3TWMA

Crystal structure of arabidopsis thaliana fpg
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
278
structure length
261
Chain Sequence
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/dna
molecule keywords Formamidopyrimidine-DNA glycosylase 1
total genus 69
structure length 261
sequence length 278
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twmA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twmA01
3SBJA 4LFCM 3C58A 4B3RM 1Z59A 1HNXM 1N36M 2F5SA 4LF7M 3A42A 5BR8M 4DV5M 4JI7M 3T1YM 4ITQA 1NNJA 4GKKM 5ITXE 5IT9S 5ITXA 1XNQM 4JYAM 2HHHM 4B3MM 2UXDM 5ITYA 3GPYA 4LF6M 4DV7M 4B3SM 3JAMS 1L2CA 2UU9M 3TWKA 3TWMA 1EE8A 3GQ5A 3J81S 4DR2M 4NRWA 1IBLM 3GQ4A 4CISA 4DV6M 1J5EM 4X64M 2HKJA 4LF5M 1R2YA 3U6QA 2ZM6M 1TDHA 3U6OA 1HNZM 2F5OA 3A46A 4NXNM 4DR3M 5FLXS 3A45A 4B3TM 1K3XA 3J7AS 4NRVA 5A2QS 1HNWM 1XC8A 4JI6M 1Z5CA 4AQYM 1HR0M 4DV4M 2Q2EB 3SAUA 1XMOM 3TWLA 4PD2A 4LF8M 4JI3M 3W0FA 4X65M 2UXCM 4PDGA 4X66M 1Z5AA 3U6PA 4G4OA 4DUYM 2UUAM 3JR4A 2ZBKB 1PM5A 4DR4M 1Q3BA 3GPPA 1FJGM 5ITQA 3OTOM 4DUZM 4JV5M 2UXBM 4LFBM 4GKJM 4DR7M 1L2BA 4DV1M 3U6CA 5IWAM 1MX0A 2UUCM 4DV0M 4LF9M 2OQ4A 5ITRA 4NXMM 2F5NA 4YHHM 3SATA 1TDZA 1IBKM 4OX9M 1MU5A 4JI8M 3VK8A 4G4RA 2UUBM 4LFAM 4G4QA 1Q3CA 4JI0M 2F5QA 4JI4M 3GQ3A 3SAVA 1Z5BA 4X62M 3DOAA 4DV2M 3SASA 3GO8A 4JI2M 1XNRM 2E5LM 3GPUA 3SAWA 3T1HM 1R2ZA 4MB7A 3U6SA 1L1TA 4DR6M 2XZUA 1K3WA 3U6EA 3JR5A 5LMNM 4DR5M 5ITTA 1IBMM 4JI1M 4K0KM 2VQFM 4JI5M 3U6MA 4G4NA 4YY3M 1L1ZA 3GP1A 1KFVA 4DV3M 4KHPM 3GPXA 2VQEM 2XZFA 1I94M 5LMUM 1PJJA 1K82A 1PJIA 1L2DA 4LF4M 1N32M 1Q39A 3J80S 3VK7A 1N33M 2EA0A 3SARA 2F4VM 3U6DA 5ITUA 4DR1M 2OPFA 4PCZA 2F5PA 3U6LA 1XMQM 1N34M 4PDIA
chains in the Genus database with same CATH superfamily
2HL7A 3CGWA 2JP7A 2J7NA 2R0IA 2VDBB 3UMMA 1XHBA 4MM3B 4Z6YA 1KYIA 2G3QA 1OFIA 3A42A 4BLCA 2L2DA 3T1YM 2XGNA 4W5WA 3W0LB 2XFTA 3PNVA 5FTJA 2CE7A 2RKOA 2UXDM 1XWIA 1GLNA 1ZMVA 3HJSA 3LCVB 4S12A 2L09A 3WHLA 4DV7M 4I8OA 2ZAMA 4B3SM 1GABA 4HL4A 1CUKA 3EIHA 4FVMA 1EE8A 1YLAA 3TWMA 4REZA 2BWEA 2V1CA 1OAIA 1GKIA 2G5GX 1E32A 3Q8XA 4NSOB 4WP2A 4KO8A 4NC6A 5L8RF 1R2YA 1NJGA 2WSCF 2Z4SA 1QDTA 4CIZA 1MN3A 1TDHA 4LJ6A 3A46A 2QPAA 2DAIA 1VEGA 1G3IA 1V33A 2EJSA 3A45A 2LVPC 3I04M 3IECA 4FCVA 4GMQA 3QYBA 4NRVA 3FUVA 3TQSA 3TPZA 3L26A 1K3XA 2R46A 2R45A 1WJ7A 3DZDA 2VF7A 2R6FA 5BPVA 1Z5CA 8CATA 4A3VB 1OFHA 3L29A 5KO3A 1OTRA 1XMOM 2NQ8C 2VF8A 4PD2A 4JI3M 3FRIA 3A98B 3U60B 1EIJA 4MGYE 5IREB 4FCTA 3J7BA 4PDGA 3KXEC 2UXCM 2H1RA 1SXJC 4FWHA 3RE8A 1Z5AA 3U6PA 2DNAA 3HU3A 4B08A 3AOEA 2C98A 3JR4A 3CF2A 2QNJA 4B7FA 4GHLA 4IBCA 2G8LA 1GL7A 1JB0F 3SFZA 1XXHB 2QQ8A 2QZ4A 3GLGE 2UXBM 3K9OA 4G6ZA 1QAOA 5FTKA 2EKFA 3GLHB 2UUCM 2JY6B 1WR1B 4LF9M 1ZMUA 2F5NA 4YHHM 3AOGA 1HQYE 2K6BA 3U61A 1IQPA 3T38A 4EIWA 2R62A 4LFAM 1EFUB 2R4EA 3GQ3A 2Y0TA 4RKUF 3D8LA 3C9PA 3I01M 4L8RC 3GPUA 2DENA 3VDPA 2K47A 3PVSA 7CATA 1GJTA 2XEPA 3FYDA 1YSYA 3SHGB 1K3WA 1A5TA 1JR3E 4NSRA 3GLHA 4AKGA 2HAKA 3KS4A 1QAMA 5ITTA 1H6UA 2CV1A 2BWBA 2DAEA 2R44A 3L2AA 3HJQA 3UJNA 3J7AS 1G59A 3T15A 2OO9A 2O25A 2CHGA 1W5SA 2DZLA 3W68A 1PJTA 2CUZA 5DFLA 2DAKA 4DV3M 1AIPC 3GRVA 1HQCA 1NNUC 2Y20A 2KRKA 4QOSA 3FD9A 1T43A 1NHWC 1SXJA 1PJJA 3B89A 2Y0QA 3HHYA 2KNZA 3VK7A 1N33M 2F4VM 2FFJA 3PFIA 1G8PA 4XK8F 2OPFA 2F5PA 2JZ0A 1QANA 1SXJD 3U6LA 4KODA 1DGHB 3SARA 1IXRC 1XNRM 3AL0C 1XB2B 1NJFA 4M9XA 4UN2B 3C3EA 4JXJA 1Z59A 4BBAA 1UM8A 3Q8GA 4LJ9A 1D0KA 1OKSA 3KVWA 5KPZA 1N36M 2QBYB 5BR8M 2M60A 4WURA 4MH0E 2Z3XA 4JI7M 1D0MA 4GKKM 3DA1A 5E6JA 4F2LA 1G4AE 4JYAM 5ITYA 4BB9A 2XSZD 1L8QA 2J5YA 4IBJA 4IJEA 1SXJE 1ZMWA 4LF6M 3TE6A 2JWSA 2LBCA 2MH8A 2C99A 2FNAA 2O01F 2CHQA 2UU9M 3SYKA 3BXWA 3HHXA 2XSZA 5KQDA 1IBLM 3LQQA 2DWNA 1OAOC 1GVNA 2XFSA 2HKJA 1QYRA 2KZUA 2X49A 3NBIA 2XH9A 3MJ5A 3R8FA 3FUXA 2LVNC 4NXNM 4LZJA 4QNRA 4XBOA 3E9SA 1QUTA 3L28A 2LVQD 4RNAA 1WIVA 3GLFE 1HR0M 2KA6B 3I4VA 2DAGA 4B7HA 3GLIB 4DV4M 2Q2EB 2QP9X 1VQ1A 4LY6A 4QHSA 3ZQJA 2QENA 1Z6TA 2LVOC 4B3TM 4GHAA 1F4IA 4AKHA 4X66M 3B74A 1OQYA 2AHMA 2DZOB 2CV0A 3L25A 3DFZA 2KRUA 1T6OA 2LH0A 4DUYM 2K0BX 3LW5F 4DR4M 3B7ZA 1E9SA 4M9ZA 3B7QA 3IG5A 1AUAA 3GLHE 3VDUA 3M7GA 2FE8A 3ILKA 1PJSA 1D2NA 3KOXE 5DYIA 5ITQA 4JV5M 4GITA 4GIPA 1IY2A 1L2BA 1I4WA 1IN4A 4IBIA 1ZQ9A 4P17A 5FSWA 4PT5A 2OQ4A 1DGBA 4LGYA 2R18A 2CWBA 1TDZA 4LRSA 1IBKM 2X8AA 1R4GA 4CGYB 4TUWA 5GKNA 3KP0E 4OVZB 4FWDA 1Q3CA 1GO5A 2JY8A 4RF0A 4ANRA 1Z5BA 5FTMA 3GLFA 3M6AA 2DHRA 4DV2M 2CFOA 2JUJA 4AKIA 1IXSB 2BNKA 1DO2A 2ERCA 5EP2A 3UK6A 4IBEA 4DR6M 2KNAA 4KLNA 2EKKA 2XZUA 3KW6A 1J7KA 4AG6A 5F3WA 3J2PB 4FD2A 5EXPA 4D82A 1QVRA 3C3DA 1ORYB 1ZV1A 2JZ1A 3FTEA 3GRRA 4MGHA 1QZEA 3QAUA 4QOZC 2N35A 2P5TA 5E26A 2QSFX 4LJ4A 5FTLA 1KFVA 1VEJA 2MGWA 2FH0A 2GQFA 3FTDA 3UGJA 1HT2E 4KHPM 1KSFX 4GRIA 3AFHA 2L6OA 3AJIB 1IY0A 1IN6A 4GEWA 3J80S 3I4YA 2EA0A 3AOEC 4LRTA 1DV0A 3KP1E 3W67A 3U6DA 3KSJA 2R65A 1GJSA 1NY6A 2L4EA 1NV8A 2C5RA 4LF5M 3V76A 5EXXA 2DWZB 2VIIA 4PDIA 1TH3A 3FYCA 3GLGA 4B3RM 1OIZA 2YNMD 1TH4A 4L16A 4GC9A 2DI0A 1TGUA 1HT1E 4LF7M 4LJ8A 1N77A 4DV5M 2YQZA 3FUWA 5ITXE 5IT9S 3HU2A 2WSEF 5C1BA 2RGOA 2V6ZM 1C7YA 3KOZE 3B7NA 1QDRA 2L7IA 3U5ZB 2I7NA 3FRHA 2ZTDA 3HHWA 3CF6E 3E46A 4NL4H 2JY7A 3JAMS 2B3TA 2C9CA 2RRUA 3HJ8A 1JQJC 3J81S 3R9XB 4DR2M 1LV7A 4NRWA 3K92A 2JY5A 1TF0B 3ZCBB 2EO2A 1DGGA 2DZNB 3CTWB 5H37D 1MJGM 3J27B 1J5EM 2ZM6M 4FWGA 1IXSA 4QNMA 3HY5A 3U6OA 4IBFA 1GL6A 4L15A 2M5ZA 3GRYA 4NOOB 1TH2A 2KZSA 4CJ6A 2CRUA 4G3OA 1XC8A 4OVZA 4JI6M 4P16A 4OU7A 5JI3E 1NHGC 5DYGA 2CV2A 1IY1A 5EQTA 1G71A 3SHFA 3W0FA 4AZFA 4X65M 2KHHA 2KW0A 1IN8A 3D8BA 3PXGA 1YE9A 3RFWA 1IXZA 2YR0A 2JNHA 5EXTA 4G4OA 3FTFA 1IFYA 4F1IA 1PM5A 2Z8YM 2DHYA 2WSFF 3GPPA 1FJGM 3I51A 3H4JA 2O5RA 3L27A 4M9SA 4DUZM 4I5SA 2R4JA 3E21A 4DR7M 4HLQA 1WHCA 2D7GA 3U6CA 1MX0A 2BJVA 4B7GA 4M0DA 4DV0M 1DGFA 4ZPXA 3GLGB 3SATA 2FOIC 2Y21A 4IBDA 3WHKA 3U5ZA 1MU5A 2CEAA 1S3SA 2Z4RA 5IZ7D 4AW4A 4IJFA 3NWLA 4JI8M 2D7HA 3HKPA 4G4RA 3VK8A 2UUBM 4G4QA 2W82A 1N78A 4IBGA 4JI0M 4JI4M 3QYEA 4LJ7A 4LG2A 3VKGA 1R6BX 3DOAA 3FTCA 4LJAA 4D81A 3GO8A 3SASA 2MJ5B 2E5LM 2ZAOA 2KEBA 4JI2M 3T1HM 1R2ZA 4MB7A 2Z7JA 4LCBA 2RGHA 5EJCA 4FCWA 1QAQA 2DVWB 3KDSE 3VKHA 4DR5M 3AKZA 3AV0A 2FS1A 4JI1M 2KDLA 1VDDA 5C18A 2VQFM 2CP8A 4JI5M 3U6MA 4G4NA 1TTEA 3KFUG 1VEKA 2LXEA 4DBGB 1L1ZA 4R3DA 4R71A 4MGZE 3GP1A 2LTUA 1V34A 5EP1A 2OOAA 1PGYA 3TL4X 2LNHC 3LVVA 4XGIA 4AG5A 3GLFB 2JXNA 4QHTA 5LMUM 1I94M 2A5YB 4I81A 3K9PA 4Q7JA 3SMSA 1Q39A 3PNYA 3LMMA 3MMPA 4LGMA 1JR3D 3MHVC 4DR1M 4L78A 4PCZA 1VG5A 3LQRA 2ZANA 3K1JA 4GC5A 4LFBM 3ZC7B 4JN6A 3SBJA 4LFCM 3C58A 1YUBA 2DAMA 1JR3A 3EIEA 1HNXM 2DXIA 4FW9A 3FUTA 2F5SA 1G41A 1XXHE 2XF3A 4RF1A 4Y28F 3BOSA 3K2LA 4IBBA 1NNJA 4ITQA 2OOBA 5ITXA 1XNQM 1C1KA 4D80A 3H4MA 2JA2A 2HHHM 4B3MM 1NVMA 4II7A 3GPYA 3K8ZA 3KOWE 2LVAA 3GRUA 1FNNA 1WGNA 3TWKA 5FTNA 1L2CA 3UZUA 3GQ5A 3LCUA 3MK6A 1J09A 3LVWA 3GQ4A 3RGPA 2X4AA 4DV6M 2I7PA 2V1UA 3T6PA 4CISA 3VFDA 3E4RA 2C96A 4X64M 4OW0A 3HHZA 1SG9A 3SMPA 3U6QA 3KS8A 3IHPA 1WGLA 5DNYA 4M0WA 1HNZM 2F5OA 2EUCA 3KOYE 5EXSA 2C9OA 1W5TA 2YFQA 5FLXS 1PJQA 4DR3M 4Z8XA 1P3QQ 5A2QS 1HNWM 3SC3A 2APLA 1QQWA 3NBXX 3U61B 4AQYM 3B9PA 4WW0A 3GLIA 3SAUA 1IN5A 4L4UA 3TWLA 4LF8M 3F92A 3CF0A 1Q02A 4MGKE 3THGA 3QWLA 3HWSA 2H5XA 1N75A 4MGIE 2UUAM 1Y8GA 2ZBKB 1Q3BA 1IN7A 1XXHA 1NSFA 2L4FA 3HGIA 1OJLA 4L6V6 1QUSA 4LJ5A 2HCBA 3OTOM 1V92A 4GKJM 1ZAEA 5JI2E 4DV1M 5IWAM 2KNVA 3RGSA 2J7OA 1TR8A 3KSXA 5ITRA 3U60A 1D0LA 4NXMM 5EP4A 3ZH9B 3HU1A 1DGHA 4OX9M 2ZTCA 1R5LA 5EP3A 2L7HA 1NV9A 4KT0F 2DWMA 2HWJA 3FKEA 2BJWA 3SYLA 2F5QA 2CHVA 1SXJB 1VDLA 3SAVA 4X62M 2K9DA 2QBYA 1QZMA 4CHTB 1E94E 4I4LA 3SAWA 1R7RA 3U6SA 1IM2A 1RU3A 3HZJA 1L1TA 4GH9A 2DWLA 1HJPA 1NY5A 3U6EA 3JR5A 3FE3A 1UFZA 5LMNM 1BVSA 4IBKA 1X37A 2QHOB 1OIPA 2GNOA 2XLJA 1IBMM 1PRBA 4K0KM 3M0EA 2LWXA 3HX3A 4IIWA 3IG8A 4R7GA 4YY3M 4AI6A 4HEOA 2KXEA 3FUUA 2D7EA 3GPXA 2MR9A 2WZJA 5KPRA 2VQEM 1T3TA 2XZFA 1NO1A 3GLIE 4LF4M 1DO0A 2LHCA 1PJIA 1K82A 1WXQA 3BBZA 5KQ8A 2QCUA 1L2DA 1N32M 1E9RA 2MROB 4LZZA 1LTMA 5KPTA 5ITUA 3VLFB 2LHGA 1XMQM 1N34M 2DKLA
chains in the Genus database with same CATH topology
2HL7A 2J7NA 3UMMA 1XHBA 4MM3B 4Z6YA 1KYIA 1OFIA 3A42A 4BLCA 3T1YM 2XGNA 4W5WA 3W0LB 2XFTA 3PNVA 5FTJA 2CE7A 2RKOA 2UXDM 1XWIA 1GLNA 3HJSA 4S12A 2L09A 3WHLA 4DV7M 4I8OA 2ZAMA 4B3SM 4HL4A 3EIHA 4FVMA 1EE8A 3TWMA 4REZA 2V1CA 1GKIA 2G5GX 1E32A 3Q8XA 4NSOB 4KO8A 1R2YA 1NJGA 2Z4SA 4LJ6A 1TDHA 3A46A 2QPAA 4AW4A 1G3IA 7CATA 4GMQA 3A45A 3TQSA 4B3TM 3L26A 4FCVA 4NRVA 1K3XA 3J7AS 3FUVA 4AKHA 3TPZA 2R46A 2R45A 3DZDA 8CATA 5BPVA 1Z5CA 4A3VB 1OFHA 3L29A 5KO3A 1XMOM 2NQ8C 4PD2A 4JI3M 3A98B 3U60B 4MGYE 5IREB 4FCTA 3J7BA 4PDGA 3KXEC 2UXCM 2H1RA 1SXJC 4FWHA 3RE8A 1Z5AA 3U6PA 3HU3A 4B08A 3AOEA 2C98A 3JR4A 3CF2A 4B7FA 4GHLA 4IBCA 2G8LA 1GL7A 3SFZA 1XXHB 2QZ4A 2UXBM 4G6ZA 1QAOA 5FTKA 3GLHB 2UUCM 4LF9M 2F5NA 4YHHM 3AOGA 1HQYE 3U61A 1IQPA 3T38A 4EIWA 2R62A 4LFAM 2R4EA 3GQ3A 2Y0TA 3D8LA 4L8RC 3GPUA 3VDPA 2K47A 3PVSA 2XEPA 3FYDA 1YSYA 3SHGB 1K3WA 4NSRA 3GLHA 4AKGA 3KS4A 1QAMA 5ITTA 1H6UA 2CV1A 3L2AA 3HJQA 3UJNA 1G59A 3T15A 2CHGA 1W5SA 2CUZA 4DV3M 3GRVA 1HQCA 1NNUC 2Y20A 2KRKA 4QOSA 3FD9A 1NHWC 1SXJA 1PJJA 2Y0QA 3HHYA 3VK7A 1N33M 2F4VM 2FFJA 3PFIA 1G8PA 2OPFA 2F5PA 1QANA 1SXJD 3U6LA 4KODA 1DGHB 3SARA 1IXRC 1XNRM 3AL0C 1NJFA 4M9XA 4JXJA 1Z59A 4BBAA 1UM8A 4LJ9A 5KPZA 1N36M 3KVWA 2QBYB 5BR8M 2M60A 4WURA 4MH0E 2Z3XA 4JI7M 4GKKM 3DA1A 5E6JA 1G4AE 4JYAM 5ITYA 4BB9A 2XSZD 1L8QA 4IBJA 4IJEA 4LF6M 1SXJE 3TE6A 2C99A 2FNAA 2UU9M 2CHQA 3SYKA 3HHXA 2XSZA 5KQDA 1IBLM 3LQQA 2DWNA 1GVNA 2XFSA 2HKJA 1QYRA 2KZUA 2X49A 3NBIA 2XH9A 3MJ5A 3R8FA 3FUXA 4NXNM 4LZJA 4QNRA 4XBOA 3E9SA 3L28A 4RNAA 1HR0M 2KA6B 3I4VA 4B7HA 3GLIB 4DV4M 2Q2EB 2QP9X 4LY6A 4QHSA 2QENA 1Z6TA 4GHAA 4X66M 3L25A 2AHMA 2DZOB 2CV0A 3DFZA 2KRUA 2LH0A 4DUYM 4DR4M 1E9SA 4M9ZA 3IG5A 3VDUA 3M7GA 2FE8A 3ILKA 3KOXE 1D2NA 5ITQA 5DYIA 4JV5M 4GITA 4GIPA 1IY2A 1L2BA 1I4WA 1IN4A 4IBIA 1ZQ9A 5FSWA 4PT5A 2OQ4A 1DGBA 4LGYA 2R18A 1TDZA 4LRSA 1IBKM 2X8AA 4CGYB 4TUWA 5GKNA 3KP0E 4OVZB 4FWDA 1Q3CA 4RF0A 1Z5BA 5FTMA 3GLFA 3M6AA 2DHRA 4DV2M 2CFOA 4AKIA 1IXSB 2BNKA 1DO2A 2ERCA 5EP2A 3UK6A 4IBEA 4DR6M 4KLNA 2XZUA 3KW6A 1J7KA 4AG6A 5F3WA 3J2PB 4FD2A 5EXPA 4D82A 1QVRA 1ORYB 3FTEA 3GRRA 4MGHA 3QAUA 4QOZC 2P5TA 5E26A 5FTLA 4LJ4A 1KFVA 3UGJA 4KHPM 3FTDA 1HT2E 1KSFX 4GRIA 3AFHA 2L6OA 3AJIB 1IY0A 1IN6A 3J80S 3I4YA 2EA0A 3AOEC 4LRTA 3KP1E 3U6DA 3KSJA 2R65A 1NY6A 2C5RA 4LF5M 5EXXA 2VIIA 2DWZB 4PDIA 1TH3A 3FYCA 3GLGA 4B3RM 2YNMD 1TH4A 4L16A 4GC9A 1TGUA 1HT1E 4LF7M 4LJ8A 1N77A 4DV5M 2YQZA 3FUWA 5ITXE 5IT9S 3HU2A 5C1BA 2RGOA 2V6ZM 3KOZE 2L7IA 3U5ZB 2I7NA 3HHWA 3CF6E 4NL4H 3JAMS 2C9CA 3HJ8A 1JQJC 3J81S 3R9XB 4DR2M 1LV7A 4NRWA 3K92A 3ZCBB 5H37D 1J5EM 2EO2A 1DGGA 2DZNB 3CTWB 3J27B 2ZM6M 4FWGA 4QNMA 3U6OA 4IBFA 1GL6A 4L15A 2M5ZA 3GRYA 4NOOB 1TH2A 2KZSA 1XC8A 4JI6M 4OVZA 4P16A 4OU7A 5JI3E 1NHGC 5DYGA 2CV2A 1IY1A 5EQTA 3SHFA 3W0FA 4AZFA 4X65M 2KW0A 1IN8A 3D8BA 3PXGA 1YE9A 3RFWA 1IXZA 2YR0A 5EXTA 4G4OA 3FTFA 1PM5A 3GPPA 1FJGM 3I51A 3L27A 2O5RA 4M9SA 4DUZM 4I5SA 2R4JA 4DR7M 4HLQA 3U6CA 2D7GA 1MX0A 2BJVA 4B7GA 4M0DA 4DV0M 1DGFA 4ZPXA 3GLGB 3SATA 2FOIC 2Y21A 4IBDA 3WHKA 3U5ZA 1MU5A 2CEAA 1S3SA 2Z4RA 5IZ7D 4IJFA 3NWLA 4JI8M 2D7HA 3HKPA 4G4RA 3VK8A 2UUBM 4G4QA 2W82A 1N78A 4IBGA 4JI0M 4JI4M 4LJ7A 4LG2A 3VKGA 1R6BX 3DOAA 3FTCA 4LJAA 4D81A 3GO8A 3SASA 4JI2M 2E5LM 2ZAOA 2KEBA 3T1HM 1R2ZA 4MB7A 2Z7JA 4LCBA 2RGHA 5EJCA 4FCWA 1QAQA 2DVWB 3KDSE 3VKHA 4DR5M 3AKZA 3AV0A 4JI1M 1VDDA 5C18A 2VQFM 3KFUG 4JI5M 3U6MA 4G4NA 2LXEA 1L1ZA 4R3DA 4MGZE 3GP1A 5EP1A 3TL4X 2LNHC 3LVVA 4XGIA 4AG5A 3GLFB 4QHTA 5LMUM 1I94M 2A5YB 4I81A 3SMSA 1Q39A 3PNYA 3LMMA 4LGMA 1JR3D 3MHVC 4DR1M 4L78A 4PCZA 3LQRA 2ZANA 3K1JA 4GC5A 4LFBM 3ZC7B 4JN6A 3SBJA 4LFCM 3C58A 1YUBA 1JR3A 3EIEA 1HNXM 2DXIA 4FW9A 3FUTA 2F5SA 1G41A 2XF3A 4RF1A 3BOSA 3K2LA 4IBBA 1NNJA 4ITQA 5ITXA 1XNQM 1C1KA 4D80A 3H4MA 2JA2A 2HHHM 4B3MM 1NVMA 4II7A 3GPYA 3K8ZA 3KOWE 3GRUA 1FNNA 1L2CA 3TWKA 5FTNA 3UZUA 3GQ5A 3MK6A 1J09A 3LVWA 3GQ4A 3RGPA 2X4AA 4DV6M 2I7PA 2V1UA 4CISA 3VFDA 3E4RA 2C96A 4X64M 4OW0A 3HHZA 3U6QA 3SMPA 3KS8A 5DNYA 4M0WA 1HNZM 2F5OA 2EUCA 3KOYE 5EXSA 2C9OA 1W5TA 2YFQA 5FLXS 4DR3M 4Z8XA 5A2QS 1HNWM 3SC3A 1QQWA 3U61B 4AQYM 3B9PA 4WW0A 3GLIA 3SAUA 1IN5A 4L4UA 3TWLA 4LF8M 3CF0A 4MGKE 3THGA 3QWLA 3HWSA 1N75A 4MGIE 2UUAM 2ZBKB 1Q3BA 1IN7A 1XXHA 1NSFA 3HGIA 1OJLA 4LJ5A 2HCBA 3OTOM 4GKJM 1ZAEA 5JI2E 4DV1M 5IWAM 3RGSA 2J7OA 3KSXA 5ITRA 3U60A 4NXMM 5EP4A 3ZH9B 3HU1A 1DGHA 4OX9M 5EP3A 2L7HA 2DWMA 3FKEA 2BJWA 3SYLA 2F5QA 2CHVA 1SXJB 3SAVA 4X62M 2QBYA 1QZMA 4CHTB 1E94E 4I4LA 3SAWA 1R7RA 3U6SA 1IM2A 1L1TA 4GH9A 2DWLA 1NY5A 3U6EA 3JR5A 5LMNM 4IBKA 1X37A 2XLJA 1IBMM 4K0KM 3M0EA 2LWXA 4IIWA 4R7GA 3IG8A 4YY3M 4AI6A 2KXEA 3FUUA 2D7EA 3GPXA 5KPRA 2VQEM 1T3TA 2XZFA 4LF4M 1DO0A 1K82A 1PJIA 1L2DA 1WXQA 5KQ8A 1N32M 2QCUA 1E9RA 4LZZA 5KPTA 5ITUA 3VLFB 1XMQM 1N34M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBJ A;  4LFC M;  3C58 A;  4B3R M;  1Z59 A;  1HNX M;  1N36 M;  2F5S A;  4LF7 M;  3A42 A;  5BR8 M;  4DV5 M;  4JI7 M;  3T1Y M;  4ITQ A;  1NNJ A;  4GKK M;  5ITX E;  5IT9 S;  5ITX A;  1XNQ M;  4JYA M;  2HHH M;  4B3M M;  2UXD M;  5ITY A;  3GPY A;  4LF6 M;  4DV7 M;  4B3S M;  3JAM S;  1L2C A;  2UU9 M;  3TWK A;  3TWM A;  1EE8 A;  3GQ5 A;  3J81 S;  4DR2 M;  4NRW A;  1IBL M;  3GQ4 A;  4CIS A;  4DV6 M;  1J5E M;  4X64 M;  2HKJ A;  4LF5 M;  1R2Y A;  3U6Q A;  2ZM6 M;  1TDH A;  3U6O A;  1HNZ M;  2F5O A;  3A46 A;  4NXN M;  4DR3 M;  5FLX S;  3A45 A;  4B3T M;  1K3X A;  3J7A S;  4NRV A;  5A2Q S;  1HNW M;  1XC8 A;  4JI6 M;  1Z5C A;  4AQY M;  1HR0 M;  4DV4 M;  2Q2E B;  3SAU A;  1XMO M;  3TWL A;  4PD2 A;  4LF8 M;  4JI3 M;  3W0F A;  4X65 M;  2UXC M;  4PDG A;  4X66 M;  1Z5A A;  3U6P A;  4G4O A;  4DUY M;  2UUA M;  3JR4 A;  2ZBK B;  1PM5 A;  4DR4 M;  1Q3B A;  3GPP A;  1FJG M;  5ITQ A;  3OTO M;  4DUZ M;  4JV5 M;  2UXB M;  4LFB M;  4GKJ M;  4DR7 M;  1L2B A;  4DV1 M;  3U6C A;  5IWA M;  1MX0 A;  2UUC M;  4DV0 M;  4LF9 M;  2OQ4 A;  5ITR A;  4NXM M;  2F5N A;  4YHH M;  3SAT A;  1TDZ A;  1IBK M;  4OX9 M;  1MU5 A;  4JI8 M;  3VK8 A;  4G4R A;  2UUB M;  4LFA M;  4G4Q A;  1Q3C A;  4JI0 M;  2F5Q A;  4JI4 M;  3GQ3 A;  3SAV A;  1Z5B A;  4X62 M;  3DOA A;  4DV2 M;  3SAS A;  3GO8 A;  4JI2 M;  1XNR M;  2E5L M;  3GPU A;  3SAW A;  3T1H M;  1R2Z A;  4MB7 A;  3U6S A;  1L1T A;  4DR6 M;  2XZU A;  1K3W A;  3U6E A;  3JR5 A;  5LMN M;  4DR5 M;  5ITT A;  1IBM M;  4JI1 M;  4K0K M;  2VQF M;  4JI5 M;  3U6M A;  4G4N A;  4YY3 M;  1L1Z A;  3GP1 A;  1KFV A;  4DV3 M;  4KHP M;  3GPX A;  2VQE M;  2XZF A;  1I94 M;  5LMU M;  1PJJ A;  1K82 A;  1PJI A;  1L2D A;  4LF4 M;  1N32 M;  1Q39 A;  3J80 S;  3VK7 A;  1N33 M;  2EA0 A;  3SAR A;  2F4V M;  3U6D A;  5ITU A;  4DR1 M;  2OPF A;  4PCZ A;  2F5P A;  3U6L A;  1XMQ M;  1N34 M;  4PDI A; 
#chains in the Genus database with same CATH topology
 2HL7 A;  3CGW A;  2JP7 A;  2J7N A;  2R0I A;  2VDB B;  3UMM A;  1XHB A;  4MM3 B;  4Z6Y A;  1KYI A;  2G3Q A;  1OFI A;  3A42 A;  4BLC A;  2L2D A;  3T1Y M;  2XGN A;  4W5W A;  3W0L B;  2XFT A;  3PNV A;  5FTJ A;  2CE7 A;  2RKO A;  2UXD M;  1XWI A;  1GLN A;  1ZMV A;  3HJS A;  3LCV B;  4S12 A;  2L09 A;  3WHL A;  4DV7 M;  4I8O A;  2ZAM A;  4B3S M;  1GAB A;  4HL4 A;  1CUK A;  3EIH A;  4FVM A;  1EE8 A;  1YLA A;  3TWM A;  4REZ A;  2BWE A;  2V1C A;  1OAI A;  1GKI A;  2G5G X;  1E32 A;  3Q8X A;  4NSO B;  4WP2 A;  4KO8 A;  4NC6 A;  5L8R F;  1R2Y A;  1NJG A;  2WSC F;  2Z4S A;  1QDT A;  4CIZ A;  1MN3 A;  1TDH A;  4LJ6 A;  3A46 A;  2QPA A;  2DAI A;  1VEG A;  1G3I A;  1V33 A;  2EJS A;  3A45 A;  2LVP C;  3I04 M;  3IEC A;  4FCV A;  4GMQ A;  3QYB A;  4NRV A;  3FUV A;  3TQS A;  3TPZ A;  3L26 A;  1K3X A;  2R46 A;  2R45 A;  1WJ7 A;  3DZD A;  2VF7 A;  2R6F A;  5BPV A;  1Z5C A;  8CAT A;  4A3V B;  1OFH A;  3L29 A;  5KO3 A;  1OTR A;  1XMO M;  2NQ8 C;  2VF8 A;  4PD2 A;  4JI3 M;  3FRI A;  3A98 B;  3U60 B;  1EIJ A;  4MGY E;  5IRE B;  4FCT A;  3J7B A;  4PDG A;  3KXE C;  2UXC M;  2H1R A;  1SXJ C;  4FWH A;  3RE8 A;  1Z5A A;  3U6P A;  2DNA A;  3HU3 A;  4B08 A;  3AOE A;  2C98 A;  3JR4 A;  3CF2 A;  2QNJ A;  4B7F A;  4GHL A;  4IBC A;  2G8L A;  1GL7 A;  1JB0 F;  3SFZ A;  1XXH B;  2QQ8 A;  2QZ4 A;  3GLG E;  2UXB M;  3K9O A;  4G6Z A;  1QAO A;  5FTK A;  2EKF A;  3GLH B;  2UUC M;  2JY6 B;  1WR1 B;  4LF9 M;  1ZMU A;  2F5N A;  4YHH M;  3AOG A;  1HQY E;  2K6B A;  3U61 A;  1IQP A;  3T38 A;  4EIW A;  2R62 A;  4LFA M;  1EFU B;  2R4E A;  3GQ3 A;  2Y0T A;  4RKU F;  3D8L A;  3C9P A;  3I01 M;  4L8R C;  3GPU A;  2DEN A;  3VDP A;  2K47 A;  3PVS A;  7CAT A;  1GJT A;  2XEP A;  3FYD A;  1YSY A;  3SHG B;  1K3W A;  1A5T A;  1JR3 E;  4NSR A;  3GLH A;  4AKG A;  2HAK A;  3KS4 A;  1QAM A;  5ITT A;  1H6U A;  2CV1 A;  2BWB A;  2DAE A;  2R44 A;  3L2A A;  3HJQ A;  3UJN A;  3J7A S;  1G59 A;  3T15 A;  2OO9 A;  2O25 A;  2CHG A;  1W5S A;  2DZL A;  3W68 A;  1PJT A;  2CUZ A;  5DFL A;  2DAK A;  4DV3 M;  1AIP C;  3GRV A;  1HQC A;  1NNU C;  2Y20 A;  2KRK A;  4QOS A;  3FD9 A;  1T43 A;  1NHW C;  1SXJ A;  1PJJ A;  3B89 A;  2Y0Q A;  3HHY A;  2KNZ A;  3VK7 A;  1N33 M;  2F4V M;  2FFJ A;  3PFI A;  1G8P A;  4XK8 F;  2OPF A;  2F5P A;  2JZ0 A;  1QAN A;  1SXJ D;  3U6L A;  4KOD A;  1DGH B;  3SAR A;  1IXR C;  1XNR M;  3AL0 C;  1XB2 B;  1NJF A;  4M9X A;  4UN2 B;  3C3E A;  4JXJ A;  1Z59 A;  4BBA A;  1UM8 A;  3Q8G A;  4LJ9 A;  1D0K A;  1OKS A;  3KVW A;  5KPZ A;  1N36 M;  2QBY B;  5BR8 M;  2M60 A;  4WUR A;  4MH0 E;  2Z3X A;  4JI7 M;  1D0M A;  4GKK M;  3DA1 A;  5E6J A;  4F2L A;  1G4A E;  4JYA M;  5ITY A;  4BB9 A;  2XSZ D;  1L8Q A;  2J5Y A;  4IBJ A;  4IJE A;  1SXJ E;  1ZMW A;  4LF6 M;  3TE6 A;  2JWS A;  2LBC A;  2MH8 A;  2C99 A;  2FNA A;  2O01 F;  2CHQ A;  2UU9 M;  3SYK A;  3BXW A;  3HHX A;  2XSZ A;  5KQD A;  1IBL M;  3LQQ A;  2DWN A;  1OAO C;  1GVN A;  2XFS A;  2HKJ A;  1QYR A;  2KZU A;  2X49 A;  3NBI A;  2XH9 A;  3MJ5 A;  3R8F A;  3FUX A;  2LVN C;  4NXN M;  4LZJ A;  4QNR A;  4XBO A;  3E9S A;  1QUT A;  3L28 A;  2LVQ D;  4RNA A;  1WIV A;  3GLF E;  1HR0 M;  2KA6 B;  3I4V A;  2DAG A;  4B7H A;  3GLI B;  4DV4 M;  2Q2E B;  2QP9 X;  1VQ1 A;  4LY6 A;  4QHS A;  3ZQJ A;  2QEN A;  1Z6T A;  2LVO C;  4B3T M;  4GHA A;  1F4I A;  4AKH A;  4X66 M;  3B74 A;  1OQY A;  2AHM A;  2DZO B;  2CV0 A;  3L25 A;  3DFZ A;  2KRU A;  1T6O A;  2LH0 A;  4DUY M;  2K0B X;  3LW5 F;  4DR4 M;  3B7Z A;  1E9S A;  4M9Z A;  3B7Q A;  3IG5 A;  1AUA A;  3GLH E;  3VDU A;  3M7G A;  2FE8 A;  3ILK A;  1PJS A;  1D2N A;  3KOX E;  5DYI A;  5ITQ A;  4JV5 M;  4GIT A;  4GIP A;  1IY2 A;  1L2B A;  1I4W A;  1IN4 A;  4IBI A;  1ZQ9 A;  4P17 A;  5FSW A;  4PT5 A;  2OQ4 A;  1DGB A;  4LGY A;  2R18 A;  2CWB A;  1TDZ A;  4LRS A;  1IBK M;  2X8A A;  1R4G A;  4CGY B;  4TUW A;  5GKN A;  3KP0 E;  4OVZ B;  4FWD A;  1Q3C A;  1GO5 A;  2JY8 A;  4RF0 A;  4ANR A;  1Z5B A;  5FTM A;  3GLF A;  3M6A A;  2DHR A;  4DV2 M;  2CFO A;  2JUJ A;  4AKI A;  1IXS B;  2BNK A;  1DO2 A;  2ERC A;  5EP2 A;  3UK6 A;  4IBE A;  4DR6 M;  2KNA A;  4KLN A;  2EKK A;  2XZU A;  3KW6 A;  1J7K A;  4AG6 A;  5F3W A;  3J2P B;  4FD2 A;  5EXP A;  4D82 A;  1QVR A;  3C3D A;  1ORY B;  1ZV1 A;  2JZ1 A;  3FTE A;  3GRR A;  4MGH A;  1QZE A;  3QAU A;  4QOZ C;  2N35 A;  2P5T A;  5E26 A;  2QSF X;  4LJ4 A;  5FTL A;  1KFV A;  1VEJ A;  2MGW A;  2FH0 A;  2GQF A;  3FTD A;  3UGJ A;  1HT2 E;  4KHP M;  1KSF X;  4GRI A;  3AFH A;  2L6O A;  3AJI B;  1IY0 A;  1IN6 A;  4GEW A;  3J80 S;  3I4Y A;  2EA0 A;  3AOE C;  4LRT A;  1DV0 A;  3KP1 E;  3W67 A;  3U6D A;  3KSJ A;  2R65 A;  1GJS A;  1NY6 A;  2L4E A;  1NV8 A;  2C5R A;  4LF5 M;  3V76 A;  5EXX A;  2DWZ B;  2VII A;  4PDI A;  1TH3 A;  3FYC A;  3GLG A;  4B3R M;  1OIZ A;  2YNM D;  1TH4 A;  4L16 A;  4GC9 A;  2DI0 A;  1TGU A;  1HT1 E;  4LF7 M;  4LJ8 A;  1N77 A;  4DV5 M;  2YQZ A;  3FUW A;  5ITX E;  5IT9 S;  3HU2 A;  2WSE F;  5C1B A;  2RGO A;  2V6Z M;  1C7Y A;  3KOZ E;  3B7N A;  1QDR A;  2L7I A;  3U5Z B;  2I7N A;  3FRH A;  2ZTD A;  3HHW A;  3CF6 E;  3E46 A;  4NL4 H;  2JY7 A;  3JAM S;  2B3T A;  2C9C A;  2RRU A;  3HJ8 A;  1JQJ C;  3J81 S;  3R9X B;  4DR2 M;  1LV7 A;  4NRW A;  3K92 A;  2JY5 A;  1TF0 B;  3ZCB B;  2EO2 A;  1DGG A;  2DZN B;  3CTW B;  5H37 D;  1MJG M;  3J27 B;  1J5E M;  2ZM6 M;  4FWG A;  1IXS A;  4QNM A;  3HY5 A;  3U6O A;  4IBF A;  1GL6 A;  4L15 A;  2M5Z A;  3GRY A;  4NOO B;  1TH2 A;  2KZS A;  4CJ6 A;  2CRU A;  4G3O A;  1XC8 A;  4OVZ A;  4JI6 M;  4P16 A;  4OU7 A;  5JI3 E;  1NHG C;  5DYG A;  2CV2 A;  1IY1 A;  5EQT A;  1G71 A;  3SHF A;  3W0F A;  4AZF A;  4X65 M;  2KHH A;  2KW0 A;  1IN8 A;  3D8B A;  3PXG A;  1YE9 A;  3RFW A;  1IXZ A;  2YR0 A;  2JNH A;  5EXT A;  4G4O A;  3FTF A;  1IFY A;  4F1I A;  1PM5 A;  2Z8Y M;  2DHY A;  2WSF F;  3GPP A;  1FJG M;  3I51 A;  3H4J A;  2O5R A;  3L27 A;  4M9S A;  4DUZ M;  4I5S A;  2R4J A;  3E21 A;  4DR7 M;  4HLQ A;  1WHC A;  2D7G A;  3U6C A;  1MX0 A;  2BJV A;  4B7G A;  4M0D A;  4DV0 M;  1DGF A;  4ZPX A;  3GLG B;  3SAT A;  2FOI C;  2Y21 A;  4IBD A;  3WHK A;  3U5Z A;  1MU5 A;  2CEA A;  1S3S A;  2Z4R A;  5IZ7 D;  4AW4 A;  4IJF A;  3NWL A;  4JI8 M;  2D7H A;  3HKP A;  4G4R A;  3VK8 A;  2UUB M;  4G4Q A;  2W82 A;  1N78 A;  4IBG A;  4JI0 M;  4JI4 M;  3QYE A;  4LJ7 A;  4LG2 A;  3VKG A;  1R6B X;  3DOA A;  3FTC A;  4LJA A;  4D81 A;  3GO8 A;  3SAS A;  2MJ5 B;  2E5L M;  2ZAO A;  2KEB A;  4JI2 M;  3T1H M;  1R2Z A;  4MB7 A;  2Z7J A;  4LCB A;  2RGH A;  5EJC A;  4FCW A;  1QAQ A;  2DVW B;  3KDS E;  3VKH A;  4DR5 M;  3AKZ A;  3AV0 A;  2FS1 A;  4JI1 M;  2KDL A;  1VDD A;  5C18 A;  2VQF M;  2CP8 A;  4JI5 M;  3U6M A;  4G4N A;  1TTE A;  3KFU G;  1VEK A;  2LXE A;  4DBG B;  1L1Z A;  4R3D A;  4R71 A;  4MGZ E;  3GP1 A;  2LTU A;  1V34 A;  5EP1 A;  2OOA A;  1PGY A;  3TL4 X;  2LNH C;  3LVV A;  4XGI A;  4AG5 A;  3GLF B;  2JXN A;  4QHT A;  5LMU M;  1I94 M;  2A5Y B;  4I81 A;  3K9P A;  4Q7J A;  3SMS A;  1Q39 A;  3PNY A;  3LMM A;  3MMP A;  4LGM A;  1JR3 D;  3MHV C;  4DR1 M;  4L78 A;  4PCZ A;  1VG5 A;  3LQR A;  2ZAN A;  3K1J A;  4GC5 A;  4LFB M;  3ZC7 B;  4JN6 A;  3SBJ A;  4LFC M;  3C58 A;  1YUB A;  2DAM A;  1JR3 A;  3EIE A;  1HNX M;  2DXI A;  4FW9 A;  3FUT A;  2F5S A;  1G41 A;  1XXH E;  2XF3 A;  4RF1 A;  4Y28 F;  3BOS A;  3K2L A;  4IBB A;  1NNJ A;  4ITQ A;  2OOB A;  5ITX A;  1XNQ M;  1C1K A;  4D80 A;  3H4M A;  2JA2 A;  2HHH M;  4B3M M;  1NVM A;  4II7 A;  3GPY A;  3K8Z A;  3KOW E;  2LVA A;  3GRU A;  1FNN A;  1WGN A;  3TWK A;  5FTN A;  1L2C A;  3UZU A;  3GQ5 A;  3LCU A;  3MK6 A;  1J09 A;  3LVW A;  3GQ4 A;  3RGP A;  2X4A A;  4DV6 M;  2I7P A;  2V1U A;  3T6P A;  4CIS A;  3VFD A;  3E4R A;  2C96 A;  4X64 M;  4OW0 A;  3HHZ A;  1SG9 A;  3SMP A;  3U6Q A;  3KS8 A;  3IHP A;  1WGL A;  5DNY A;  4M0W A;  1HNZ M;  2F5O A;  2EUC A;  3KOY E;  5EXS A;  2C9O A;  1W5T A;  2YFQ A;  5FLX S;  1PJQ A;  4DR3 M;  4Z8X A;  1P3Q Q;  5A2Q S;  1HNW M;  3SC3 A;  2APL A;  1QQW A;  3NBX X;  3U61 B;  4AQY M;  3B9P A;  4WW0 A;  3GLI A;  3SAU A;  1IN5 A;  4L4U A;  3TWL A;  4LF8 M;  3F92 A;  3CF0 A;  1Q02 A;  4MGK E;  3THG A;  3QWL A;  3HWS A;  2H5X A;  1N75 A;  4MGI E;  2UUA M;  1Y8G A;  2ZBK B;  1Q3B A;  1IN7 A;  1XXH A;  1NSF A;  2L4F A;  3HGI A;  1OJL A;  4L6V 6;  1QUS A;  4LJ5 A;  2HCB A;  3OTO M;  1V92 A;  4GKJ M;  1ZAE A;  5JI2 E;  4DV1 M;  5IWA M;  2KNV A;  3RGS A;  2J7O A;  1TR8 A;  3KSX A;  5ITR A;  3U60 A;  1D0L A;  4NXM M;  5EP4 A;  3ZH9 B;  3HU1 A;  1DGH A;  4OX9 M;  2ZTC A;  1R5L A;  5EP3 A;  2L7H A;  1NV9 A;  4KT0 F;  2DWM A;  2HWJ A;  3FKE A;  2BJW A;  3SYL A;  2F5Q A;  2CHV A;  1SXJ B;  1VDL A;  3SAV A;  4X62 M;  2K9D A;  2QBY A;  1QZM A;  4CHT B;  1E94 E;  4I4L A;  3SAW A;  1R7R A;  3U6S A;  1IM2 A;  1RU3 A;  3HZJ A;  1L1T A;  4GH9 A;  2DWL A;  1HJP A;  1NY5 A;  3U6E A;  3JR5 A;  3FE3 A;  1UFZ A;  5LMN M;  1BVS A;  4IBK A;  1X37 A;  2QHO B;  1OIP A;  2GNO A;  2XLJ A;  1IBM M;  1PRB A;  4K0K M;  3M0E A;  2LWX A;  3HX3 A;  4IIW A;  3IG8 A;  4R7G A;  4YY3 M;  4AI6 A;  4HEO A;  2KXE A;  3FUU A;  2D7E A;  3GPX A;  2MR9 A;  2WZJ A;  5KPR A;  2VQE M;  1T3T A;  2XZF A;  1NO1 A;  3GLI E;  4LF4 M;  1DO0 A;  2LHC A;  1PJI A;  1K82 A;  1WXQ A;  3BBZ A;  5KQ8 A;  2QCU A;  1L2D A;  1N32 M;  1E9R A;  2MRO B;  4LZZ A;  1LTM A;  5KPT A;  5ITU A;  3VLF B;  2LHG A;  1XMQ M;  1N34 M;  2DKL A; 
#chains in the Genus database with same CATH homology
 2HL7 A;  2J7N A;  3UMM A;  1XHB A;  4MM3 B;  4Z6Y A;  1KYI A;  1OFI A;  3A42 A;  4BLC A;  3T1Y M;  2XGN A;  4W5W A;  3W0L B;  2XFT A;  3PNV A;  5FTJ A;  2CE7 A;  2RKO A;  2UXD M;  1XWI A;  1GLN A;  3HJS A;  4S12 A;  2L09 A;  3WHL A;  4DV7 M;  4I8O A;  2ZAM A;  4B3S M;  4HL4 A;  3EIH A;  4FVM A;  1EE8 A;  3TWM A;  4REZ A;  2V1C A;  1GKI A;  2G5G X;  1E32 A;  3Q8X A;  4NSO B;  4KO8 A;  1R2Y A;  1NJG A;  2Z4S A;  4LJ6 A;  1TDH A;  3A46 A;  2QPA A;  4AW4 A;  1G3I A;  7CAT A;  4GMQ A;  3A45 A;  3TQS A;  4B3T M;  3L26 A;  4FCV A;  4NRV A;  1K3X A;  3J7A S;  3FUV A;  4AKH A;  3TPZ A;  2R46 A;  2R45 A;  3DZD A;  8CAT A;  5BPV A;  1Z5C A;  4A3V B;  1OFH A;  3L29 A;  5KO3 A;  1XMO M;  2NQ8 C;  4PD2 A;  4JI3 M;  3A98 B;  3U60 B;  4MGY E;  5IRE B;  4FCT A;  3J7B A;  4PDG A;  3KXE C;  2UXC M;  2H1R A;  1SXJ C;  4FWH A;  3RE8 A;  1Z5A A;  3U6P A;  3HU3 A;  4B08 A;  3AOE A;  2C98 A;  3JR4 A;  3CF2 A;  4B7F A;  4GHL A;  4IBC A;  2G8L A;  1GL7 A;  3SFZ A;  1XXH B;  2QZ4 A;  2UXB M;  4G6Z A;  1QAO A;  5FTK A;  3GLH B;  2UUC M;  4LF9 M;  2F5N A;  4YHH M;  3AOG A;  1HQY E;  3U61 A;  1IQP A;  3T38 A;  4EIW A;  2R62 A;  4LFA M;  2R4E A;  3GQ3 A;  2Y0T A;  3D8L A;  4L8R C;  3GPU A;  3VDP A;  2K47 A;  3PVS A;  2XEP A;  3FYD A;  1YSY A;  3SHG B;  1K3W A;  4NSR A;  3GLH A;  4AKG A;  3KS4 A;  1QAM A;  5ITT A;  1H6U A;  2CV1 A;  3L2A A;  3HJQ A;  3UJN A;  1G59 A;  3T15 A;  2CHG A;  1W5S A;  2CUZ A;  4DV3 M;  3GRV A;  1HQC A;  1NNU C;  2Y20 A;  2KRK A;  4QOS A;  3FD9 A;  1NHW C;  1SXJ A;  1PJJ A;  2Y0Q A;  3HHY A;  3VK7 A;  1N33 M;  2F4V M;  2FFJ A;  3PFI A;  1G8P A;  2OPF A;  2F5P A;  1QAN A;  1SXJ D;  3U6L A;  4KOD A;  1DGH B;  3SAR A;  1IXR C;  1XNR M;  3AL0 C;  1NJF A;  4M9X A;  4JXJ A;  1Z59 A;  4BBA A;  1UM8 A;  4LJ9 A;  5KPZ A;  1N36 M;  3KVW A;  2QBY B;  5BR8 M;  2M60 A;  4WUR A;  4MH0 E;  2Z3X A;  4JI7 M;  4GKK M;  3DA1 A;  5E6J A;  1G4A E;  4JYA M;  5ITY A;  4BB9 A;  2XSZ D;  1L8Q A;  4IBJ A;  4IJE A;  4LF6 M;  1SXJ E;  3TE6 A;  2C99 A;  2FNA A;  2UU9 M;  2CHQ A;  3SYK A;  3HHX A;  2XSZ A;  5KQD A;  1IBL M;  3LQQ A;  2DWN A;  1GVN A;  2XFS A;  2HKJ A;  1QYR A;  2KZU A;  2X49 A;  3NBI A;  2XH9 A;  3MJ5 A;  3R8F A;  3FUX A;  4NXN M;  4LZJ A;  4QNR A;  4XBO A;  3E9S A;  3L28 A;  4RNA A;  1HR0 M;  2KA6 B;  3I4V A;  4B7H A;  3GLI B;  4DV4 M;  2Q2E B;  2QP9 X;  4LY6 A;  4QHS A;  2QEN A;  1Z6T A;  4GHA A;  4X66 M;  3L25 A;  2AHM A;  2DZO B;  2CV0 A;  3DFZ A;  2KRU A;  2LH0 A;  4DUY M;  4DR4 M;  1E9S A;  4M9Z A;  3IG5 A;  3VDU A;  3M7G A;  2FE8 A;  3ILK A;  3KOX E;  1D2N A;  5ITQ A;  5DYI A;  4JV5 M;  4GIT A;  4GIP A;  1IY2 A;  1L2B A;  1I4W A;  1IN4 A;  4IBI A;  1ZQ9 A;  5FSW A;  4PT5 A;  2OQ4 A;  1DGB A;  4LGY A;  2R18 A;  1TDZ A;  4LRS A;  1IBK M;  2X8A A;  4CGY B;  4TUW A;  5GKN A;  3KP0 E;  4OVZ B;  4FWD A;  1Q3C A;  4RF0 A;  1Z5B A;  5FTM A;  3GLF A;  3M6A A;  2DHR A;  4DV2 M;  2CFO A;  4AKI A;  1IXS B;  2BNK A;  1DO2 A;  2ERC A;  5EP2 A;  3UK6 A;  4IBE A;  4DR6 M;  4KLN A;  2XZU A;  3KW6 A;  1J7K A;  4AG6 A;  5F3W A;  3J2P B;  4FD2 A;  5EXP A;  4D82 A;  1QVR A;  1ORY B;  3FTE A;  3GRR A;  4MGH A;  3QAU A;  4QOZ C;  2P5T A;  5E26 A;  5FTL A;  4LJ4 A;  1KFV A;  3UGJ A;  4KHP M;  3FTD A;  1HT2 E;  1KSF X;  4GRI A;  3AFH A;  2L6O A;  3AJI B;  1IY0 A;  1IN6 A;  3J80 S;  3I4Y A;  2EA0 A;  3AOE C;  4LRT A;  3KP1 E;  3U6D A;  3KSJ A;  2R65 A;  1NY6 A;  2C5R A;  4LF5 M;  5EXX A;  2VII A;  2DWZ B;  4PDI A;  1TH3 A;  3FYC A;  3GLG A;  4B3R M;  2YNM D;  1TH4 A;  4L16 A;  4GC9 A;  1TGU A;  1HT1 E;  4LF7 M;  4LJ8 A;  1N77 A;  4DV5 M;  2YQZ A;  3FUW A;  5ITX E;  5IT9 S;  3HU2 A;  5C1B A;  2RGO A;  2V6Z M;  3KOZ E;  2L7I A;  3U5Z B;  2I7N A;  3HHW A;  3CF6 E;  4NL4 H;  3JAM S;  2C9C A;  3HJ8 A;  1JQJ C;  3J81 S;  3R9X B;  4DR2 M;  1LV7 A;  4NRW A;  3K92 A;  3ZCB B;  5H37 D;  1J5E M;  2EO2 A;  1DGG A;  2DZN B;  3CTW B;  3J27 B;  2ZM6 M;  4FWG A;  4QNM A;  3U6O A;  4IBF A;  1GL6 A;  4L15 A;  2M5Z A;  3GRY A;  4NOO B;  1TH2 A;  2KZS A;  1XC8 A;  4JI6 M;  4OVZ A;  4P16 A;  4OU7 A;  5JI3 E;  1NHG C;  5DYG A;  2CV2 A;  1IY1 A;  5EQT A;  3SHF A;  3W0F A;  4AZF A;  4X65 M;  2KW0 A;  1IN8 A;  3D8B A;  3PXG A;  1YE9 A;  3RFW A;  1IXZ A;  2YR0 A;  5EXT A;  4G4O A;  3FTF A;  1PM5 A;  3GPP A;  1FJG M;  3I51 A;  3L27 A;  2O5R A;  4M9S A;  4DUZ M;  4I5S A;  2R4J A;  4DR7 M;  4HLQ A;  3U6C A;  2D7G A;  1MX0 A;  2BJV A;  4B7G A;  4M0D A;  4DV0 M;  1DGF A;  4ZPX A;  3GLG B;  3SAT A;  2FOI C;  2Y21 A;  4IBD A;  3WHK A;  3U5Z A;  1MU5 A;  2CEA A;  1S3S A;  2Z4R A;  5IZ7 D;  4IJF A;  3NWL A;  4JI8 M;  2D7H A;  3HKP A;  4G4R A;  3VK8 A;  2UUB M;  4G4Q A;  2W82 A;  1N78 A;  4IBG A;  4JI0 M;  4JI4 M;  4LJ7 A;  4LG2 A;  3VKG A;  1R6B X;  3DOA A;  3FTC A;  4LJA A;  4D81 A;  3GO8 A;  3SAS A;  4JI2 M;  2E5L M;  2ZAO A;  2KEB A;  3T1H M;  1R2Z A;  4MB7 A;  2Z7J A;  4LCB A;  2RGH A;  5EJC A;  4FCW A;  1QAQ A;  2DVW B;  3KDS E;  3VKH A;  4DR5 M;  3AKZ A;  3AV0 A;  4JI1 M;  1VDD A;  5C18 A;  2VQF M;  3KFU G;  4JI5 M;  3U6M A;  4G4N A;  2LXE A;  1L1Z A;  4R3D A;  4MGZ E;  3GP1 A;  5EP1 A;  3TL4 X;  2LNH C;  3LVV A;  4XGI A;  4AG5 A;  3GLF B;  4QHT A;  5LMU M;  1I94 M;  2A5Y B;  4I81 A;  3SMS A;  1Q39 A;  3PNY A;  3LMM A;  4LGM A;  1JR3 D;  3MHV C;  4DR1 M;  4L78 A;  4PCZ A;  3LQR A;  2ZAN A;  3K1J A;  4GC5 A;  4LFB M;  3ZC7 B;  4JN6 A;  3SBJ A;  4LFC M;  3C58 A;  1YUB A;  1JR3 A;  3EIE A;  1HNX M;  2DXI A;  4FW9 A;  3FUT A;  2F5S A;  1G41 A;  2XF3 A;  4RF1 A;  3BOS A;  3K2L A;  4IBB A;  1NNJ A;  4ITQ A;  5ITX A;  1XNQ M;  1C1K A;  4D80 A;  3H4M A;  2JA2 A;  2HHH M;  4B3M M;  1NVM A;  4II7 A;  3GPY A;  3K8Z A;  3KOW E;  3GRU A;  1FNN A;  1L2C A;  3TWK A;  5FTN A;  3UZU A;  3GQ5 A;  3MK6 A;  1J09 A;  3LVW A;  3GQ4 A;  3RGP A;  2X4A A;  4DV6 M;  2I7P A;  2V1U A;  4CIS A;  3VFD A;  3E4R A;  2C96 A;  4X64 M;  4OW0 A;  3HHZ A;  3U6Q A;  3SMP A;  3KS8 A;  5DNY A;  4M0W A;  1HNZ M;  2F5O A;  2EUC A;  3KOY E;  5EXS A;  2C9O A;  1W5T A;  2YFQ A;  5FLX S;  4DR3 M;  4Z8X A;  5A2Q S;  1HNW M;  3SC3 A;  1QQW A;  3U61 B;  4AQY M;  3B9P A;  4WW0 A;  3GLI A;  3SAU A;  1IN5 A;  4L4U A;  3TWL A;  4LF8 M;  3CF0 A;  4MGK E;  3THG A;  3QWL A;  3HWS A;  1N75 A;  4MGI E;  2UUA M;  2ZBK B;  1Q3B A;  1IN7 A;  1XXH A;  1NSF A;  3HGI A;  1OJL A;  4LJ5 A;  2HCB A;  3OTO M;  4GKJ M;  1ZAE A;  5JI2 E;  4DV1 M;  5IWA M;  3RGS A;  2J7O A;  3KSX A;  5ITR A;  3U60 A;  4NXM M;  5EP4 A;  3ZH9 B;  3HU1 A;  1DGH A;  4OX9 M;  5EP3 A;  2L7H A;  2DWM A;  3FKE A;  2BJW A;  3SYL A;  2F5Q A;  2CHV A;  1SXJ B;  3SAV A;  4X62 M;  2QBY A;  1QZM A;  4CHT B;  1E94 E;  4I4L A;  3SAW A;  1R7R A;  3U6S A;  1IM2 A;  1L1T A;  4GH9 A;  2DWL A;  1NY5 A;  3U6E A;  3JR5 A;  5LMN M;  4IBK A;  1X37 A;  2XLJ A;  1IBM M;  4K0K M;  3M0E A;  2LWX A;  4IIW A;  4R7G A;  3IG8 A;  4YY3 M;  4AI6 A;  2KXE A;  3FUU A;  2D7E A;  3GPX A;  5KPR A;  2VQE M;  1T3T A;  2XZF A;  4LF4 M;  1DO0 A;  1K82 A;  1PJI A;  1L2D A;  1WXQ A;  5KQ8 A;  1N32 M;  2QCU A;  1E9R A;  4LZZ A;  5KPT A;  5ITU A;  3VLF B;  1XMQ M;  1N34 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...