3TWMA

Crystal structure of arabidopsis thaliana fpg
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
278
structure length
261
Chain Sequence
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/dna
molecule keywords Formamidopyrimidine-DNA glycosylase 1
total genus 69
structure length 261
sequence length 278
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twmA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twmA01
4X64M 1PJJA 1J5EM 1I94M 1R2ZA 3A42A 4LF9M 4JI0M 1Z5BA 3JR4A 1L1ZA 3U6EA 4MB7A 5ITYA 3GQ3A 1L2CA 1Z5CA 4DV5M 2UXBM 2VQEM 3VK8A 4LFBM 1L2BA 2F5NA 2UUCM 2ZM6M 5ITXA 4DUYM 4DR4M 1Z59A 3U6LA 1N36M 4B3TM 1N33M 4JI5M 4JI1M 2UXDM 3J81S 3GPPA 1HNZM 5FLXS 1Q39A 3TWKA 3SATA 1HR0M 4DR7M 3OTOM 1XNRM 3U6DA 2F5OA 4DR2M 3U6OA 3U6CA 1KFVA 4DUZM 4GKKM 2ZBKB 4NRVA 3U6QA 3T1HM 1FJGM 1Q3CA 4DR5M 1R2YA 3JR5A 3GQ4A 2Q2EB 3JAMS 4LF5M 3GP1A 4K0KM 4YY3M 5ITUA 2F5PA 4PD2A 2HHHM 4JI2M 2OPFA 3SAVA 4NXNM 2VQFM 1IBLM 2XZFA 1Z5AA 4DR6M 2XZUA 3W0FA 1PJIA 4CISA 4LF4M 4OX9M 4NRWA 4KHPM 4DV4M 4G4QA 4DV7M 1IBKM 1HNWM 3U6SA 4LFCM 5ITQA 1TDZA 1N34M 3SARA 3DOAA 2UXCM 2E5LM 1PM5A 2F4VM 5LMNM 3SAUA 4DV0M 1XC8A 4B3MM 4YHHM 3VK7A 3TWLA 5IWAM 5LMUM 3C58A 4LF6M 4JV5M 3GQ5A 3SASA 4JI3M 3GPYA 3U6PA 3GPXA 3SBJA 4GKJM 5ITXE 4G4RA 3J80S 1Q3BA 3GPUA 1XMQM 4X62M 4NXMM 5ITRA 3GO8A 1MX0A 3TWMA 4X65M 5BR8M 4DR3M 3SAWA 4X66M 2OQ4A 3A45A 3A46A 1K82A 2F5SA 1L1TA 4ITQA 2UUBM 4PDIA 3U6MA 1K3XA 2UUAM 4JI4M 4B3RM 2UU9M 1MU5A 4JI6M 4DV2M 1XNQM 4DV1M 2F5QA 5ITTA 4LFAM 4B3SM 2HKJA 4JI7M 4AQYM 4JI8M 5IT9S 1TDHA 1NNJA 4LF8M 4DR1M 3J7AS 1EE8A 4PDGA 4DV3M 4PCZA 5A2QS 1IBMM 1K3WA 4JYAM 4G4OA 1L2DA 2EA0A 4G4NA 3T1YM 4LF7M 1HNXM 4DV6M 1XMOM 1N32M
chains in the Genus database with same CATH superfamily
1PJJA 1R6BX 1ZQ9A 1QVRA 4FWDA 3MMPA 3T15A 1J5EM 2LWXA 4AKGA 1T43A 1GKIA 1Z5BA 5IZ7D 1L1ZA 3B7ZA 4M0DA 1T6OA 2QNJA 2DHRA 4D81A 1P3QQ 2DAMA 2JP7A 2VQEM 2G5GX 2YFQA 3UK6A 3K8ZA 3EIHA 2ZM6M 5ITXA 4DUYM 2KZUA 1VDLA 2R6FA 1VEKA 1NHWC 1NY6A 3ZCBB 5EP1A 1N36M 4JI5M 2KW0A 3J81S 2L2DA 2HCBA 7CATA 3IHPA 3J2PB 1YLAA 1QAQA 2I7NA 3OTOM 1YE9A 2XGNA 4RF0A 2F5OA 4DR2M 2JNHA 1EFUB 2CFOA 4IBGA 5F3WA 3FUXA 1N77A 4DUZM 3GLFA 4GKKM 2XFSA 3T1HM 1HQYE 4DR5M 2QSFX 2O5RA 2C9OA 3JR5A 1R2YA 3KS4A 2Y0QA 4W5WA 1XXHA 3TPZA 4MGHA 2F5PA 3L25A 2DXIA 2JY8A 1IN4A 2APLA 1GABA 4LJ4A 5KQDA 3ZQJA 3B7NA 2K9DA 3KOZE 4KLNA 2XZUA 4LF4M 4DR6M 1GLNA 2C9CA 4CISA 4NRWA 4KHPM 2K6BA 3HJQA 4G4QA 5C18A 4LCBA 3KXEC 2VDBB 3CF2A 4P17A 4FD2A 1HJPA 1G3IA 1N34M 2KRUA 3DOAA 1X37A 2R18A 3MHVC 4FVMA 4CHTB 1S3SA 1N78A 2F4VM 3SYLA 3KVWA 1TH4A 1NVMA 4B3MM 2YQZA 2FH0A 4LRSA 2GNOA 1ZMUA 4JI3M 3U6PA 3ILKA 3NBIA 3VDPA 4D82A 1E32A 3J80S 3HU1A 1T3TA 4RNAA 2W82A 3M0EA 1VDDA 4XBOA 3KOWE 4AI6A 3R9XB 3GO8A 1ORYB 3BXWA 4X65M 3GLGE 2EKFA 3Q8XA 3AJIB 1ZMWA 3A45A 3A46A 2LVOC 2RGOA 2B3TA 2DHYA 2LXEA 2WSFF 2UUBM 1C1KA 3MK6A 3U6MA 1K3XA 3QYBA 5KPZA 3SFZA 4F2LA 3CF6E 2UU9M 1MU5A 4NL4H 3SMPA 5H37D 4DV1M 4QOSA 4LZJA 4LJ6A 5EQTA 3A98B 2DWNA 4LGMA 2X4AA 3HGIA 3KSXA 2M60A 2CHVA 4M9ZA 2CUZA 4MH0E 4GHAA 1SXJB 2MR9A 4M9SA 2Z3XA 1NJGA 5C1BA 4LJAA 4PCZA 3U61A 4IBDA 4WURA 4HL4A 1TTEA 1YSYA 4BLCA 4BB9A 1Q02A 3UMMA 2H5XA 2EA0A 2JZ1A 2EO2A 1GL6A 2KNVA 2O25A 3L28A 3HKPA 4GITA 1XMOM 1C7YA 1N32M 4IBEA 2ZTCA 2DWZB 3HHYA 2J7OA 2VIIA 1E9SA 3U6EA 2CE7A 2DZNB 3KP0E 2DZLA 5FSWA 3HWSA 1IM2A 3U5ZB 4AKHA 2UXBM 2JY5A 2O01F 4LJ5A 2QBYB 3AL0C 1LTMA 2WSEF 3GRVA 4G6ZA 2Z7JA 3FYCA 1HQCA 2DKLA 4DR4M 4B3TM 2DAIA 4M9XA 3PNVA 3HHZA 2V1CA 4JI1M 4I4LA 3GPPA 2CEAA 2RRUA 3HZJA 1VQ1A 4IBKA 4WW0A 3VLFB 1IFYA 3GLIB 3E46A 4HEOA 4M0WA 4ZPXA 3SATA 1XHBA 1DGBA 5JI3E 1NV8A 1WIVA 1TR8A 1H6UA 1D0MA 2G8LA 3GLHA 1IN5A 3U6CA 1KFVA 2HAKA 1IY1A 1SG9A 2LVPC 3KOYE 4GC9A 1OFIA 3U6QA 1RU3A 4GHLA 1NO1A 3V76A 2CHQA 2WSCF 1SXJA 3H4MA 2Q2EB 4RF1A 3JAMS 1QQWA 3GP1A 5ITUA 2H1RA 1V34A 2LHCA 1PJSA 2OOBA 1VEJA 3FUTA 4JN6A 2HHHM 4NXNM 2VQFM 1IN8A 5DYGA 1IBLM 1E9RA 3RGSA 4DV4M 1IY0A 1CUKA 3LVWA 1W5SA 4Y28F 3AOGA 4XK8F 4B08A 1TDZA 2E5LM 2XLJA 1PM5A 1SXJE 2BJVA 3T38A 4LJ7A 4I81A 5E6JA 4IJFA 4YHHM 5BPVA 3TWLA 2R44A 5IWAM 5L8RF 3C58A 1OKSA 3C3EA 3KP1E 5DYIA 3GPYA 2MH8A 4NOOB 3LQRA 3AFHA 4IBIA 2KRKA 3LVVA 4G4RA 2YNMD 1NNUC 4MGKE 4QHTA 2XFTA 3U5ZA 2CV2A 2NQ8C 4NXMM 5FTNA 3GLHE 1VEGA 3SHGB 3W68A 3EIEA 2WZJA 5BR8M 3FUWA 1XWIA 3HJ8A 2OQ4A 1QDRA 2R46A 2LNHC 4AZFA 3WHKA 4OU7A 1V33A 2FOIC 1K82A 4ITQA 3TE6A 5KPTA 1QZMA 2R62A 4FCTA 2KEBA 3FTEA 3BBZA 2Y21A 3TL4X 1JQJC 4KO8A 4ANRA 4AG5A 4B3RM 1IXSB 4DV2M 2FS1A 1F4IA 1GL7A 5ITTA 4JI7M 3L26A 2QENA 3T6PA 1XB2B 5IT9S 3NWLA 1DGGA 2AHMA 1TDHA 1WHCA 2HL7A 2K0BX 4AW4A 4UN2B 2DENA 4LJ9A 3ZC7B 3SMSA 4LF8M 3IG5A 4DR1M 2L09A 1EE8A 2R4EA 4OW0A 4DV3M 3D8LA 5A2QS 4OVZA 1HT2E 3QWLA 1QAOA 3FRHA 1K3WA 3PFIA 4JXJA 2LHGA 3KOXE 3J27B 3LCVB 1GO5A 1OTRA 3T1YM 1JR3E 1G41A 1HNXM 2EJSA 4XGIA 4G3OA 4DV6M 2M5ZA 4X64M 2LH0A 3VKGA 1DGHA 1R2ZA 3A42A 4EIWA 2C96A 3LW5F 1D2NA 5EXTA 5ITYA 2QP9X 3VK8A 3R8FA 2F5NA 2FFJA 3K1JA 2JY6B 1OJLA 1MN3A 2BNKA 1Z59A 2LBCA 2MROB 1YUBA 4FWGA 3U6LA 2EKKA 2LTUA 1PGYA 3GLIE 3SC3A 1N33M 2R45A 3FTCA 4R3DA 1G4AE 1NV9A 3KW6A 4PT5A 3PXGA 1HNZM 2XSZA 3L2AA 5FLXS 4GEWA 4R7GA 1HR0M 1QANA 4IBBA 2YR0A 4NSOB 5KQ8A 3U6DA 2CV1A 2QZ4A 3U6OA 3W67A 3C9PA 4NRVA 1G8PA 1FJGM 4L8RC 3GLHB 4FW9A 3GQ4A 3SYKA 2GQFA 3U61B 3NBXX 2DZOB 2R65A 3I51A 3KSJA 4PD2A 1ZMVA 4AKIA 3SAVA 5EXPA 2K47A 2L4FA 2R0IA 3K9PA 3M7GA 3E4RA 4L4UA 3VKHA 3U60B 1QAMA 5GKNA 2XZFA 2KNZA 1OAIA 4QOZC 5FTMA 1UM8A 3W0FA 1NHGC 5EJCA 5KO3A 3E21A 4I5SA 4DV7M 1IBKM 1HNWM 3U6SA 5FTKA 4LFCM 1NY5A 3PNYA 5ITQA 1N75A 3GRUA 2EUCA 4LY6A 2HWJA 2UXCM 3UZUA 2LVAA 1Y8GA 2Z4RA 1AIPC 4S12A 5LMNM 3SAUA 4DV0M 1XC8A 3VK7A 1DO0A 1OFHA 4JV5M 1EIJA 1JR3A 1DGHB 1WJ7A 3SASA 3L27A 2DWLA 4F1IA 3M6AA 3SBJA 5EP2A 3CTWB 1WGNA 3W0LB 2RGHA 2QHOB 4GKJM 5ITXE 4D80A 3C3DA 2DAEA 4HLQA 3J7BA 1IXRC 1L8QA 3MJ5A 3QAUA 1IN6A 3RGPA 1Q3BA 1DV0A 3QYEA 4IBCA 1XMQM 5ITRA 1VG5A 1ZV1A 1MX0A 1OQYA 2CV0A 2QCUA 3LCUA 2V6ZM 2OOAA 2A5YB 2RKOA 3RFWA 4X66M 1W5TA 2J7NA 1WXQA 3BOSA 3GLGA 2C5RA 1L1TA 2DVWB 2F5SA 3VFDA 2DAKA 1V92A 4Q7JA 4LZZA 5EXXA 2DAGA 4PDIA 1ZAEA 3HX3A 3HU2A 4R71A 3THGA 2Z8YM 4LRTA 4MGIE 3AOEA 3K92A 2BWEA 4BBAA 4LFAM 3HHXA 2HKJA 2X8AA 1XNQM 2BJWA 2MGWA 4FCVA 3L29A 1NNJA 3DFZA 3TQSA 1NSFA 3J7AS 2KZSA 5DFLA 1IBMM 4CJ6A 1QDTA 2OO9A 1GJSA 4KT0F 3RE8A 4KODA 2DNAA 3CGWA 4G4OA 1QUSA 1FNNA 2ZANA 4IBFA 2VF8A 2JZ0A 4G4NA 3U60A 4FWHA 4LG2A 4LF7M 3I4YA 4FCWA 4L15A 2KXEA 5EP3A 2V1UA 2XH9A 1LV7A 1PJQA 1I94M 4LF9M 2D7HA 2L7IA 3F92A 3HY5A 1D0LA 4JI0M 4NC6A 3JR4A 2Y20A 2ZTDA 4MB7A 1TH3A 3GQ3A 3FRIA 1L2CA 1Z5CA 4DV5M 3DZDA 3LMMA 4LFBM 2BWBA 1QZEA 3B9PA 4REZA 1L2BA 2UUCM 4IIWA 2G3QA 4MGZE 4QHSA 2KHHA 2L6OA 3B7QA 1IXZA 3FUUA 3HU3A 5EXSA 4CIZA 2ZAMA 4MGYE 2UXDM 2D7EA 2VF7A 3KFUG 1UFZA 2XEPA 1Q39A 2DWMA 2JUJA 3TWKA 2R4JA 4DR7M 1OIZA 4CGYB 1XNRM 1GJTA 2C99A 2LVQD 3GRRA 2FNAA 1Z6TA 3E9SA 3FD9A 3GLIA 1TH2A 1XXHB 2Z4SA 2KA6B 2ZBKB 3DA1A 3K9OA 4GH9A 1Q3CA 3GLGB 4B7GA 3LQQA 1I4WA 2LVNC 4DBGB 1AUAA 4IJEA 4LF5M 3Q8GA 1DGFA 3HHWA 4YY3M 4K0KM 3I04M 2KNAA 2OPFA 4JI2M 3B89A 3FKEA 2Y0TA 5E26A 1R4GA 5EP4A 2JY7A 4GC5A 4L78A 2CHGA 3IG8A 5FTLA 2QQ8A 1DO2A 1Z5AA 5KPRA 4MM3B 4NSRA 5IREB 1PJIA 4OX9M 4WP2A 4IBJA 1QUTA 1SXJC 5JI2E 2I7PA 1JB0F 4Z6YA 1G71A 4RKUF 2FE8A 2KDLA 1R5LA 3UJNA 3SARA 3KS8A 4QNMA 4I8OA 1SXJD 1G59A 2N35A 1TF0B 1R7RA 2QBYA 5DNYA 5LMUM 4LF6M 3FE3A 3GQ5A 1E94E 2JWSA 3GPXA 2L4EA 1NJFA 3I01M 4AG6A 3WHLA 1KYIA 4II7A 1WR1B 2XF3A 1WGLA 4LJ8A 4B7HA 3FUVA 3GPUA 3K2LA 4TUWA 4X62M 3PVSA 2JA2A 3IECA 4QNRA 4B7FA 3FTFA 3TWMA 3SHFA 1J09A 2QPAA 1D0KA 4DR3M 3SAWA 3CF0A 2CWBA 1BVSA 2CP8A 3GLFB 4LGYA 1IXSA 2X49A 1KSFX 3ZH9B 3FTDA 3H4JA 2ERCA 4A3VB 1PJTA 2UUAM 1PRBA 2MJ5B 4GRIA 4JI4M 1J7KA 4JI6M 2D7GA 3UGJA 2F5QA 1OAOC 3VDUA 4B3SM 3GRYA 4AQYM 2JXNA 1OIPA 5FTJA 4JI8M 1IQPA 2CRUA 2C98A 1IN7A 3GLFE 4L16A 2DI0A 3AKZA 2XSZD 4PDGA 1QYRA 1IY2A 1GVNA 1MJGM 3D8BA 4JYAM 1XXHE 4GMQA 3I4VA 3FYDA 4L6V6 3KDSE 3HJSA 1L2DA 3AV0A 2P5TA 2ZAOA 2J5YA 1HT1E 4OVZB 8CATA 1JR3D 3AOEC 1TGUA 4GIPA 4P16A 3B74A 2L7HA 1A5TA 4Z8XA
chains in the Genus database with same CATH topology
1PJJA 1R6BX 1ZQ9A 1QVRA 4FWDA 1J5EM 3T15A 2LWXA 4AKGA 1GKIA 1Z5BA 5IZ7D 1L1ZA 4M0DA 2DHRA 4D81A 2VQEM 2G5GX 2YFQA 3UK6A 3K8ZA 3EIHA 2ZM6M 5ITXA 4DUYM 2KZUA 1NHWC 1NY6A 3ZCBB 5EP1A 1N36M 4JI5M 2KW0A 3J81S 2HCBA 7CATA 3J2PB 1QAQA 2I7NA 3OTOM 1YE9A 2XGNA 4RF0A 2F5OA 4DR2M 2CFOA 4IBGA 5F3WA 3FUXA 1N77A 4DUZM 3GLFA 4GKKM 2XFSA 3T1HM 1HQYE 4DR5M 1R2YA 2O5RA 2C9OA 3JR5A 3KS4A 2Y0QA 4W5WA 1XXHA 3TPZA 4MGHA 2F5PA 3L25A 2DXIA 1IN4A 4LJ4A 5KQDA 3KOZE 4DR6M 4KLNA 2XZUA 4LF4M 1GLNA 2C9CA 4CISA 4NRWA 4KHPM 3HJQA 4G4QA 5C18A 4LCBA 3KXEC 3CF2A 4FD2A 1N34M 1G3IA 2KRUA 3DOAA 1X37A 2R18A 3MHVC 4FVMA 4CHTB 1S3SA 1N78A 2F4VM 3SYLA 3KVWA 1TH4A 1NVMA 4B3MM 2YQZA 4LRSA 4JI3M 3U6PA 3ILKA 3NBIA 3VDPA 4D82A 1E32A 3J80S 3HU1A 1T3TA 4RNAA 3M0EA 2W82A 1VDDA 4XBOA 3KOWE 4AI6A 3R9XB 3GO8A 1ORYB 4X65M 3Q8XA 3AJIB 3A45A 3A46A 2RGOA 2LXEA 2UUBM 1C1KA 3MK6A 3U6MA 1K3XA 5KPZA 3SFZA 3CF6E 2UU9M 1MU5A 4NL4H 3SMPA 5H37D 4DV1M 4QOSA 4LZJA 4LJ6A 5EQTA 3A98B 2DWNA 4LGMA 2X4AA 3HGIA 3KSXA 2M60A 2CHVA 4M9ZA 2CUZA 4MH0E 4GHAA 1SXJB 4M9SA 2Z3XA 1NJGA 5C1BA 4LJAA 4PCZA 3U61A 4IBDA 4WURA 4HL4A 1YSYA 4BLCA 4BB9A 3UMMA 2EA0A 2EO2A 1GL6A 3L28A 3HKPA 4GITA 1XMOM 1N32M 4IBEA 2DWZB 3HHYA 2J7OA 2VIIA 1E9SA 3U6EA 2CE7A 2DZNB 3KP0E 5FSWA 4AKHA 3HWSA 1IM2A 3U5ZB 2UXBM 4LJ5A 2QBYB 3AL0C 3GRVA 4G6ZA 2Z7JA 3FYCA 1HQCA 4DR4M 4B3TM 4M9XA 3PNVA 3HHZA 2V1CA 4JI1M 4I4LA 3GPPA 2CEAA 4IBKA 4WW0A 3VLFB 3GLIB 4M0WA 4ZPXA 3SATA 1XHBA 1DGBA 5JI3E 1H6UA 3GLHA 2G8LA 1IN5A 3U6CA 1KFVA 1IY1A 3KOYE 4GC9A 1OFIA 3U6QA 4GHLA 2CHQA 1SXJA 3H4MA 2Q2EB 4RF1A 3JAMS 1QQWA 3GP1A 5ITUA 2H1RA 4JN6A 2HHHM 3FUTA 4NXNM 2VQFM 1IN8A 5DYGA 1IBLM 1E9RA 3RGSA 4DV4M 1IY0A 3LVWA 1W5SA 3AOGA 4B08A 1TDZA 2E5LM 2XLJA 1PM5A 1SXJE 2BJVA 3T38A 4LJ7A 4I81A 5E6JA 4IJFA 4YHHM 5BPVA 3TWLA 5IWAM 3C58A 3KP1E 5DYIA 3GPYA 4NOOB 3LQRA 3AFHA 4IBIA 2KRKA 4G4RA 2YNMD 1NNUC 4MGKE 4QHTA 2XFTA 3U5ZA 2CV2A 2NQ8C 4NXMM 5FTNA 3SHGB 3EIEA 5BR8M 3FUWA 1XWIA 3HJ8A 2OQ4A 2R46A 2LNHC 4AZFA 3WHKA 4OU7A 2FOIC 1K82A 4ITQA 3TE6A 5KPTA 1QZMA 2R62A 4FCTA 2KEBA 3FTEA 2Y21A 3TL4X 1JQJC 4KO8A 4AG5A 4B3RM 1IXSB 4DV2M 1GL7A 5ITTA 4JI7M 3L26A 2QENA 5IT9S 3NWLA 1DGGA 2AHMA 1TDHA 2HL7A 4AW4A 4LF8M 4LJ9A 3ZC7B 3SMSA 3IG5A 4DR1M 2L09A 1EE8A 2R4EA 4OW0A 4DV3M 3D8LA 5A2QS 4OVZA 1HT2E 3QWLA 1QAOA 1K3WA 3PFIA 4JXJA 3KOXE 3J27B 3T1YM 1G41A 1HNXM 4XGIA 4DV6M 2M5ZA 4X64M 2LH0A 3VKGA 1DGHA 1R2ZA 3A42A 4EIWA 2C96A 5EXTA 1D2NA 5ITYA 2QP9X 3VK8A 3R8FA 2F5NA 2FFJA 3K1JA 1OJLA 2BNKA 1Z59A 4FWGA 3U6LA 1YUBA 1N33M 3SC3A 2R45A 3FTCA 4R3DA 1G4AE 4PT5A 3KW6A 1HNZM 3PXGA 2XSZA 3L2AA 5FLXS 4R7GA 1HR0M 1QANA 4IBBA 2YR0A 4NSOB 5KQ8A 3U6DA 2CV1A 2QZ4A 3U6OA 4NRVA 1G8PA 1FJGM 4L8RC 3GLHB 4FW9A 3GQ4A 3SYKA 3U61B 2DZOB 2R65A 3I51A 3KSJA 4PD2A 4AKIA 3SAVA 5EXPA 2K47A 3M7GA 3E4RA 4L4UA 3VKHA 3U60B 1QAMA 5GKNA 2XZFA 4QOZC 5FTMA 1UM8A 3W0FA 1NHGC 5EJCA 5KO3A 4I5SA 4DV7M 1IBKM 1HNWM 3U6SA 5FTKA 4LFCM 1NY5A 3PNYA 5ITQA 1N75A 3GRUA 2EUCA 4LY6A 2UXCM 3UZUA 2Z4RA 4S12A 5LMNM 3SAUA 4DV0M 1XC8A 3VK7A 1DO0A 1OFHA 4JV5M 1JR3A 1DGHB 3SASA 3L27A 2DWLA 3M6AA 3SBJA 5EP2A 3CTWB 3W0LB 2RGHA 4GKJM 5ITXE 4D80A 4HLQA 3J7BA 1IXRC 1L8QA 3QAUA 3MJ5A 1IN6A 3RGPA 1Q3BA 4IBCA 1XMQM 5ITRA 1MX0A 2CV0A 2QCUA 2V6ZM 2RKOA 2A5YB 3RFWA 4X66M 1W5TA 2J7NA 1WXQA 3BOSA 3GLGA 2C5RA 1L1TA 2DVWB 2F5SA 3VFDA 5EXXA 4PDIA 4LZZA 1ZAEA 3HU2A 3THGA 4LRTA 4MGIE 3AOEA 3K92A 4BBAA 1XNQM 4LFAM 3HHXA 2HKJA 2X8AA 2BJWA 4FCVA 1NNJA 3L29A 3DFZA 3TQSA 1NSFA 3J7AS 2KZSA 1IBMM 3RE8A 4KODA 4G4OA 1FNNA 2ZANA 4IBFA 4G4NA 3U60A 4FWHA 4LG2A 4LF7M 3I4YA 4FCWA 4L15A 2KXEA 5EP3A 2V1UA 2XH9A 1LV7A 1I94M 4LF9M 2D7HA 2L7IA 4JI0M 3JR4A 2Y20A 4MB7A 1TH3A 3GQ3A 1L2CA 1Z5CA 4DV5M 3DZDA 3LMMA 4LFBM 3B9PA 4REZA 1L2BA 2UUCM 4IIWA 4MGZE 4QHSA 2L6OA 1IXZA 3FUUA 3HU3A 5EXSA 2ZAMA 4MGYE 2UXDM 2D7EA 3KFUG 2XEPA 1Q39A 2DWMA 3TWKA 2R4JA 4DR7M 4CGYB 1XNRM 2C99A 3GRRA 2FNAA 1Z6TA 3E9SA 3FD9A 3GLIA 1TH2A 1XXHB 2Z4SA 2KA6B 2ZBKB 3DA1A 4GH9A 3GLGB 1Q3CA 4B7GA 3LQQA 1I4WA 4IJEA 4LF5M 4K0KM 1DGFA 3HHWA 4YY3M 4JI2M 2OPFA 3FKEA 2Y0TA 5E26A 5EP4A 4GC5A 4L78A 2CHGA 3IG8A 5FTLA 1DO2A 1Z5AA 5KPRA 4MM3B 4NSRA 5IREB 1PJIA 4OX9M 4IBJA 1SXJC 5JI2E 2I7PA 4Z6YA 3SARA 2FE8A 3UJNA 3KS8A 4QNMA 4I8OA 1SXJD 1G59A 1R7RA 2QBYA 5DNYA 5LMUM 4LF6M 3GQ5A 1E94E 3GPXA 1NJFA 4AG6A 3WHLA 1KYIA 4II7A 2XF3A 4LJ8A 4B7HA 3FUVA 3GPUA 3K2LA 4TUWA 4X62M 3PVSA 2JA2A 4QNRA 4B7FA 3FTFA 3TWMA 3SHFA 1J09A 2QPAA 4DR3M 3SAWA 3CF0A 3GLFB 4LGYA 2X49A 1KSFX 3ZH9B 3FTDA 4A3VB 2ERCA 2UUAM 4GRIA 4JI4M 1J7KA 4JI6M 2D7GA 3UGJA 2F5QA 3VDUA 4B3SM 3GRYA 4AQYM 4JI8M 5FTJA 1IQPA 2C98A 1IN7A 4L16A 3AKZA 2XSZD 4PDGA 1QYRA 1IY2A 1GVNA 3D8BA 4JYAM 4GMQA 3I4VA 3FYDA 3KDSE 3HJSA 1L2DA 3AV0A 2P5TA 2ZAOA 4OVZB 1HT1E 8CATA 1JR3D 3AOEC 1TGUA 4GIPA 4P16A 2L7HA 3LVVA 4Z8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 M;  1PJJ A;  1J5E M;  1I94 M;  1R2Z A;  3A42 A;  4LF9 M;  4JI0 M;  1Z5B A;  3JR4 A;  1L1Z A;  3U6E A;  4MB7 A;  5ITY A;  3GQ3 A;  1L2C A;  1Z5C A;  4DV5 M;  2UXB M;  2VQE M;  3VK8 A;  4LFB M;  1L2B A;  2F5N A;  2UUC M;  2ZM6 M;  5ITX A;  4DUY M;  4DR4 M;  1Z59 A;  3U6L A;  1N36 M;  4B3T M;  1N33 M;  4JI5 M;  4JI1 M;  2UXD M;  3J81 S;  3GPP A;  1HNZ M;  5FLX S;  1Q39 A;  3TWK A;  3SAT A;  1HR0 M;  4DR7 M;  3OTO M;  1XNR M;  3U6D A;  2F5O A;  4DR2 M;  3U6O A;  3U6C A;  1KFV A;  4DUZ M;  4GKK M;  2ZBK B;  4NRV A;  3U6Q A;  3T1H M;  1FJG M;  1Q3C A;  4DR5 M;  1R2Y A;  3JR5 A;  3GQ4 A;  2Q2E B;  3JAM S;  4LF5 M;  3GP1 A;  4K0K M;  4YY3 M;  5ITU A;  2F5P A;  4PD2 A;  2HHH M;  4JI2 M;  2OPF A;  3SAV A;  4NXN M;  2VQF M;  1IBL M;  2XZF A;  1Z5A A;  4DR6 M;  2XZU A;  3W0F A;  1PJI A;  4CIS A;  4LF4 M;  4OX9 M;  4NRW A;  4KHP M;  4DV4 M;  4G4Q A;  4DV7 M;  1IBK M;  1HNW M;  3U6S A;  4LFC M;  5ITQ A;  1TDZ A;  1N34 M;  3SAR A;  3DOA A;  2UXC M;  2E5L M;  1PM5 A;  2F4V M;  5LMN M;  3SAU A;  4DV0 M;  1XC8 A;  4B3M M;  4YHH M;  3VK7 A;  3TWL A;  5IWA M;  5LMU M;  3C58 A;  4LF6 M;  4JV5 M;  3GQ5 A;  3SAS A;  4JI3 M;  3GPY A;  3U6P A;  3GPX A;  3SBJ A;  4GKJ M;  5ITX E;  4G4R A;  3J80 S;  1Q3B A;  3GPU A;  1XMQ M;  4X62 M;  4NXM M;  5ITR A;  3GO8 A;  1MX0 A;  3TWM A;  4X65 M;  5BR8 M;  4DR3 M;  3SAW A;  4X66 M;  2OQ4 A;  3A45 A;  3A46 A;  1K82 A;  2F5S A;  1L1T A;  4ITQ A;  2UUB M;  4PDI A;  3U6M A;  1K3X A;  2UUA M;  4JI4 M;  4B3R M;  2UU9 M;  1MU5 A;  4JI6 M;  4DV2 M;  1XNQ M;  4DV1 M;  2F5Q A;  5ITT A;  4LFA M;  4B3S M;  2HKJ A;  4JI7 M;  4AQY M;  4JI8 M;  5IT9 S;  1TDH A;  1NNJ A;  4LF8 M;  4DR1 M;  3J7A S;  1EE8 A;  4PDG A;  4DV3 M;  4PCZ A;  5A2Q S;  1IBM M;  1K3W A;  4JYA M;  4G4O A;  1L2D A;  2EA0 A;  4G4N A;  3T1Y M;  4LF7 M;  1HNX M;  4DV6 M;  1XMO M;  1N32 M; 
#chains in the Genus database with same CATH topology
 1PJJ A;  1R6B X;  1ZQ9 A;  1QVR A;  4FWD A;  3MMP A;  3T15 A;  1J5E M;  2LWX A;  4AKG A;  1T43 A;  1GKI A;  1Z5B A;  5IZ7 D;  1L1Z A;  3B7Z A;  4M0D A;  1T6O A;  2QNJ A;  2DHR A;  4D81 A;  1P3Q Q;  2DAM A;  2JP7 A;  2VQE M;  2G5G X;  2YFQ A;  3UK6 A;  3K8Z A;  3EIH A;  2ZM6 M;  5ITX A;  4DUY M;  2KZU A;  1VDL A;  2R6F A;  1VEK A;  1NHW C;  1NY6 A;  3ZCB B;  5EP1 A;  1N36 M;  4JI5 M;  2KW0 A;  3J81 S;  2L2D A;  2HCB A;  7CAT A;  3IHP A;  3J2P B;  1YLA A;  1QAQ A;  2I7N A;  3OTO M;  1YE9 A;  2XGN A;  4RF0 A;  2F5O A;  4DR2 M;  2JNH A;  1EFU B;  2CFO A;  4IBG A;  5F3W A;  3FUX A;  1N77 A;  4DUZ M;  3GLF A;  4GKK M;  2XFS A;  3T1H M;  1HQY E;  4DR5 M;  2QSF X;  2O5R A;  2C9O A;  3JR5 A;  1R2Y A;  3KS4 A;  2Y0Q A;  4W5W A;  1XXH A;  3TPZ A;  4MGH A;  2F5P A;  3L25 A;  2DXI A;  2JY8 A;  1IN4 A;  2APL A;  1GAB A;  4LJ4 A;  5KQD A;  3ZQJ A;  3B7N A;  2K9D A;  3KOZ E;  4KLN A;  2XZU A;  4LF4 M;  4DR6 M;  1GLN A;  2C9C A;  4CIS A;  4NRW A;  4KHP M;  2K6B A;  3HJQ A;  4G4Q A;  5C18 A;  4LCB A;  3KXE C;  2VDB B;  3CF2 A;  4P17 A;  4FD2 A;  1HJP A;  1G3I A;  1N34 M;  2KRU A;  3DOA A;  1X37 A;  2R18 A;  3MHV C;  4FVM A;  4CHT B;  1S3S A;  1N78 A;  2F4V M;  3SYL A;  3KVW A;  1TH4 A;  1NVM A;  4B3M M;  2YQZ A;  2FH0 A;  4LRS A;  2GNO A;  1ZMU A;  4JI3 M;  3U6P A;  3ILK A;  3NBI A;  3VDP A;  4D82 A;  1E32 A;  3J80 S;  3HU1 A;  1T3T A;  4RNA A;  2W82 A;  3M0E A;  1VDD A;  4XBO A;  3KOW E;  4AI6 A;  3R9X B;  3GO8 A;  1ORY B;  3BXW A;  4X65 M;  3GLG E;  2EKF A;  3Q8X A;  3AJI B;  1ZMW A;  3A45 A;  3A46 A;  2LVO C;  2RGO A;  2B3T A;  2DHY A;  2LXE A;  2WSF F;  2UUB M;  1C1K A;  3MK6 A;  3U6M A;  1K3X A;  3QYB A;  5KPZ A;  3SFZ A;  4F2L A;  3CF6 E;  2UU9 M;  1MU5 A;  4NL4 H;  3SMP A;  5H37 D;  4DV1 M;  4QOS A;  4LZJ A;  4LJ6 A;  5EQT A;  3A98 B;  2DWN A;  4LGM A;  2X4A A;  3HGI A;  3KSX A;  2M60 A;  2CHV A;  4M9Z A;  2CUZ A;  4MH0 E;  4GHA A;  1SXJ B;  2MR9 A;  4M9S A;  2Z3X A;  1NJG A;  5C1B A;  4LJA A;  4PCZ A;  3U61 A;  4IBD A;  4WUR A;  4HL4 A;  1TTE A;  1YSY A;  4BLC A;  4BB9 A;  1Q02 A;  3UMM A;  2H5X A;  2EA0 A;  2JZ1 A;  2EO2 A;  1GL6 A;  2KNV A;  2O25 A;  3L28 A;  3HKP A;  4GIT A;  1XMO M;  1C7Y A;  1N32 M;  4IBE A;  2ZTC A;  2DWZ B;  3HHY A;  2J7O A;  2VII A;  1E9S A;  3U6E A;  2CE7 A;  2DZN B;  3KP0 E;  2DZL A;  5FSW A;  3HWS A;  1IM2 A;  3U5Z B;  4AKH A;  2UXB M;  2JY5 A;  2O01 F;  4LJ5 A;  2QBY B;  3AL0 C;  1LTM A;  2WSE F;  3GRV A;  4G6Z A;  2Z7J A;  3FYC A;  1HQC A;  2DKL A;  4DR4 M;  4B3T M;  2DAI A;  4M9X A;  3PNV A;  3HHZ A;  2V1C A;  4JI1 M;  4I4L A;  3GPP A;  2CEA A;  2RRU A;  3HZJ A;  1VQ1 A;  4IBK A;  4WW0 A;  3VLF B;  1IFY A;  3GLI B;  3E46 A;  4HEO A;  4M0W A;  4ZPX A;  3SAT A;  1XHB A;  1DGB A;  5JI3 E;  1NV8 A;  1WIV A;  1TR8 A;  1H6U A;  1D0M A;  2G8L A;  3GLH A;  1IN5 A;  3U6C A;  1KFV A;  2HAK A;  1IY1 A;  1SG9 A;  2LVP C;  3KOY E;  4GC9 A;  1OFI A;  3U6Q A;  1RU3 A;  4GHL A;  1NO1 A;  3V76 A;  2CHQ A;  2WSC F;  1SXJ A;  3H4M A;  2Q2E B;  4RF1 A;  3JAM S;  1QQW A;  3GP1 A;  5ITU A;  2H1R A;  1V34 A;  2LHC A;  1PJS A;  2OOB A;  1VEJ A;  3FUT A;  4JN6 A;  2HHH M;  4NXN M;  2VQF M;  1IN8 A;  5DYG A;  1IBL M;  1E9R A;  3RGS A;  4DV4 M;  1IY0 A;  1CUK A;  3LVW A;  1W5S A;  4Y28 F;  3AOG A;  4XK8 F;  4B08 A;  1TDZ A;  2E5L M;  2XLJ A;  1PM5 A;  1SXJ E;  2BJV A;  3T38 A;  4LJ7 A;  4I81 A;  5E6J A;  4IJF A;  4YHH M;  5BPV A;  3TWL A;  2R44 A;  5IWA M;  5L8R F;  3C58 A;  1OKS A;  3C3E A;  3KP1 E;  5DYI A;  3GPY A;  2MH8 A;  4NOO B;  3LQR A;  3AFH A;  4IBI A;  2KRK A;  3LVV A;  4G4R A;  2YNM D;  1NNU C;  4MGK E;  4QHT A;  2XFT A;  3U5Z A;  2CV2 A;  2NQ8 C;  4NXM M;  5FTN A;  3GLH E;  1VEG A;  3SHG B;  3W68 A;  3EIE A;  2WZJ A;  5BR8 M;  3FUW A;  1XWI A;  3HJ8 A;  2OQ4 A;  1QDR A;  2R46 A;  2LNH C;  4AZF A;  3WHK A;  4OU7 A;  1V33 A;  2FOI C;  1K82 A;  4ITQ A;  3TE6 A;  5KPT A;  1QZM A;  2R62 A;  4FCT A;  2KEB A;  3FTE A;  3BBZ A;  2Y21 A;  3TL4 X;  1JQJ C;  4KO8 A;  4ANR A;  4AG5 A;  4B3R M;  1IXS B;  4DV2 M;  2FS1 A;  1F4I A;  1GL7 A;  5ITT A;  4JI7 M;  3L26 A;  2QEN A;  3T6P A;  1XB2 B;  5IT9 S;  3NWL A;  1DGG A;  2AHM A;  1TDH A;  1WHC A;  2HL7 A;  2K0B X;  4AW4 A;  4UN2 B;  2DEN A;  4LJ9 A;  3ZC7 B;  3SMS A;  4LF8 M;  3IG5 A;  4DR1 M;  2L09 A;  1EE8 A;  2R4E A;  4OW0 A;  4DV3 M;  3D8L A;  5A2Q S;  4OVZ A;  1HT2 E;  3QWL A;  1QAO A;  3FRH A;  1K3W A;  3PFI A;  4JXJ A;  2LHG A;  3KOX E;  3J27 B;  3LCV B;  1GO5 A;  1OTR A;  3T1Y M;  1JR3 E;  1G41 A;  1HNX M;  2EJS A;  4XGI A;  4G3O A;  4DV6 M;  2M5Z A;  4X64 M;  2LH0 A;  3VKG A;  1DGH A;  1R2Z A;  3A42 A;  4EIW A;  2C96 A;  3LW5 F;  1D2N A;  5EXT A;  5ITY A;  2QP9 X;  3VK8 A;  3R8F A;  2F5N A;  2FFJ A;  3K1J A;  2JY6 B;  1OJL A;  1MN3 A;  2BNK A;  1Z59 A;  2LBC A;  2MRO B;  1YUB A;  4FWG A;  3U6L A;  2EKK A;  2LTU A;  1PGY A;  3GLI E;  3SC3 A;  1N33 M;  2R45 A;  3FTC A;  4R3D A;  1G4A E;  1NV9 A;  3KW6 A;  4PT5 A;  3PXG A;  1HNZ M;  2XSZ A;  3L2A A;  5FLX S;  4GEW A;  4R7G A;  1HR0 M;  1QAN A;  4IBB A;  2YR0 A;  4NSO B;  5KQ8 A;  3U6D A;  2CV1 A;  2QZ4 A;  3U6O A;  3W67 A;  3C9P A;  4NRV A;  1G8P A;  1FJG M;  4L8R C;  3GLH B;  4FW9 A;  3GQ4 A;  3SYK A;  2GQF A;  3U61 B;  3NBX X;  2DZO B;  2R65 A;  3I51 A;  3KSJ A;  4PD2 A;  1ZMV A;  4AKI A;  3SAV A;  5EXP A;  2K47 A;  2L4F A;  2R0I A;  3K9P A;  3M7G A;  3E4R A;  4L4U A;  3VKH A;  3U60 B;  1QAM A;  5GKN A;  2XZF A;  2KNZ A;  1OAI A;  4QOZ C;  5FTM A;  1UM8 A;  3W0F A;  1NHG C;  5EJC A;  5KO3 A;  3E21 A;  4I5S A;  4DV7 M;  1IBK M;  1HNW M;  3U6S A;  5FTK A;  4LFC M;  1NY5 A;  3PNY A;  5ITQ A;  1N75 A;  3GRU A;  2EUC A;  4LY6 A;  2HWJ A;  2UXC M;  3UZU A;  2LVA A;  1Y8G A;  2Z4R A;  1AIP C;  4S12 A;  5LMN M;  3SAU A;  4DV0 M;  1XC8 A;  3VK7 A;  1DO0 A;  1OFH A;  4JV5 M;  1EIJ A;  1JR3 A;  1DGH B;  1WJ7 A;  3SAS A;  3L27 A;  2DWL A;  4F1I A;  3M6A A;  3SBJ A;  5EP2 A;  3CTW B;  1WGN A;  3W0L B;  2RGH A;  2QHO B;  4GKJ M;  5ITX E;  4D80 A;  3C3D A;  2DAE A;  4HLQ A;  3J7B A;  1IXR C;  1L8Q A;  3MJ5 A;  3QAU A;  1IN6 A;  3RGP A;  1Q3B A;  1DV0 A;  3QYE A;  4IBC A;  1XMQ M;  5ITR A;  1VG5 A;  1ZV1 A;  1MX0 A;  1OQY A;  2CV0 A;  2QCU A;  3LCU A;  2V6Z M;  2OOA A;  2A5Y B;  2RKO A;  3RFW A;  4X66 M;  1W5T A;  2J7N A;  1WXQ A;  3BOS A;  3GLG A;  2C5R A;  1L1T A;  2DVW B;  2F5S A;  3VFD A;  2DAK A;  1V92 A;  4Q7J A;  4LZZ A;  5EXX A;  2DAG A;  4PDI A;  1ZAE A;  3HX3 A;  3HU2 A;  4R71 A;  3THG A;  2Z8Y M;  4LRT A;  4MGI E;  3AOE A;  3K92 A;  2BWE A;  4BBA A;  4LFA M;  3HHX A;  2HKJ A;  2X8A A;  1XNQ M;  2BJW A;  2MGW A;  4FCV A;  3L29 A;  1NNJ A;  3DFZ A;  3TQS A;  1NSF A;  3J7A S;  2KZS A;  5DFL A;  1IBM M;  4CJ6 A;  1QDT A;  2OO9 A;  1GJS A;  4KT0 F;  3RE8 A;  4KOD A;  2DNA A;  3CGW A;  4G4O A;  1QUS A;  1FNN A;  2ZAN A;  4IBF A;  2VF8 A;  2JZ0 A;  4G4N A;  3U60 A;  4FWH A;  4LG2 A;  4LF7 M;  3I4Y A;  4FCW A;  4L15 A;  2KXE A;  5EP3 A;  2V1U A;  2XH9 A;  1LV7 A;  1PJQ A;  1I94 M;  4LF9 M;  2D7H A;  2L7I A;  3F92 A;  3HY5 A;  1D0L A;  4JI0 M;  4NC6 A;  3JR4 A;  2Y20 A;  2ZTD A;  4MB7 A;  1TH3 A;  3GQ3 A;  3FRI A;  1L2C A;  1Z5C A;  4DV5 M;  3DZD A;  3LMM A;  4LFB M;  2BWB A;  1QZE A;  3B9P A;  4REZ A;  1L2B A;  2UUC M;  4IIW A;  2G3Q A;  4MGZ E;  4QHS A;  2KHH A;  2L6O A;  3B7Q A;  1IXZ A;  3FUU A;  3HU3 A;  5EXS A;  4CIZ A;  2ZAM A;  4MGY E;  2UXD M;  2D7E A;  2VF7 A;  3KFU G;  1UFZ A;  2XEP A;  1Q39 A;  2DWM A;  2JUJ A;  3TWK A;  2R4J A;  4DR7 M;  1OIZ A;  4CGY B;  1XNR M;  1GJT A;  2C99 A;  2LVQ D;  3GRR A;  2FNA A;  1Z6T A;  3E9S A;  3FD9 A;  3GLI A;  1TH2 A;  1XXH B;  2Z4S A;  2KA6 B;  2ZBK B;  3DA1 A;  3K9O A;  4GH9 A;  1Q3C A;  3GLG B;  4B7G A;  3LQQ A;  1I4W A;  2LVN C;  4DBG B;  1AUA A;  4IJE A;  4LF5 M;  3Q8G A;  1DGF A;  3HHW A;  4YY3 M;  4K0K M;  3I04 M;  2KNA A;  2OPF A;  4JI2 M;  3B89 A;  3FKE A;  2Y0T A;  5E26 A;  1R4G A;  5EP4 A;  2JY7 A;  4GC5 A;  4L78 A;  2CHG A;  3IG8 A;  5FTL A;  2QQ8 A;  1DO2 A;  1Z5A A;  5KPR A;  4MM3 B;  4NSR A;  5IRE B;  1PJI A;  4OX9 M;  4WP2 A;  4IBJ A;  1QUT A;  1SXJ C;  5JI2 E;  2I7P A;  1JB0 F;  4Z6Y A;  1G71 A;  4RKU F;  2FE8 A;  2KDL A;  1R5L A;  3UJN A;  3SAR A;  3KS8 A;  4QNM A;  4I8O A;  1SXJ D;  1G59 A;  2N35 A;  1TF0 B;  1R7R A;  2QBY A;  5DNY A;  5LMU M;  4LF6 M;  3FE3 A;  3GQ5 A;  1E94 E;  2JWS A;  3GPX A;  2L4E A;  1NJF A;  3I01 M;  4AG6 A;  3WHL A;  1KYI A;  4II7 A;  1WR1 B;  2XF3 A;  1WGL A;  4LJ8 A;  4B7H A;  3FUV A;  3GPU A;  3K2L A;  4TUW A;  4X62 M;  3PVS A;  2JA2 A;  3IEC A;  4QNR A;  4B7F A;  3FTF A;  3TWM A;  3SHF A;  1J09 A;  2QPA A;  1D0K A;  4DR3 M;  3SAW A;  3CF0 A;  2CWB A;  1BVS A;  2CP8 A;  3GLF B;  4LGY A;  1IXS A;  2X49 A;  1KSF X;  3ZH9 B;  3FTD A;  3H4J A;  2ERC A;  4A3V B;  1PJT A;  2UUA M;  1PRB A;  2MJ5 B;  4GRI A;  4JI4 M;  1J7K A;  4JI6 M;  2D7G A;  3UGJ A;  2F5Q A;  1OAO C;  3VDU A;  4B3S M;  3GRY A;  4AQY M;  2JXN A;  1OIP A;  5FTJ A;  4JI8 M;  1IQP A;  2CRU A;  2C98 A;  1IN7 A;  3GLF E;  4L16 A;  2DI0 A;  3AKZ A;  2XSZ D;  4PDG A;  1QYR A;  1IY2 A;  1GVN A;  1MJG M;  3D8B A;  4JYA M;  1XXH E;  4GMQ A;  3I4V A;  3FYD A;  4L6V 6;  3KDS E;  3HJS A;  1L2D A;  3AV0 A;  2P5T A;  2ZAO A;  2J5Y A;  1HT1 E;  4OVZ B;  8CAT A;  1JR3 D;  3AOE C;  1TGU A;  4GIP A;  4P16 A;  3B74 A;  2L7H A;  1A5T A;  4Z8X A; 
#chains in the Genus database with same CATH homology
 1PJJ A;  1R6B X;  1ZQ9 A;  1QVR A;  4FWD A;  1J5E M;  3T15 A;  2LWX A;  4AKG A;  1GKI A;  1Z5B A;  5IZ7 D;  1L1Z A;  4M0D A;  2DHR A;  4D81 A;  2VQE M;  2G5G X;  2YFQ A;  3UK6 A;  3K8Z A;  3EIH A;  2ZM6 M;  5ITX A;  4DUY M;  2KZU A;  1NHW C;  1NY6 A;  3ZCB B;  5EP1 A;  1N36 M;  4JI5 M;  2KW0 A;  3J81 S;  2HCB A;  7CAT A;  3J2P B;  1QAQ A;  2I7N A;  3OTO M;  1YE9 A;  2XGN A;  4RF0 A;  2F5O A;  4DR2 M;  2CFO A;  4IBG A;  5F3W A;  3FUX A;  1N77 A;  4DUZ M;  3GLF A;  4GKK M;  2XFS A;  3T1H M;  1HQY E;  4DR5 M;  1R2Y A;  2O5R A;  2C9O A;  3JR5 A;  3KS4 A;  2Y0Q A;  4W5W A;  1XXH A;  3TPZ A;  4MGH A;  2F5P A;  3L25 A;  2DXI A;  1IN4 A;  4LJ4 A;  5KQD A;  3KOZ E;  4DR6 M;  4KLN A;  2XZU A;  4LF4 M;  1GLN A;  2C9C A;  4CIS A;  4NRW A;  4KHP M;  3HJQ A;  4G4Q A;  5C18 A;  4LCB A;  3KXE C;  3CF2 A;  4FD2 A;  1N34 M;  1G3I A;  2KRU A;  3DOA A;  1X37 A;  2R18 A;  3MHV C;  4FVM A;  4CHT B;  1S3S A;  1N78 A;  2F4V M;  3SYL A;  3KVW A;  1TH4 A;  1NVM A;  4B3M M;  2YQZ A;  4LRS A;  4JI3 M;  3U6P A;  3ILK A;  3NBI A;  3VDP A;  4D82 A;  1E32 A;  3J80 S;  3HU1 A;  1T3T A;  4RNA A;  3M0E A;  2W82 A;  1VDD A;  4XBO A;  3KOW E;  4AI6 A;  3R9X B;  3GO8 A;  1ORY B;  4X65 M;  3Q8X A;  3AJI B;  3A45 A;  3A46 A;  2RGO A;  2LXE A;  2UUB M;  1C1K A;  3MK6 A;  3U6M A;  1K3X A;  5KPZ A;  3SFZ A;  3CF6 E;  2UU9 M;  1MU5 A;  4NL4 H;  3SMP A;  5H37 D;  4DV1 M;  4QOS A;  4LZJ A;  4LJ6 A;  5EQT A;  3A98 B;  2DWN A;  4LGM A;  2X4A A;  3HGI A;  3KSX A;  2M60 A;  2CHV A;  4M9Z A;  2CUZ A;  4MH0 E;  4GHA A;  1SXJ B;  4M9S A;  2Z3X A;  1NJG A;  5C1B A;  4LJA A;  4PCZ A;  3U61 A;  4IBD A;  4WUR A;  4HL4 A;  1YSY A;  4BLC A;  4BB9 A;  3UMM A;  2EA0 A;  2EO2 A;  1GL6 A;  3L28 A;  3HKP A;  4GIT A;  1XMO M;  1N32 M;  4IBE A;  2DWZ B;  3HHY A;  2J7O A;  2VII A;  1E9S A;  3U6E A;  2CE7 A;  2DZN B;  3KP0 E;  5FSW A;  4AKH A;  3HWS A;  1IM2 A;  3U5Z B;  2UXB M;  4LJ5 A;  2QBY B;  3AL0 C;  3GRV A;  4G6Z A;  2Z7J A;  3FYC A;  1HQC A;  4DR4 M;  4B3T M;  4M9X A;  3PNV A;  3HHZ A;  2V1C A;  4JI1 M;  4I4L A;  3GPP A;  2CEA A;  4IBK A;  4WW0 A;  3VLF B;  3GLI B;  4M0W A;  4ZPX A;  3SAT A;  1XHB A;  1DGB A;  5JI3 E;  1H6U A;  3GLH A;  2G8L A;  1IN5 A;  3U6C A;  1KFV A;  1IY1 A;  3KOY E;  4GC9 A;  1OFI A;  3U6Q A;  4GHL A;  2CHQ A;  1SXJ A;  3H4M A;  2Q2E B;  4RF1 A;  3JAM S;  1QQW A;  3GP1 A;  5ITU A;  2H1R A;  4JN6 A;  2HHH M;  3FUT A;  4NXN M;  2VQF M;  1IN8 A;  5DYG A;  1IBL M;  1E9R A;  3RGS A;  4DV4 M;  1IY0 A;  3LVW A;  1W5S A;  3AOG A;  4B08 A;  1TDZ A;  2E5L M;  2XLJ A;  1PM5 A;  1SXJ E;  2BJV A;  3T38 A;  4LJ7 A;  4I81 A;  5E6J A;  4IJF A;  4YHH M;  5BPV A;  3TWL A;  5IWA M;  3C58 A;  3KP1 E;  5DYI A;  3GPY A;  4NOO B;  3LQR A;  3AFH A;  4IBI A;  2KRK A;  4G4R A;  2YNM D;  1NNU C;  4MGK E;  4QHT A;  2XFT A;  3U5Z A;  2CV2 A;  2NQ8 C;  4NXM M;  5FTN A;  3SHG B;  3EIE A;  5BR8 M;  3FUW A;  1XWI A;  3HJ8 A;  2OQ4 A;  2R46 A;  2LNH C;  4AZF A;  3WHK A;  4OU7 A;  2FOI C;  1K82 A;  4ITQ A;  3TE6 A;  5KPT A;  1QZM A;  2R62 A;  4FCT A;  2KEB A;  3FTE A;  2Y21 A;  3TL4 X;  1JQJ C;  4KO8 A;  4AG5 A;  4B3R M;  1IXS B;  4DV2 M;  1GL7 A;  5ITT A;  4JI7 M;  3L26 A;  2QEN A;  5IT9 S;  3NWL A;  1DGG A;  2AHM A;  1TDH A;  2HL7 A;  4AW4 A;  4LF8 M;  4LJ9 A;  3ZC7 B;  3SMS A;  3IG5 A;  4DR1 M;  2L09 A;  1EE8 A;  2R4E A;  4OW0 A;  4DV3 M;  3D8L A;  5A2Q S;  4OVZ A;  1HT2 E;  3QWL A;  1QAO A;  1K3W A;  3PFI A;  4JXJ A;  3KOX E;  3J27 B;  3T1Y M;  1G41 A;  1HNX M;  4XGI A;  4DV6 M;  2M5Z A;  4X64 M;  2LH0 A;  3VKG A;  1DGH A;  1R2Z A;  3A42 A;  4EIW A;  2C96 A;  5EXT A;  1D2N A;  5ITY A;  2QP9 X;  3VK8 A;  3R8F A;  2F5N A;  2FFJ A;  3K1J A;  1OJL A;  2BNK A;  1Z59 A;  4FWG A;  3U6L A;  1YUB A;  1N33 M;  3SC3 A;  2R45 A;  3FTC A;  4R3D A;  1G4A E;  4PT5 A;  3KW6 A;  1HNZ M;  3PXG A;  2XSZ A;  3L2A A;  5FLX S;  4R7G A;  1HR0 M;  1QAN A;  4IBB A;  2YR0 A;  4NSO B;  5KQ8 A;  3U6D A;  2CV1 A;  2QZ4 A;  3U6O A;  4NRV A;  1G8P A;  1FJG M;  4L8R C;  3GLH B;  4FW9 A;  3GQ4 A;  3SYK A;  3U61 B;  2DZO B;  2R65 A;  3I51 A;  3KSJ A;  4PD2 A;  4AKI A;  3SAV A;  5EXP A;  2K47 A;  3M7G A;  3E4R A;  4L4U A;  3VKH A;  3U60 B;  1QAM A;  5GKN A;  2XZF A;  4QOZ C;  5FTM A;  1UM8 A;  3W0F A;  1NHG C;  5EJC A;  5KO3 A;  4I5S A;  4DV7 M;  1IBK M;  1HNW M;  3U6S A;  5FTK A;  4LFC M;  1NY5 A;  3PNY A;  5ITQ A;  1N75 A;  3GRU A;  2EUC A;  4LY6 A;  2UXC M;  3UZU A;  2Z4R A;  4S12 A;  5LMN M;  3SAU A;  4DV0 M;  1XC8 A;  3VK7 A;  1DO0 A;  1OFH A;  4JV5 M;  1JR3 A;  1DGH B;  3SAS A;  3L27 A;  2DWL A;  3M6A A;  3SBJ A;  5EP2 A;  3CTW B;  3W0L B;  2RGH A;  4GKJ M;  5ITX E;  4D80 A;  4HLQ A;  3J7B A;  1IXR C;  1L8Q A;  3QAU A;  3MJ5 A;  1IN6 A;  3RGP A;  1Q3B A;  4IBC A;  1XMQ M;  5ITR A;  1MX0 A;  2CV0 A;  2QCU A;  2V6Z M;  2RKO A;  2A5Y B;  3RFW A;  4X66 M;  1W5T A;  2J7N A;  1WXQ A;  3BOS A;  3GLG A;  2C5R A;  1L1T A;  2DVW B;  2F5S A;  3VFD A;  5EXX A;  4PDI A;  4LZZ A;  1ZAE A;  3HU2 A;  3THG A;  4LRT A;  4MGI E;  3AOE A;  3K92 A;  4BBA A;  1XNQ M;  4LFA M;  3HHX A;  2HKJ A;  2X8A A;  2BJW A;  4FCV A;  1NNJ A;  3L29 A;  3DFZ A;  3TQS A;  1NSF A;  3J7A S;  2KZS A;  1IBM M;  3RE8 A;  4KOD A;  4G4O A;  1FNN A;  2ZAN A;  4IBF A;  4G4N A;  3U60 A;  4FWH A;  4LG2 A;  4LF7 M;  3I4Y A;  4FCW A;  4L15 A;  2KXE A;  5EP3 A;  2V1U A;  2XH9 A;  1LV7 A;  1I94 M;  4LF9 M;  2D7H A;  2L7I A;  4JI0 M;  3JR4 A;  2Y20 A;  4MB7 A;  1TH3 A;  3GQ3 A;  1L2C A;  1Z5C A;  4DV5 M;  3DZD A;  3LMM A;  4LFB M;  3B9P A;  4REZ A;  1L2B A;  2UUC M;  4IIW A;  4MGZ E;  4QHS A;  2L6O A;  1IXZ A;  3FUU A;  3HU3 A;  5EXS A;  2ZAM A;  4MGY E;  2UXD M;  2D7E A;  3KFU G;  2XEP A;  1Q39 A;  2DWM A;  3TWK A;  2R4J A;  4DR7 M;  4CGY B;  1XNR M;  2C99 A;  3GRR A;  2FNA A;  1Z6T A;  3E9S A;  3FD9 A;  3GLI A;  1TH2 A;  1XXH B;  2Z4S A;  2KA6 B;  2ZBK B;  3DA1 A;  4GH9 A;  3GLG B;  1Q3C A;  4B7G A;  3LQQ A;  1I4W A;  4IJE A;  4LF5 M;  4K0K M;  1DGF A;  3HHW A;  4YY3 M;  4JI2 M;  2OPF A;  3FKE A;  2Y0T A;  5E26 A;  5EP4 A;  4GC5 A;  4L78 A;  2CHG A;  3IG8 A;  5FTL A;  1DO2 A;  1Z5A A;  5KPR A;  4MM3 B;  4NSR A;  5IRE B;  1PJI A;  4OX9 M;  4IBJ A;  1SXJ C;  5JI2 E;  2I7P A;  4Z6Y A;  3SAR A;  2FE8 A;  3UJN A;  3KS8 A;  4QNM A;  4I8O A;  1SXJ D;  1G59 A;  1R7R A;  2QBY A;  5DNY A;  5LMU M;  4LF6 M;  3GQ5 A;  1E94 E;  3GPX A;  1NJF A;  4AG6 A;  3WHL A;  1KYI A;  4II7 A;  2XF3 A;  4LJ8 A;  4B7H A;  3FUV A;  3GPU A;  3K2L A;  4TUW A;  4X62 M;  3PVS A;  2JA2 A;  4QNR A;  4B7F A;  3FTF A;  3TWM A;  3SHF A;  1J09 A;  2QPA A;  4DR3 M;  3SAW A;  3CF0 A;  3GLF B;  4LGY A;  2X49 A;  1KSF X;  3ZH9 B;  3FTD A;  4A3V B;  2ERC A;  2UUA M;  4GRI A;  4JI4 M;  1J7K A;  4JI6 M;  2D7G A;  3UGJ A;  2F5Q A;  3VDU A;  4B3S M;  3GRY A;  4AQY M;  4JI8 M;  5FTJ A;  1IQP A;  2C98 A;  1IN7 A;  4L16 A;  3AKZ A;  2XSZ D;  4PDG A;  1QYR A;  1IY2 A;  1GVN A;  3D8B A;  4JYA M;  4GMQ A;  3I4V A;  3FYD A;  3KDS E;  3HJS A;  1L2D A;  3AV0 A;  2P5T A;  2ZAO A;  4OVZ B;  1HT1 E;  8CAT A;  1JR3 D;  3AOE C;  1TGU A;  4GIP A;  4P16 A;  2L7H A;  3LVV A;  4Z8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...