UU9M 3ZC7B 1R7RA 2DZNB 3W0LB 4KLNA 4AG5A 3GLIE 4QHSA 3GLGA 2C99A 3GQ5A 1GLNA 2CV0A 1WIVA 2X49A 2LH0A 2GQFA 2LHGA 1J7KA 3B74A 1QYRA 2MH8A 1CUKA 3GLIB 4NSOB 2CRUA 1MJGM 1XXHA 1TH4A 2BNKA 3FUVA 3V76A 5C1BA 4JI1M 3KS8A 4WP2A 2XZUA 3KSXA 1AUAA 2D7GA 2R0IA 3BOSA 2LWXA 5IZ7D 2EKFA 3GRUA 4RNAA 3T6PA 1VEJA 5C18A 1TDZA 3B89A 2K0BX 2L09A 2G8LA 5EP4A 1IFYA 2JY6B 3W0FA 1IN7A 1RU3A 1R4GA 3CTWB 1ZQ9A 3KOYE 4FWHA 2C5RA 2GNOA 5KQ8A 4LGYA 4B7GA 4M9SA 4L78A 1R6BX 4DUYM 2QZ4A 4JI3M 1SXJA 4JYAM 2QSFX 4G3OA 2WSFF 5ITYA 2H1RA 5IREB 3SYLA 1IN4A 2KZUA 1OAIA 1DGFA 3RGSA 2DHYA 3J7AS 2Y0TA 1JR3E 1HR0M 2XH9A 3E46A 4IBJA 4KODA 4NXMM 1IQPA 1MN3A 1PJJA 2M5ZA 3CF6E 3EIHA 3U5ZA 2F5SA 3LW5F 3HZJA 1IM2A 4IBDA 1JR3D 4FCVA 1R5LA 3FRHA 4L4UA 3IHPA 1NY6A 2M60A 4K0KM 4DV4M 2FH0A 2V1UA 2UXDM 2L6OA 3M0EA 2HL7A 1MU5A 2RGOA 3GRVA 1Q3BA 5EXTA 1XMOM 2DWLA 2MGWA 5ITRA 3U6OA 1PM5A 4MB7A 2DWNA 4G4NA 4ITQA 1XNRM 2DAGA 4X66M 4IBGA 5FTLA 2E5LM 3PNYA 2UUBM 1EFUB 2FS1A 3QYBA 1L8QA 3TPZA 2F4VM 4LJ8A 1TF0B 2KNAA 1ZV1A 5E26A 3VK7A 4GIPA 1N36M 2LHCA 1T43A 3GP1A 1HNZM 1Y8GA 4GMQA 2JY8A 1GJSA 2G5GX 4B3RM 1E9RA 1A5TA 3NBXX 3T38A 4PDIA 2BWEA 2NQ8C 1N78A 4MM3B 4G6ZA 5DYIA 4AG6A 1TTEA 2I7PA 2UUCM 3GLFA 4NL4H 1IY2A 4AKHA 3BBZA 3TL4X 5BPVA 5KPZA 3U6CA 4M0DA 1Z5BA 1IBMM 3AOEA 4WURA 2FOIC 2HCBA 3FUWA 2KA6B 3IG8A 3SBJA 4RF1A 3HJQA 5FSWA 2HAKA 2QHOB 4DBGB 3C58A 3VKHA 1QAQA 2P5TA 2Z7JA 3HJSA 1E9SA 2DENA 1DO0A 2KEBA 2EKKA 3J80S 1QUTA 4QOSA 3ZCBB 4GC9A 3GPPA 3AL0C 2C98A 2UXBM 4HL4A 2B3TA 4B3SM 2DAIA 1VEKA 3RE8A 3VDUA 4CHTB 3GLIA 3U61B 1N77A 1HNXM 5JI2E 5LMUM 1G4AE 4WW0A 5KPTA 2JZ0A 3UMMA 4MH0E 4IIWA 4LFBM 1OFHA 1OFIA 3HKPA 1G71A 2R44A 1PJQA 4LF6M 3E9SA 4X65M 2ZTCA 4JI0M 4DR7M 3OTOM 1X37A 3FE3A 1K82A 1W5TA 4LJ9A 1GABA 4M9XA 2LVOC 2XZFA 1BVSA 5E6JA 2DZOB 4CGYB 1F4IA 1NV8A 3FRIA 1J5EM 1IXRC 2KRKA 1ZAEA 3B7NA 1NHWC 4GEWA 2UUAM 4AZFA 2XFTA 1W5SA 3W68A 3U60A 1XC8A 2ZBKB 5L8RF 1IN5A 4JI4M 3A42A 2L4FA 3FTDA 4LF7M 4XBOA 1DGHB 1S3SA 4G4RA 3PFIA 3THGA 3H4JA 2RKOA 4PD2A 3HHYA 2OQ4A 4IBKA 1G3IA 4JN6A 4X62M 4NRWA 3ZH9B 3VLFB 4BBAA 4DR1M 1QAMA 4GH9A 4ANRA 5ITQA 1I4WA 1PGYA 2VQEM 1NY5A 3Q8GA 1HJPA 4FVMA 2DWZB 2KNZA 2DZLA 4LFCM 1NVMA 3T1YM 1J09A 1DO2A 1JR3A 2JP7A 2K47A 3E21A 4IBEA 3FUTA 2HWJA 2XF3A 4R3DA 3UJNA 4PT5A 3U6LA 3L2AA 1NV9A 2L7IA 2LVNC 2F5OA 3M6AA 4DV1M 1NNJA 4L8RC 1YE9A 4CISA 2O5RA 4KHPM 5EP2A 2VDBB 3U6DA 2OOAA 2V1CA 2EUCA 3DA1A 2H5XA 1V34A 1FNNA 1XNQM 5FTJA 2QENA 2LVQD 2RGHA 5FTMA 3GLHE 3AV0A 3E4RA 3J7BA 4DR6M 2ZAMA 3KW6A 3KFUG 3C9PA 1TGUA 2BWBA 3GPXA 3DFZA 2ERCA 4AQYM 4GRIA 3B7QA 2JNHA 2EA0A 3KP1E 4JI2M 1SXJC 4YY3M 2XGNA 1WHCA 3GLHB 4LJ6A 2J7OA 3GRYA 2FE8A 2W82A 2XFSA 1V92A 1QUSA 3UGJA 2CUZA 2BJWA 1IXSA 3PNVA 3VKGA 1Q39A 3TE6A 4LJ7A 4M9ZA 3L27A 1L1ZA 2JZ1A 2JUJA 3FKEA 2KXEA 1Z59A 4RKUF 1DV0A 4QOZC 4TUWA 1D2NA 3MK6A 2Y20A 2CV1A 2N35A 1XWIA 2AHMA 4ZPXA 4S12A 3I4VA 1QZEA 2CFOA 3GPUA 4G4QA 2DAEA 4OW0A 2G3QA 4MGIE 3GRRA 2O01F 3GLGB 1ZMVA 3QAUA 2CE7A 1EE8A 3J2PB 2KHHA 5EXPA 8CATA 1GL7A 2Z8YM 2ZTDA 2KRUA 5A2QS 3FYCA 3HU3A 4LG2A 1L2DA 2KW0A 3SC3A 4R7GA 3B7ZA 5F3WA 4DV0M 4LF9M 3VDPA 3L28A 1GO5A 5GKNA 4IBCA 4RF0A 2YQZA 4F1IA 1PJIA 4NOOB 2HKJA 2K9DA 5EXXA 1TH3A 1Q3CA 2DNAA 1VDDA 3FTCA 3M7GA 2OPFA 3C3DA 7CATA 3Q8XA 3KOZE 4JI8M 5KPRA 4D80A 3L25A 2MR9A 1E32A 4L6V6 3L29A 1K3XA 2WSEF 3KP0E 4DR3M 3CF0A 1HQCA 2DAMA 1P3QQ 4W5WA 4B7FA 4FCWA 2LTUA 2RRUA 4IBFA 3U6SA 3SYKA 4LF8M 2WSCF 1MX0A 4I4LA 4YHHM 3HGIA 4JXJA 1SXJB 1NHGC 1IY1A 1OJLA 1XB2B 2APLA 4NRVA 5EP1A 5FLXS 4JV5M 3A45A 1OQYA 4CIZA 1WGLA 2Q2EB 3CGWA 3DZDA 3SAUA 4DV5M 1IN8A 1D0LA 4AKIA 3LCVB 3AKZA 4Y28F 3KDSE 4II7A 2DAKA 2I7NA 4PDGA 1N34M 3CF2A 1FJGM 1K3WA 4L15A 2KDLA 3LQQA 2R46A 4GKKM 1HT2E 2DVWB 2R62A 4NXNM 1IBKM 1ZMWA 1TDHA 2FFJA 1VG5A 3ILKA 3JAMS 3U6PA 1GVNA 3HU2A 1EIJA 4LRTA 3AOGA 4GITA 2CP8A 3J81S 1XMQM 4OVZB 4FWDA 1PRBA 2R4EA 4AW4A 1T3TA 2CWBA 2Y21A 2QP9X 3SHGB 1OIPA 3K2LA 2XSZD 3GLHA 5FTNA 2F5QA 2LVPC 2OOBA 1Q02A 3I51A 1E94E 1C1KA 5IWAM 3RGPA 2DWMA 4GHLA 2YFQA 2X8AA 4MGHA 2Z4RA 3SATA 3F92A 3HY5A 4LJ5A 4I8OA 5DYGA 2CHVA 4LF4M 4OX9M 2ZM6M 4MGYE 1PJTA 2VIIA 2WZJA 1R2ZA 1DGGA 2LNHC 2KNVA 3VFDA 5EQTA 4DR2M 2QNJA 4A3VB 3GQ3A 3A46A 1LV7A 1NSFA 1WXQA 4UN2B 4BLCA 3GLFB 3KOWE 2X4AA 2QBYB 2DHRA 3K9OA 1HT1E 2VQFM 3H4MA 1GKIA 2CHGA 1YUBA 3SMSA 2YNMD 1YLAA
chains in the Genus database with same CATH topology
3K1JA 1R2YA 4MGZE 4KO8A 3IG5A 3QWLA 5EP3A 5ITXE 2ZANA 2CHQA 5KQDA 3LVVA 1GL6A 3GPYA 3T15A 3MHVC 2V6ZM 2QPAA 4B08A 4DR5M 3JR4A 4DV6M 4D82A 3KS4A 4FD2A 1JQJC 1G59A 3HHZA 1N32M 4IBBA 3R8FA 3SMPA 4BB9A 4EIWA 3LQRA 1N75A 4DUZM 3KXEC 3PVSA 3TWMA 3JR5A 3HJ8A 3FUXA 3SHFA 4DR4M 2R4JA 5FTKA 2UXCM 4LGMA 3UK6A 3AJIB 1Z5CA 2FNAA 3I4YA 4JI6M 4GKJM 3T1HM 4I81A 3J27B 4IBIA 3U61A 1QAOA 3HHXA 4IJFA 1ORYB 3U60B 2QCUA 1I94M 4NSRA 2HHHM 2F5NA 1XHBA 3DOAA 4FW9A 1UM8A 1HQYE 4LFAM 1QVRA 3FUUA 5IT9S 2ZAOA 3UZUA 4FCTA 3WHLA 2J7NA 1NJGA 3HWSA 3FD9A 4LZJA 4JI5M 4AI6A 5H37D 1KYIA 2LXEA 3KSJA 2Z4SA 3U6MA 2YR0A 2R18A 3D8BA 4OVZA 5LMNM 5EJCA 4B3TM 3WHKA 1XXHB 3K8ZA 3LVWA 2F5PA 4QHTA 4M0WA 2A5YB 3U6EA 2KZSA 4LRSA 3AOEC 1G41A 1DGHA 1QZMA 4JI4M 1QANA 2XSZA 1IXZA 4L16A 4DV3M 2BJVA 3KVWA 3A98B 2D7EA 3FTEA 2XLJA 1SXJE 1KFVA 2D7HA 4Z6YA 5EXSA 3SAWA 3MJ5A 3HU1A 4MGKE 4LJAA 4QNRA 1HNWM 3KOXE 2C96A 4X64M 4D81A 4Z8XA 3UGJA 1SXJD 2CEAA 4DR6M 4FWGA 3SFZA 4JI7M 3D8LA 5ITUA 3U6QA 4LJ4A 3TWKA 2QBYA 1Z6TA 2R65A 3TWLA 1IY0A 1IN6A 1L2BA 3NWLA 4LY6A 1IBLM 3NBIA 1NJFA 3LMMA 4P16A 4B7HA 5DNYA 1Z5AA 2JA2A 3RFWA 1KSFX 1QQWA 4LF5M 1IXSB 4XGIA 4LZZA 3AFHA 4DV7M 3U5ZB 4GC5A 3EIEA 4I5SA 4G4OA 4B3MM 3L26A 3SASA 3B9PA 1L2CA 2L7HA 3VK8A 4REZA 5ITXA 4OU7A 2XEPA 3SAVA 4AKGA 1TH2A 3FYDA 3SARA 4LCBA 2EO2A 2C9CA 3R9XB 1DGBA 3GQ4A 1YSYA 4DV2M 1L1TA 5KO3A 3GO8A 5ITTA 1G8PA 4HLQA 1H6UA 5JI3E 4GHAA 5BR8M 3PXGA 2CV2A 3HHWA 2DXIA 2R45A 3FTFA 1NNUC 2Y0QA 4IJEA 3TQSA 1N33M 4QNMA 4PCZA 2C9OA 2Z3XA 2UU9M 3ZC7B 1R7RA 2DZNB 3W0LB 4KLNA 4AG5A 4QHSA 3GLGA 2C99A 3GQ5A 1GLNA 2CV0A 2X49A 2LH0A 1J7KA 1QYRA 3GLIB 4NSOB 1XXHA 1TH4A 2BNKA 3FUVA 5C1BA 4JI1M 3KS8A 2XZUA 3KSXA 2D7GA 3BOSA 2LWXA 5IZ7D 3GRUA 1TDZA 4RNAA 5C18A 2L09A 2G8LA 5EP4A 3W0FA 1IN7A 3CTWB 1ZQ9A 3KOYE 4FWHA 2C5RA 5KQ8A 4LGYA 4B7GA 4M9SA 4L78A 1R6BX 4DUYM 2QZ4A 4JI3M 1SXJA 4JYAM 5ITYA 2H1RA 5IREB 3SYLA 1IN4A 2KZUA 1DGFA 3RGSA 3J7AS 2Y0TA 2XH9A 4IBJA 4KODA 4NXMM 1IQPA 1PJJA 2M5ZA 3CF6E 3EIHA 3U5ZA 2F5SA 1IM2A 4IBDA 1JR3D 4FCVA 4L4UA 1NY6A 2M60A 4K0KM 4DV4M 2UXDM 2V1UA 2L6OA 3M0EA 2HL7A 1MU5A 2RGOA 3GRVA 1Q3BA 5EXTA 1XMOM 2DWLA 5ITRA 3U6OA 1PM5A 4ITQA 4MB7A 2DWNA 4G4NA 1XNRM 4X66M 2E5LM 4IBGA 5FTLA 2F4VM 3PNYA 2UUBM 1L8QA 3TPZA 4LJ8A 3VK7A 5E26A 4GIPA 1N36M 3GP1A 1HNZM 4GMQA 2G5GX 4B3RM 1E9RA 3T38A 4PDIA 2NQ8C 1N78A 4MM3B 4G6ZA 5DYIA 4AG6A 2I7PA 2UUCM 3GLFA 4NL4H 1IY2A 4AKHA 3TL4X 5BPVA 5KPZA 3U6CA 4M0DA 1Z5BA 1IBMM 3AOEA 4WURA 2FOIC 2HCBA 3FUWA 2KA6B 3IG8A 3SBJA 4RF1A 3HJQA 5FSWA 3C58A 3VKHA 1QAQA 2P5TA 2Z7JA 3HJSA 1E9SA 2KEBA 1DO0A 3GPPA 1HR0M 3J80S 3ZCBB 4QOSA 3AL0C 4GC9A 2C98A 2UXBM 4HL4A 4B3SM 3RE8A 3VDUA 4CHTB 3GLIA 3U61B 1N77A 1HNXM 5JI2E 5LMUM 1G4AE 4WW0A 5KPTA 3UMMA 4MH0E 4IIWA 4LFBM 1OFHA 1OFIA 3HKPA 4LF6M 3E9SA 4X65M 4JI0M 4DR7M 3OTOM 1X37A 1K82A 1W5TA 4LJ9A 4M9XA 2XZFA 5E6JA 2DZOB 4CGYB 1J5EM 1IXRC 2KRKA 1ZAEA 1NHWC 2UUAM 4AZFA 2XFTA 1W5SA 3U60A 1XC8A 2ZBKB 1IN5A 3A42A 3FTDA 4LF7M 4XBOA 1DGHB 1S3SA 4G4RA 3PFIA 3THGA 2RKOA 4PD2A 3HHYA 2OQ4A 4IBKA 1G3IA 4JN6A 4X62M 4NRWA 3ZH9B 3VLFB 4BBAA 4DR1M 1QAMA 4GH9A 5ITQA 1I4WA 2VQEM 1NY5A 4FVMA 2DWZB 4LFCM 1NVMA 3T1YM 1J09A 1DO2A 1JR3A 2K47A 4IBEA 3FUTA 2XF3A 4R3DA 3UJNA 4PT5A 3U6LA 3L2AA 2L7IA 2F5OA 4L8RC 3M6AA 4DV1M 1NNJA 1YE9A 4CISA 2O5RA 4KHPM 5EP2A 3U6DA 2V1CA 2EUCA 3DA1A 1FNNA 1XNQM 5FTJA 2QENA 2RGHA 5FTMA 3AV0A 3E4RA 3J7BA 2ZAMA 3KW6A 3KFUG 1TGUA 3GPXA 4AQYM 3DFZA 2ERCA 4GRIA 2EA0A 4JI2M 3KP1E 1SXJC 4YY3M 2XGNA 3GLHB 4LJ6A 2J7OA 3GRYA 2FE8A 2XFSA 2W82A 2CUZA 2BJWA 3VKGA 3PNVA 1Q39A 3TE6A 4LJ7A 4M9ZA 3L27A 1L1ZA 3FKEA 2KXEA 1Z59A 4QOZC 4TUWA 1D2NA 3MK6A 2Y20A 2CV1A 1XWIA 2AHMA 4ZPXA 4S12A 3I4VA 3GPUA 2CFOA 4G4QA 4OW0A 4MGIE 3GRRA 3GLGB 3QAUA 2CE7A 1EE8A 3J2PB 5EXPA 8CATA 1GL7A 2KRUA 5A2QS 3FYCA 3HU3A 4LG2A 1L2DA 2KW0A 3SC3A 4R7GA 5F3WA 4LF9M 4DV0M 3VDPA 3L28A 5GKNA 4IBCA 4RF0A 2YQZA 1PJIA 4NOOB 2HKJA 5EXXA 1TH3A 1Q3CA 1VDDA 3FTCA 3M7GA 2OPFA 7CATA 4JI8M 3Q8XA 3KOZE 5KPRA 4D80A 3L25A 1E32A 3L29A 1K3XA 3KP0E 4DR3M 3CF0A 1HQCA 4W5WA 4B7FA 4FCWA 4IBFA 3U6SA 3SYKA 4LF8M 1MX0A 4I4LA 4YHHM 3HGIA 4JXJA 1SXJB 1NHGC 1IY1A 1OJLA 4NRVA 5EP1A 5FLXS 4JV5M 3A45A 2Q2EB 3DZDA 3SAUA 4DV5M 1IN8A 4AKIA 3AKZA 3KDSE 4II7A 2I7NA 4PDGA 1N34M 3CF2A 1FJGM 1K3WA 4L15A 3LQQA 2R46A 4GKKM 1HT2E 2DVWB 2R62A 4NXNM 1IBKM 3ILKA 1TDHA 2FFJA 3JAMS 3U6PA 1GVNA 3HU2A 4LRTA 3AOGA 4GITA 3J81S 1XMQM 4OVZB 4FWDA 2R4EA 4AW4A 1T3TA 2Y21A 2QP9X 3SHGB 3K2LA 2XSZD 3GLHA 5FTNA 2F5QA 3I51A 1E94E 1C1KA 5IWAM 3RGPA 2DWMA 4GHLA 2YFQA 2X8AA 4MGHA 2Z4RA 3SATA 4LJ5A 5DYGA 4I8OA 2CHVA 4LF4M 4OX9M 2ZM6M 4MGYE 2VIIA 1R2ZA 1DGGA 2LNHC 4DR2M 3VFDA 5EQTA 4A3VB 3GQ3A 3A46A 1LV7A 1NSFA 1WXQA 4BLCA 3GLFB 3KOWE 2X4AA 2QBYB 2DHRA 2VQFM 1HT1E 3H4MA 1GKIA 2CHGA 1YUBA 3SMSA 2YNMD 3K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITX A;  1R2Y A;  1Q39 A;  3SAV A;  2UUC M;  1L1Z A;  3SAR A;  5ITX E;  1Z59 A;  3U6C A;  1Z5B A;  3GPY A;  3GQ4 A;  1IBM M;  4DV2 M;  1L1T A;  3GO8 A;  4DR5 M;  3JR4 A;  3SBJ A;  4DV6 M;  5ITT A;  3C58 A;  3GPU A;  5BR8 M;  1HR0 M;  4G4Q A;  1N32 M;  3GPP A;  3J80 S;  2UXB M;  4B3S M;  4DUZ M;  1N33 M;  3TWM A;  1EE8 A;  3JR5 A;  1HNX M;  4DR4 M;  2UXC M;  4PCZ A;  5LMU M;  1Z5C A;  5A2Q S;  2UU9 M;  4JI6 M;  4GKJ M;  4LFB M;  1L2D A;  3T1H M;  4LF9 M;  4DV0 M;  4LF6 M;  3GQ5 A;  1PJI A;  4X65 M;  2HKJ A;  4JI0 M;  4DR7 M;  1Q3C A;  3OTO M;  1K82 A;  2OPF A;  4JI8 M;  1I94 M;  2HHH M;  2XZF A;  2F5N A;  3DOA A;  4LFA M;  1K3X A;  1J5E M;  4DR3 M;  4JI1 M;  5IT9 S;  2XZU A;  2UUA M;  3U6S A;  1TDZ A;  1XC8 A;  4JI5 M;  4LF8 M;  2ZBK B;  1MX0 A;  4YHH M;  3A42 A;  4LF7 M;  4G4R A;  4NRV A;  3U6M A;  3W0F A;  5FLX S;  4JV5 M;  3A45 A;  5LMN M;  4PD2 A;  4B3T M;  2Q2E B;  2OQ4 A;  4X62 M;  4NRW A;  3SAU A;  4DV5 M;  4DR1 M;  2F5P A;  5ITQ A;  2VQE M;  1N34 M;  4PDG A;  1FJG M;  3U6E A;  4DUY M;  1K3W A;  4LFC M;  4JI3 M;  4GKK M;  4JI4 M;  3T1Y M;  4JYA M;  1IBK M;  4NXN M;  3JAM S;  1TDH A;  4DV3 M;  3U6P A;  5ITY A;  3U6L A;  3J81 S;  1KFV A;  1XMQ M;  3J7A S;  3SAW A;  2F5O A;  4DV1 M;  4NXM M;  1NNJ A;  1PJJ A;  4CIS A;  1HNW M;  4X64 M;  4KHP M;  4DR6 M;  3U6D A;  2F5S A;  2F5Q A;  4JI7 M;  5ITU A;  3U6Q A;  3TWK A;  3TWL A;  1XNQ M;  4K0K M;  5IWA M;  4DV4 M;  1L2B A;  2UXD M;  1MU5 A;  1IBL M;  1Q3B A;  1XMO M;  3SAT A;  1Z5A A;  5ITR A;  3U6O A;  1PM5 A;  4ITQ A;  4MB7 A;  1XNR M;  4G4N A;  4LF4 M;  4OX9 M;  2ZM6 M;  4LF5 M;  4X66 M;  2E5L M;  3GPX A;  4AQY M;  1R2Z A;  2UUB M;  4DR2 M;  2F4V M;  2EA0 A;  4JI2 M;  4DV7 M;  3GQ3 A;  4YY3 M;  3A46 A;  3VK7 A;  1N36 M;  3GP1 A;  1HNZ M;  4G4O A;  4B3M M;  3SAS A;  2VQF M;  1L2C A;  4B3R M;  3VK8 A;  4PDI A; 
#chains in the Genus database with same CATH topology
 3K1J A;  1R2Y A;  1QDR A;  4MGZ E;  2VF8 A;  4KO8 A;  3IG5 A;  3QWL A;  5EP3 A;  5ITX E;  1LTM A;  2ZAN A;  2CHQ A;  5KQD A;  1WGN A;  1GL6 A;  3LVV A;  3GPY A;  3T15 A;  3MHV C;  2V6Z M;  2QPA A;  4NC6 A;  4B08 A;  4DR5 M;  3JR4 A;  4CJ6 A;  4DV6 M;  4D82 A;  2JWS A;  3KS4 A;  2DI0 A;  2J5Y A;  4FD2 A;  1JQJ C;  1G59 A;  3HHZ A;  1N32 M;  4IBB A;  3R8F A;  3SMP A;  4BB9 A;  4EIW A;  3LQR A;  1N75 A;  1OIZ A;  4XK8 F;  4DUZ M;  3KXE C;  3PVS A;  3TWM A;  2VF7 A;  3JR5 A;  2JXN A;  3HJ8 A;  3FUX A;  3SHF A;  4DR4 M;  2R4J A;  5FTK A;  2UXC M;  4LGM A;  3UK6 A;  3AJI B;  1Z5C A;  2FNA A;  3I4Y A;  4JI6 M;  4GKJ M;  3T1H M;  4I81 A;  3J27 B;  4IBI A;  1TR8 A;  3U61 A;  3K9P A;  1QAO A;  3HHX A;  4IJF A;  3GLG E;  1ORY B;  3U60 B;  2QCU A;  1I94 M;  4NSR A;  2HHH M;  2F5N A;  1XHB A;  3DOA A;  4FW9 A;  1UM8 A;  1HQY E;  4LFA M;  1QVR A;  3FUU A;  5IT9 S;  2ZAO A;  3UZU A;  4FCT A;  1JB0 F;  3WHL A;  2J7N A;  1D0M A;  1XXH E;  1NJG A;  3HWS A;  3FD9 A;  4LZJ A;  4JI5 M;  4AI6 A;  5H37 D;  1KYI A;  2LXE A;  3KSJ A;  2JY7 A;  2Z4S A;  3U6M A;  2MJ5 B;  2R18 A;  2YR0 A;  2LVA A;  3D8B A;  4OVZ A;  5EJC A;  5LMN M;  1WJ7 A;  1C7Y A;  3WHK A;  4B3T M;  1XXH B;  3K8Z A;  3LVW A;  2F5P A;  4QHT A;  4M0W A;  2A5Y B;  3U6E A;  2KZS A;  2O25 A;  4LRS A;  1G41 A;  1DGH A;  3AOE C;  1QZM A;  4HEO A;  1QAN A;  2XSZ A;  2QQ8 A;  1IXZ A;  2LBC A;  4L16 A;  4DV3 M;  2BJV A;  1OTR A;  1OAO C;  3I01 M;  3KVW A;  3A98 B;  2D7E A;  3FTE A;  1WR1 B;  2XLJ A;  1SXJ E;  1KFV A;  2D7H A;  2DKL A;  4Z6Y A;  5EXS A;  3SAW A;  3MJ5 A;  3HU1 A;  4MGK E;  4LJA A;  4QNR A;  1HNW M;  3KOX E;  2C96 A;  4X64 M;  1PJS A;  1VQ1 A;  4D81 A;  5DFL A;  2EJS A;  1SXJ D;  2CEA A;  2L4E A;  3IEC A;  4FWG A;  4Z8X A;  3SFZ A;  3D8L A;  3W67 A;  4JI7 M;  5ITU A;  3U6Q A;  1SG9 A;  4LJ4 A;  3TWK A;  1Z6T A;  2R65 A;  3TWL A;  1ZMU A;  2QBY A;  1IY0 A;  1IN6 A;  1L2B A;  3NWL A;  4LY6 A;  1IBL M;  3NBI A;  1NJF A;  3LMM A;  4P16 A;  4B7H A;  5DNY A;  1Z5A A;  2JA2 A;  3RFW A;  3ZQJ A;  1KSF X;  1QQW A;  2JY5 A;  4LF5 M;  1IXS B;  4XGI A;  3I04 M;  4LZZ A;  3AFH A;  4DV7 M;  3U5Z B;  4GC5 A;  1VDL A;  3BXW A;  3EIE A;  4I5S A;  4G4O A;  4B3M M;  3L26 A;  3SAS A;  3B9P A;  1L2C A;  3HX3 A;  1D0K A;  1QDT A;  2L7H A;  3VK8 A;  4REZ A;  5ITX A;  1VEG A;  4OU7 A;  1AIP C;  2XEP A;  3SAV A;  1TH2 A;  4AKG A;  3C3E A;  2OO9 A;  3FYD A;  3SAR A;  4LCB A;  2R6F A;  2EO2 A;  2C9C A;  3R9X B;  1DGB A;  3GQ4 A;  1YSY A;  3LCU A;  1OKS A;  1V33 A;  3GLF E;  3QYE A;  4DV2 M;  1L1T A;  5KO3 A;  3GO8 A;  4P17 A;  5ITT A;  1G8P A;  4Q7J A;  1T6O A;  4HLQ A;  1H6U A;  5JI3 E;  4GHA A;  5BR8 M;  3PXG A;  2MRO B;  2CV2 A;  2K6B A;  3HHW A;  2DXI A;  2R45 A;  4KT0 F;  3FTF A;  1NNU C;  2Y0Q A;  3K92 A;  3MMP A;  4IJE A;  3TQS A;  1GJT A;  1NO1 A;  4R71 A;  1N33 M;  2L2D A;  4QNM A;  4F2L A;  1UFZ A;  4PCZ A;  2C9O A;  2Z3X A;  2UU9 M;  3ZC7 B;  1R7R A;  2DZN B;  3W0L B;  4KLN A;  4AG5 A;  3GLI E;  4QHS A;  3GLG A;  2C99 A;  3GQ5 A;  1GLN A;  2CV0 A;  1WIV A;  2X49 A;  2LH0 A;  2GQF A;  2LHG A;  1J7K A;  3B74 A;  1QYR A;  2MH8 A;  1CUK A;  3GLI B;  4NSO B;  2CRU A;  1MJG M;  1XXH A;  1TH4 A;  2BNK A;  3FUV A;  3V76 A;  5C1B A;  4JI1 M;  3KS8 A;  4WP2 A;  2XZU A;  3KSX A;  1AUA A;  2D7G A;  2R0I A;  3BOS A;  2LWX A;  5IZ7 D;  2EKF A;  3GRU A;  4RNA A;  3T6P A;  1VEJ A;  5C18 A;  1TDZ A;  3B89 A;  2K0B X;  2L09 A;  2G8L A;  5EP4 A;  1IFY A;  2JY6 B;  3W0F A;  1IN7 A;  1RU3 A;  1R4G A;  3CTW B;  1ZQ9 A;  3KOY E;  4FWH A;  2C5R A;  2GNO A;  5KQ8 A;  4LGY A;  4B7G A;  4M9S A;  4L78 A;  1R6B X;  4DUY M;  2QZ4 A;  4JI3 M;  1SXJ A;  4JYA M;  2QSF X;  4G3O A;  2WSF F;  5ITY A;  2H1R A;  5IRE B;  3SYL A;  1IN4 A;  2KZU A;  1OAI A;  1DGF A;  3RGS A;  2DHY A;  3J7A S;  2Y0T A;  1JR3 E;  1HR0 M;  2XH9 A;  3E46 A;  4IBJ A;  4KOD A;  4NXM M;  1IQP A;  1MN3 A;  1PJJ A;  2M5Z A;  3CF6 E;  3EIH A;  3U5Z A;  2F5S A;  3LW5 F;  3HZJ A;  1IM2 A;  4IBD A;  1JR3 D;  4FCV A;  1R5L A;  3FRH A;  4L4U A;  3IHP A;  1NY6 A;  2M60 A;  4K0K M;  4DV4 M;  2FH0 A;  2V1U A;  2UXD M;  2L6O A;  3M0E A;  2HL7 A;  1MU5 A;  2RGO A;  3GRV A;  1Q3B A;  5EXT A;  1XMO M;  2DWL A;  2MGW A;  5ITR A;  3U6O A;  1PM5 A;  4MB7 A;  2DWN A;  4G4N A;  4ITQ A;  1XNR M;  2DAG A;  4X66 M;  4IBG A;  5FTL A;  2E5L M;  3PNY A;  2UUB M;  1EFU B;  2FS1 A;  3QYB A;  1L8Q A;  3TPZ A;  2F4V M;  4LJ8 A;  1TF0 B;  2KNA A;  1ZV1 A;  5E26 A;  3VK7 A;  4GIP A;  1N36 M;  2LHC A;  1T43 A;  3GP1 A;  1HNZ M;  1Y8G A;  4GMQ A;  2JY8 A;  1GJS A;  2G5G X;  4B3R M;  1E9R A;  1A5T A;  3NBX X;  3T38 A;  4PDI A;  2BWE A;  2NQ8 C;  1N78 A;  4MM3 B;  4G6Z A;  5DYI A;  4AG6 A;  1TTE A;  2I7P A;  2UUC M;  3GLF A;  4NL4 H;  1IY2 A;  4AKH A;  3BBZ A;  3TL4 X;  5BPV A;  5KPZ A;  3U6C A;  4M0D A;  1Z5B A;  1IBM M;  3AOE A;  4WUR A;  2FOI C;  2HCB A;  3FUW A;  2KA6 B;  3IG8 A;  3SBJ A;  4RF1 A;  3HJQ A;  5FSW A;  2HAK A;  2QHO B;  4DBG B;  3C58 A;  3VKH A;  1QAQ A;  2P5T A;  2Z7J A;  3HJS A;  1E9S A;  2DEN A;  1DO0 A;  2KEB A;  2EKK A;  3J80 S;  1QUT A;  4QOS A;  3ZCB B;  4GC9 A;  3GPP A;  3AL0 C;  2C98 A;  2UXB M;  4HL4 A;  2B3T A;  4B3S M;  2DAI A;  1VEK A;  3RE8 A;  3VDU A;  4CHT B;  3GLI A;  3U61 B;  1N77 A;  1HNX M;  5JI2 E;  5LMU M;  1G4A E;  4WW0 A;  5KPT A;  2JZ0 A;  3UMM A;  4MH0 E;  4IIW A;  4LFB M;  1OFH A;  1OFI A;  3HKP A;  1G71 A;  2R44 A;  1PJQ A;  4LF6 M;  3E9S A;  4X65 M;  2ZTC A;  4JI0 M;  4DR7 M;  3OTO M;  1X37 A;  3FE3 A;  1K82 A;  1W5T A;  4LJ9 A;  1GAB A;  4M9X A;  2LVO C;  2XZF A;  1BVS A;  5E6J A;  2DZO B;  4CGY B;  1F4I A;  1NV8 A;  3FRI A;  1J5E M;  1IXR C;  2KRK A;  1ZAE A;  3B7N A;  1NHW C;  4GEW A;  2UUA M;  4AZF A;  2XFT A;  1W5S A;  3W68 A;  3U60 A;  1XC8 A;  2ZBK B;  5L8R F;  1IN5 A;  4JI4 M;  3A42 A;  2L4F A;  3FTD A;  4LF7 M;  4XBO A;  1DGH B;  1S3S A;  4G4R A;  3PFI A;  3THG A;  3H4J A;  2RKO A;  4PD2 A;  3HHY A;  2OQ4 A;  4IBK A;  1G3I A;  4JN6 A;  4X62 M;  4NRW A;  3ZH9 B;  3VLF B;  4BBA A;  4DR1 M;  1QAM A;  4GH9 A;  4ANR A;  5ITQ A;  1I4W A;  1PGY A;  2VQE M;  1NY5 A;  3Q8G A;  1HJP A;  4FVM A;  2DWZ B;  2KNZ A;  2DZL A;  4LFC M;  1NVM A;  3T1Y M;  1J09 A;  1DO2 A;  1JR3 A;  2JP7 A;  2K47 A;  3E21 A;  4IBE A;  3FUT A;  2HWJ A;  2XF3 A;  4R3D A;  3UJN A;  4PT5 A;  3U6L A;  3L2A A;  1NV9 A;  2L7I A;  2LVN C;  2F5O A;  3M6A A;  4DV1 M;  1NNJ A;  4L8R C;  1YE9 A;  4CIS A;  2O5R A;  4KHP M;  5EP2 A;  2VDB B;  3U6D A;  2OOA A;  2V1C A;  2EUC A;  3DA1 A;  2H5X A;  1V34 A;  1FNN A;  1XNQ M;  5FTJ A;  2QEN A;  2LVQ D;  2RGH A;  5FTM A;  3GLH E;  3AV0 A;  3E4R A;  3J7B A;  4DR6 M;  2ZAM A;  3KW6 A;  3KFU G;  3C9P A;  1TGU A;  2BWB A;  3GPX A;  3DFZ A;  2ERC A;  4AQY M;  4GRI A;  3B7Q A;  2JNH A;  2EA0 A;  3KP1 E;  4JI2 M;  1SXJ C;  4YY3 M;  2XGN A;  1WHC A;  3GLH B;  4LJ6 A;  2J7O A;  3GRY A;  2FE8 A;  2W82 A;  2XFS A;  1V92 A;  1QUS A;  3UGJ A;  2CUZ A;  2BJW A;  1IXS A;  3PNV A;  3VKG A;  1Q39 A;  3TE6 A;  4LJ7 A;  4M9Z A;  3L27 A;  1L1Z A;  2JZ1 A;  2JUJ A;  3FKE A;  2KXE A;  1Z59 A;  4RKU F;  1DV0 A;  4QOZ C;  4TUW A;  1D2N A;  3MK6 A;  2Y20 A;  2CV1 A;  2N35 A;  1XWI A;  2AHM A;  4ZPX A;  4S12 A;  3I4V A;  1QZE A;  2CFO A;  3GPU A;  4G4Q A;  2DAE A;  4OW0 A;  2G3Q A;  4MGI E;  3GRR A;  2O01 F;  3GLG B;  1ZMV A;  3QAU A;  2CE7 A;  1EE8 A;  3J2P B;  2KHH A;  5EXP A;  8CAT A;  1GL7 A;  2Z8Y M;  2ZTD A;  2KRU A;  5A2Q S;  3FYC A;  3HU3 A;  4LG2 A;  1L2D A;  2KW0 A;  3SC3 A;  4R7G A;  3B7Z A;  5F3W A;  4DV0 M;  4LF9 M;  3VDP A;  3L28 A;  1GO5 A;  5GKN A;  4IBC A;  4RF0 A;  2YQZ A;  4F1I A;  1PJI A;  4NOO B;  2HKJ A;  2K9D A;  5EXX A;  1TH3 A;  1Q3C A;  2DNA A;  1VDD A;  3FTC A;  3M7G A;  2OPF A;  3C3D A;  7CAT A;  3Q8X A;  3KOZ E;  4JI8 M;  5KPR A;  4D80 A;  3L25 A;  2MR9 A;  1E32 A;  4L6V 6;  3L29 A;  1K3X A;  2WSE F;  3KP0 E;  4DR3 M;  3CF0 A;  1HQC A;  2DAM A;  1P3Q Q;  4W5W A;  4B7F A;  4FCW A;  2LTU A;  2RRU A;  4IBF A;  3U6S A;  3SYK A;  4LF8 M;  2WSC F;  1MX0 A;  4I4L A;  4YHH M;  3HGI A;  4JXJ A;  1SXJ B;  1NHG C;  1IY1 A;  1OJL A;  1XB2 B;  2APL A;  4NRV A;  5EP1 A;  5FLX S;  4JV5 M;  3A45 A;  1OQY A;  4CIZ A;  1WGL A;  2Q2E B;  3CGW A;  3DZD A;  3SAU A;  4DV5 M;  1IN8 A;  1D0L A;  4AKI A;  3LCV B;  3AKZ A;  4Y28 F;  3KDS E;  4II7 A;  2DAK A;  2I7N A;  4PDG A;  1N34 M;  3CF2 A;  1FJG M;  1K3W A;  4L15 A;  2KDL A;  3LQQ A;  2R46 A;  4GKK M;  1HT2 E;  2DVW B;  2R62 A;  4NXN M;  1IBK M;  1ZMW A;  1TDH A;  2FFJ A;  1VG5 A;  3ILK A;  3JAM S;  3U6P A;  1GVN A;  3HU2 A;  1EIJ A;  4LRT A;  3AOG A;  4GIT A;  2CP8 A;  3J81 S;  1XMQ M;  4OVZ B;  4FWD A;  1PRB A;  2R4E A;  4AW4 A;  1T3T A;  2CWB A;  2Y21 A;  2QP9 X;  3SHG B;  1OIP A;  3K2L A;  2XSZ D;  3GLH A;  5FTN A;  2F5Q A;  2LVP C;  2OOB A;  1Q02 A;  3I51 A;  1E94 E;  1C1K A;  5IWA M;  3RGP A;  2DWM A;  4GHL A;  2YFQ A;  2X8A A;  4MGH A;  2Z4R A;  3SAT A;  3F92 A;  3HY5 A;  4LJ5 A;  4I8O A;  5DYG A;  2CHV A;  4LF4 M;  4OX9 M;  2ZM6 M;  4MGY E;  1PJT A;  2VII A;  2WZJ A;  1R2Z A;  1DGG A;  2LNH C;  2KNV A;  3VFD A;  5EQT A;  4DR2 M;  2QNJ A;  4A3V B;  3GQ3 A;  3A46 A;  1LV7 A;  1NSF A;  1WXQ A;  4UN2 B;  4BLC A;  3GLF B;  3KOW E;  2X4A A;  2QBY B;  2DHR A;  3K9O A;  1HT1 E;  2VQF M;  3H4M A;  1GKI A;  2CHG A;  1YUB A;  3SMS A;  2YNM D;  1YLA A; 
#chains in the Genus database with same CATH homology
 3K1J A;  1R2Y A;  4MGZ E;  4KO8 A;  3IG5 A;  3QWL A;  5EP3 A;  5ITX E;  2ZAN A;  2CHQ A;  5KQD A;  3LVV A;  1GL6 A;  3GPY A;  3T15 A;  3MHV C;  2V6Z M;  2QPA A;  4B08 A;  4DR5 M;  3JR4 A;  4DV6 M;  4D82 A;  3KS4 A;  4FD2 A;  1JQJ C;  1G59 A;  3HHZ A;  1N32 M;  4IBB A;  3R8F A;  3SMP A;  4BB9 A;  4EIW A;  3LQR A;  1N75 A;  4DUZ M;  3KXE C;  3PVS A;  3TWM A;  3JR5 A;  3HJ8 A;  3FUX A;  3SHF A;  4DR4 M;  2R4J A;  5FTK A;  2UXC M;  4LGM A;  3UK6 A;  3AJI B;  1Z5C A;  2FNA A;  3I4Y A;  4JI6 M;  4GKJ M;  3T1H M;  4I81 A;  3J27 B;  4IBI A;  3U61 A;  1QAO A;  3HHX A;  4IJF A;  1ORY B;  3U60 B;  2QCU A;  1I94 M;  4NSR A;  2HHH M;  2F5N A;  1XHB A;  3DOA A;  4FW9 A;  1UM8 A;  1HQY E;  4LFA M;  1QVR A;  3FUU A;  5IT9 S;  2ZAO A;  3UZU A;  4FCT A;  3WHL A;  2J7N A;  1NJG A;  3HWS A;  3FD9 A;  4LZJ A;  4JI5 M;  4AI6 A;  5H37 D;  1KYI A;  2LXE A;  3KSJ A;  2Z4S A;  3U6M A;  2YR0 A;  2R18 A;  3D8B A;  4OVZ A;  5LMN M;  5EJC A;  4B3T M;  3WHK A;  1XXH B;  3K8Z A;  3LVW A;  2F5P A;  4QHT A;  4M0W A;  2A5Y B;  3U6E A;  2KZS A;  4LRS A;  3AOE C;  1G41 A;  1DGH A;  1QZM A;  4JI4 M;  1QAN A;  2XSZ A;  1IXZ A;  4L16 A;  4DV3 M;  2BJV A;  3KVW A;  3A98 B;  2D7E A;  3FTE A;  2XLJ A;  1SXJ E;  1KFV A;  2D7H A;  4Z6Y A;  5EXS A;  3SAW A;  3MJ5 A;  3HU1 A;  4MGK E;  4LJA A;  4QNR A;  1HNW M;  3KOX E;  2C96 A;  4X64 M;  4D81 A;  4Z8X A;  3UGJ A;  1SXJ D;  2CEA A;  4DR6 M;  4FWG A;  3SFZ A;  4JI7 M;  3D8L A;  5ITU A;  3U6Q A;  4LJ4 A;  3TWK A;  2QBY A;  1Z6T A;  2R65 A;  3TWL A;  1IY0 A;  1IN6 A;  1L2B A;  3NWL A;  4LY6 A;  1IBL M;  3NBI A;  1NJF A;  3LMM A;  4P16 A;  4B7H A;  5DNY A;  1Z5A A;  2JA2 A;  3RFW A;  1KSF X;  1QQW A;  4LF5 M;  1IXS B;  4XGI A;  4LZZ A;  3AFH A;  4DV7 M;  3U5Z B;  4GC5 A;  3EIE A;  4I5S A;  4G4O A;  4B3M M;  3L26 A;  3SAS A;  3B9P A;  1L2C A;  2L7H A;  3VK8 A;  4REZ A;  5ITX A;  4OU7 A;  2XEP A;  3SAV A;  4AKG A;  1TH2 A;  3FYD A;  3SAR A;  4LCB A;  2EO2 A;  2C9C A;  3R9X B;  1DGB A;  3GQ4 A;  1YSY A;  4DV2 M;  1L1T A;  5KO3 A;  3GO8 A;  5ITT A;  1G8P A;  4HLQ A;  1H6U A;  5JI3 E;  4GHA A;  5BR8 M;  3PXG A;  2CV2 A;  3HHW A;  2DXI A;  2R45 A;  3FTF A;  1NNU C;  2Y0Q A;  4IJE A;  3TQS A;  1N33 M;  4QNM A;  4PCZ A;  2C9O A;  2Z3X A;  2UU9 M;  3ZC7 B;  1R7R A;  2DZN B;  3W0L B;  4KLN A;  4AG5 A;  4QHS A;  3GLG A;  2C99 A;  3GQ5 A;  1GLN A;  2CV0 A;  2X49 A;  2LH0 A;  1J7K A;  1QYR A;  3GLI B;  4NSO B;  1XXH A;  1TH4 A;  2BNK A;  3FUV A;  5C1B A;  4JI1 M;  3KS8 A;  2XZU A;  3KSX A;  2D7G A;  3BOS A;  2LWX A;  5IZ7 D;  3GRU A;  1TDZ A;  4RNA A;  5C18 A;  2L09 A;  2G8L A;  5EP4 A;  3W0F A;  1IN7 A;  3CTW B;  1ZQ9 A;  3KOY E;  4FWH A;  2C5R A;  5KQ8 A;  4LGY A;  4B7G A;  4M9S A;  4L78 A;  1R6B X;  4DUY M;  2QZ4 A;  4JI3 M;  1SXJ A;  4JYA M;  5ITY A;  2H1R A;  5IRE B;  3SYL A;  1IN4 A;  2KZU A;  1DGF A;  3RGS A;  3J7A S;  2Y0T A;  2XH9 A;  4IBJ A;  4KOD A;  4NXM M;  1IQP A;  1PJJ A;  2M5Z A;  3CF6 E;  3EIH A;  3U5Z A;  2F5S A;  1IM2 A;  4IBD A;  1JR3 D;  4FCV A;  4L4U A;  1NY6 A;  2M60 A;  4K0K M;  4DV4 M;  2UXD M;  2V1U A;  2L6O A;  3M0E A;  2HL7 A;  1MU5 A;  2RGO A;  3GRV A;  1Q3B A;  5EXT A;  1XMO M;  2DWL A;  5ITR A;  3U6O A;  1PM5 A;  4ITQ A;  4MB7 A;  2DWN A;  4G4N A;  1XNR M;  4X66 M;  2E5L M;  4IBG A;  5FTL A;  2F4V M;  3PNY A;  2UUB M;  1L8Q A;  3TPZ A;  4LJ8 A;  3VK7 A;  5E26 A;  4GIP A;  1N36 M;  3GP1 A;  1HNZ M;  4GMQ A;  2G5G X;  4B3R M;  1E9R A;  3T38 A;  4PDI A;  2NQ8 C;  1N78 A;  4MM3 B;  4G6Z A;  5DYI A;  4AG6 A;  2I7P A;  2UUC M;  3GLF A;  4NL4 H;  1IY2 A;  4AKH A;  3TL4 X;  5BPV A;  5KPZ A;  3U6C A;  4M0D A;  1Z5B A;  1IBM M;  3AOE A;  4WUR A;  2FOI C;  2HCB A;  3FUW A;  2KA6 B;  3IG8 A;  3SBJ A;  4RF1 A;  3HJQ A;  5FSW A;  3C58 A;  3VKH A;  1QAQ A;  2P5T A;  2Z7J A;  3HJS A;  1E9S A;  2KEB A;  1DO0 A;  3GPP A;  1HR0 M;  3J80 S;  3ZCB B;  4QOS A;  3AL0 C;  4GC9 A;  2C98 A;  2UXB M;  4HL4 A;  4B3S M;  3RE8 A;  3VDU A;  4CHT B;  3GLI A;  3U61 B;  1N77 A;  1HNX M;  5JI2 E;  5LMU M;  1G4A E;  4WW0 A;  5KPT A;  3UMM A;  4MH0 E;  4IIW A;  4LFB M;  1OFH A;  1OFI A;  3HKP A;  4LF6 M;  3E9S A;  4X65 M;  4JI0 M;  4DR7 M;  3OTO M;  1X37 A;  1K82 A;  1W5T A;  4LJ9 A;  4M9X A;  2XZF A;  5E6J A;  2DZO B;  4CGY B;  1J5E M;  1IXR C;  2KRK A;  1ZAE A;  1NHW C;  2UUA M;  4AZF A;  2XFT A;  1W5S A;  3U60 A;  1XC8 A;  2ZBK B;  1IN5 A;  3A42 A;  3FTD A;  4LF7 M;  4XBO A;  1DGH B;  1S3S A;  4G4R A;  3PFI A;  3THG A;  2RKO A;  4PD2 A;  3HHY A;  2OQ4 A;  4IBK A;  1G3I A;  4JN6 A;  4X62 M;  4NRW A;  3ZH9 B;  3VLF B;  4BBA A;  4DR1 M;  1QAM A;  4GH9 A;  5ITQ A;  1I4W A;  2VQE M;  1NY5 A;  4FVM A;  2DWZ B;  4LFC M;  1NVM A;  3T1Y M;  1J09 A;  1DO2 A;  1JR3 A;  2K47 A;  4IBE A;  3FUT A;  2XF3 A;  4R3D A;  3UJN A;  4PT5 A;  3U6L A;  3L2A A;  2L7I A;  2F5O A;  4L8R C;  3M6A A;  4DV1 M;  1NNJ A;  1YE9 A;  4CIS A;  2O5R A;  4KHP M;  5EP2 A;  3U6D A;  2V1C A;  2EUC A;  3DA1 A;  1FNN A;  1XNQ M;  5FTJ A;  2QEN A;  2RGH A;  5FTM A;  3AV0 A;  3E4R A;  3J7B A;  2ZAM A;  3KW6 A;  3KFU G;  1TGU A;  3GPX A;  4AQY M;  3DFZ A;  2ERC A;  4GRI A;  2EA0 A;  4JI2 M;  3KP1 E;  1SXJ C;  4YY3 M;  2XGN A;  3GLH B;  4LJ6 A;  2J7O A;  3GRY A;  2FE8 A;  2XFS A;  2W82 A;  2CUZ A;  2BJW A;  3VKG A;  3PNV A;  1Q39 A;  3TE6 A;  4LJ7 A;  4M9Z A;  3L27 A;  1L1Z A;  3FKE A;  2KXE A;  1Z59 A;  4QOZ C;  4TUW A;  1D2N A;  3MK6 A;  2Y20 A;  2CV1 A;  1XWI A;  2AHM A;  4ZPX A;  4S12 A;  3I4V A;  3GPU A;  2CFO A;  4G4Q A;  4OW0 A;  4MGI E;  3GRR A;  3GLG B;  3QAU A;  2CE7 A;  1EE8 A;  3J2P B;  5EXP A;  8CAT A;  1GL7 A;  2KRU A;  5A2Q S;  3FYC A;  3HU3 A;  4LG2 A;  1L2D A;  2KW0 A;  3SC3 A;  4R7G A;  5F3W A;  4LF9 M;  4DV0 M;  3VDP A;  3L28 A;  5GKN A;  4IBC A;  4RF0 A;  2YQZ A;  1PJI A;  4NOO B;  2HKJ A;  5EXX A;  1TH3 A;  1Q3C A;  1VDD A;  3FTC A;  3M7G A;  2OPF A;  7CAT A;  4JI8 M;  3Q8X A;  3KOZ E;  5KPR A;  4D80 A;  3L25 A;  1E32 A;  3L29 A;  1K3X A;  3KP0 E;  4DR3 M;  3CF0 A;  1HQC A;  4W5W A;  4B7F A;  4FCW A;  4IBF A;  3U6S A;  3SYK A;  4LF8 M;  1MX0 A;  4I4L A;  4YHH M;  3HGI A;  4JXJ A;  1SXJ B;  1NHG C;  1IY1 A;  1OJL A;  4NRV A;  5EP1 A;  5FLX S;  4JV5 M;  3A45 A;  2Q2E B;  3DZD A;  3SAU A;  4DV5 M;  1IN8 A;  4AKI A;  3AKZ A;  3KDS E;  4II7 A;  2I7N A;  4PDG A;  1N34 M;  3CF2 A;  1FJG M;  1K3W A;  4L15 A;  3LQQ A;  2R46 A;  4GKK M;  1HT2 E;  2DVW B;  2R62 A;  4NXN M;  1IBK M;  3ILK A;  1TDH A;  2FFJ A;  3JAM S;  3U6P A;  1GVN A;  3HU2 A;  4LRT A;  3AOG A;  4GIT A;  3J81 S;  1XMQ M;  4OVZ B;  4FWD A;  2R4E A;  4AW4 A;  1T3T A;  2Y21 A;  2QP9 X;  3SHG B;  3K2L A;  2XSZ D;  3GLH A;  5FTN A;  2F5Q A;  3I51 A;  1E94 E;  1C1K A;  5IWA M;  3RGP A;  2DWM A;  4GHL A;  2YFQ A;  2X8A A;  4MGH A;  2Z4R A;  3SAT A;  4LJ5 A;  5DYG A;  4I8O A;  2CHV A;  4LF4 M;  4OX9 M;  2ZM6 M;  4MGY E;  2VII A;  1R2Z A;  1DGG A;  2LNH C;  4DR2 M;  3VFD A;  5EQT A;  4A3V B;  3GQ3 A;  3A46 A;  1LV7 A;  1NSF A;  1WXQ A;  4BLC A;  3GLF B;  3KOW E;  2X4A A;  2QBY B;  2DHR A;  2VQF M;  1HT1 E;  3H4M A;  1GKI A;  2CHG A;  1YUB A;  3SMS A;  2YNM D;  3K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...