3TWWA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human lnpep (chimeric peptide)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
b'GNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 51
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twwA00
1A5EA 2ETBA 4U95D 4HRLA 3KEAA 1N0QA 3V31A 5FINA 2RFMA 3TWRA 2J8SD 1MX4A 4LSZE 4DX5D 1AP7A 3DEPA 5AN8A 3JXIA 2F8YA 4BETA 1K3ZD 5HRYA 2ZGGA 1BLXB 4QFVA 2BKGA 4DX7D 2F8XK 4BEPA 1YMPA 5AQ7A 2XEHA 4DRXE 3V79K 1WDYA 4HRMB 4HNAD 1IHBA 4N5QA 4BESA 2PNNA 2HE0A 3AAAC 3UXGA 5FIOA 2V5QC 3SO8A 4YDYA 4A63B 1BU9A 3NOGD 2QC9A 1BD8A 4HI9A 4U8YD 4O1PA 5ENQD 2XZDG 2DVWA 3Q9NC 3HG0D 4HLLA 3JXJA 1BI7B 4C48B 4UUCA 3HRAA 2XENA 1K1AA 3EU9A 4RLYA 3ZUVB 5ENSD 5ITZF 2ETCA 4TUMA 4K5AB 1S70B 3J5QB 5AQAA 2ETAA 5EILA 5CECB 5AQBA 4HBDA 3TWXA 4G8KA 4NIKA 4F1PA 4J7WA 5KBAA 2DZOA 3JUEA 2XEEA 1MX6A 3B95A 3D9HA 2RFAA 4CZ2D 4F6RD 4Z68A 5CERB 5EIBE 4HB5A 3B7BA 2QYJA 4QQIA 4DX6D 1WG0A 5EIDA 1IXVA 3T9KA 5CEAA 3EHQA 3C5RA 1N0RA 1MYOA 4LNUD 5KNHD 5CEDB 2P2CP 3V2OA 3TWSA 4LG6A 3TWUA 4B93B 4BERA 4HQDA 2JABA 4ZFHA 3NBNB 2DWZA 5KNGA 5EYLA 1BI8B 4ATZD 2BKKB 4O1OA 2ZGDA 4O60A 5AAOA 1IKND 1MX2A 1UOHA 4K5BA 5ENRD 3AJIA 3LJNA 4U8VD 1DC2A 4DX1A 5JA4D 1NFIE 5AARA 1G3NB 5EN5D 5JMND 4BSZB 4ZHBA 3DEOA 2V4HC 3TWWA 3TWQA 4JB8P 5ENPD 3EHRA 3TWTA 5CBOA 3ZKJA 2AJAA 2B0OE 5EYPF 2KXPC 1YYHA 4J8YA 4GMRA 1MJ0A 1QYMA 4OAVB 2DZNA 5KWDA 2F37A 4CYMD 4HI8A 3ZNGA 4DUIA 4K5CA 3ZU7B 2VGEA 4HRNA 3W9GA 3UI2A 3V30A 5BXOA 5AQ9A 2XZTG 1AWCB 4OAUC 1SW6A 4GPMA 5HKPA 1OY3D 4U96D 1TR4A 5CBNA 2L6BA 5HS0A 3IXEA 3TWVA 3W9FA 2NYJA 3Q9UC 5BXUA 1N11A 1K1BA 3NOCD 4DX2A 1D9SA 4G8LA 3F6QA 2Y0BG 2MYOA 5D66A 5ENOD 3V2XA 2Y1LE 2FO1E 1YCSB 1SVXA 3UTMA 4YDWA 3T8KA 1DCQA 2KBXA 5ENTD 2A5EA 3J5PA 1OT8A
chains in the Genus database with same CATH superfamily
4GTTA 3U4TA 5BV0A 4G1TA 3SFXA 4GPKA 3PZ4A 3CK9A 3L9TA 1IHBA 3OAWA 4K03A 2R5SA 1Y8MA 4L9PA 1GW6A 5ENQD 2XZDG 2LXMA 1U2VG 1TJFA 2XS1A 3D9JA 5CMYA 2L9BA 4AY5A 4NURA 2DZOA 1HE8A 3B95A 3UM3A 3SBTB 5EX3A 3MV3B 1WG0A 3T9KA 4EPZA 2EINE 2R03A 2HYZA 2WMNA 2EQXA 1Z3YA 3ZYKA 4LUNU 2P9IG 1IKND 4BSZB 5CCMA 3CHOA 3TWWA 4XKBA 5ENPD 3S7JA 4UI9C 1E8ZA 4MKTA 4N39A 2VGEA 4BFRA 1UN9A 3Q73A 4EZKA 3FY4A 3SZ7A 1OY3D 1H6OA 2L6BA 3MCXA 3LYAA 3LXUX 1N11A 2NXPA 3DPYA 3CLJA 2Y0BG 2FO1E 3EJNA 4M7CA 3DSWA 3KEAA 3TG5A 4FA6A 3IV0A 1Z5SC 4NQ0A 4BTAA 2YQ8A 3SY2A 1BLXB 3S7FA 3AG2E 4Y6WA 5B1BE 3U64A 1K8KG 3ZXPA 4C9BB 4BX8A 2X6FA 4FJYA 3AU4A 1XNFA 4WNDA 3RRNB 2ETCA 4HVBA 2I6HA 4GU5A 3NZUA 5CECB 2KM4A 3JCKC 3FUIA 4DX6D 3VLFA 2LXLA 5ENNA 3ZEFA 2AVPA 2NSZA 1IQRA 2EILE 1HG5A 4ATZD 3EU5A 1VDYA 3FTXA 4AP2A 1U3DA 1IYGA 3AG3E 3RIBA 4JL0A 2GRNB 1JUQA 5EYPF 3RAUA 2Q7FA 4ANUA 4M3OA 2F37A 4DUIA 2BEDA 4K5CA 4J8FA 5BXOA 4CDMA 4EQFA 4HOQA 4J6IA 2X6KA 2QZAA 4K0RA 4MS6A 3CHRA 5FZRA 2E0IA 3Q9UC 5BXUA 4G23A 3KSLA 5FQ7A 4ILHB 3FULA 3TGOA 4N2QA 4W9RA 3MJWA 2WXNA 3CVQA 3IEGA 3EHMA 2XRYA 2WXKA 4GCNA 3CQGB 3BG1B 2IF4A 4BESA 5BW8C 5FIOA 1FVHA 3D9NA 1S63A 4BT8A 2WQ6A 4Q94A 2JEKA 3DRAA 4TUMA 1N4RA 3Q49B 2PM7A 4EHMA 3Q15A 4HBDA 2P9LG 4I6EA 3SFYA 3D9HA 3CKCA 2AWIA 2IOLA 1DNPA 1UG3A 4L7TA 4CRWA 3FEYA 2DWZA 5KNGA 4ANVA 5LP0A 2WQHA 3UKRG 1MX2A 5T8IA 1H6KA 3PUKA 1Q2ZA 2R2LA 3FUKA 3ZPJA 3MV2B 4HORA 2B0OE 1RW2A 3R9AB 3SQVA 5EDSA 3S2AA 4NACA 5AJDA 4OAUC 5HKPA 5LOZA 1UJKA 1W3BA 1ZU2A 5D0QD 5D66A 4GTOA 3PZ3A 4GZCA 4I17A 3B7RL 3FTVA 1N0QA 2I1JA 3IKOB 2MHKA 5FJYA 1OUVA 4XIFA 4WUYA 5HRYA 5AIJA 3CV0A 4DRXE 4U04A 4HNAD 4AY6A 2HE0A 2OEWA 3NOGD 3VLEA 3KSQA 2J09A 1TN6A 2ZXWE 3ASDA 4XEIG 5FQ4A 3SD5A 5DBKA 5ITZF 4G2VA 3SI5A 3DSTA 3TL5A 5KBAA 5HQ8A 3FU0A 1O1TA 3PH0C 3JYSA 4LNUD 3GYZA 3OXGA 1DCEA 3Q78A 4I43A 2C0MA 5CHEE 2XEVA 3PREA 5EKQD 1H0AA 3AS4A 4GMLA 2HO1A 3UKUG 1FCHA 2AXVA 5BNWA 4OAVB 4GYOA 3R9MA 4HI8A 3LS8A 4EBAA 4HRNA 5C1DA 2XZTG 3HIZA 3ZRHA 3C72A 3CVXA 2CHZA 1KZPA 3E30A 4DX2A 1OCRE 3GZSA 2J4DA 4LSZE 3PZDA 5KJKA 3DEPA 3ZGQA 2WB2A 5AENA 4UWKA 5KCMA 3ASNE 3R7QA 3EDTB 4YDYA 1N94A 4LNBA 2QC9A 4ACKA 2YNQA 4XZ4A 1QZ2A 3QC1A 1S70B 2H6GA 4BTBA 5D0OD 4G8KA 5CRUA 3QOUA 4X8QA 4UQZA 1ZB1A 4TXQA 3EHQA 3TWUA 4L1BA 3UUXA 3CHQA 3APDA 3QJZA 5EYLA 3FWVA 3FH7A 4JEUA 4BSXA 4LRZA 4LERA 1UOHA 2IONA 1ZBPA 4G24A 3BG0B 3KS2A 4J8SA 3UPVA 2E2EA 3FUHA 3EHRA 3ZYLA 4ACLA 5AJLA 4J8YA 2PQNA 4BY6A 2DZNA 3B7TA 1MQSA 1KZOA 4JC8A 4GTVA 3NF1A 2WXFA 2WMOA 3RK6A 4GTMA 5ENTD 3U66A 1A17A 4GMJA 4WNEA 2XQ0A 3X2QE 1TNZA 4HLEA 4RSYA 5KJLA 1H6PA 2L0TB 3UXGA 1BU9A 3MA5A 3S7DA 4HXIA 1E96B 4HI9A 3DSUA 3LPZA 3Q47B 4FHKA 4C48B 4N3CA 2XENA 3Q75A 4KZCA 3T5XA 4LCTA 5J08A 3LVRE 1HXIA 3JQ0A 4CCAA 5CERB 3NB2A 4HB5A 3ABME 3CSFA 2P9SG 4LNGA 5KNHD 4FP7A 5IY5E 3Q7FA 4LG6A 3GZ1A 4FLBA 4A3VA 2LO6A 2WXHA 4G11A 2BTDA 1UN8A 3LJNA 4A55A 2Y69E 3RJVA 4WWOA 4U0ZA 1JWGA 4FU3A 1TNYA 5H7PA 5G2NA 1NI1A 3TG4A 3AG4E 3NQPA 3ZU7B 3FFLA 1SW6A 2VSNA 3UQ3A 3ABLE 5B1AE 4XE0A 4GB9A 4PS7A 4GZ3A 3PVLA 3QWVA 2P58C 2RG8A 3PUJA 2KBXA 2ZIRA 2L6JA 1HS6A 2VYIA 2J4BA 3ML9A 1K3ZD 4E6HA 1H2VC 5AQ7A 4PUCA 4IN3B 2GGFA 2WXLA 4F53A 4GCOA 1ELWA 1D8DA 3MYVA 1KT1A 1SA5A 1D8EA 3G2VA 3ZN3A 3HXFA 1SZAA 4DLOA 2M63A 3UT4A 3JUEA 3TXNA 2RFAA 4Z68A 2R59A 3SHFA 3L08A 4G26A 3UT8A 2P2CP 4BERA 4IYPA 1TN7A 4KVMA 1IQUA 3PDNA 4PS3A 3QWPA 5KJMA 1FPPA 4ANXA 1NA3A 2AXUA 3DEOA 4A1SA 1O1SA 3E4BA 3D9KA 1H2TC 2KCLA 4B8CB 2I1KA 2H6FA 2IJGX 2IY0C 3MEKA 5D2MC 5CBNA 5FWQA 1E8YA 3RRMB 2DYSE 1PAQA 3L82A 2UWJG 3BQOA 2YHCA 4PH4B 2IEJA 4R7LA 3SFZA 4AOFA 2J49A 4HRLA 4NRHB 4I1MA 4ANWA 3C3OA 3D9MA 4F1SA 5AN8A 2OCCE 1H19A 4URKA 3CK8A 2WXQA 2XPZA 3HXBA 3APCA 3V79K 4E85A 4GZ6A 4KXKB 3MKRA 3FUDA 5FZQA 4AV7A 3AAAC 2XHEA 2MOWA 3KD7A 4O1PA 4DLQA 3JXJA 4UUCA 1K1AA 5ENSD 3E33A 1P5QA 4AVXA 4KZ0A 4WNFA 5AQAA 3I4GA 2LAHA 5CEAA 1N0RA 3TWSA 4JZYA 3IBEA 4L23A 2P9PG 3HXEA 4IULA 4RQIA 3APFA 1BI8B 1RZ4A 4O1OA 1JWFA 2RKKA 3L54A 3LJ3A 5A6CA 4DX1A 3ONLA 1HFAA 1V55E 4CT4A 1YYHA 1QYMA 1NP7A 5JHAA 2GRRB 2GRMA 1E8XA 2VSXE 1OWNA 1TNBA 3IXEA 3NAWA 1D9SA 2IU1A 5ARFA 3DBSA 1HO8A 2GROB 2VSYA 4HFGA 4GYWA 3RO2A 3UX4A 3CSTA 1NZNA 3VTYA 2ETBA 4UI9J 1MX4A 2DIWA 4U0SA 5JHBA 1O5MA 2BKGA 2KATA 5G05C 4GAAA 4N5QA 3LVQE 3E34A 5B3SE 2KCKA 2DVWA 3LKUA 4IRUA 3WG7E 3RKVA 2H6HA 3CVNA 4K5AB 4KYOB 5ANRA 3IHYA 3DXMG 2Y4TA 2PL2A 2X6JA 3UM1A 3ML8A 2JABA 3I5PA 5FTPA 3TJPA 1FT2A 2ZGDA 2UY1A 2YINA 1G3NB 5EN5D 3G2WA 4N3AA 1LF8A 3OXFA 3OXLA 2X38A 2OV8A 1NL4A 3ZW3A 3UMVA 5BPPA 4XI0A 3W9FA 3ZXSA 4B8AA 1K1BA 4I6JA 1HF8A 3ASGA 2LNIA 4TRQA 3TAXA 1OXJA 2A5EA 3J5PA 2GRPB 2UY1B 4V3IA 3HXCA 2XPIA 4JVSA 3IHVA 2YHEA 1LD8A 4DX5D 2FO7A 5T3RA 5G04C 3FU6A 3PNTB 1OWMA 2VJ8A 4QFVA 4BEPA 3DSSA 2ONDA 3ONKA 2R17C 2PQRA 2WXMA 1E7UA 2WXPA 5EX0A 4H7YA 3ULQA 3L22A 3PEVB 3CR3A 4JHKA 4OVVA 4TUUA 3FEXA 3CVUA 2WVIA 2IOSA 4N2SA 4JD2G 1LTXA 1JCQA 1QBQA 4P29A 4AIFA 4U7EB 5BV1A 3N71A 5LFAA 3FHEA 2XCBA 4PDXA 4RVBA 2P9NG 3HYMB 4BX9A 1SQMA 2OEVA 1SZ9A 2VQ2A 2BKKB 3PNLB 4A3TA 4FJZA 3L17A 1E8WA 1DC2A 2IO3C 4ME2A 3UT7A 1TJCA 3VLDA 2VGXA 4U0UA 5FZSA 4CDRA 3AU5A 4GTPA 5AYWD 2I2OA 2PM6A 3GW4A 3NZSA 4J0UA 3ESLA 3D9PA 4UQXA 5T4YA 4CT0A 4DI4A 3C3QA 2CHXA 3UTMA 1DCQA 4U8HA 4DI3A 4Q96A 4U07A 3HXDA 5FT9A 2ILRA 3P2BA 4U95D 3CK7A 4D10C 3E32A 4BETA 2XPYA 2ZGGA 1TNUA 2VGXB 3LY8A 4OVUA 2XEHA 4AEZC 1UJJA 3FUEA 2PNNA 3AS8A 3QK0A 3Q9NC 3HG0D 3ZIMA 3TXMA 1BI7B 3FH5A 3HRAA 3EU9A 2KC7A 4I1OB 2H6IA 4B94A 4EBAG 3D9OA 5AQBA 4I1AA 1KT0A 3U9WA 4WWPA 4DK5A 4F6RD 2KCVA 2HM8A 3C5RA 1MYOA 3V2OA 2WPVA 4ATGA 3LDZA 4GTRA 2BUGA 4XKCA 4ILGA 4K5BA 3PEUB 3E37A 4U8VD 5AARA 3CHSA 2LUHA 2RD0A 1YA0A 2XGOA 3U3WA 1S64A 3TWQA 5JJTA 4JPSA 2WXIA 3G2SA 4MRUA 4GMRA 4JXTA 3KEZA 3DSVA 2WM9A 4XI9A 4APFA 3FP3A 2IFUA 2GRQB 1N9AA 4RG6A 4GPMA 1NA0A 4U96D 1N4PA 2X3MA 1FVFA 2NYJA 2LSVA 3QDNA 3F6QA 3V2XA 3PRZA 3MGBA 2X6HA 4FULA 4TV3A 4WNGA 3FUNA 3KAEA 3B13A 2QY7A 3FU3A 3JXIA 2GRLA 4HOSA 1OWOA 1IHGA 5G04J 4FC8A 2EIKE 1O1RA 1EDUA 4GZ5A 4KMOA 1WDYA 1LD7A 4UWLA 2VGYA 3ULYA 3FDHA 4HLLA 4JA9A 1TEZA 2PZIA 1X81A 2ZU6B 3EUVA 2HR2A 2ETAA 2VSOE 4BT9A 4C0EA 4DPRA 4F1PA 3EIQC 1HZ4A 1MX6A 3RO3A 4AJWA 1MZCA 2QYJA 5EIDA 3ASHA 2XCCA 4UQYA 5CEDB 4HQDA 3QWWA 4ZFHA 3Q79A 3BEEA 1JPLA 4O60A 4YDOA 4BWRA 2FBNA 3AJIA 4GA0A 4J8DA 5C2YA 3TWTA 3QARA 3RRUA 1Z3XA 5CRVA 2KXPC 4CDNA 2XRZA 3ZNGA 3SF4A 4I2WA 3ZVVA 3B7UX 3CGHA 3QNKA 3FTUA 1N95A 3ESKA 2P9KG 5HS0A 1N54A 2WXGA 4YDWA 1JCSA 4EZJA 1PC2A 3MX3A 3UIPC 2A5UA 3OTNA 5FINA 1H2UA 2QYUA 4JEHA 4CEMA 2J8SD 4DJAA 1OWLA 3UM0A 1AP7A 5LX8A 2J9QA 4FLHA 4FHJA 3ZYMA 3DXKG 4YNDA 3FUJA 3ISMC 4A63B 3AS5A 2XGSA 3I4RB 1BD8A 3FH8A 4U8YD 2WXJA 5LCWC 3ABKE 4RLYA 4O6FA 4JA7A 3ZUVB 4WWNA 3GZ2A 3LY9A 4YVOA 1BPOA 3CVVA 4Q69A 2CG3A 3HHMA 3Q5MA 4CZ2D 3L13A 3UIOC 2EIJE 2VTBA 4OYSA 2XS8A 1QNFA 3Q4AB 1TYQG 2JLBA 4YVQC 2C0LA 1E90A 4L2YA 3R7RA 3O4ZA 2AXZA 3LCAA 3ZKJA 1ELRA 1MJ0A 5KJNA 3DPDA 3L16A 1Y6IA 3V30A 3URZA 5J90A 1Z6TA 1N4SA 3PZ2A 3LEWA 2CFUA 3FTZA 4J8EA 3Q7AA 2CFZA 1JCRA 3TWVA 2DCPA 4I6GA 2VTBB 2V0PA 1EYHA 2FF4A 5ENOD 3CHMA 2Y1LE 1YCSB 2Y4UA 4RG9A 3QKYA 1OT8A 4FADA 3MKQA 1UW4B 2NC9A 4LEUA 2AW6A 1TNOA 4U63A 5DIZA 4GA2A 4MLPA 3ULEG 3T8MA 2WQ7A 1S0PA 3BUAA 1HU3A 2QFCA 1KLXA 4GTQA 4WAFA 3QB2A 1YMPA 3G2TA 4GZDA 4B89A 4B0ZA 1WM5A 2XGMA 3ENEA 1PY1A 3EHNA 3PZ1A 3J5QB 2J08A 2R02A 5E76A 1WY6A 4NIKA 3MKQB 1N52A 3VTXA 4GYYA 2P9UG 4F7AA 4HOTA 4UWGA 5BT1A 4EECA 1ELKA 4L2LA 2CHWA 4GTSA 3JUIA 3SGHA 2LSUA 1HG2A 3T5VA 1NFIE 3FTYA 5JMND 4ZHBA 4N5CA 4GA1A 3CHPA 3CVPA 1HH8A 4JB8P 4N3BA 5CCLA 4APOA 4TXPA 3SBSA 3CVWA 2OVBA 3HVEA 4KVOA 3I3NA 5AQ9A 4XX5A 5JJ7A 3CIAA 2CG2A 3SNXA 3NOCD 3FTSA 4JW1A 4ILIA 4UWFA 2V4LA 3O48A 5FQ6A 3TWRA 2V8SE 4PS8A 2F8YA 3S7BA 5HI7A 2I9CA 4DX7D 2F8XK 3C98A 1DVPA 3HVEB 2KZTA 4HRMB 4I9CA 4KBQA 2V5QC 3SO8A 4I2ZA 3K9IA 4F3VA 3L6AA 1QQEA 4JHRA 3FUMA 4YDEA 3ASFA 3CVLA 5LCWJ 2OVFA 4HOUA 2DYRE 3UM2A 4J7WA 2L0IA 2XEEA 3BU8A 1EF1C 3B7BA 4QQIA 4G25A 1EPUA 1OCCE 3D9LA 5FQ8A 5JJ6A 3WXXA 4B93B 2R05A 3NBNB 2B6CA 5ANLA 5A7DB 3PS6A 2KZTB 1L5JA 5AAOA 3ASOE 4Y6CA 3DWLG 5ENRD 2J07A 4JHJA 3G2UA 3P1UA 3JQ1A 2AJAA 2ZISA 2EIME 2WXRA 4C0MA 2FI7A 1KPSB 3W9GA 3RSEG 2IO2C 1U3CA 2A4ZA 1FT1A 1TR4A 2FULA 2GW1A 1E7VA 1TN8A 1SVXA 3D9IA 1INZA 1A5EA 3V31A 3FU5A 2RFMA 4KT6B 3CKBA 3MZLB 3CEQA 2FEZA 4ABNA 3ZHEA 3CVYA 3HDXA 1X5BA 1OCOE 4CGVA 3PE4A 1SA4A 2C2LA 1HX8A 2DBAA 5E75A 5EILA 4I9EA 3TWXA 5BUZA 2Y3AA 4EZLA 4CGWA 3ZFWA 5EIBE 5G55A 5G05J 1IXVA 3FUFA 1XGWA 4UI9K 4AXHA 4HS2A 2MRIA 2F0YA 4H7XA 3LY7A 2BF0X 1WAO1 3ZHEB 5M72A 3UINC 1V54E 3B7SA 4AM9A 1OCZE 5JA4D 3ZYQA 3AG1E 2OOEA 3RU0A 2V4HC 5CBOA 2LAIA 2WXOA 2V5FA 4TXRA 5KWDA 4CYMD 3UI2A 1AWCB 1MHQA 5ARGA 2IQCA 5CMWA 2X6IA 3C3RA 3D3MA 3EIJA 3PE3A 1OWPA 3DSXA 4G8LA 4MBGA 2MYOA 5A23A 1N4QA 1B89A 3CQCB 4UWHA 3T8KA 4A1GA 3FTWA 3QAQA
chains in the Genus database with same CATH topology
1A5EA 2ETBA 4U95D 4HRLA 3KEAA 1N0QA 3V31A 5FINA 2RFMA 3TWRA 2J8SD 1MX4A 4LSZE 4DX5D 1AP7A 3DEPA 5AN8A 3JXIA 2F8YA 4BETA 1K3ZD 5HRYA 2ZGGA 1BLXB 4QFVA 2BKGA 4DX7D 2F8XK 4BEPA 1YMPA 5AQ7A 2XEHA 4DRXE 3V79K 1WDYA 4HRMB 4HNAD 1IHBA 4N5QA 4BESA 2PNNA 2HE0A 3AAAC 3UXGA 5FIOA 2V5QC 3SO8A 4YDYA 4A63B 1BU9A 3NOGD 2QC9A 1BD8A 4HI9A 4U8YD 4O1PA 5ENQD 2XZDG 2DVWA 3Q9NC 3HG0D 4HLLA 3JXJA 1BI7B 4C48B 4UUCA 3HRAA 2XENA 1K1AA 3EU9A 4RLYA 3ZUVB 5ENSD 5ITZF 2ETCA 4TUMA 4K5AB 1S70B 3J5QB 5AQAA 2ETAA 5EILA 5CECB 5AQBA 4HBDA 3TWXA 4G8KA 4NIKA 4F1PA 4J7WA 5KBAA 2DZOA 3JUEA 2XEEA 1MX6A 3B95A 3D9HA 2RFAA 4CZ2D 4F6RD 4Z68A 5CERB 5EIBE 4HB5A 3B7BA 2QYJA 4QQIA 4DX6D 1WG0A 5EIDA 1IXVA 3T9KA 5CEAA 3EHQA 3C5RA 1N0RA 1MYOA 4LNUD 5KNHD 5CEDB 2P2CP 3V2OA 3TWSA 4LG6A 3TWUA 4B93B 4BERA 4HQDA 2JABA 4ZFHA 3NBNB 2DWZA 5KNGA 5EYLA 1BI8B 4ATZD 2BKKB 4O1OA 2ZGDA 4O60A 5AAOA 1IKND 1MX2A 1UOHA 4K5BA 5ENRD 3AJIA 3LJNA 4U8VD 1DC2A 4DX1A 5JA4D 1NFIE 5AARA 1G3NB 5EN5D 5JMND 4BSZB 4ZHBA 3DEOA 2V4HC 3TWWA 3TWQA 4JB8P 5ENPD 3EHRA 3TWTA 5CBOA 3ZKJA 2AJAA 2B0OE 5EYPF 2KXPC 1YYHA 4J8YA 4GMRA 1MJ0A 1QYMA 4OAVB 2DZNA 5KWDA 2F37A 4CYMD 4HI8A 3ZNGA 4DUIA 4K5CA 3ZU7B 2VGEA 4HRNA 3W9GA 3UI2A 3V30A 5BXOA 5AQ9A 2XZTG 1AWCB 4OAUC 1SW6A 4GPMA 5HKPA 1OY3D 4U96D 1TR4A 5CBNA 2L6BA 5HS0A 3IXEA 3TWVA 3W9FA 2NYJA 3Q9UC 5BXUA 1N11A 1K1BA 3NOCD 4DX2A 1D9SA 4G8LA 3F6QA 2Y0BG 2MYOA 5D66A 5ENOD 3V2XA 2Y1LE 2FO1E 1YCSB 1SVXA 3UTMA 4YDWA 3T8KA 1DCQA 2KBXA 5ENTD 2A5EA 3J5PA 1OT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5E A;  2ETB A;  4U95 D;  4HRL A;  3KEA A;  1N0Q A;  3V31 A;  5FIN A;  2RFM A;  3TWR A;  2J8S D;  1MX4 A;  4LSZ E;  4DX5 D;  1AP7 A;  3DEP A;  5AN8 A;  3JXI A;  2F8Y A;  4BET A;  1K3Z D;  5HRY A;  2ZGG A;  1BLX B;  4QFV A;  2BKG A;  4DX7 D;  2F8X K;  4BEP A;  1YMP A;  5AQ7 A;  2XEH A;  4DRX E;  3V79 K;  1WDY A;  4HRM B;  4HNA D;  1IHB A;  4N5Q A;  4BES A;  2PNN A;  2HE0 A;  3AAA C;  3UXG A;  5FIO A;  2V5Q C;  3SO8 A;  4YDY A;  4A63 B;  1BU9 A;  3NOG D;  2QC9 A;  1BD8 A;  4HI9 A;  4U8Y D;  4O1P A;  5ENQ D;  2XZD G;  2DVW A;  3Q9N C;  3HG0 D;  4HLL A;  3JXJ A;  1BI7 B;  4C48 B;  4UUC A;  3HRA A;  2XEN A;  1K1A A;  3EU9 A;  4RLY A;  3ZUV B;  5ENS D;  5ITZ F;  2ETC A;  4TUM A;  4K5A B;  1S70 B;  3J5Q B;  5AQA A;  2ETA A;  5EIL A;  5CEC B;  5AQB A;  4HBD A;  3TWX A;  4G8K A;  4NIK A;  4F1P A;  4J7W A;  5KBA A;  2DZO A;  3JUE A;  2XEE A;  1MX6 A;  3B95 A;  3D9H A;  2RFA A;  4CZ2 D;  4F6R D;  4Z68 A;  5CER B;  5EIB E;  4HB5 A;  3B7B A;  2QYJ A;  4QQI A;  4DX6 D;  1WG0 A;  5EID A;  1IXV A;  3T9K A;  5CEA A;  3EHQ A;  3C5R A;  1N0R A;  1MYO A;  4LNU D;  5KNH D;  5CED B;  2P2C P;  3V2O A;  3TWS A;  4LG6 A;  3TWU A;  4B93 B;  4BER A;  4HQD A;  2JAB A;  4ZFH A;  3NBN B;  2DWZ A;  5KNG A;  5EYL A;  1BI8 B;  4ATZ D;  2BKK B;  4O1O A;  2ZGD A;  4O60 A;  5AAO A;  1IKN D;  1MX2 A;  1UOH A;  4K5B A;  5ENR D;  3AJI A;  3LJN A;  4U8V D;  1DC2 A;  4DX1 A;  5JA4 D;  1NFI E;  5AAR A;  1G3N B;  5EN5 D;  5JMN D;  4BSZ B;  4ZHB A;  3DEO A;  2V4H C;  3TWW A;  3TWQ A;  4JB8 P;  5ENP D;  3EHR A;  3TWT A;  5CBO A;  3ZKJ A;  2AJA A;  2B0O E;  5EYP F;  2KXP C;  1YYH A;  4J8Y A;  4GMR A;  1MJ0 A;  1QYM A;  4OAV B;  2DZN A;  5KWD A;  2F37 A;  4CYM D;  4HI8 A;  3ZNG A;  4DUI A;  4K5C A;  3ZU7 B;  2VGE A;  4HRN A;  3W9G A;  3UI2 A;  3V30 A;  5BXO A;  5AQ9 A;  2XZT G;  1AWC B;  4OAU C;  1SW6 A;  4GPM A;  5HKP A;  1OY3 D;  4U96 D;  1TR4 A;  5CBN A;  2L6B A;  5HS0 A;  3IXE A;  3TWV A;  3W9F A;  2NYJ A;  3Q9U C;  5BXU A;  1N11 A;  1K1B A;  3NOC D;  4DX2 A;  1D9S A;  4G8L A;  3F6Q A;  2Y0B G;  2MYO A;  5D66 A;  5ENO D;  3V2X A;  2Y1L E;  2FO1 E;  1YCS B;  1SVX A;  3UTM A;  4YDW A;  3T8K A;  1DCQ A;  2KBX A;  5ENT D;  2A5E A;  3J5P A;  1OT8 A; 
#chains in the Genus database with same CATH topology
 4GTT A;  3U4T A;  5BV0 A;  4G1T A;  3SFX A;  4GPK A;  3PZ4 A;  3CK9 A;  3L9T A;  1IHB A;  3OAW A;  4K03 A;  2R5S A;  1Y8M A;  4L9P A;  1GW6 A;  5ENQ D;  2XZD G;  2LXM A;  1U2V G;  1TJF A;  2XS1 A;  3D9J A;  5CMY A;  2L9B A;  4AY5 A;  4NUR A;  2DZO A;  1HE8 A;  3B95 A;  3UM3 A;  3SBT B;  5EX3 A;  3MV3 B;  1WG0 A;  3T9K A;  4EPZ A;  2EIN E;  2R03 A;  2HYZ A;  2WMN A;  2EQX A;  1Z3Y A;  3ZYK A;  4LUN U;  2P9I G;  1IKN D;  4BSZ B;  5CCM A;  3CHO A;  3TWW A;  4XKB A;  5ENP D;  3S7J A;  4UI9 C;  1E8Z A;  4MKT A;  4N39 A;  2VGE A;  4BFR A;  1UN9 A;  3Q73 A;  4EZK A;  3FY4 A;  3SZ7 A;  1OY3 D;  1H6O A;  2L6B A;  3MCX A;  3LYA A;  3LXU X;  1N11 A;  2NXP A;  3DPY A;  3CLJ A;  2Y0B G;  2FO1 E;  3EJN A;  4M7C A;  3DSW A;  3KEA A;  3TG5 A;  4FA6 A;  3IV0 A;  1Z5S C;  4NQ0 A;  4BTA A;  2YQ8 A;  3SY2 A;  1BLX B;  3S7F A;  3AG2 E;  4Y6W A;  5B1B E;  3U64 A;  1K8K G;  3ZXP A;  4C9B B;  4BX8 A;  2X6F A;  4FJY A;  3AU4 A;  1XNF A;  4WND A;  3RRN B;  2ETC A;  4HVB A;  2I6H A;  4GU5 A;  3NZU A;  5CEC B;  2KM4 A;  3JCK C;  3FUI A;  4DX6 D;  3VLF A;  2LXL A;  5ENN A;  3ZEF A;  2AVP A;  2NSZ A;  1IQR A;  2EIL E;  1HG5 A;  4ATZ D;  3EU5 A;  1VDY A;  3FTX A;  4AP2 A;  1U3D A;  1IYG A;  3AG3 E;  3RIB A;  4JL0 A;  2GRN B;  1JUQ A;  5EYP F;  3RAU A;  2Q7F A;  4ANU A;  4M3O A;  2F37 A;  4DUI A;  2BED A;  4K5C A;  4J8F A;  5BXO A;  4CDM A;  4EQF A;  4HOQ A;  4J6I A;  2X6K A;  2QZA A;  4K0R A;  4MS6 A;  3CHR A;  5FZR A;  2E0I A;  3Q9U C;  5BXU A;  4G23 A;  3KSL A;  5FQ7 A;  4ILH B;  3FUL A;  3TGO A;  4N2Q A;  4W9R A;  3MJW A;  2WXN A;  3CVQ A;  3IEG A;  3EHM A;  2XRY A;  2WXK A;  4GCN A;  3CQG B;  3BG1 B;  2IF4 A;  4BES A;  5BW8 C;  5FIO A;  1FVH A;  3D9N A;  1S63 A;  4BT8 A;  2WQ6 A;  4Q94 A;  2JEK A;  3DRA A;  4TUM A;  1N4R A;  3Q49 B;  2PM7 A;  4EHM A;  3Q15 A;  4HBD A;  2P9L G;  4I6E A;  3SFY A;  3D9H A;  3CKC A;  2AWI A;  2IOL A;  1DNP A;  1UG3 A;  4L7T A;  4CRW A;  3FEY A;  2DWZ A;  5KNG A;  4ANV A;  5LP0 A;  2WQH A;  3UKR G;  1MX2 A;  5T8I A;  1H6K A;  3PUK A;  1Q2Z A;  2R2L A;  3FUK A;  3ZPJ A;  3MV2 B;  4HOR A;  2B0O E;  1RW2 A;  3R9A B;  3SQV A;  5EDS A;  3S2A A;  4NAC A;  5AJD A;  4OAU C;  5HKP A;  5LOZ A;  1UJK A;  1W3B A;  1ZU2 A;  5D0Q D;  5D66 A;  4GTO A;  3PZ3 A;  4GZC A;  4I17 A;  3B7R L;  3FTV A;  1N0Q A;  2I1J A;  3IKO B;  2MHK A;  5FJY A;  1OUV A;  4XIF A;  4WUY A;  5HRY A;  5AIJ A;  3CV0 A;  4DRX E;  4U04 A;  4HNA D;  4AY6 A;  2HE0 A;  2OEW A;  3NOG D;  3VLE A;  3KSQ A;  2J09 A;  1TN6 A;  2ZXW E;  3ASD A;  4XEI G;  5FQ4 A;  3SD5 A;  5DBK A;  5ITZ F;  4G2V A;  3SI5 A;  3DST A;  3TL5 A;  5KBA A;  5HQ8 A;  3FU0 A;  1O1T A;  3PH0 C;  3JYS A;  4LNU D;  3GYZ A;  3OXG A;  1DCE A;  3Q78 A;  4I43 A;  2C0M A;  5CHE E;  2XEV A;  3PRE A;  5EKQ D;  1H0A A;  3AS4 A;  4GML A;  2HO1 A;  3UKU G;  1FCH A;  2AXV A;  5BNW A;  4OAV B;  4GYO A;  3R9M A;  4HI8 A;  3LS8 A;  4EBA A;  4HRN A;  5C1D A;  2XZT G;  3HIZ A;  3ZRH A;  3C72 A;  3CVX A;  2CHZ A;  1KZP A;  3E30 A;  4DX2 A;  1OCR E;  3GZS A;  2J4D A;  4LSZ E;  3PZD A;  5KJK A;  3DEP A;  3ZGQ A;  2WB2 A;  5AEN A;  4UWK A;  5KCM A;  3ASN E;  3R7Q A;  3EDT B;  4YDY A;  1N94 A;  4LNB A;  2QC9 A;  4ACK A;  2YNQ A;  4XZ4 A;  1QZ2 A;  3QC1 A;  1S70 B;  2H6G A;  4BTB A;  5D0O D;  4G8K A;  5CRU A;  3QOU A;  4X8Q A;  4UQZ A;  1ZB1 A;  4TXQ A;  3EHQ A;  3TWU A;  4L1B A;  3UUX A;  3CHQ A;  3APD A;  3QJZ A;  5EYL A;  3FWV A;  3FH7 A;  4JEU A;  4BSX A;  4LRZ A;  4LER A;  1UOH A;  2ION A;  1ZBP A;  4G24 A;  3BG0 B;  3KS2 A;  4J8S A;  3UPV A;  2E2E A;  3FUH A;  3EHR A;  3ZYL A;  4ACL A;  5AJL A;  4J8Y A;  2PQN A;  4BY6 A;  2DZN A;  3B7T A;  1MQS A;  1KZO A;  4JC8 A;  4GTV A;  3NF1 A;  2WXF A;  2WMO A;  3RK6 A;  4GTM A;  5ENT D;  3U66 A;  1A17 A;  4GMJ A;  4WNE A;  2XQ0 A;  3X2Q E;  1TNZ A;  4HLE A;  4RSY A;  5KJL A;  1H6P A;  2L0T B;  3UXG A;  1BU9 A;  3MA5 A;  3S7D A;  4HXI A;  1E96 B;  4HI9 A;  3DSU A;  3LPZ A;  3Q47 B;  4FHK A;  4C48 B;  4N3C A;  2XEN A;  3Q75 A;  4KZC A;  3T5X A;  4LCT A;  5J08 A;  3LVR E;  1HXI A;  3JQ0 A;  4CCA A;  5CER B;  3NB2 A;  4HB5 A;  3ABM E;  3CSF A;  2P9S G;  4LNG A;  5KNH D;  4FP7 A;  5IY5 E;  3Q7F A;  4LG6 A;  3GZ1 A;  4FLB A;  4A3V A;  2LO6 A;  2WXH A;  4G11 A;  2BTD A;  1UN8 A;  3LJN A;  4A55 A;  2Y69 E;  3RJV A;  4WWO A;  4U0Z A;  1JWG A;  4FU3 A;  1TNY A;  5H7P A;  5G2N A;  1NI1 A;  3TG4 A;  3AG4 E;  3NQP A;  3ZU7 B;  3FFL A;  1SW6 A;  2VSN A;  3UQ3 A;  3ABL E;  5B1A E;  4XE0 A;  4GB9 A;  4PS7 A;  4GZ3 A;  3PVL A;  3QWV A;  2P58 C;  2RG8 A;  3PUJ A;  2KBX A;  2ZIR A;  2L6J A;  1HS6 A;  2VYI A;  2J4B A;  3ML9 A;  1K3Z D;  4E6H A;  1H2V C;  5AQ7 A;  4PUC A;  4IN3 B;  2GGF A;  2WXL A;  4F53 A;  4GCO A;  1ELW A;  1D8D A;  3MYV A;  1KT1 A;  1SA5 A;  1D8E A;  3G2V A;  3ZN3 A;  3HXF A;  1SZA A;  4DLO A;  2M63 A;  3UT4 A;  3JUE A;  3TXN A;  2RFA A;  4Z68 A;  2R59 A;  3SHF A;  3L08 A;  4G26 A;  3UT8 A;  2P2C P;  4BER A;  4IYP A;  1TN7 A;  4KVM A;  1IQU A;  3PDN A;  4PS3 A;  3QWP A;  5KJM A;  1FPP A;  4ANX A;  1NA3 A;  2AXU A;  3DEO A;  4A1S A;  1O1S A;  3E4B A;  3D9K A;  1H2T C;  2KCL A;  4B8C B;  2I1K A;  2H6F A;  2IJG X;  2IY0 C;  3MEK A;  5D2M C;  5CBN A;  5FWQ A;  1E8Y A;  3RRM B;  2DYS E;  1PAQ A;  3L82 A;  2UWJ G;  3BQO A;  2YHC A;  4PH4 B;  2IEJ A;  4R7L A;  3SFZ A;  4AOF A;  2J49 A;  4HRL A;  4NRH B;  4I1M A;  4ANW A;  3C3O A;  3D9M A;  4F1S A;  5AN8 A;  2OCC E;  1H19 A;  4URK A;  3CK8 A;  2WXQ A;  2XPZ A;  3HXB A;  3APC A;  3V79 K;  4E85 A;  4GZ6 A;  4KXK B;  3MKR A;  3FUD A;  5FZQ A;  4AV7 A;  3AAA C;  2XHE A;  2MOW A;  3KD7 A;  4O1P A;  4DLQ A;  3JXJ A;  4UUC A;  1K1A A;  5ENS D;  3E33 A;  1P5Q A;  4AVX A;  4KZ0 A;  4WNF A;  5AQA A;  3I4G A;  2LAH A;  5CEA A;  1N0R A;  3TWS A;  4JZY A;  3IBE A;  4L23 A;  2P9P G;  3HXE A;  4IUL A;  4RQI A;  3APF A;  1BI8 B;  1RZ4 A;  4O1O A;  1JWF A;  2RKK A;  3L54 A;  3LJ3 A;  5A6C A;  4DX1 A;  3ONL A;  1HFA A;  1V55 E;  4CT4 A;  1YYH A;  1QYM A;  1NP7 A;  5JHA A;  2GRR B;  2GRM A;  1E8X A;  2VSX E;  1OWN A;  1TNB A;  3IXE A;  3NAW A;  1D9S A;  2IU1 A;  5ARF A;  3DBS A;  1HO8 A;  2GRO B;  2VSY A;  4HFG A;  4GYW A;  3RO2 A;  3UX4 A;  3CST A;  1NZN A;  3VTY A;  2ETB A;  4UI9 J;  1MX4 A;  2DIW A;  4U0S A;  5JHB A;  1O5M A;  2BKG A;  2KAT A;  5G05 C;  4GAA A;  4N5Q A;  3LVQ E;  3E34 A;  5B3S E;  2KCK A;  2DVW A;  3LKU A;  4IRU A;  3WG7 E;  3RKV A;  2H6H A;  3CVN A;  4K5A B;  4KYO B;  5ANR A;  3IHY A;  3DXM G;  2Y4T A;  2PL2 A;  2X6J A;  3UM1 A;  3ML8 A;  2JAB A;  3I5P A;  5FTP A;  3TJP A;  1FT2 A;  2ZGD A;  2UY1 A;  2YIN A;  1G3N B;  5EN5 D;  3G2W A;  4N3A A;  1LF8 A;  3OXF A;  3OXL A;  2X38 A;  2OV8 A;  1NL4 A;  3ZW3 A;  3UMV A;  5BPP A;  4XI0 A;  3W9F A;  3ZXS A;  4B8A A;  1K1B A;  4I6J A;  1HF8 A;  3ASG A;  2LNI A;  4TRQ A;  3TAX A;  1OXJ A;  2A5E A;  3J5P A;  2GRP B;  2UY1 B;  4V3I A;  3HXC A;  2XPI A;  4JVS A;  3IHV A;  2YHE A;  1LD8 A;  4DX5 D;  2FO7 A;  5T3R A;  5G04 C;  3FU6 A;  3PNT B;  1OWM A;  2VJ8 A;  4QFV A;  4BEP A;  3DSS A;  2OND A;  3ONK A;  2R17 C;  2PQR A;  2WXM A;  1E7U A;  2WXP A;  5EX0 A;  4H7Y A;  3ULQ A;  3L22 A;  3PEV B;  3CR3 A;  4JHK A;  4OVV A;  4TUU A;  3FEX A;  3CVU A;  2WVI A;  2IOS A;  4N2S A;  4JD2 G;  1LTX A;  1JCQ A;  1QBQ A;  4P29 A;  4AIF A;  4U7E B;  5BV1 A;  3N71 A;  5LFA A;  3FHE A;  2XCB A;  4PDX A;  4RVB A;  2P9N G;  3HYM B;  4BX9 A;  1SQM A;  2OEV A;  1SZ9 A;  2VQ2 A;  2BKK B;  3PNL B;  4A3T A;  4FJZ A;  3L17 A;  1E8W A;  1DC2 A;  2IO3 C;  4ME2 A;  3UT7 A;  1TJC A;  3VLD A;  2VGX A;  4U0U A;  5FZS A;  4CDR A;  3AU5 A;  4GTP A;  5AYW D;  2I2O A;  2PM6 A;  3GW4 A;  3NZS A;  4J0U A;  3ESL A;  3D9P A;  4UQX A;  5T4Y A;  4CT0 A;  4DI4 A;  3C3Q A;  2CHX A;  3UTM A;  1DCQ A;  4U8H A;  4DI3 A;  4Q96 A;  4U07 A;  3HXD A;  5FT9 A;  2ILR A;  3P2B A;  4U95 D;  3CK7 A;  4D10 C;  3E32 A;  4BET A;  2XPY A;  2ZGG A;  1TNU A;  2VGX B;  3LY8 A;  4OVU A;  2XEH A;  4AEZ C;  1UJJ A;  3FUE A;  2PNN A;  3AS8 A;  3QK0 A;  3Q9N C;  3HG0 D;  3ZIM A;  3TXM A;  1BI7 B;  3FH5 A;  3HRA A;  3EU9 A;  2KC7 A;  4I1O B;  2H6I A;  4B94 A;  4EBA G;  3D9O A;  5AQB A;  4I1A A;  1KT0 A;  3U9W A;  4WWP A;  4DK5 A;  4F6R D;  2KCV A;  2HM8 A;  3C5R A;  1MYO A;  3V2O A;  2WPV A;  4ATG A;  3LDZ A;  4GTR A;  2BUG A;  4XKC A;  4ILG A;  4K5B A;  3PEU B;  3E37 A;  4U8V D;  5AAR A;  3CHS A;  2LUH A;  2RD0 A;  1YA0 A;  2XGO A;  3U3W A;  1S64 A;  3TWQ A;  5JJT A;  4JPS A;  2WXI A;  3G2S A;  4MRU A;  4GMR A;  4JXT A;  3KEZ A;  3DSV A;  2WM9 A;  4XI9 A;  4APF A;  3FP3 A;  2IFU A;  2GRQ B;  1N9A A;  4RG6 A;  4GPM A;  1NA0 A;  4U96 D;  1N4P A;  2X3M A;  1FVF A;  2NYJ A;  2LSV A;  3QDN A;  3F6Q A;  3V2X A;  3PRZ A;  3MGB A;  2X6H A;  4FUL A;  4TV3 A;  4WNG A;  3FUN A;  3KAE A;  3B13 A;  2QY7 A;  3FU3 A;  3JXI A;  2GRL A;  4HOS A;  1OWO A;  1IHG A;  5G04 J;  4FC8 A;  2EIK E;  1O1R A;  1EDU A;  4GZ5 A;  4KMO A;  1WDY A;  1LD7 A;  4UWL A;  2VGY A;  3ULY A;  3FDH A;  4HLL A;  4JA9 A;  1TEZ A;  2PZI A;  1X81 A;  2ZU6 B;  3EUV A;  2HR2 A;  2ETA A;  2VSO E;  4BT9 A;  4C0E A;  4DPR A;  4F1P A;  3EIQ C;  1HZ4 A;  1MX6 A;  3RO3 A;  4AJW A;  1MZC A;  2QYJ A;  5EID A;  3ASH A;  2XCC A;  4UQY A;  5CED B;  4HQD A;  3QWW A;  4ZFH A;  3Q79 A;  3BEE A;  1JPL A;  4O60 A;  4YDO A;  4BWR A;  2FBN A;  3AJI A;  4GA0 A;  4J8D A;  5C2Y A;  3TWT A;  3QAR A;  3RRU A;  1Z3X A;  5CRV A;  2KXP C;  4CDN A;  2XRZ A;  3ZNG A;  3SF4 A;  4I2W A;  3ZVV A;  3B7U X;  3CGH A;  3QNK A;  3FTU A;  1N95 A;  3ESK A;  2P9K G;  5HS0 A;  1N54 A;  2WXG A;  4YDW A;  1JCS A;  4EZJ A;  1PC2 A;  3MX3 A;  3UIP C;  2A5U A;  3OTN A;  5FIN A;  1H2U A;  2QYU A;  4JEH A;  4CEM A;  2J8S D;  4DJA A;  1OWL A;  3UM0 A;  1AP7 A;  5LX8 A;  2J9Q A;  4FLH A;  4FHJ A;  3ZYM A;  3DXK G;  4YND A;  3FUJ A;  3ISM C;  4A63 B;  3AS5 A;  2XGS A;  3I4R B;  1BD8 A;  3FH8 A;  4U8Y D;  2WXJ A;  5LCW C;  3ABK E;  4RLY A;  4O6F A;  4JA7 A;  3ZUV B;  4WWN A;  3GZ2 A;  3LY9 A;  4YVO A;  1BPO A;  3CVV A;  4Q69 A;  2CG3 A;  3HHM A;  3Q5M A;  4CZ2 D;  3L13 A;  3UIO C;  2EIJ E;  2VTB A;  4OYS A;  2XS8 A;  1QNF A;  3Q4A B;  1TYQ G;  2JLB A;  4YVQ C;  2C0L A;  1E90 A;  4L2Y A;  3R7R A;  3O4Z A;  2AXZ A;  3LCA A;  3ZKJ A;  1ELR A;  1MJ0 A;  5KJN A;  3DPD A;  3L16 A;  1Y6I A;  3V30 A;  3URZ A;  5J90 A;  1Z6T A;  1N4S A;  3PZ2 A;  3LEW A;  2CFU A;  3FTZ A;  4J8E A;  3Q7A A;  2CFZ A;  1JCR A;  3TWV A;  2DCP A;  4I6G A;  2VTB B;  2V0P A;  1EYH A;  2FF4 A;  5ENO D;  3CHM A;  2Y1L E;  1YCS B;  2Y4U A;  4RG9 A;  3QKY A;  1OT8 A;  4FAD A;  3MKQ A;  1UW4 B;  2NC9 A;  4LEU A;  2AW6 A;  1TNO A;  4U63 A;  5DIZ A;  4GA2 A;  4MLP A;  3ULE G;  3T8M A;  2WQ7 A;  1S0P A;  3BUA A;  1HU3 A;  2QFC A;  1KLX A;  4GTQ A;  4WAF A;  3QB2 A;  1YMP A;  3G2T A;  4GZD A;  4B89 A;  4B0Z A;  1WM5 A;  2XGM A;  3ENE A;  1PY1 A;  3EHN A;  3PZ1 A;  3J5Q B;  2J08 A;  2R02 A;  5E76 A;  1WY6 A;  4NIK A;  3MKQ B;  1N52 A;  3VTX A;  4GYY A;  2P9U G;  4F7A A;  4HOT A;  4UWG A;  5BT1 A;  4EEC A;  1ELK A;  4L2L A;  2CHW A;  4GTS A;  3JUI A;  3SGH A;  2LSU A;  1HG2 A;  3T5V A;  1NFI E;  3FTY A;  5JMN D;  4ZHB A;  4N5C A;  4GA1 A;  3CHP A;  3CVP A;  1HH8 A;  4JB8 P;  4N3B A;  5CCL A;  4APO A;  4TXP A;  3SBS A;  3CVW A;  2OVB A;  3HVE A;  4KVO A;  3I3N A;  5AQ9 A;  4XX5 A;  5JJ7 A;  3CIA A;  2CG2 A;  3SNX A;  3NOC D;  3FTS A;  4JW1 A;  4ILI A;  4UWF A;  2V4L A;  3O48 A;  5FQ6 A;  3TWR A;  2V8S E;  4PS8 A;  2F8Y A;  3S7B A;  5HI7 A;  2I9C A;  4DX7 D;  2F8X K;  3C98 A;  1DVP A;  3HVE B;  2KZT A;  4HRM B;  4I9C A;  4KBQ A;  2V5Q C;  3SO8 A;  4I2Z A;  3K9I A;  4F3V A;  3L6A A;  1QQE A;  4JHR A;  3FUM A;  4YDE A;  3ASF A;  3CVL A;  5LCW J;  2OVF A;  4HOU A;  2DYR E;  3UM2 A;  4J7W A;  2L0I A;  2XEE A;  3BU8 A;  1EF1 C;  3B7B A;  4QQI A;  4G25 A;  1EPU A;  1OCC E;  3D9L A;  5FQ8 A;  5JJ6 A;  3WXX A;  4B93 B;  2R05 A;  3NBN B;  2B6C A;  5ANL A;  5A7D B;  3PS6 A;  2KZT B;  1L5J A;  5AAO A;  3ASO E;  4Y6C A;  3DWL G;  5ENR D;  2J07 A;  4JHJ A;  3G2U A;  3P1U A;  3JQ1 A;  2AJA A;  2ZIS A;  2EIM E;  2WXR A;  4C0M A;  2FI7 A;  1KPS B;  3W9G A;  3RSE G;  2IO2 C;  1U3C A;  2A4Z A;  1FT1 A;  1TR4 A;  2FUL A;  2GW1 A;  1E7V A;  1TN8 A;  1SVX A;  3D9I A;  1INZ A;  1A5E A;  3V31 A;  3FU5 A;  2RFM A;  4KT6 B;  3CKB A;  3MZL B;  3CEQ A;  2FEZ A;  4ABN A;  3ZHE A;  3CVY A;  3HDX A;  1X5B A;  1OCO E;  4CGV A;  3PE4 A;  1SA4 A;  2C2L A;  1HX8 A;  2DBA A;  5E75 A;  5EIL A;  4I9E A;  3TWX A;  5BUZ A;  2Y3A A;  4EZL A;  4CGW A;  3ZFW A;  5EIB E;  5G55 A;  5G05 J;  1IXV A;  3FUF A;  1XGW A;  4UI9 K;  4AXH A;  4HS2 A;  2MRI A;  2F0Y A;  4H7X A;  3LY7 A;  2BF0 X;  1WAO 1;  3ZHE B;  5M72 A;  3UIN C;  1V54 E;  3B7S A;  4AM9 A;  1OCZ E;  5JA4 D;  3ZYQ A;  3AG1 E;  2OOE A;  3RU0 A;  2V4H C;  5CBO A;  2LAI A;  2WXO A;  2V5F A;  4TXR A;  5KWD A;  4CYM D;  3UI2 A;  1AWC B;  1MHQ A;  5ARG A;  2IQC A;  5CMW A;  2X6I A;  3C3R A;  3D3M A;  3EIJ A;  3PE3 A;  1OWP A;  3DSX A;  4G8L A;  4MBG A;  2MYO A;  5A23 A;  1N4Q A;  1B89 A;  3CQC B;  4UWH A;  3T8K A;  4A1G A;  3FTW A;  3QAQ A; 
#chains in the Genus database with same CATH homology
 1A5E A;  2ETB A;  4U95 D;  4HRL A;  3KEA A;  1N0Q A;  3V31 A;  5FIN A;  2RFM A;  3TWR A;  2J8S D;  1MX4 A;  4LSZ E;  4DX5 D;  1AP7 A;  3DEP A;  5AN8 A;  3JXI A;  2F8Y A;  4BET A;  1K3Z D;  5HRY A;  2ZGG A;  1BLX B;  4QFV A;  2BKG A;  4DX7 D;  2F8X K;  4BEP A;  1YMP A;  5AQ7 A;  2XEH A;  4DRX E;  3V79 K;  1WDY A;  4HRM B;  4HNA D;  1IHB A;  4N5Q A;  4BES A;  2PNN A;  2HE0 A;  3AAA C;  3UXG A;  5FIO A;  2V5Q C;  3SO8 A;  4YDY A;  4A63 B;  1BU9 A;  3NOG D;  2QC9 A;  1BD8 A;  4HI9 A;  4U8Y D;  4O1P A;  5ENQ D;  2XZD G;  2DVW A;  3Q9N C;  3HG0 D;  4HLL A;  3JXJ A;  1BI7 B;  4C48 B;  4UUC A;  3HRA A;  2XEN A;  1K1A A;  3EU9 A;  4RLY A;  3ZUV B;  5ENS D;  5ITZ F;  2ETC A;  4TUM A;  4K5A B;  1S70 B;  3J5Q B;  5AQA A;  2ETA A;  5EIL A;  5CEC B;  5AQB A;  4HBD A;  3TWX A;  4G8K A;  4NIK A;  4F1P A;  4J7W A;  5KBA A;  2DZO A;  3JUE A;  2XEE A;  1MX6 A;  3B95 A;  3D9H A;  2RFA A;  4CZ2 D;  4F6R D;  4Z68 A;  5CER B;  5EIB E;  4HB5 A;  3B7B A;  2QYJ A;  4QQI A;  4DX6 D;  1WG0 A;  5EID A;  1IXV A;  3T9K A;  5CEA A;  3EHQ A;  3C5R A;  1N0R A;  1MYO A;  4LNU D;  5KNH D;  5CED B;  2P2C P;  3V2O A;  3TWS A;  4LG6 A;  3TWU A;  4B93 B;  4BER A;  4HQD A;  2JAB A;  4ZFH A;  3NBN B;  2DWZ A;  5KNG A;  5EYL A;  1BI8 B;  4ATZ D;  2BKK B;  4O1O A;  2ZGD A;  4O60 A;  5AAO A;  1IKN D;  1MX2 A;  1UOH A;  4K5B A;  5ENR D;  3AJI A;  3LJN A;  4U8V D;  1DC2 A;  4DX1 A;  5JA4 D;  1NFI E;  5AAR A;  1G3N B;  5EN5 D;  5JMN D;  4BSZ B;  4ZHB A;  3DEO A;  2V4H C;  3TWW A;  3TWQ A;  4JB8 P;  5ENP D;  3EHR A;  3TWT A;  5CBO A;  3ZKJ A;  2AJA A;  2B0O E;  5EYP F;  2KXP C;  1YYH A;  4J8Y A;  4GMR A;  1MJ0 A;  1QYM A;  4OAV B;  2DZN A;  5KWD A;  2F37 A;  4CYM D;  4HI8 A;  3ZNG A;  4DUI A;  4K5C A;  3ZU7 B;  2VGE A;  4HRN A;  3W9G A;  3UI2 A;  3V30 A;  5BXO A;  5AQ9 A;  2XZT G;  1AWC B;  4OAU C;  1SW6 A;  4GPM A;  5HKP A;  1OY3 D;  4U96 D;  1TR4 A;  5CBN A;  2L6B A;  5HS0 A;  3IXE A;  3TWV A;  3W9F A;  2NYJ A;  3Q9U C;  5BXU A;  1N11 A;  1K1B A;  3NOC D;  4DX2 A;  1D9S A;  4G8L A;  3F6Q A;  2Y0B G;  2MYO A;  5D66 A;  5ENO D;  3V2X A;  2Y1L E;  2FO1 E;  1YCS B;  1SVX A;  3UTM A;  4YDW A;  3T8K A;  1DCQ A;  2KBX A;  5ENT D;  2A5E A;  3J5P A;  1OT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...