3TWXA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human fnbp1 (chimeric peptide)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 51
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twxA00
5D66A 1K1BA 3UTMA 4HLLA 3AAAC 3IXEA 2B0OE 2BKGA 3T9KA 2BKKB 1BLXB 4O60A 2RFMA 3HRAA 3DEPA 4YDWA 2JABA 3V31A 3TWUA 4HRNA 3C5RA 2V5QC 4BETA 4LG6A 5AQAA 3ZKJA 4DX6D 5JA4D 5EIDA 1DCQA 4BESA 4A63B 2V4HC 2ETAA 5HKPA 1MJ0A 4HI9A 2KXPC 4LNUD 5HS0A 1S70B 1NFIE 2XEHA 3Q9NC 1N0QA 4K5AB 4O1OA 4QFVA 5CBOA 1OT8A 4DX7D 1MX4A 4U95D 3W9GA 4DRXE 4GMRA 4TUMA 3V2XA 3EU9A 2HE0A 5CECB 5AARA 5ITZF 2FO1E 5AQBA 3UXGA 3V30A 1BI7B 3EHQA 2F37A 4B93B 2VGEA 5CBNA 4Z68A 3TWQA 3TWXA 4DX2A 4ZHBA 4U96D 4JB8P 1K1AA 5KWDA 5BXOA 4ATZD 2F8XK 1MYOA 4G8LA 5AN8A 1YMPA 4OAVB 1N11A 3T8KA 3TWWA 2MYOA 2P2CP 4HI8A 5KNHD 3ZU7B 5EIBE 4GPMA 3NBNB 2XZDG 4YDYA 3TWSA 1BD8A 3ZNGA 4CZ2D 5EILA 3Q9UC 1UOHA 3AJIA 1BI8B 4HNAD 2DVWA 3W9FA 3F6QA 2F8YA 1QYMA 2ETCA 3TWRA 1G3NB 4OAUC 3UI2A 5CERB 5EN5D 1WG0A 3NOCD 5KBAA 5EYPF 5BXUA 1SW6A 4HQDA 4J7WA 3V2OA 3NOGD 4DX5D 4F6RD 1A5EA 4J8YA 1IKND 1MX6A 2QYJA 4DX1A 4CYMD 4K5CA 4BSZB 2Y0BG 1IHBA 5ENOD 5EYLA 2A5EA 2J8SD 2ZGDA 5ENPD 1OY3D 2ZGGA 3JXIA 4G8KA 5AAOA 2DWZA 2DZNA 5KNGA 2L6BA 5FINA 5FIOA 5ENRD 4O1PA 1TR4A 4HRMB 4N5QA 4DUIA 1WDYA 4U8VD 5JMND 4K5BA 3V79K 2Y1LE 4BEPA 4BERA 3J5QB 3LJNA 3DEOA 4F1PA 2XEEA 1YCSB 4RLYA 5CEAA 2ETBA 2KBXA 1AP7A 2QC9A 2RFAA 3HG0D 5ENSD 4LSZE 5HRYA 5ENQD 5AQ7A 1MX2A 4ZFHA 3SO8A 3ZUVB 2XENA 3TWTA 1YYHA 5CEDB 5AQ9A 1AWCB 4C48B 1K3ZD 4HRLA 2XZTG 5ENTD 2DZOA 1D9SA 3B7BA 4HB5A 3B95A 1DC2A 2NYJA 3JUEA 1BU9A 4HBDA 4UUCA 2AJAA 4QQIA 3JXJA 3D9HA 4NIKA 4U8YD 3TWVA 3J5PA 3KEAA 3EHRA 1N0RA 2PNNA 1IXVA 1SVXA
chains in the Genus database with same CATH superfamily
2GW1A 2FI7A 4JHKA 3QWWA 2HR2A 3KEZA 3ONLA 3IV0A 1BLXB 1HFAA 2JABA 3DXMG 2FEZA 4L9PA 3FTSA 1QBQA 1Y8MA 1JWFA 4I6JA 5J90A 2WXJA 4BFRA 4B89A 3EDTB 4I9CA 1N4RA 3D3MA 4G26A 1HU3A 1E8YA 1EYHA 1B89A 3EHMA 3DPYA 2NXPA 3UT7A 3Q9UC 3ASOE 3F6QA 1H2VC 3OXGA 2LAIA 1K8KG 3V2OA 2QYJA 3CHMA 3D9IA 3Q47B 3JXIA 4PH4B 4TXRA 4G24A 5EX0A 4CDRA 3HXCA 3WG7E 4BERA 3J5QB 1N52A 3N71A 5T3RA 4B8AA 3PDNA 5AQ7A 1N9AA 3ZUVB 3QARA 4U8HA 1EF1C 3ULQA 2NYJA 3JUEA 1DNPA 1ELKA 4UUCA 2AJAA 3B7RL 4HXIA 4BT8A 4XIFA 3QDNA 4O6FA 4BX8A 4CCAA 1YA0A 2X38A 3E4BA 4DK5A 1WAO1 3TWUA 4JEHA 3SI5A 5DBKA 5EIDA 2GRQB 2V4HC 3VLEA 4E6HA 4U95D 3EU9A 2AW6A 5JJTA 4V3IA 3HXDA 2WM9A 5CBNA 1P5QA 1X81A 3CLJA 3UQ3A 4DJAA 4F53A 3UPVA 4GPMA 4F3VA 4B94A 4G25A 2E0IA 4GTPA 4CZ2D 3RO2A 2LXMA 2XS1A 2ZISA 1WM5A 3HVEB 1IQUA 4J0UA 4L2YA 4RG9A 5AJLA 4LNGA 4GZDA 2C0LA 2R17C 3Q15A 3TGOA 1QZ2A 2XCBA 5FINA 3CQGB 2DCPA 2RD0A 1O1RA 1KZPA 3FTYA 2OEVA 3AG2E 4XEIG 3EIQC 4ACLA 1AP7A 3RKVA 4PUCA 2CG3A 4JHRA 4FULA 4XX5A 1E8WA 4BTAA 1EDUA 3LYAA 4FHJA 5FQ8A 4CRWA 3OXLA 4QQIA 1OXJA 3KEAA 3PVLA 3AS5A 5JHAA 1TJFA 1MZCA 1IXVA 2WPVA 4JL0A 3DRAA 2EQXA 3QOUA 3SHFA 3FUKA 4O60A 3KS2A 1NI1A 4L23A 3RU0A 1H2TC 3TL5A 4TRQA 1NFIE 3ZYLA 4BTBA 2WXGA 2EILE 4XKCA 1E8ZA 4WAFA 4CT0A 3FEXA 3CVLA 2IF4A 1FT1A 2RKKA 1U3DA 4A1GA 5KJNA 3U66A 2MYOA 2IOLA 4J8DA 4JW1A 4AVXA 4GA1A 4JD2G 4GMLA 2LSUA 3UT8A 5KBAA 5HI7A 2LO6A 1SW6A 4J7WA 4OVVA 3R7QA 3LKUA 3FH7A 3Q7AA 4MKTA 2Y4TA 2ZGDA 3DSWA 3L82A 2LXLA 3BUAA 4GZ3A 5AIJA 5JMND 2L0TB 4AJWA 1O5MA 2WXOA 2V4LA 4ABNA 1U3CA 2QC9A 2RFAA 4HOSA 1MX2A 3LY8A 4H7XA 3EHNA 3CHQA 2LNIA 4DPRA 5DIZA 3NB2A 4A3VA 4E85A 2DZOA 1KLXA 1SA4A 3KSQA 4HORA 3UUXA 4GAAA 3TWVA 1ZBPA 3J5PA 4ANXA 3BG1B 4NURA 2JLBA 1K1BA 3E30A 3ZYMA 3K9IA 1OUVA 3APDA 5JA4D 3ABKE 4HI9A 3RJVA 5HS0A 4G1TA 1JCRA 4GTVA 3ZGQA 5AARA 3ZN3A 3FTWA 1NP7A 5D2MC 2VGEA 4I1OB 4ZHBA 1N11A 1EPUA 3PE4A 3LY7A 3ZU7B 3NBNB 1RZ4A 3FULA 3FUIA 5ARGA 3UM1A 3CK8A 2A4ZA 2H6HA 5J08A 5ENOD 2LUHA 3ZVVA 3S7DA 2CG2A 3HXEA 3ISMC 4AEZC 1OWMA 4UQZA 4A55A 3CHRA 3ZIMA 2HM8A 3LJNA 2Y4UA 2UY1A 3AS8A 5ANRA 3FTVA 1DCEA 5G05J 3NF1A 3ZXSA 2GGFA 1K3ZD 2XZTG 1FT2A 1DC2A 4U0ZA 4GYOA 4J8EA 3FH8A 3L22A 2XPIA 2GRNB 5FZSA 4FC8A 2CFUA 4JHJA 3TAXA 1O1TA 1TNZA 1UN9A 2ETAA 3OAWA 3CVQA 4K03A 3LDZA 4LNUD 4K5AB 1N94A 5D0OD 4AIFA 3W9GA 4GU5A 3UKRG 3CV0A 1JCSA 1H19A 1E7UA 1N4SA 4YVQC 3T8KA 2FULA 3UINC 1N54A 4YDYA 3C3OA 3ZNGA 4MLPA 3ULYA 4GTQA 2ETCA 4HOTA 5IY5E 4DX5D 4F6RD 3FHEA 1E8XA 3FDHA 3FTUA 5EYLA 1Z6TA 2A5EA 1OY3D 4XE0A 4OYSA 4XKBA 2WXNA 4GB9A 1SQMA 5T8IA 5H7PA 3HVEA 4DLOA 2J4DA 4FLBA 3HG0D 5ENQD 2IO3C 4NACA 1SZAA 4Q69A 2R59A 3T5VA 1NA3A 4LCTA 2E2EA 1BU9A 3CQCB 3FTZA 4FADA 3GYZA 3SFXA 2I1KA 3P1UA 4Q94A 3MA5A 3CHPA 2BKGA 4NRHB 4KMOA 5KJKA 5HQ8A 4WWPA 1NZNA 2V5QC 2YHCA 5FWQA 1TNBA 4JXTA 4I2WA 2KXPC 4QFVA 4LEUA 2GRLA 2WXPA 4EBAG 1QQEA 5BNWA 2P58C 4GA0A 2EIKE 2IOSA 5M72A 4UWFA 1TN7A 1IHGA 1UJJA 1SA5A 5E75A 3TWWA 4XI9A 5KNHD 2PQRA 4FLHA 2FO7A 3TWSA 1BD8A 4I2ZA 5EILA 4ANVA 4ILGA 4HFGA 3TWRA 2VQ2A 4OAUC 2XQ0A 3Q49B 5EN5D 4HVBA 4ME2A 1X5BA 2WVIA 3FU0A 2AWIA 4FJYA 4UWHA 1OWLA 1HX8A 3C3RA 4TUUA 3MV2B 2KZTA 1H6OA 3L9TA 3VLDA 4JA7A 3APCA 2XRYA 4U04A 2VGXB 1PAQA 2FF4A 2HYZA 4DUIA 1KT0A 1HH8A 3BU8A 3UTMA 3QJZA 3ESKA 4APOA 5FT9A 3C5RA 5AQAA 3ZKJA 1BPOA 4O1OA 1E90A 4TV3A 2OOEA 2HE0A 3IHYA 5AQBA 2YQ8A 1H0AA 3TWXA 2L0IA 4RSYA 3HDXA 2GRRB 1UW4B 5B3SE 3R7RA 3PZ3A 4APFA 2C2LA 4BT9A 2CFZA 1NL4A 1E7VA 5AJDA 1IKND 1MX6A 1HS6A 2VSOE 3AS4A 4U63A 2XHEA 2P9PG 2BTDA 4AP2A 1TNUA 3MEKA 4UQXA 3O4ZA 2DBAA 3MKQB 3KAEA 2LAHA 4M3OA 3SFYA 3BEEA 2XEEA 3FUHA 4B8CB 3DSTA 4AY6A 2MOWA 4EQFA 4B0ZA 2DYSE 4N39A 4AM9A 2XPYA 4I43A 4KVOA 3QNKA 3I5PA 3LVQE 3UKUG 3HRAA 3ZXPA 2GRMA 3EJNA 1MJ0A 4L1BA 2ILRA 1N0QA 3NQPA 2J09A 3ZFWA 1UN8A 4GYWA 4XI0A 4GMRA 2XCCA 3V2XA 4IRUA 3RRUA 3JUIA 4B93B 1N95A 4LRZA 3BG0B 5FZQA 2OVFA 4UI9J 4ATZD 1PY1A 4HS2A 5AN8A 2X6HA 2XRZA 4OAVB 5LP0A 3DSSA 5G04J 2X6IA 2EINE 4HLEA 4HNAD 3RAUA 2I6HA 2PQNA 2VSXE 4N3BA 1V54E 2P9IG 2BEDA 2Y0BG 1H6KA 1IHBA 3KSLA 5ENPD 1DVPA 3DWLG 4Q96A 3VTYA 3SNXA 3MJWA 3L54A 3D9JA 1JPLA 3JYSA 2X6JA 3KD7A 1KZOA 1YCSB 2ETBA 5ENSD 4C9BB 3MCXA 3FY4A 3SO8A 1A17A 3CKCA 2OCCE 1TYQG 4NQ0A 5AQ9A 1AWCB 1D9SA 2LSVA 4K0RA 4YDOA 1Z3YA 4N3CA 4IULA 3FTXA 4HLLA 5FQ4A 1FVHA 3EU5A 4GTTA 3VTXA 4YDWA 4HRNA 4CT4A 5A6CA 3I3NA 1DCQA 4P29A 3Q7FA 3RIBA 2YHEA 1D8EA 3CVWA 5D0QD 4DX7D 1Y6IA 1MX4A 4L7TA 5EX3A 2PL2A 3U4TA 3FUMA 3FUEA 1SZ9A 1K1AA 1S0PA 3QAQA 3O48A 3CVXA 3CVVA 4A3TA 3L08A 5AENA 3L13A 4J6IA 3GZ2A 4MRUA 1WG0A 3ASGA 3BQOA 3ESLA 5LFAA 3CKBA 3SD5A 4KBQA 4AV7A 2J8SD 5A23A 2DWZA 2DZNA 4YDEA 3T5XA 4UQYA 4N5QA 3S7FA 4G23A 1JUQA 4GZCA 2L9BA 2WXLA 4R7LA 4N5CA 2VTBB 2OVBA 1HXIA 5FZRA 5FQ7A 3S7JA 4EZJA 4PS7A 4ZFHA 2CHZA 1Q2ZA 3TWTA 2RG8A 1W3BA 2XEVA 3Q5MA 3D9PA 3MYVA 4DLQA 4U7EB 2Y3AA 3ZHEA 4NIKA 3RO3A 3MGBA 3QWVA 4BX9A 3NZUA 4LNBA 2PNNA 4U0UA 2DYRE 3EIJA 3IEGA 3AAAC 3IXEA 1HO8A 3AU5A 4XZ4A 1OWPA 4WUYA 3UIPC 2RFMA 2VJ8A 4ILIA 3E37A 4U0SA 2PM7A 3LEWA 5G04C 3X2QE 4OVUA 1TJCA 4KVMA 1OCOE 1OT8A 2J9QA 4UI9C 2HO1A 3ABME 5LCWJ 2P9NG 3UXGA 4H7YA 1UG3A 5EDSA 3URZA 3LJ3A 4U96D 4URKA 3DSUA 4ANWA 1OWNA 4G8LA 2WXKA 4X8QA 2P2CP 4D10C 2I2OA 5EIBE 4DI4A 3FU6A 1E96B 3PREA 1HZ4A 3PUJA 2H6FA 1BI8B 3SF4A 2CHWA 2GRPB 5FTPA 4C0MA 5E76A 3RRMB 2WB2A 3NZSA 4L2LA 5BT1A 3ZYQA 3T8MA 4G8KA 4ATGA 5KJLA 3NAWA 2KCKA 3DPDA 2Y69E 1WDYA 1WY6A 2R2LA 5CMYA 4GCNA 1RW2A 3ASFA 3B7SA 5CEAA 2KBXA 3APFA 4A1SA 1N4PA 4BSXA 1FVFA 1NA0A 2QYUA 3DXKG 4UWGA 1D8DA 4EPZA 3B95A 1L5JA 4LUNU 4I9EA 2XGMA 1VDYA 4KT6B 1PC2A 3MKRA 3I4GA 4WNDA 2BKKB 2IQCA 5BV0A 4LG6A 2VTBA 4DX6D 2IONA 2WXQA 4HOQA 3HXBA 3R9AB 5LOZA 5G55A 2KM4A 5BV1A 3MV3B 4GMJA 4TUMA 3TG5A 1JWGA 4GPKA 3QWPA 1KT1A 3OTNA 4JB8P 4WWNA 3ZHEB 1TN6A 2PZIA 3FH5A 1OWOA 5BW8C 3LY9A 1XGWA 2PM6A 3B7UX 3QK0A 3Q4AB 3GZ1A 3L6AA 2R05A 2OV8A 4I1AA 2WQHA 3CK9A 2ZGGA 3LCAA 3ZW3A 2VGXA 5KNGA 5FIOA 3FU3A 4EECA 2IFUA 4ILHB 2KCVA 3U64A 3HXFA 4G2VA 5EKQD 2WQ6A 3D9KA 1FPPA 1QNFA 2GROB 2AXVA 2XENA 1JCQA 2IY0C 3CK7A 3L17A 5CMWA 4W9RA 3D9HA 4BY6A 3PNTB 3EHRA 3E32A 4WNFA 3TG4A 3FUJA 4YNDA 2J08A 1FCHA 2R03A 3JCKC 4I17A 3FFLA 5ARFA 4CGVA 4A63B 4JPSA 3CSFA 4GTMA 1OCRE 3G2VA 3SGHA 2V0PA 2IU1A 2MRIA 5JJ7A 5ITZF 1BI7B 4DI3A 2MHKA 3UMVA 4FP7A 4Z68A 2M63A 4KYOB 5KWDA 3ULEG 4GTSA 3RK6A 5A7DB 4RG6A 4C0EA 3TXMA 1UOHA 2DVWA 3PRZA 2JEKA 2XS8A 3OXFA 1XNFA 3FUNA 5JJ6A 4BSZB 3FUFA 2UY1B 3Q73A 1TR4A 4HRMB 2C0MA 2UWJG 4K5BA 3CVPA 4UWKA 3CVUA 3PZ2A 4MS6A 2BUGA 3ASDA 4HRLA 3FEYA 2KCLA 1ELWA 4UI9K 3B7BA 4HBDA 1OCCE 1O1SA 5KCMA 4ACKA 2EIME 4EHMA 1KPSB 3TXNA 2P9SG 1N0RA 1YMPA 1MHQA 3PE3A 3B13A 5CRUA 3DEPA 1MQSA 2F0YA 4BESA 3Q75A 3PS6A 4RQIA 2J49A 2NSZA 4YVOA 2WMNA 5CECB 5KJMA 3PEVB 1HG5A 4EZKA 3EHQA 4JZYA 2WXRA 3PUKA 4TXPA 3G2WA 2KZTB 4ANUA 3ENEA 2QZAA 2OEWA 2IJGX 2XZDG 3SY2A 3I4RB 3AG4E 2WQ7A 5CERB 3QC1A 2I1JA 3SBSA 4DX1A 4CGWA 3HHMA 4I6EA 5AAOA 4Y6CA 3PZDA 1LD8A 4G11A 2V8SE 5ENRD 2XGOA 2CHXA 3ZEFA 2AVPA 4GYYA 4I6GA 2R02A 2WXHA 3ZYKA 2VGYA 5G05C 5BUZA 3LS8A 5CEDB 4U07A 3D9NA 1N4QA 4F1SA 2YINA 3UX4A 2WXIA 3ASNE 3CGHA 5T4YA 4Y6WA 4M7CA 1S63A 4GTOA 4GZ5A 2X3MA 3IHVA 5ANLA 3PZ1A 4JA9A 1GW6A 3ABLE 3CEQA 3CHOA 3GZSA 2J07A 3S7BA 2IO2C 2AXUA 1LF8A 3AU4A 3SFZA 5BPPA 3Q78A 3RSEG 5B1BE 3G2SA 3TWQA 4DX2A 3U9WA 3CSTA 5CRVA 3GW4A 3D9OA 5C2YA 4AOFA 3VLFA 2P9UG 3AJIA 1ELRA 4GA2A 1QYMA 1G3NB 4N2SA 1Z3XA 2KC7A 3LVRE 3ZRHA 3C98A 3ML9A 4RVBA 5BXUA 4BWRA 2KATA 4HQDA 3UM2A 2ZXWE 3NOGD 2YNQA 3C72A 4LERA 3RRNB 2I9CA 1HE8A 3UM0A 4O1PA 3AG1E 4CEMA 3ASHA 4U8VD 1HG2A 3V79K 4BEPA 3R9MA 3FU5A 3DEOA 3FP3A 3UT4A 4RLYA 5FQ6A 5C1DA 5HRYA 1V55E 4JC8A 2VYIA 3U3WA 4TXQA 5CHEE 4C48B 2EIJE 3UIOC 4CDNA 3FWVA 1ZU2A 3HYMB 4FA6A 3JXJA 4U8YD 3EUVA 3LXUX 4GTRA 2AXZA 3FUDA 2VSYA 3DBSA 3DSXA 5D66A 2X6FA 1INZA 1ZB1A 3T9KA 4KZ0A 3D9LA 2QY7A 3V31A 2NC9A 2DIWA 4BETA 3PNLB 5HKPA 1UJKA 2Q7FA 2XGSA 3Q9NC 3DSVA 3PEUB 3ONKA 4DRXE 3PH0C 2FO1E 1H6PA 1TN8A 3V30A 2QFCA 4PDXA 2F37A 2H6IA 4IYPA 2F8XK 2X6KA 1LD7A 3QKYA 4HI8A 1U2VG 3CIAA 2V5FA 3HIZA 3W9FA 3B7TA 4J8SA 1IQRA 3D9MA 3JQ0A 3UI2A 2R5SA 5LX8A 1IYGA 2P9KG 3NOCD 5EYPF 4WNEA 4JVSA 3CR3A 3MZLB 2IEJA 2WXFA 4CYMD 3E34A 3TJPA 5LCWC 5JHBA 2ZU6B 4UWLA 5FJYA 3PZ4A 5G2NA 4EZLA 3ZPJA 5ENNA 4KXKB 3WXXA 3CVYA 3UM3A 3MKQA 3IBEA 4FU3A 1YYHA 4EBAA 4PS8A 4GZ6A 1H2UA 3CHSA 4N2QA 3C3QA 4FHKA 2ZIRA 3IKOB 3P2BA 3SBTB 2H6GA 1TEZA 2B0OE 5CCMA 3AG3E 3G2TA 3G2UA 2FBNA 3E33A 2L6JA 4WWOA 1S70B 2XEHA 5CBOA 3LPZA 5CCLA 1OCZE 3ML8A 3QB2A 4MBGA 2P9LG 5BXOA 4AXHA 1MYOA 2J4BA 1Z5SC 1LTXA 1S64A 2VSNA 4WNGA 4JEUA 4HOUA 3CVNA 1HF8A 3S2AA 2ONDA 3JQ1A 3MX3A 4FJZA 1TNOA 2F8YA 4PS3A 2XPZA 2B6CA 4J8FA 1A5EA 2A5UA 4J8YA 4F7AA 4K5CA 4GCOA 5AYWD 2L6BA 3SZ7A 2WXMA 2Y1LE 2BF0X 4F1PA 5B1AE 4LSZE 4KZCA 3Q79A 4AY5A 4CDMA 4IN3B 4N3AA 5ENTD 4HB5A 1TNYA 2WMOA 3L16A 4I1MA 3SQVA 1SVXA
chains in the Genus database with same CATH topology
5D66A 1K1BA 3UTMA 4HLLA 3AAAC 3IXEA 2B0OE 2BKGA 3T9KA 2BKKB 1BLXB 4O60A 2RFMA 3HRAA 3DEPA 4YDWA 2JABA 3V31A 3TWUA 4HRNA 3C5RA 2V5QC 4BETA 4LG6A 5AQAA 3ZKJA 4DX6D 5JA4D 5EIDA 1DCQA 4BESA 4A63B 2V4HC 2ETAA 5HKPA 1MJ0A 4HI9A 2KXPC 4LNUD 5HS0A 1S70B 1NFIE 2XEHA 3Q9NC 1N0QA 4K5AB 4O1OA 4QFVA 5CBOA 1OT8A 4DX7D 1MX4A 4U95D 3W9GA 4DRXE 4GMRA 4TUMA 3V2XA 3EU9A 2HE0A 5CECB 5AARA 5ITZF 2FO1E 5AQBA 3UXGA 3V30A 1BI7B 3EHQA 2F37A 4B93B 2VGEA 5CBNA 4Z68A 3TWQA 3TWXA 4DX2A 4ZHBA 4U96D 4JB8P 1K1AA 5KWDA 5BXOA 4ATZD 2F8XK 1MYOA 4G8LA 5AN8A 1YMPA 4OAVB 1N11A 3T8KA 3TWWA 2MYOA 2P2CP 4HI8A 5KNHD 3ZU7B 5EIBE 4GPMA 3NBNB 2XZDG 4YDYA 3TWSA 1BD8A 3ZNGA 4CZ2D 5EILA 3Q9UC 1UOHA 3AJIA 1BI8B 4HNAD 2DVWA 3W9FA 3F6QA 2F8YA 1QYMA 2ETCA 3TWRA 1G3NB 4OAUC 3UI2A 5CERB 5EN5D 1WG0A 3NOCD 5KBAA 5EYPF 5BXUA 1SW6A 4HQDA 4J7WA 3V2OA 3NOGD 4DX5D 4F6RD 1A5EA 4J8YA 1IKND 1MX6A 2QYJA 4DX1A 4CYMD 4K5CA 4BSZB 2Y0BG 1IHBA 5ENOD 5EYLA 2A5EA 2J8SD 2ZGDA 5ENPD 1OY3D 2ZGGA 3JXIA 4G8KA 5AAOA 2DWZA 2DZNA 5KNGA 2L6BA 5FINA 5FIOA 5ENRD 4O1PA 1TR4A 4HRMB 4N5QA 4DUIA 1WDYA 4U8VD 5JMND 4K5BA 3V79K 2Y1LE 4BEPA 4BERA 3J5QB 3LJNA 3DEOA 4F1PA 2XEEA 1YCSB 4RLYA 5CEAA 2ETBA 2KBXA 1AP7A 2QC9A 2RFAA 3HG0D 5ENSD 4LSZE 5HRYA 5ENQD 5AQ7A 1MX2A 4ZFHA 3SO8A 3ZUVB 2XENA 3TWTA 1YYHA 5CEDB 5AQ9A 1AWCB 4C48B 1K3ZD 4HRLA 2XZTG 5ENTD 2DZOA 1D9SA 3B7BA 4HB5A 3B95A 1DC2A 2NYJA 3JUEA 1BU9A 4HBDA 4UUCA 2AJAA 4QQIA 3JXJA 3D9HA 4NIKA 4U8YD 3TWVA 3J5PA 3KEAA 3EHRA 1N0RA 2PNNA 1IXVA 1SVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D66 A;  1K1B A;  3UTM A;  4HLL A;  3AAA C;  3IXE A;  2B0O E;  2BKG A;  3T9K A;  2BKK B;  1BLX B;  4O60 A;  2RFM A;  3HRA A;  3DEP A;  4YDW A;  2JAB A;  3V31 A;  3TWU A;  4HRN A;  3C5R A;  2V5Q C;  4BET A;  4LG6 A;  5AQA A;  3ZKJ A;  4DX6 D;  5JA4 D;  5EID A;  1DCQ A;  4BES A;  4A63 B;  2V4H C;  2ETA A;  5HKP A;  1MJ0 A;  4HI9 A;  2KXP C;  4LNU D;  5HS0 A;  1S70 B;  1NFI E;  2XEH A;  3Q9N C;  1N0Q A;  4K5A B;  4O1O A;  4QFV A;  5CBO A;  1OT8 A;  4DX7 D;  1MX4 A;  4U95 D;  3W9G A;  4DRX E;  4GMR A;  4TUM A;  3V2X A;  3EU9 A;  2HE0 A;  5CEC B;  5AAR A;  5ITZ F;  2FO1 E;  5AQB A;  3UXG A;  3V30 A;  1BI7 B;  3EHQ A;  2F37 A;  4B93 B;  2VGE A;  5CBN A;  4Z68 A;  3TWQ A;  3TWX A;  4DX2 A;  4ZHB A;  4U96 D;  4JB8 P;  1K1A A;  5KWD A;  5BXO A;  4ATZ D;  2F8X K;  1MYO A;  4G8L A;  5AN8 A;  1YMP A;  4OAV B;  1N11 A;  3T8K A;  3TWW A;  2MYO A;  2P2C P;  4HI8 A;  5KNH D;  3ZU7 B;  5EIB E;  4GPM A;  3NBN B;  2XZD G;  4YDY A;  3TWS A;  1BD8 A;  3ZNG A;  4CZ2 D;  5EIL A;  3Q9U C;  1UOH A;  3AJI A;  1BI8 B;  4HNA D;  2DVW A;  3W9F A;  3F6Q A;  2F8Y A;  1QYM A;  2ETC A;  3TWR A;  1G3N B;  4OAU C;  3UI2 A;  5CER B;  5EN5 D;  1WG0 A;  3NOC D;  5KBA A;  5EYP F;  5BXU A;  1SW6 A;  4HQD A;  4J7W A;  3V2O A;  3NOG D;  4DX5 D;  4F6R D;  1A5E A;  4J8Y A;  1IKN D;  1MX6 A;  2QYJ A;  4DX1 A;  4CYM D;  4K5C A;  4BSZ B;  2Y0B G;  1IHB A;  5ENO D;  5EYL A;  2A5E A;  2J8S D;  2ZGD A;  5ENP D;  1OY3 D;  2ZGG A;  3JXI A;  4G8K A;  5AAO A;  2DWZ A;  2DZN A;  5KNG A;  2L6B A;  5FIN A;  5FIO A;  5ENR D;  4O1P A;  1TR4 A;  4HRM B;  4N5Q A;  4DUI A;  1WDY A;  4U8V D;  5JMN D;  4K5B A;  3V79 K;  2Y1L E;  4BEP A;  4BER A;  3J5Q B;  3LJN A;  3DEO A;  4F1P A;  2XEE A;  1YCS B;  4RLY A;  5CEA A;  2ETB A;  2KBX A;  1AP7 A;  2QC9 A;  2RFA A;  3HG0 D;  5ENS D;  4LSZ E;  5HRY A;  5ENQ D;  5AQ7 A;  1MX2 A;  4ZFH A;  3SO8 A;  3ZUV B;  2XEN A;  3TWT A;  1YYH A;  5CED B;  5AQ9 A;  1AWC B;  4C48 B;  1K3Z D;  4HRL A;  2XZT G;  5ENT D;  2DZO A;  1D9S A;  3B7B A;  4HB5 A;  3B95 A;  1DC2 A;  2NYJ A;  3JUE A;  1BU9 A;  4HBD A;  4UUC A;  2AJA A;  4QQI A;  3JXJ A;  3D9H A;  4NIK A;  4U8Y D;  3TWV A;  3J5P A;  3KEA A;  3EHR A;  1N0R A;  2PNN A;  1IXV A;  1SVX A; 
#chains in the Genus database with same CATH topology
 2GW1 A;  2FI7 A;  4JHK A;  3QWW A;  2HR2 A;  3KEZ A;  3ONL A;  3IV0 A;  1BLX B;  1HFA A;  2JAB A;  3DXM G;  2FEZ A;  4L9P A;  3FTS A;  1QBQ A;  1Y8M A;  1JWF A;  4I6J A;  5J90 A;  2WXJ A;  4BFR A;  4B89 A;  3EDT B;  4I9C A;  1N4R A;  3D3M A;  4G26 A;  1HU3 A;  1E8Y A;  1EYH A;  1B89 A;  3EHM A;  3DPY A;  2NXP A;  3UT7 A;  3Q9U C;  3ASO E;  3F6Q A;  1H2V C;  3OXG A;  2LAI A;  1K8K G;  3V2O A;  2QYJ A;  3CHM A;  3D9I A;  3Q47 B;  3JXI A;  4PH4 B;  4TXR A;  4G24 A;  5EX0 A;  4CDR A;  3HXC A;  3WG7 E;  4BER A;  3J5Q B;  1N52 A;  3N71 A;  5T3R A;  4B8A A;  3PDN A;  5AQ7 A;  1N9A A;  3ZUV B;  3QAR A;  4U8H A;  1EF1 C;  3ULQ A;  2NYJ A;  3JUE A;  1DNP A;  1ELK A;  4UUC A;  2AJA A;  3B7R L;  4HXI A;  4BT8 A;  4XIF A;  3QDN A;  4O6F A;  4BX8 A;  4CCA A;  1YA0 A;  2X38 A;  3E4B A;  4DK5 A;  1WAO 1;  3TWU A;  4JEH A;  3SI5 A;  5DBK A;  5EID A;  2GRQ B;  2V4H C;  3VLE A;  4E6H A;  4U95 D;  3EU9 A;  2AW6 A;  5JJT A;  4V3I A;  3HXD A;  2WM9 A;  5CBN A;  1P5Q A;  1X81 A;  3CLJ A;  3UQ3 A;  4DJA A;  4F53 A;  3UPV A;  4GPM A;  4F3V A;  4B94 A;  4G25 A;  2E0I A;  4GTP A;  4CZ2 D;  3RO2 A;  2LXM A;  2XS1 A;  2ZIS A;  1WM5 A;  3HVE B;  1IQU A;  4J0U A;  4L2Y A;  4RG9 A;  5AJL A;  4LNG A;  4GZD A;  2C0L A;  2R17 C;  3Q15 A;  3TGO A;  1QZ2 A;  2XCB A;  5FIN A;  3CQG B;  2DCP A;  2RD0 A;  1O1R A;  1KZP A;  3FTY A;  2OEV A;  3AG2 E;  4XEI G;  3EIQ C;  4ACL A;  1AP7 A;  3RKV A;  4PUC A;  2CG3 A;  4JHR A;  4FUL A;  4XX5 A;  1E8W A;  4BTA A;  1EDU A;  3LYA A;  4FHJ A;  5FQ8 A;  4CRW A;  3OXL A;  4QQI A;  1OXJ A;  3KEA A;  3PVL A;  3AS5 A;  5JHA A;  1TJF A;  1MZC A;  1IXV A;  2WPV A;  4JL0 A;  3DRA A;  2EQX A;  3QOU A;  3SHF A;  3FUK A;  4O60 A;  3KS2 A;  1NI1 A;  4L23 A;  3RU0 A;  1H2T C;  3TL5 A;  4TRQ A;  1NFI E;  3ZYL A;  4BTB A;  2WXG A;  2EIL E;  4XKC A;  1E8Z A;  4WAF A;  4CT0 A;  3FEX A;  3CVL A;  2IF4 A;  1FT1 A;  2RKK A;  1U3D A;  4A1G A;  5KJN A;  3U66 A;  2MYO A;  2IOL A;  4J8D A;  4JW1 A;  4AVX A;  4GA1 A;  4JD2 G;  4GML A;  2LSU A;  3UT8 A;  5KBA A;  5HI7 A;  2LO6 A;  1SW6 A;  4J7W A;  4OVV A;  3R7Q A;  3LKU A;  3FH7 A;  3Q7A A;  4MKT A;  2Y4T A;  2ZGD A;  3DSW A;  3L82 A;  2LXL A;  3BUA A;  4GZ3 A;  5AIJ A;  5JMN D;  2L0T B;  4AJW A;  1O5M A;  2WXO A;  2V4L A;  4ABN A;  1U3C A;  2QC9 A;  2RFA A;  4HOS A;  1MX2 A;  3LY8 A;  4H7X A;  3EHN A;  3CHQ A;  2LNI A;  4DPR A;  5DIZ A;  3NB2 A;  4A3V A;  4E85 A;  2DZO A;  1KLX A;  1SA4 A;  3KSQ A;  4HOR A;  3UUX A;  4GAA A;  3TWV A;  1ZBP A;  3J5P A;  4ANX A;  3BG1 B;  4NUR A;  2JLB A;  1K1B A;  3E30 A;  3ZYM A;  3K9I A;  1OUV A;  3APD A;  5JA4 D;  3ABK E;  4HI9 A;  3RJV A;  5HS0 A;  4G1T A;  1JCR A;  4GTV A;  3ZGQ A;  5AAR A;  3ZN3 A;  3FTW A;  1NP7 A;  5D2M C;  2VGE A;  4I1O B;  4ZHB A;  1N11 A;  1EPU A;  3PE4 A;  3LY7 A;  3ZU7 B;  3NBN B;  1RZ4 A;  3FUL A;  3FUI A;  5ARG A;  3UM1 A;  3CK8 A;  2A4Z A;  2H6H A;  5J08 A;  5ENO D;  2LUH A;  3ZVV A;  3S7D A;  2CG2 A;  3HXE A;  3ISM C;  4AEZ C;  1OWM A;  4UQZ A;  4A55 A;  3CHR A;  3ZIM A;  2HM8 A;  3LJN A;  2Y4U A;  2UY1 A;  3AS8 A;  5ANR A;  3FTV A;  1DCE A;  5G05 J;  3NF1 A;  3ZXS A;  2GGF A;  1K3Z D;  2XZT G;  1FT2 A;  1DC2 A;  4U0Z A;  4GYO A;  4J8E A;  3FH8 A;  3L22 A;  2XPI A;  2GRN B;  5FZS A;  4FC8 A;  2CFU A;  4JHJ A;  3TAX A;  1O1T A;  1TNZ A;  1UN9 A;  2ETA A;  3OAW A;  3CVQ A;  4K03 A;  3LDZ A;  4LNU D;  4K5A B;  1N94 A;  5D0O D;  4AIF A;  3W9G A;  4GU5 A;  3UKR G;  3CV0 A;  1JCS A;  1H19 A;  1E7U A;  1N4S A;  4YVQ C;  3T8K A;  2FUL A;  3UIN C;  1N54 A;  4YDY A;  3C3O A;  3ZNG A;  4MLP A;  3ULY A;  4GTQ A;  2ETC A;  4HOT A;  5IY5 E;  4DX5 D;  4F6R D;  3FHE A;  1E8X A;  3FDH A;  3FTU A;  5EYL A;  1Z6T A;  2A5E A;  1OY3 D;  4XE0 A;  4OYS A;  4XKB A;  2WXN A;  4GB9 A;  1SQM A;  5T8I A;  5H7P A;  3HVE A;  4DLO A;  2J4D A;  4FLB A;  3HG0 D;  5ENQ D;  2IO3 C;  4NAC A;  1SZA A;  4Q69 A;  2R59 A;  3T5V A;  1NA3 A;  4LCT A;  2E2E A;  1BU9 A;  3CQC B;  3FTZ A;  4FAD A;  3GYZ A;  3SFX A;  2I1K A;  3P1U A;  4Q94 A;  3MA5 A;  3CHP A;  2BKG A;  4NRH B;  4KMO A;  5KJK A;  5HQ8 A;  4WWP A;  1NZN A;  2V5Q C;  2YHC A;  5FWQ A;  1TNB A;  4JXT A;  4I2W A;  2KXP C;  4QFV A;  4LEU A;  2GRL A;  2WXP A;  4EBA G;  1QQE A;  5BNW A;  2P58 C;  4GA0 A;  2EIK E;  2IOS A;  5M72 A;  4UWF A;  1TN7 A;  1IHG A;  1UJJ A;  1SA5 A;  5E75 A;  3TWW A;  4XI9 A;  5KNH D;  2PQR A;  4FLH A;  2FO7 A;  3TWS A;  1BD8 A;  4I2Z A;  5EIL A;  4ANV A;  4ILG A;  4HFG A;  3TWR A;  2VQ2 A;  4OAU C;  2XQ0 A;  3Q49 B;  5EN5 D;  4HVB A;  4ME2 A;  1X5B A;  2WVI A;  3FU0 A;  2AWI A;  4FJY A;  4UWH A;  1OWL A;  1HX8 A;  3C3R A;  4TUU A;  3MV2 B;  2KZT A;  1H6O A;  3L9T A;  3VLD A;  4JA7 A;  3APC A;  2XRY A;  4U04 A;  2VGX B;  1PAQ A;  2FF4 A;  2HYZ A;  4DUI A;  1KT0 A;  1HH8 A;  3BU8 A;  3UTM A;  3QJZ A;  3ESK A;  4APO A;  5FT9 A;  3C5R A;  5AQA A;  3ZKJ A;  1BPO A;  4O1O A;  1E90 A;  4TV3 A;  2OOE A;  2HE0 A;  3IHY A;  5AQB A;  2YQ8 A;  1H0A A;  3TWX A;  2L0I A;  4RSY A;  3HDX A;  2GRR B;  1UW4 B;  5B3S E;  3R7R A;  3PZ3 A;  4APF A;  2C2L A;  4BT9 A;  2CFZ A;  1NL4 A;  1E7V A;  5AJD A;  1IKN D;  1MX6 A;  1HS6 A;  2VSO E;  3AS4 A;  4U63 A;  2XHE A;  2P9P G;  2BTD A;  4AP2 A;  1TNU A;  3MEK A;  4UQX A;  3O4Z A;  2DBA A;  3MKQ B;  3KAE A;  2LAH A;  4M3O A;  3SFY A;  3BEE A;  2XEE A;  3FUH A;  4B8C B;  3DST A;  4AY6 A;  2MOW A;  4EQF A;  4B0Z A;  2DYS E;  4N39 A;  4AM9 A;  2XPY A;  4I43 A;  4KVO A;  3QNK A;  3I5P A;  3LVQ E;  3UKU G;  3HRA A;  3ZXP A;  2GRM A;  3EJN A;  1MJ0 A;  4L1B A;  2ILR A;  1N0Q A;  3NQP A;  2J09 A;  3ZFW A;  1UN8 A;  4GYW A;  4XI0 A;  4GMR A;  2XCC A;  3V2X A;  4IRU A;  3RRU A;  3JUI A;  4B93 B;  1N95 A;  4LRZ A;  3BG0 B;  5FZQ A;  2OVF A;  4UI9 J;  4ATZ D;  1PY1 A;  4HS2 A;  5AN8 A;  2X6H A;  2XRZ A;  4OAV B;  5LP0 A;  3DSS A;  5G04 J;  2X6I A;  2EIN E;  4HLE A;  4HNA D;  3RAU A;  2I6H A;  2PQN A;  2VSX E;  4N3B A;  1V54 E;  2P9I G;  2BED A;  2Y0B G;  1H6K A;  1IHB A;  3KSL A;  5ENP D;  1DVP A;  3DWL G;  4Q96 A;  3VTY A;  3SNX A;  3MJW A;  3L54 A;  3D9J A;  1JPL A;  3JYS A;  2X6J A;  3KD7 A;  1KZO A;  1YCS B;  2ETB A;  5ENS D;  4C9B B;  3MCX A;  3FY4 A;  3SO8 A;  1A17 A;  3CKC A;  2OCC E;  1TYQ G;  4NQ0 A;  5AQ9 A;  1AWC B;  1D9S A;  2LSV A;  4K0R A;  4YDO A;  1Z3Y A;  4N3C A;  4IUL A;  3FTX A;  4HLL A;  5FQ4 A;  1FVH A;  3EU5 A;  4GTT A;  3VTX A;  4YDW A;  4HRN A;  4CT4 A;  5A6C A;  3I3N A;  1DCQ A;  4P29 A;  3Q7F A;  3RIB A;  2YHE A;  1D8E A;  3CVW A;  5D0Q D;  4DX7 D;  1Y6I A;  1MX4 A;  4L7T A;  5EX3 A;  2PL2 A;  3U4T A;  3FUM A;  3FUE A;  1SZ9 A;  1K1A A;  1S0P A;  3QAQ A;  3O48 A;  3CVX A;  3CVV A;  4A3T A;  3L08 A;  5AEN A;  3L13 A;  4J6I A;  3GZ2 A;  4MRU A;  1WG0 A;  3ASG A;  3BQO A;  3ESL A;  5LFA A;  3CKB A;  3SD5 A;  4KBQ A;  4AV7 A;  2J8S D;  5A23 A;  2DWZ A;  2DZN A;  4YDE A;  3T5X A;  4UQY A;  4N5Q A;  3S7F A;  4G23 A;  1JUQ A;  4GZC A;  2L9B A;  2WXL A;  4R7L A;  4N5C A;  2VTB B;  2OVB A;  1HXI A;  5FZR A;  5FQ7 A;  3S7J A;  4EZJ A;  4PS7 A;  4ZFH A;  2CHZ A;  1Q2Z A;  3TWT A;  2RG8 A;  1W3B A;  2XEV A;  3Q5M A;  3D9P A;  3MYV A;  4DLQ A;  4U7E B;  2Y3A A;  3ZHE A;  4NIK A;  3RO3 A;  3MGB A;  3QWV A;  4BX9 A;  3NZU A;  4LNB A;  2PNN A;  4U0U A;  2DYR E;  3EIJ A;  3IEG A;  3AAA C;  3IXE A;  1HO8 A;  3AU5 A;  4XZ4 A;  1OWP A;  4WUY A;  3UIP C;  2RFM A;  2VJ8 A;  4ILI A;  3E37 A;  4U0S A;  2PM7 A;  3LEW A;  5G04 C;  3X2Q E;  4OVU A;  1TJC A;  4KVM A;  1OCO E;  1OT8 A;  2J9Q A;  4UI9 C;  2HO1 A;  3ABM E;  5LCW J;  2P9N G;  3UXG A;  4H7Y A;  1UG3 A;  5EDS A;  3URZ A;  3LJ3 A;  4U96 D;  4URK A;  3DSU A;  4ANW A;  1OWN A;  4G8L A;  2WXK A;  4X8Q A;  2P2C P;  4D10 C;  2I2O A;  5EIB E;  4DI4 A;  3FU6 A;  1E96 B;  3PRE A;  1HZ4 A;  3PUJ A;  2H6F A;  1BI8 B;  3SF4 A;  2CHW A;  2GRP B;  5FTP A;  4C0M A;  5E76 A;  3RRM B;  2WB2 A;  3NZS A;  4L2L A;  5BT1 A;  3ZYQ A;  3T8M A;  4G8K A;  4ATG A;  5KJL A;  3NAW A;  2KCK A;  3DPD A;  2Y69 E;  1WDY A;  1WY6 A;  2R2L A;  5CMY A;  4GCN A;  1RW2 A;  3ASF A;  3B7S A;  5CEA A;  2KBX A;  3APF A;  4A1S A;  1N4P A;  4BSX A;  1FVF A;  1NA0 A;  2QYU A;  3DXK G;  4UWG A;  1D8D A;  4EPZ A;  3B95 A;  1L5J A;  4LUN U;  4I9E A;  2XGM A;  1VDY A;  4KT6 B;  1PC2 A;  3MKR A;  3I4G A;  4WND A;  2BKK B;  2IQC A;  5BV0 A;  4LG6 A;  2VTB A;  4DX6 D;  2ION A;  2WXQ A;  4HOQ A;  3HXB A;  3R9A B;  5LOZ A;  5G55 A;  2KM4 A;  5BV1 A;  3MV3 B;  4GMJ A;  4TUM A;  3TG5 A;  1JWG A;  4GPK A;  3QWP A;  1KT1 A;  3OTN A;  4JB8 P;  4WWN A;  3ZHE B;  1TN6 A;  2PZI A;  3FH5 A;  1OWO A;  5BW8 C;  3LY9 A;  1XGW A;  2PM6 A;  3B7U X;  3QK0 A;  3Q4A B;  3GZ1 A;  3L6A A;  2R05 A;  2OV8 A;  4I1A A;  2WQH A;  3CK9 A;  2ZGG A;  3LCA A;  3ZW3 A;  2VGX A;  5KNG A;  5FIO A;  3FU3 A;  4EEC A;  2IFU A;  4ILH B;  2KCV A;  3U64 A;  3HXF A;  4G2V A;  5EKQ D;  2WQ6 A;  3D9K A;  1FPP A;  1QNF A;  2GRO B;  2AXV A;  2XEN A;  1JCQ A;  2IY0 C;  3CK7 A;  3L17 A;  5CMW A;  4W9R A;  3D9H A;  4BY6 A;  3PNT B;  3EHR A;  3E32 A;  4WNF A;  3TG4 A;  3FUJ A;  4YND A;  2J08 A;  1FCH A;  2R03 A;  3JCK C;  4I17 A;  3FFL A;  5ARF A;  4CGV A;  4A63 B;  4JPS A;  3CSF A;  4GTM A;  1OCR E;  3G2V A;  3SGH A;  2V0P A;  2IU1 A;  2MRI A;  5JJ7 A;  5ITZ F;  1BI7 B;  4DI3 A;  2MHK A;  3UMV A;  4FP7 A;  4Z68 A;  2M63 A;  4KYO B;  5KWD A;  3ULE G;  4GTS A;  3RK6 A;  5A7D B;  4RG6 A;  4C0E A;  3TXM A;  1UOH A;  2DVW A;  3PRZ A;  2JEK A;  2XS8 A;  3OXF A;  1XNF A;  3FUN A;  5JJ6 A;  4BSZ B;  3FUF A;  2UY1 B;  3Q73 A;  1TR4 A;  4HRM B;  2C0M A;  2UWJ G;  4K5B A;  3CVP A;  4UWK A;  3CVU A;  3PZ2 A;  4MS6 A;  2BUG A;  3ASD A;  4HRL A;  3FEY A;  2KCL A;  1ELW A;  4UI9 K;  3B7B A;  4HBD A;  1OCC E;  1O1S A;  5KCM A;  4ACK A;  2EIM E;  4EHM A;  1KPS B;  3TXN A;  2P9S G;  1N0R A;  1YMP A;  1MHQ A;  3PE3 A;  3B13 A;  5CRU A;  3DEP A;  1MQS A;  2F0Y A;  4BES A;  3Q75 A;  3PS6 A;  4RQI A;  2J49 A;  2NSZ A;  4YVO A;  2WMN A;  5CEC B;  5KJM A;  3PEV B;  1HG5 A;  4EZK A;  3EHQ A;  4JZY A;  2WXR A;  3PUK A;  4TXP A;  3G2W A;  2KZT B;  4ANU A;  3ENE A;  2QZA A;  2OEW A;  2IJG X;  2XZD G;  3SY2 A;  3I4R B;  3AG4 E;  2WQ7 A;  5CER B;  3QC1 A;  2I1J A;  3SBS A;  4DX1 A;  4CGW A;  3HHM A;  4I6E A;  5AAO A;  4Y6C A;  3PZD A;  1LD8 A;  4G11 A;  2V8S E;  5ENR D;  2XGO A;  2CHX A;  3ZEF A;  2AVP A;  4GYY A;  4I6G A;  2R02 A;  2WXH A;  3ZYK A;  2VGY A;  5G05 C;  5BUZ A;  3LS8 A;  5CED B;  4U07 A;  3D9N A;  1N4Q A;  4F1S A;  2YIN A;  3UX4 A;  2WXI A;  3ASN E;  3CGH A;  5T4Y A;  4Y6W A;  4M7C A;  1S63 A;  4GTO A;  4GZ5 A;  2X3M A;  3IHV A;  5ANL A;  3PZ1 A;  4JA9 A;  1GW6 A;  3ABL E;  3CEQ A;  3CHO A;  3GZS A;  2J07 A;  3S7B A;  2IO2 C;  2AXU A;  1LF8 A;  3AU4 A;  3SFZ A;  5BPP A;  3Q78 A;  3RSE G;  5B1B E;  3G2S A;  3TWQ A;  4DX2 A;  3U9W A;  3CST A;  5CRV A;  3GW4 A;  3D9O A;  5C2Y A;  4AOF A;  3VLF A;  2P9U G;  3AJI A;  1ELR A;  4GA2 A;  1QYM A;  1G3N B;  4N2S A;  1Z3X A;  2KC7 A;  3LVR E;  3ZRH A;  3C98 A;  3ML9 A;  4RVB A;  5BXU A;  4BWR A;  2KAT A;  4HQD A;  3UM2 A;  2ZXW E;  3NOG D;  2YNQ A;  3C72 A;  4LER A;  3RRN B;  2I9C A;  1HE8 A;  3UM0 A;  4O1P A;  3AG1 E;  4CEM A;  3ASH A;  4U8V D;  1HG2 A;  3V79 K;  4BEP A;  3R9M A;  3FU5 A;  3DEO A;  3FP3 A;  3UT4 A;  4RLY A;  5FQ6 A;  5C1D A;  5HRY A;  1V55 E;  4JC8 A;  2VYI A;  3U3W A;  4TXQ A;  5CHE E;  4C48 B;  2EIJ E;  3UIO C;  4CDN A;  3FWV A;  1ZU2 A;  3HYM B;  4FA6 A;  3JXJ A;  4U8Y D;  3EUV A;  3LXU X;  4GTR A;  2AXZ A;  3FUD A;  2VSY A;  3DBS A;  3DSX A;  5D66 A;  2X6F A;  1INZ A;  1ZB1 A;  3T9K A;  4KZ0 A;  3D9L A;  2QY7 A;  3V31 A;  2NC9 A;  2DIW A;  4BET A;  3PNL B;  5HKP A;  1UJK A;  2Q7F A;  2XGS A;  3Q9N C;  3DSV A;  3PEU B;  3ONK A;  4DRX E;  3PH0 C;  2FO1 E;  1H6P A;  1TN8 A;  3V30 A;  2QFC A;  4PDX A;  2F37 A;  2H6I A;  4IYP A;  2F8X K;  2X6K A;  1LD7 A;  3QKY A;  4HI8 A;  1U2V G;  3CIA A;  2V5F A;  3HIZ A;  3W9F A;  3B7T A;  4J8S A;  1IQR A;  3D9M A;  3JQ0 A;  3UI2 A;  2R5S A;  5LX8 A;  1IYG A;  2P9K G;  3NOC D;  5EYP F;  4WNE A;  4JVS A;  3CR3 A;  3MZL B;  2IEJ A;  2WXF A;  4CYM D;  3E34 A;  3TJP A;  5LCW C;  5JHB A;  2ZU6 B;  4UWL A;  5FJY A;  3PZ4 A;  5G2N A;  4EZL A;  3ZPJ A;  5ENN A;  4KXK B;  3WXX A;  3CVY A;  3UM3 A;  3MKQ A;  3IBE A;  4FU3 A;  1YYH A;  4EBA A;  4PS8 A;  4GZ6 A;  1H2U A;  3CHS A;  4N2Q A;  3C3Q A;  4FHK A;  2ZIR A;  3IKO B;  3P2B A;  3SBT B;  2H6G A;  1TEZ A;  2B0O E;  5CCM A;  3AG3 E;  3G2T A;  3G2U A;  2FBN A;  3E33 A;  2L6J A;  4WWO A;  1S70 B;  2XEH A;  5CBO A;  3LPZ A;  5CCL A;  1OCZ E;  3ML8 A;  3QB2 A;  4MBG A;  2P9L G;  5BXO A;  4AXH A;  1MYO A;  2J4B A;  1Z5S C;  1LTX A;  1S64 A;  2VSN A;  4WNG A;  4JEU A;  4HOU A;  3CVN A;  1HF8 A;  3S2A A;  2OND A;  3JQ1 A;  3MX3 A;  4FJZ A;  1TNO A;  2F8Y A;  4PS3 A;  2XPZ A;  2B6C A;  4J8F A;  1A5E A;  2A5U A;  4J8Y A;  4F7A A;  4K5C A;  4GCO A;  5AYW D;  2L6B A;  3SZ7 A;  2WXM A;  2Y1L E;  2BF0 X;  4F1P A;  5B1A E;  4LSZ E;  4KZC A;  3Q79 A;  4AY5 A;  4CDM A;  4IN3 B;  4N3A A;  5ENT D;  4HB5 A;  1TNY A;  2WMO A;  3L16 A;  4I1M A;  3SQV A;  1SVX A; 
#chains in the Genus database with same CATH homology
 5D66 A;  1K1B A;  3UTM A;  4HLL A;  3AAA C;  3IXE A;  2B0O E;  2BKG A;  3T9K A;  2BKK B;  1BLX B;  4O60 A;  2RFM A;  3HRA A;  3DEP A;  4YDW A;  2JAB A;  3V31 A;  3TWU A;  4HRN A;  3C5R A;  2V5Q C;  4BET A;  4LG6 A;  5AQA A;  3ZKJ A;  4DX6 D;  5JA4 D;  5EID A;  1DCQ A;  4BES A;  4A63 B;  2V4H C;  2ETA A;  5HKP A;  1MJ0 A;  4HI9 A;  2KXP C;  4LNU D;  5HS0 A;  1S70 B;  1NFI E;  2XEH A;  3Q9N C;  1N0Q A;  4K5A B;  4O1O A;  4QFV A;  5CBO A;  1OT8 A;  4DX7 D;  1MX4 A;  4U95 D;  3W9G A;  4DRX E;  4GMR A;  4TUM A;  3V2X A;  3EU9 A;  2HE0 A;  5CEC B;  5AAR A;  5ITZ F;  2FO1 E;  5AQB A;  3UXG A;  3V30 A;  1BI7 B;  3EHQ A;  2F37 A;  4B93 B;  2VGE A;  5CBN A;  4Z68 A;  3TWQ A;  3TWX A;  4DX2 A;  4ZHB A;  4U96 D;  4JB8 P;  1K1A A;  5KWD A;  5BXO A;  4ATZ D;  2F8X K;  1MYO A;  4G8L A;  5AN8 A;  1YMP A;  4OAV B;  1N11 A;  3T8K A;  3TWW A;  2MYO A;  2P2C P;  4HI8 A;  5KNH D;  3ZU7 B;  5EIB E;  4GPM A;  3NBN B;  2XZD G;  4YDY A;  3TWS A;  1BD8 A;  3ZNG A;  4CZ2 D;  5EIL A;  3Q9U C;  1UOH A;  3AJI A;  1BI8 B;  4HNA D;  2DVW A;  3W9F A;  3F6Q A;  2F8Y A;  1QYM A;  2ETC A;  3TWR A;  1G3N B;  4OAU C;  3UI2 A;  5CER B;  5EN5 D;  1WG0 A;  3NOC D;  5KBA A;  5EYP F;  5BXU A;  1SW6 A;  4HQD A;  4J7W A;  3V2O A;  3NOG D;  4DX5 D;  4F6R D;  1A5E A;  4J8Y A;  1IKN D;  1MX6 A;  2QYJ A;  4DX1 A;  4CYM D;  4K5C A;  4BSZ B;  2Y0B G;  1IHB A;  5ENO D;  5EYL A;  2A5E A;  2J8S D;  2ZGD A;  5ENP D;  1OY3 D;  2ZGG A;  3JXI A;  4G8K A;  5AAO A;  2DWZ A;  2DZN A;  5KNG A;  2L6B A;  5FIN A;  5FIO A;  5ENR D;  4O1P A;  1TR4 A;  4HRM B;  4N5Q A;  4DUI A;  1WDY A;  4U8V D;  5JMN D;  4K5B A;  3V79 K;  2Y1L E;  4BEP A;  4BER A;  3J5Q B;  3LJN A;  3DEO A;  4F1P A;  2XEE A;  1YCS B;  4RLY A;  5CEA A;  2ETB A;  2KBX A;  1AP7 A;  2QC9 A;  2RFA A;  3HG0 D;  5ENS D;  4LSZ E;  5HRY A;  5ENQ D;  5AQ7 A;  1MX2 A;  4ZFH A;  3SO8 A;  3ZUV B;  2XEN A;  3TWT A;  1YYH A;  5CED B;  5AQ9 A;  1AWC B;  4C48 B;  1K3Z D;  4HRL A;  2XZT G;  5ENT D;  2DZO A;  1D9S A;  3B7B A;  4HB5 A;  3B95 A;  1DC2 A;  2NYJ A;  3JUE A;  1BU9 A;  4HBD A;  4UUC A;  2AJA A;  4QQI A;  3JXJ A;  3D9H A;  4NIK A;  4U8Y D;  3TWV A;  3J5P A;  3KEA A;  3EHR A;  1N0R A;  2PNN A;  1IXV A;  1SVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...