3TWXA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human fnbp1 (chimeric peptide)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
b'MGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 51
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twxA00
1QYMA 4YDWA 2QYJA 3HRAA 1N0QA 2ETBA 4G8LA 4BERA 1S70B 2V5QC 4U8YD 3ZUVB 4O60A 4HNAD 5AQAA 1BU9A 2L6BA 4DUIA 5D66A 2ZGDA 4U96D 3UTMA 2AJAA 1D9SA 5AQ9A 5AAOA 4NIKA 4HB5A 4HRNA 3J5PA 2RFMA 2DWZA 3AJIA 4O1PA 5EN5D 4DX1A 5JA4D 1A5EA 2DZNA 2Y0BG 4QFVA 3NOCD 4U8VD 2V4HC 4DX5D 4F6RD 1BLXB 4QQIA 1SW6A 3V79K 2ZGGA 4YDYA 3T8KA 4UUCA 3ZU7B 4GPMA 4HI8A 5EIDA 2Y1LE 4K5AB 3NOGD 4ATZD 4HLLA 3DEOA 5CBNA 2XENA 5FINA 2J8SD 3LJNA 1MYOA 4RLYA 4G8KA 3KEAA 2JABA 1IKND 4BETA 1MX4A 5EYLA 5ENSD 1IXVA 4J7WA 2B0OE 2KXPC 4DX6D 5FIOA 3Q9NC 2NYJA 3V31A 4ZFHA 3T9KA 3D9HA 1MJ0A 2HE0A 4BESA 4DX2A 5CERB 5JMND 3V2OA 1N11A 5AARA 2PNNA 1YYHA 3AAAC 4OAVB 1SVXA 1AWCB 3SO8A 2FO1E 1IHBA 4HBDA 3J5QB 3UI2A 3EHRA 1BD8A 4LSZE 1BI7B 4A63B 3C5RA 1YMPA 5HRYA 5EYPF 4JB8P 5EILA 2QC9A 1YCSB 2DVWA 3IXEA 5ENPD 4Z68A 4HQDA 3JUEA 4HI9A 1UOHA 4LG6A 1DC2A 5ENQD 2A5EA 5EIBE 2XZDG 5AQ7A 2XZTG 3B95A 4J8YA 2DZOA 4B93B 3TWTA 4HRLA 2F37A 5KNHD 3EU9A 5CEDB 1N0RA 3NBNB 3TWWA 3ZNGA 5HKPA 4TUMA 3JXIA 4OAUC 1WDYA 4LNUD 2BKKB 4HRMB 1TR4A 3F6QA 4DX7D 4O1OA 4C48B 1K1BA 3V2XA 5KBAA 3JXJA 5KNGA 4CYMD 5ENRD 5AQBA 4ZHBA 2KBXA 2ETAA 2RFAA 3TWQA 1K1AA 2MYOA 4GMRA 3W9GA 4F1PA 1AP7A 5BXUA 4U95D 1MX6A 3HG0D 5BXOA 3TWSA 1K3ZD 1NFIE 4N5QA 2VGEA 4K5BA 5HS0A 3TWXA 4BSZB 5ENOD 2XEEA 3DEPA 1G3NB 2BKGA 4CZ2D 2XEHA 5CEAA 1DCQA 3TWRA 3TWVA 3UXGA 3TWUA 1OY3D 4BEPA 1BI8B 2P2CP 1WG0A 2F8YA 2ETCA 1OT8A 3EHQA 5KWDA 3Q9UC 5CECB 1MX2A 4K5CA 3W9FA 4DRXE 3B7BA 5ENTD 5ITZF 3V30A 5AN8A 5CBOA 3ZKJA 2F8XK
chains in the Genus database with same CATH superfamily
4PDXA 4BERA 4C9BB 4JXTA 5FQ8A 2VTBA 5E76A 5D66A 3ML9A 3CHMA 2BF0X 1HG2A 2AWIA 4HRNA 5EX3A 5E75A 4AJWA 1L5JA 3CEQA 4B8AA 3UIPC 3MEKA 1MYOA 5KJMA 2VTBB 5EYLA 4J7WA 3QWWA 3TXMA 1ELRA 1HG5A 3X2QE 3ESKA 3O4ZA 2BTDA 2P9PG 3EIQC 4XKCA 1JCRA 4LSZE 3C5RA 3PDNA 2XZTG 4TXQA 4TUUA 3L08A 1X5BA 3VLFA 2YQ8A 1LD7A 3U3WA 2J08A 4NACA 1S64A 3RKVA 1TR4A 2DYSE 4GYYA 3E34A 1OWPA 2CHXA 2WPVA 5AQBA 3ASOE 5FT9A 1O1SA 3LJ3A 1PAQA 3L9TA 4YVQC 4GMRA 4I1AA 2FULA 2XPYA 4G24A 4FC8A 5HI7A 4N5QA 5HS0A 3MKRA 3ZHEB 2WXRA 3FEYA 3FWVA 1QQEA 2IU1A 3W9FA 3D9IA 2GRRB 3ABME 5C1DA 3KD7A 2OCCE 3T5XA 3NF1A 2JLBA 3PUJA 5G04J 4N3CA 4F6RD 2ZGGA 3DXMG 1RW2A 2R05A 3UM2A 4UWKA 3QK0A 3LY9A 3CHOA 2XGOA 2OVBA 4LNGA 4FJYA 4OAVB 3VLDA 4EECA 3J5QB 2WB2A 1H0AA 4KZ0A 2PQRA 1U3CA 3KAEA 1QNFA 2ONDA 5T3RA 4KVOA 1Y8MA 3TGOA 4B0ZA 4UQYA 4O1OA 4C48B 2NXPA 2RFAA 3IBEA 3D9PA 4N3BA 2BUGA 4F7AA 1H6KA 1N4RA 3UIOC 2GRLA 1KZPA 4GA1A 4KZCA 2ETCA 5EX0A 3EHQA 3R7QA 3SY2A 3E32A 3SHFA 2IEJA 3V30A 4L9PA 3ABKE 2F8XK 1FVHA 3EDTB 2CG3A 3FTUA 2ZIRA 4HNAD 2IY0C 4U0ZA 1IQUA 1RZ4A 1P5QA 3D9MA 2OV8A 4JHKA 5AQ9A 3LY8A 5D0OD 2DZNA 2XS8A 2L6JA 4TRQA 2YHCA 3Q15A 5BT1A 4HS2A 2E2EA 2WXHA 4YNDA 1XNFA 4G8KA 4JC8A 3GZ2A 3CVPA 3QAQA 2KCVA 5FZSA 4CGVA 3V31A 3URZA 3I4GA 2PL2A 3Q78A 4H7YA 4ACLA 5FJYA 2KZTA 4FHKA 1YMPA 3AU5A 5EYPF 5CMWA 4E85A 2F0YA 4Z68A 4K0RA 4C0EA 3Q73A 1UOHA 5KJNA 4AEZC 3QARA 5JJ6A 4N2QA 3G2VA 5HKPA 1K1BA 3G2WA 5KNGA 3CK8A 2KZTB 3FEXA 3FTXA 4I6GA 3W9GA 4Q94A 3FDHA 4I9EA 5KJLA 1OCCE 3TXNA 3TWXA 2WMNA 3QWVA 4K5BA 3LXUX 3D9NA 1JCSA 2RKKA 2I6HA 4JD2G 3TWUA 1MQSA 4CDMA 3OTNA 4JW1A 5LOZA 5ENTD 5ANRA 4ACKA 4GPKA 5AYWD 3LKUA 3JQ0A 1FPPA 5FTPA 4J8SA 1A5EA 4A1SA 2PZIA 3FTYA 3AS4A 3HYMB 3AU4A 2EIME 1TNZA 3B13A 4GYOA 3GYZA 3C3RA 3PEUB 4L2LA 4G1TA 2GRMA 4LRZA 3RO3A 1OXJA 1U3DA 4ANXA 3T9KA 4U63A 4DX2A 5ANLA 4G23A 4KXKB 1IHBA 2QC9A 4GTVA 5CHEE 3SBSA 4AVXA 5ENQD 3Q47B 4HRLA 2EIJE 3EU9A 3FUNA 1WDYA 4RVBA 5A23A 5KBAA 1OWOA 1ZU2A 3FFLA 5CRVA 5IY5E 3CHSA 2AXZA 4FADA 3OAWA 3LCAA 4PS8A 2R2LA 5LX8A 3FTVA 4FULA 1HH8A 1E7UA 3LPZA 3QC1A 3RAUA 4GMLA 2M63A 2J4DA 5BPPA 1BU9A 2C2LA 2RG8A 3OXFA 3FULA 3FUFA 4XX5A 2I1JA 4UI9C 4GTSA 4NQ0A 4HXIA 1TJCA 1SW6A 1UJJA 3AG1E 3T8KA 4HI8A 4WWOA 2KM4A 4DI4A 3TL5A 4FJZA 3B7UX 1HXIA 3L54A 2V0PA 1E8XA 2YNQA 4AIFA 4M7CA 2NC9A 5AJDA 4HBDA 4HOUA 5LCWJ 4A63B 2X6JA 3PNLB 2EIKE 2L0IA 4BTAA 3JQ1A 3TWWA 2CFZA 1Z5SC 1OCZE 2GW1A 4R7LA 3Q5MA 3FTWA 3ZYLA 2EQXA 2XQ0A 2P9SG 5BXUA 3HXBA 4DJAA 1DNPA 3QB2A 3RU0A 5BW8C 2P2CP 3CVUA 4I43A 3CQGB 3Q9UC 3MX3A 5AJLA 4JHRA 2GGFA 3ZYMA 2V5QC 4AY6A 2X3MA 2X38A 3UMVA 5CCLA 3ZN3A 1OWNA 4LCTA 3E37A 3EU5A 2NSZA 4N2SA 4PS3A 4DX1A 2DWZA 4U7EB 2V4LA 4UUCA 4CGWA 4HFGA 1X81A 4O6FA 3DSWA 3SBTB 2VYIA 1IYGA 3QKYA 5ENSD 2GROB 2VGXA 3PVLA 4UI9K 4D10C 5JMND 3V2OA 2WXQA 3ENEA 2XGSA 4A3VA 1Y6IA 1TNYA 4KBQA 3S7FA 3ULQA 3CGHA 2P9KG 3DSSA 1SQMA 2UWJG 1FT2A 2VGXB 4MBGA 3NBNB 3VTYA 2EINE 3D9KA 2BKKB 3FUDA 3F6QA 3CHRA 2V5FA 3V2XA 2IOSA 3JXJA 1H6OA 1GW6A 4YVOA 3ULYA 3RJVA 4BWRA 2VGYA 1E8ZA 4G11A 2CG2A 3TG5A 1N9AA 3ZIMA 3AG2E 1WM5A 4N39A 5D0QD 3IEGA 4FLHA 1N4QA 3ZHEA 3SGHA 4BFRA 2F8YA 2I1KA 4DRXE 3B7RL 2FI7A 2VSYA 3HXEA 3PNTB 4BX8A 3Q4AB 4JEHA 3RSEG 2P9LG 4ATGA 4HOSA 5B3SE 1N4PA 4LNBA 4AY5A 4O1PA 3SD5A 4U8VD 3TG4A 2V4HC 4GA2A 2C0MA 5BUZA 4V3IA 4GPMA 2Y1LE 4K5AB 2FF4A 3FU5A 3ASNE 2LAHA 1W3BA 4GTTA 1FCHA 3ABLE 2XPIA 3K9IA 3B7TA 2MOWA 3LYAA 4CT4A 5FQ6A 3FH5A 4RG6A 2FBNA 5G05J 1YYHA 3IHVA 2DCPA 2WXLA 4G25A 4OVVA 4ILIA 1YCSB 2DVWA 3FU3A 3HDXA 1KT1A 5EIBE 4GZ6A 3ZXSA 3TAXA 2X6IA 2ZISA 3FP3A 3ZNGA 3BUAA 5AENA 3QOUA 2GRPB 5CCMA 2FEZA 4CYMD 1H2TC 3NZUA 2WXKA 3MYVA 2JEKA 1ELWA 1UG3A 2IONA 2BEDA 3PUKA 3OXGA 1K8KG 2R02A 2VGEA 3PZ1A 3SNXA 1HU3A 1N4SA 4GAAA 4I6JA 4DLOA 3O48A 2Y4TA 4JPSA 3D9LA 1OY3D 1EDUA 5A6CA 4B8CB 2DIWA 3E30A 3GZSA 5G2NA 4BX9A 2EILE 3ASGA 1SA4A 3FUIA 5CMYA 3CVXA 4GTQA 1S70B 2A5UA 3NB2A 5JHBA 5AIJA 4J6IA 3AG4E 3CVLA 2AJAA 3DBSA 4ILHB 1E90A 3MKQA 4GTPA 2RFMA 1TN8A 3RRUA 2Y0BG 1JWFA 3WXXA 1OWLA 3MGBA 1NP7A 4C0MA 3FU6A 5CBNA 2X6KA 4URKA 2P9IG 2Q7FA 4LEUA 5T4YA 5FZQA 5H7PA 5BV0A 5FIOA 1WAO1 3MKQB 1HZ4A 3Q75A 2HE0A 3Q7AA 3ZEFA 1KT0A 2WQ7A 1NZNA 4MRUA 5ENPD 4HQDA 3R9AB 3Q79A 1NI1A 2RD0A 1LD8A 2OOEA 4ANUA 5JJ7A 4FU3A 4XE0A 1N95A 2MYOA 3ONKA 1AP7A 3CIAA 1MX6A 3G2SA 3KEZA 1TN7A 4G2VA 5BV1A 1TNUA 3BG0B 2GRNB 3CR3A 2WXGA 1DCQA 1KLXA 3TWRA 4WNFA 4K5CA 3S2AA 3UM1A 2WQ6A 4W9RA 1JUQA 5D2MC 1V54E 4BT9A 3S7JA 3CKBA 5AQAA 3DSVA 4AM9A 2LUHA 4RG9A 3FH8A 4ABNA 3T8MA 5EN5D 4P29A 2QY7A 1BLXB 2PQNA 3EHNA 5EIDA 2H6GA 2I9CA 3ISMC 3C3OA 5FINA 3FTZA 1JCQA 4BETA 4B94A 3GZ1A 2LSVA 3Q9NC 3D9JA 3MJWA 3UKRG 3ZW3A 4EBAG 3UT7A 1TEZA 3AAAC 3IKOB 3EHRA 3T5VA 3BG1B 2V8SE 4U0SA 3JUEA 4HI9A 4DI3A 4LG6A 2J07A 2XZDG 4WNEA 3KSQA 3CVVA 3DSUA 1N0RA 2Y4UA 2L9BA 4TUMA 3JXIA 3ULEG 4HRMB 3FHEA 1LTXA 1EF1C 3QDNA 1E96B 5BXOA 1U2VG 4MLPA 2BKGA 5CEAA 2XEHA 3TWVA 2KCKA 2LSUA 4Y6WA 3LEWA 1YA0A 1BI8B 1WG0A 4XI0A 4I17A 4XI9A 2LXMA 2AVPA 3D3MA 3PZ2A 3HXCA 2QYJA 4HORA 4UWFA 2AXVA 4NURA 3EUVA 3AG3E 4CDNA 2HM8A 4DUIA 2ZGDA 1O1TA 4WWNA 3ZYKA 1KZOA 3SFYA 3AJIA 5JA4D 3FH7A 4JA7A 4DX5D 3DRAA 3ZU7B 4ATZD 3NQPA 3RRMB 3MV2B 1H2VC 1H2UA 4OYSA 3FY4A 4IRUA 2CFUA 4FLBA 1MX4A 3BQOA 3PS6A 4ZFHA 4IN3B 4ANWA 3GW4A 5EKQD 3L17A 4AOFA 5HRYA 1SZAA 3PEVB 3DPYA 2DYRE 1UN9A 3CK7A 4AV7A 1WY6A 4UWHA 2WXOA 2XGMA 3EIJA 1TNBA 4EHMA 1HF8A 1NL4A 3B7SA 3PRZA 1NA3A 2R5SA 3CVQA 4WAFA 3CVNA 2MRIA 2KBXA 5EDSA 3L6AA 1H6PA 1LF8A 2H6HA 3I4RB 3ML8A 3FU0A 2AXUA 2KC7A 2OEWA 3U64A 2P9UG 2XS1A 1HE8A 4GTMA 4U04A 5CECB 2VSXE 4LUNU 5FZRA 4HLEA 3B7BA 3CQCB 4GTOA 5AN8A 5CBOA 3RK6A 4GCNA 4YDWA 1N0QA 5ARGA 4U8YD 3ZUVB 3E33A 4U96D 2OVFA 2XCCA 2WXNA 2B6CA 2AW6A 3SZ7A 2LNIA 4L1BA 3DPDA 4CDRA 4KVMA 3JYSA 2FO7A 3UPVA 3ZPJA 1Z3YA 3SFXA 4GYWA 4LERA 4K03A 3PZ3A 5G04C 2KATA 2J9QA 3OXLA 4UQXA 2X6HA 3NZSA 3L82A 3TJPA 4TXPA 3L16A 3PE4A 4BSXA 3HXDA 2VJ8A 4FP7A 4APFA 2J09A 3DSXA 2DZOA 3FUHA 5KNHD 4N5CA 2PM7A 2WM9A 4EPZA 4F1SA 4BY6A 2E0IA 4ILGA 2ZU6B 2H6IA 4I2WA 2OEVA 4CEMA 1KPSB 2XHEA 5BNWA 4EZJA 3TWSA 4GB9A 1K3ZD 3CVWA 4U0UA 5B1BE 4KT6B 2XRYA 3HVEA 3QWPA 3ZRHA 4KMOA 2C0LA 3UQ3A 2HYZA 1EPUA 4J8FA 3UT4A 3RO2A 2XRZA 3ASFA 4UI9J 4X8QA 1Q2ZA 3PREA 1QYMA 2R03A 4WNDA 3AS5A 5B1AE 4B89A 4WWPA 3RRNB 3UUXA 4UWGA 4TV3A 3HVEB 4NIKA 4DK5A 4Y6CA 3VLEA 4XKBA 2VSNA 4L7TA 4OVUA 3V79K 4YDYA 4KYOB 3NOGD 2J8SD 4TXRA 3MV3B 3LVRE 3KEAA 1EYHA 2B0OE 2MHKA 1MJ0A 3FUJA 5LP0A 1INZA 4UQZA 4GA0A 5FQ4A 4A55A 3UX4A 3CHPA 3CV0A 1BD8A 4JB8P 5EILA 2R17C 3PE3A 2A5EA 1UW4B 3ASHA 4I1OB 2VQ2A 1QBQA 1IHGA 5C2YA 4F1PA 4J8EA 3ESLA 5KCMA 2WVIA 3PZDA 3QNKA 3FUMA 4CZ2D 3ZFWA 4A1GA 3CSTA 4ANVA 1N52A 4GCOA 4CRWA 1FT1A 3HXFA 3Q7FA 1UJKA 2YHEA 4YDOA 3L13A 3R7RA 5T8IA 2L0TB 2WMOA 3APCA 4AP2A 3D9OA 1ELKA 1S0PA 4GZ5A 4BTBA 4I1MA 3R9MA 1D9SA 3U66A 2WQHA 3ZYQA 4QFVA 3LDZA 4QQIA 5DBKA 4A3TA 3CHQA 4H7XA 3SFZA 1HS6A 1DCEA 1V55E 2JABA 4PS7A 4APOA 2IFUA 3CLJA 3HHMA 4F3VA 4DX6D 1JWGA 3PZ4A 2NYJA 4GZDA 2IF4A 4XIFA 4YDEA 5AARA 1DVPA 3UT8A 3UI2A 4MKTA 2IOLA 3U4TA 3JUIA 1Z3XA 3B95A 2QZAA 3FTSA 4L2YA 2HR2A 4XEIG 3U9WA 5CEDB 3CVYA 4Q96A 1TN6A 3I5PA 2KCLA 3MA5A 4F53A 4ZHBA 3LVQE 2IJGX 3TWQA 1K1AA 1ZB1A 1XGWA 2IQCA 1HO8A 5M72A 1OCOE 3SI5A 1NFIE 3LS8A 4J0UA 5DIZA 4EQFA 4Q69A 2LXLA 4PH4B 5ENOD 2XCBA 2LAIA 1G3NB 1HX8A 4RQIA 3AS8A 4PUCA 2I2OA 2WXJA 3ZGQA 2ETBA 4GZ3A 1S63A 1N94A 3UM0A 2DBAA 3UTMA 4GU5A 4DPRA 2XPZA 5J08A 1E8WA 3J5PA 3MZLB 1N54A 3EHMA 4HLLA 3FUEA 3APDA 1O5MA 1E7VA 1IXVA 2KXPC 3IV0A 2YINA 4FHJA 1SA5A 3DWLG 2A4ZA 5CERB 4HOQA 1IQRA 1SVXA 1AWCB 4U07A 3SO8A 2FO1E 4GTRA 1HFAA 3QJZA 1MZCA 5FWQA 3ONLA 3L22A 5G55A 3S7DA 5AQ7A 4J8YA 3JCKC 4B93B 4GMJA 1O1RA 3NAWA 3BEEA 4LNUD 1VDYA 4DX7D 5LCWC 4JVSA 3S7BA 4I6EA 3ZVVA 4BT8A 4CCAA 5ENNA 3WG7E 2WXMA 1B89A 4I9CA 4ME2A 4BSZB 3MCXA 4E6HA 3Q49B 4BEPA 1OT8A 5KWDA 1MX2A 4EZLA 2P9NG 5ITZF 5JJTA 4G8LA 2ILRA 2J4BA 4IULA 2HO1A 3KSLA 2L6BA 3N71A 1TNOA 3P1UA 3PH0C 5HQ8A 3DSTA 4I2ZA 4JHJA 4JA9A 3NOCD 4HOTA 2QFCA 2WXFA 3I3NA 3ASDA 3IHYA 3CK9A 3CKCA 3DXKG 3C72A 2XEVA 1PY1A 1NA0A 3C98A 4N3AA 2CHZA 4BESA 1D8DA 1N11A 2X6FA 4CT0A 5JHAA 4G26A 3IXEA 4UWLA 3UKUG 5FQ7A 3TWTA 4MS6A 4JEUA 3ZXPA 1OCRE 5CRUA 2GRQB 2P58C 4RSYA 2IO2C 1TYQG 3HG0D 3BU8A 1OUVA 3SQVA 4EZKA 3UXGA 2PM6A 2H6FA 3C3QA 3P2BA 4AXHA 4XZ4A 2LO6A 1TJFA 2IO3C 4NRHB 4L23A 2Y3AA 2J49A 2ZXWE 3ZKJA 3HRAA 2WXPA 4JZYA 4O60A 3E4BA 3FUKA 3VTXA 3RIBA 1BPOA 3UINC 5AAOA 1MHQA 1SZ9A 5KJKA 4HB5A 3LY7A 4FA6A 3DEOA 2XENA 2UY1A 3LJNA 4RLYA 1UN8A 3SF4A 2R59A 1IKND 1E8YA 5LFAA 4WNGA 3D9HA 3HIZA 1A17A 4JL0A 4WUYA 2QYUA 1PC2A 2PNNA 3APFA 1BI7B 1QZ2A 4J8DA 2UY1B 5A7DB 3CSFA 3KS2A 1D8EA 1DC2A 2F37A 1H19A 2CHWA 4GZCA 5G05C 4OAUC 1OWMA 4U8HA 4IYPA 2WXIA 5ARFA 3UM3A 5ENRD 1ZBPA 5J90A 2ETAA 1JPLA 4DLQA 4M3OA 4U95D 3G2TA 2XEEA 3DEPA 2Y69E 1Z6TA 3G2UA 1FVFA 4EBAA 3EJNA 2VSOE 4HVBA
chains in the Genus database with same CATH topology
1QYMA 4YDWA 2QYJA 3HRAA 1N0QA 2ETBA 4G8LA 4BERA 1S70B 2V5QC 4U8YD 3ZUVB 4O60A 4HNAD 5AQAA 1BU9A 2L6BA 4DUIA 5D66A 2ZGDA 4U96D 3UTMA 2AJAA 1D9SA 5AQ9A 5AAOA 4NIKA 4HB5A 4HRNA 3J5PA 2RFMA 2DWZA 3AJIA 4O1PA 5EN5D 4DX1A 5JA4D 1A5EA 2DZNA 2Y0BG 4QFVA 3NOCD 4U8VD 2V4HC 4DX5D 4F6RD 1BLXB 4QQIA 1SW6A 3V79K 2ZGGA 4YDYA 3T8KA 4UUCA 3ZU7B 4GPMA 4HI8A 5EIDA 2Y1LE 4K5AB 3NOGD 4ATZD 4HLLA 3DEOA 5CBNA 2XENA 5FINA 2J8SD 3LJNA 1MYOA 4RLYA 4G8KA 3KEAA 2JABA 1IKND 4BETA 1MX4A 5EYLA 5ENSD 1IXVA 4J7WA 2B0OE 2KXPC 4DX6D 5FIOA 3Q9NC 2NYJA 3V31A 4ZFHA 3T9KA 3D9HA 1MJ0A 2HE0A 4BESA 4DX2A 5CERB 5JMND 3V2OA 1N11A 5AARA 2PNNA 1YYHA 3AAAC 4OAVB 1SVXA 1AWCB 3SO8A 2FO1E 1IHBA 4HBDA 3J5QB 3UI2A 3EHRA 1BD8A 4LSZE 1BI7B 4A63B 3C5RA 1YMPA 5HRYA 5EYPF 4JB8P 5EILA 2QC9A 1YCSB 2DVWA 3IXEA 5ENPD 4Z68A 4HQDA 3JUEA 4HI9A 1UOHA 4LG6A 1DC2A 5ENQD 2A5EA 5EIBE 2XZDG 5AQ7A 2XZTG 3B95A 4J8YA 2DZOA 4B93B 3TWTA 4HRLA 2F37A 5KNHD 3EU9A 5CEDB 1N0RA 3NBNB 3TWWA 3ZNGA 5HKPA 4TUMA 3JXIA 4OAUC 1WDYA 4LNUD 2BKKB 4HRMB 1TR4A 3F6QA 4DX7D 4O1OA 4C48B 1K1BA 3V2XA 5KBAA 3JXJA 5KNGA 4CYMD 5ENRD 5AQBA 4ZHBA 2KBXA 2ETAA 2RFAA 3TWQA 1K1AA 2MYOA 4GMRA 3W9GA 4F1PA 1AP7A 5BXUA 4U95D 1MX6A 3HG0D 5BXOA 3TWSA 1K3ZD 1NFIE 4N5QA 2VGEA 4K5BA 5HS0A 3TWXA 4BSZB 5ENOD 2XEEA 3DEPA 1G3NB 2BKGA 4CZ2D 2XEHA 5CEAA 1DCQA 3TWRA 3TWVA 3UXGA 3TWUA 1OY3D 4BEPA 1BI8B 2P2CP 1WG0A 2F8YA 2ETCA 1OT8A 3EHQA 5KWDA 3Q9UC 5CECB 1MX2A 4K5CA 3W9FA 4DRXE 3B7BA 5ENTD 5ITZF 3V30A 5AN8A 5CBOA 3ZKJA 2F8XK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYM A;  4YDW A;  2QYJ A;  3HRA A;  1N0Q A;  2ETB A;  4G8L A;  4BER A;  1S70 B;  2V5Q C;  4U8Y D;  3ZUV B;  4O60 A;  4HNA D;  5AQA A;  1BU9 A;  2L6B A;  4DUI A;  5D66 A;  2ZGD A;  4U96 D;  3UTM A;  2AJA A;  1D9S A;  5AQ9 A;  5AAO A;  4NIK A;  4HB5 A;  4HRN A;  3J5P A;  2RFM A;  2DWZ A;  3AJI A;  4O1P A;  5EN5 D;  4DX1 A;  5JA4 D;  1A5E A;  2DZN A;  2Y0B G;  4QFV A;  3NOC D;  4U8V D;  2V4H C;  4DX5 D;  4F6R D;  1BLX B;  4QQI A;  1SW6 A;  3V79 K;  2ZGG A;  4YDY A;  3T8K A;  4UUC A;  3ZU7 B;  4GPM A;  4HI8 A;  5EID A;  2Y1L E;  4K5A B;  3NOG D;  4ATZ D;  4HLL A;  3DEO A;  5CBN A;  2XEN A;  5FIN A;  2J8S D;  3LJN A;  1MYO A;  4RLY A;  4G8K A;  3KEA A;  2JAB A;  1IKN D;  4BET A;  1MX4 A;  5EYL A;  5ENS D;  1IXV A;  4J7W A;  2B0O E;  2KXP C;  4DX6 D;  5FIO A;  3Q9N C;  2NYJ A;  3V31 A;  4ZFH A;  3T9K A;  3D9H A;  1MJ0 A;  2HE0 A;  4BES A;  4DX2 A;  5CER B;  5JMN D;  3V2O A;  1N11 A;  5AAR A;  2PNN A;  1YYH A;  3AAA C;  4OAV B;  1SVX A;  1AWC B;  3SO8 A;  2FO1 E;  1IHB A;  4HBD A;  3J5Q B;  3UI2 A;  3EHR A;  1BD8 A;  4LSZ E;  1BI7 B;  4A63 B;  3C5R A;  1YMP A;  5HRY A;  5EYP F;  4JB8 P;  5EIL A;  2QC9 A;  1YCS B;  2DVW A;  3IXE A;  5ENP D;  4Z68 A;  4HQD A;  3JUE A;  4HI9 A;  1UOH A;  4LG6 A;  1DC2 A;  5ENQ D;  2A5E A;  5EIB E;  2XZD G;  5AQ7 A;  2XZT G;  3B95 A;  4J8Y A;  2DZO A;  4B93 B;  3TWT A;  4HRL A;  2F37 A;  5KNH D;  3EU9 A;  5CED B;  1N0R A;  3NBN B;  3TWW A;  3ZNG A;  5HKP A;  4TUM A;  3JXI A;  4OAU C;  1WDY A;  4LNU D;  2BKK B;  4HRM B;  1TR4 A;  3F6Q A;  4DX7 D;  4O1O A;  4C48 B;  1K1B A;  3V2X A;  5KBA A;  3JXJ A;  5KNG A;  4CYM D;  5ENR D;  5AQB A;  4ZHB A;  2KBX A;  2ETA A;  2RFA A;  3TWQ A;  1K1A A;  2MYO A;  4GMR A;  3W9G A;  4F1P A;  1AP7 A;  5BXU A;  4U95 D;  1MX6 A;  3HG0 D;  5BXO A;  3TWS A;  1K3Z D;  1NFI E;  4N5Q A;  2VGE A;  4K5B A;  5HS0 A;  3TWX A;  4BSZ B;  5ENO D;  2XEE A;  3DEP A;  1G3N B;  2BKG A;  4CZ2 D;  2XEH A;  5CEA A;  1DCQ A;  3TWR A;  3TWV A;  3UXG A;  3TWU A;  1OY3 D;  4BEP A;  1BI8 B;  2P2C P;  1WG0 A;  2F8Y A;  2ETC A;  1OT8 A;  3EHQ A;  5KWD A;  3Q9U C;  5CEC B;  1MX2 A;  4K5C A;  3W9F A;  4DRX E;  3B7B A;  5ENT D;  5ITZ F;  3V30 A;  5AN8 A;  5CBO A;  3ZKJ A;  2F8X K; 
#chains in the Genus database with same CATH topology
 4PDX A;  4BER A;  4C9B B;  4JXT A;  5FQ8 A;  2VTB A;  5E76 A;  5D66 A;  3ML9 A;  3CHM A;  2BF0 X;  1HG2 A;  2AWI A;  4HRN A;  5EX3 A;  5E75 A;  4AJW A;  1L5J A;  3CEQ A;  4B8A A;  3UIP C;  3MEK A;  1MYO A;  5KJM A;  2VTB B;  5EYL A;  4J7W A;  3QWW A;  3TXM A;  1ELR A;  1HG5 A;  3X2Q E;  3ESK A;  3O4Z A;  2BTD A;  2P9P G;  3EIQ C;  4XKC A;  1JCR A;  4LSZ E;  3C5R A;  3PDN A;  2XZT G;  4TXQ A;  4TUU A;  3L08 A;  1X5B A;  3VLF A;  2YQ8 A;  1LD7 A;  3U3W A;  2J08 A;  4NAC A;  1S64 A;  3RKV A;  1TR4 A;  2DYS E;  4GYY A;  3E34 A;  1OWP A;  2CHX A;  2WPV A;  5AQB A;  3ASO E;  5FT9 A;  1O1S A;  3LJ3 A;  1PAQ A;  3L9T A;  4YVQ C;  4GMR A;  4I1A A;  2FUL A;  2XPY A;  4G24 A;  4FC8 A;  5HI7 A;  4N5Q A;  5HS0 A;  3MKR A;  3ZHE B;  2WXR A;  3FEY A;  3FWV A;  1QQE A;  2IU1 A;  3W9F A;  3D9I A;  2GRR B;  3ABM E;  5C1D A;  3KD7 A;  2OCC E;  3T5X A;  3NF1 A;  2JLB A;  3PUJ A;  5G04 J;  4N3C A;  4F6R D;  2ZGG A;  3DXM G;  1RW2 A;  2R05 A;  3UM2 A;  4UWK A;  3QK0 A;  3LY9 A;  3CHO A;  2XGO A;  2OVB A;  4LNG A;  4FJY A;  4OAV B;  3VLD A;  4EEC A;  3J5Q B;  2WB2 A;  1H0A A;  4KZ0 A;  2PQR A;  1U3C A;  3KAE A;  1QNF A;  2OND A;  5T3R A;  4KVO A;  1Y8M A;  3TGO A;  4B0Z A;  4UQY A;  4O1O A;  4C48 B;  2NXP A;  2RFA A;  3IBE A;  3D9P A;  4N3B A;  2BUG A;  4F7A A;  1H6K A;  1N4R A;  3UIO C;  2GRL A;  1KZP A;  4GA1 A;  4KZC A;  2ETC A;  5EX0 A;  3EHQ A;  3R7Q A;  3SY2 A;  3E32 A;  3SHF A;  2IEJ A;  3V30 A;  4L9P A;  3ABK E;  2F8X K;  1FVH A;  3EDT B;  2CG3 A;  3FTU A;  2ZIR A;  4HNA D;  2IY0 C;  4U0Z A;  1IQU A;  1RZ4 A;  1P5Q A;  3D9M A;  2OV8 A;  4JHK A;  5AQ9 A;  3LY8 A;  5D0O D;  2DZN A;  2XS8 A;  2L6J A;  4TRQ A;  2YHC A;  3Q15 A;  5BT1 A;  4HS2 A;  2E2E A;  2WXH A;  4YND A;  1XNF A;  4G8K A;  4JC8 A;  3GZ2 A;  3CVP A;  3QAQ A;  2KCV A;  5FZS A;  4CGV A;  3V31 A;  3URZ A;  3I4G A;  2PL2 A;  3Q78 A;  4H7Y A;  4ACL A;  5FJY A;  2KZT A;  4FHK A;  1YMP A;  3AU5 A;  5EYP F;  5CMW A;  4E85 A;  2F0Y A;  4Z68 A;  4K0R A;  4C0E A;  3Q73 A;  1UOH A;  5KJN A;  4AEZ C;  3QAR A;  5JJ6 A;  4N2Q A;  3G2V A;  5HKP A;  1K1B A;  3G2W A;  5KNG A;  3CK8 A;  2KZT B;  3FEX A;  3FTX A;  4I6G A;  3W9G A;  4Q94 A;  3FDH A;  4I9E A;  5KJL A;  1OCC E;  3TXN A;  3TWX A;  2WMN A;  3QWV A;  4K5B A;  3LXU X;  3D9N A;  1JCS A;  2RKK A;  2I6H A;  4JD2 G;  3TWU A;  1MQS A;  4CDM A;  3OTN A;  4JW1 A;  5LOZ A;  5ENT D;  5ANR A;  4ACK A;  4GPK A;  5AYW D;  3LKU A;  3JQ0 A;  1FPP A;  5FTP A;  4J8S A;  1A5E A;  4A1S A;  2PZI A;  3FTY A;  3AS4 A;  3HYM B;  3AU4 A;  2EIM E;  1TNZ A;  3B13 A;  4GYO A;  3GYZ A;  3C3R A;  3PEU B;  4L2L A;  4G1T A;  2GRM A;  4LRZ A;  3RO3 A;  1OXJ A;  1U3D A;  4ANX A;  3T9K A;  4U63 A;  4DX2 A;  5ANL A;  4G23 A;  4KXK B;  1IHB A;  2QC9 A;  4GTV A;  5CHE E;  3SBS A;  4AVX A;  5ENQ D;  3Q47 B;  4HRL A;  2EIJ E;  3EU9 A;  3FUN A;  1WDY A;  4RVB A;  5A23 A;  5KBA A;  1OWO A;  1ZU2 A;  3FFL A;  5CRV A;  5IY5 E;  3CHS A;  2AXZ A;  4FAD A;  3OAW A;  3LCA A;  4PS8 A;  2R2L A;  5LX8 A;  3FTV A;  4FUL A;  1HH8 A;  1E7U A;  3LPZ A;  3QC1 A;  3RAU A;  4GML A;  2M63 A;  2J4D A;  5BPP A;  1BU9 A;  2C2L A;  2RG8 A;  3OXF A;  3FUL A;  3FUF A;  4XX5 A;  2I1J A;  4UI9 C;  4GTS A;  4NQ0 A;  4HXI A;  1TJC A;  1SW6 A;  1UJJ A;  3AG1 E;  3T8K A;  4HI8 A;  4WWO A;  2KM4 A;  4DI4 A;  3TL5 A;  4FJZ A;  3B7U X;  1HXI A;  3L54 A;  2V0P A;  1E8X A;  2YNQ A;  4AIF A;  4M7C A;  2NC9 A;  5AJD A;  4HBD A;  4HOU A;  5LCW J;  4A63 B;  2X6J A;  3PNL B;  2EIK E;  2L0I A;  4BTA A;  3JQ1 A;  3TWW A;  2CFZ A;  1Z5S C;  1OCZ E;  2GW1 A;  4R7L A;  3Q5M A;  3FTW A;  3ZYL A;  2EQX A;  2XQ0 A;  2P9S G;  5BXU A;  3HXB A;  4DJA A;  1DNP A;  3QB2 A;  3RU0 A;  5BW8 C;  2P2C P;  3CVU A;  4I43 A;  3CQG B;  3Q9U C;  3MX3 A;  5AJL A;  4JHR A;  2GGF A;  3ZYM A;  2V5Q C;  4AY6 A;  2X3M A;  2X38 A;  3UMV A;  5CCL A;  3ZN3 A;  1OWN A;  4LCT A;  3E37 A;  3EU5 A;  2NSZ A;  4N2S A;  4PS3 A;  4DX1 A;  2DWZ A;  4U7E B;  2V4L A;  4UUC A;  4CGW A;  4HFG A;  1X81 A;  4O6F A;  3DSW A;  3SBT B;  2VYI A;  1IYG A;  3QKY A;  5ENS D;  2GRO B;  2VGX A;  3PVL A;  4UI9 K;  4D10 C;  5JMN D;  3V2O A;  2WXQ A;  3ENE A;  2XGS A;  4A3V A;  1Y6I A;  1TNY A;  4KBQ A;  3S7F A;  3ULQ A;  3CGH A;  2P9K G;  3DSS A;  1SQM A;  2UWJ G;  1FT2 A;  2VGX B;  4MBG A;  3NBN B;  3VTY A;  2EIN E;  3D9K A;  2BKK B;  3FUD A;  3F6Q A;  3CHR A;  2V5F A;  3V2X A;  2IOS A;  3JXJ A;  1H6O A;  1GW6 A;  4YVO A;  3ULY A;  3RJV A;  4BWR A;  2VGY A;  1E8Z A;  4G11 A;  2CG2 A;  3TG5 A;  1N9A A;  3ZIM A;  3AG2 E;  1WM5 A;  4N39 A;  5D0Q D;  3IEG A;  4FLH A;  1N4Q A;  3ZHE A;  3SGH A;  4BFR A;  2F8Y A;  2I1K A;  4DRX E;  3B7R L;  2FI7 A;  2VSY A;  3HXE A;  3PNT B;  4BX8 A;  3Q4A B;  4JEH A;  3RSE G;  2P9L G;  4ATG A;  4HOS A;  5B3S E;  1N4P A;  4LNB A;  4AY5 A;  4O1P A;  3SD5 A;  4U8V D;  3TG4 A;  2V4H C;  4GA2 A;  2C0M A;  5BUZ A;  4V3I A;  4GPM A;  2Y1L E;  4K5A B;  2FF4 A;  3FU5 A;  3ASN E;  2LAH A;  1W3B A;  4GTT A;  1FCH A;  3ABL E;  2XPI A;  3K9I A;  3B7T A;  2MOW A;  3LYA A;  4CT4 A;  5FQ6 A;  3FH5 A;  4RG6 A;  2FBN A;  5G05 J;  1YYH A;  3IHV A;  2DCP A;  2WXL A;  4G25 A;  4OVV A;  4ILI A;  1YCS B;  2DVW A;  3FU3 A;  3HDX A;  1KT1 A;  5EIB E;  4GZ6 A;  3ZXS A;  3TAX A;  2X6I A;  2ZIS A;  3FP3 A;  3ZNG A;  3BUA A;  5AEN A;  3QOU A;  2GRP B;  5CCM A;  2FEZ A;  4CYM D;  1H2T C;  3NZU A;  2WXK A;  3MYV A;  2JEK A;  1ELW A;  1UG3 A;  2ION A;  2BED A;  3PUK A;  3OXG A;  1K8K G;  2R02 A;  2VGE A;  3PZ1 A;  3SNX A;  1HU3 A;  1N4S A;  4GAA A;  4I6J A;  4DLO A;  3O48 A;  2Y4T A;  4JPS A;  3D9L A;  1OY3 D;  1EDU A;  5A6C A;  4B8C B;  2DIW A;  3E30 A;  3GZS A;  5G2N A;  4BX9 A;  2EIL E;  3ASG A;  1SA4 A;  3FUI A;  5CMY A;  3CVX A;  4GTQ A;  1S70 B;  2A5U A;  3NB2 A;  5JHB A;  5AIJ A;  4J6I A;  3AG4 E;  3CVL A;  2AJA A;  3DBS A;  4ILH B;  1E90 A;  3MKQ A;  4GTP A;  2RFM A;  1TN8 A;  3RRU A;  2Y0B G;  1JWF A;  3WXX A;  1OWL A;  3MGB A;  1NP7 A;  4C0M A;  3FU6 A;  5CBN A;  2X6K A;  4URK A;  2P9I G;  2Q7F A;  4LEU A;  5T4Y A;  5FZQ A;  5H7P A;  5BV0 A;  5FIO A;  1WAO 1;  3MKQ B;  1HZ4 A;  3Q75 A;  2HE0 A;  3Q7A A;  3ZEF A;  1KT0 A;  2WQ7 A;  1NZN A;  4MRU A;  5ENP D;  4HQD A;  3R9A B;  3Q79 A;  1NI1 A;  2RD0 A;  1LD8 A;  2OOE A;  4ANU A;  5JJ7 A;  4FU3 A;  4XE0 A;  1N95 A;  2MYO A;  3ONK A;  1AP7 A;  3CIA A;  1MX6 A;  3G2S A;  3KEZ A;  1TN7 A;  4G2V A;  5BV1 A;  1TNU A;  3BG0 B;  2GRN B;  3CR3 A;  2WXG A;  1DCQ A;  1KLX A;  3TWR A;  4WNF A;  4K5C A;  3S2A A;  3UM1 A;  2WQ6 A;  4W9R A;  1JUQ A;  5D2M C;  1V54 E;  4BT9 A;  3S7J A;  3CKB A;  5AQA A;  3DSV A;  4AM9 A;  2LUH A;  4RG9 A;  3FH8 A;  4ABN A;  3T8M A;  5EN5 D;  4P29 A;  2QY7 A;  1BLX B;  2PQN A;  3EHN A;  5EID A;  2H6G A;  2I9C A;  3ISM C;  3C3O A;  5FIN A;  3FTZ A;  1JCQ A;  4BET A;  4B94 A;  3GZ1 A;  2LSV A;  3Q9N C;  3D9J A;  3MJW A;  3UKR G;  3ZW3 A;  4EBA G;  3UT7 A;  1TEZ A;  3AAA C;  3IKO B;  3EHR A;  3T5V A;  3BG1 B;  2V8S E;  4U0S A;  3JUE A;  4HI9 A;  4DI3 A;  4LG6 A;  2J07 A;  2XZD G;  4WNE A;  3KSQ A;  3CVV A;  3DSU A;  1N0R A;  2Y4U A;  2L9B A;  4TUM A;  3JXI A;  3ULE G;  4HRM B;  3FHE A;  1LTX A;  1EF1 C;  3QDN A;  1E96 B;  5BXO A;  1U2V G;  4MLP A;  2BKG A;  5CEA A;  2XEH A;  3TWV A;  2KCK A;  2LSU A;  4Y6W A;  3LEW A;  1YA0 A;  1BI8 B;  1WG0 A;  4XI0 A;  4I17 A;  4XI9 A;  2LXM A;  2AVP A;  3D3M A;  3PZ2 A;  3HXC A;  2QYJ A;  4HOR A;  4UWF A;  2AXV A;  4NUR A;  3EUV A;  3AG3 E;  4CDN A;  2HM8 A;  4DUI A;  2ZGD A;  1O1T A;  4WWN A;  3ZYK A;  1KZO A;  3SFY A;  3AJI A;  5JA4 D;  3FH7 A;  4JA7 A;  4DX5 D;  3DRA A;  3ZU7 B;  4ATZ D;  3NQP A;  3RRM B;  3MV2 B;  1H2V C;  1H2U A;  4OYS A;  3FY4 A;  4IRU A;  2CFU A;  4FLB A;  1MX4 A;  3BQO A;  3PS6 A;  4ZFH A;  4IN3 B;  4ANW A;  3GW4 A;  5EKQ D;  3L17 A;  4AOF A;  5HRY A;  1SZA A;  3PEV B;  3DPY A;  2DYR E;  1UN9 A;  3CK7 A;  4AV7 A;  1WY6 A;  4UWH A;  2WXO A;  2XGM A;  3EIJ A;  1TNB A;  4EHM A;  1HF8 A;  1NL4 A;  3B7S A;  3PRZ A;  1NA3 A;  2R5S A;  3CVQ A;  4WAF A;  3CVN A;  2MRI A;  2KBX A;  5EDS A;  3L6A A;  1H6P A;  1LF8 A;  2H6H A;  3I4R B;  3ML8 A;  3FU0 A;  2AXU A;  2KC7 A;  2OEW A;  3U64 A;  2P9U G;  2XS1 A;  1HE8 A;  4GTM A;  4U04 A;  5CEC B;  2VSX E;  4LUN U;  5FZR A;  4HLE A;  3B7B A;  3CQC B;  4GTO A;  5AN8 A;  5CBO A;  3RK6 A;  4GCN A;  4YDW A;  1N0Q A;  5ARG A;  4U8Y D;  3ZUV B;  3E33 A;  4U96 D;  2OVF A;  2XCC A;  2WXN A;  2B6C A;  2AW6 A;  3SZ7 A;  2LNI A;  4L1B A;  3DPD A;  4CDR A;  4KVM A;  3JYS A;  2FO7 A;  3UPV A;  3ZPJ A;  1Z3Y A;  3SFX A;  4GYW A;  4LER A;  4K03 A;  3PZ3 A;  5G04 C;  2KAT A;  2J9Q A;  3OXL A;  4UQX A;  2X6H A;  3NZS A;  3L82 A;  3TJP A;  4TXP A;  3L16 A;  3PE4 A;  4BSX A;  3HXD A;  2VJ8 A;  4FP7 A;  4APF A;  2J09 A;  3DSX A;  2DZO A;  3FUH A;  5KNH D;  4N5C A;  2PM7 A;  2WM9 A;  4EPZ A;  4F1S A;  4BY6 A;  2E0I A;  4ILG A;  2ZU6 B;  2H6I A;  4I2W A;  2OEV A;  4CEM A;  1KPS B;  2XHE A;  5BNW A;  4EZJ A;  3TWS A;  4GB9 A;  1K3Z D;  3CVW A;  4U0U A;  5B1B E;  4KT6 B;  2XRY A;  3HVE A;  3QWP A;  3ZRH A;  4KMO A;  2C0L A;  3UQ3 A;  2HYZ A;  1EPU A;  4J8F A;  3UT4 A;  3RO2 A;  2XRZ A;  3ASF A;  4UI9 J;  4X8Q A;  1Q2Z A;  3PRE A;  1QYM A;  2R03 A;  4WND A;  3AS5 A;  5B1A E;  4B89 A;  4WWP A;  3RRN B;  3UUX A;  4UWG A;  4TV3 A;  3HVE B;  4NIK A;  4DK5 A;  4Y6C A;  3VLE A;  4XKB A;  2VSN A;  4L7T A;  4OVU A;  3V79 K;  4YDY A;  4KYO B;  3NOG D;  2J8S D;  4TXR A;  3MV3 B;  3LVR E;  3KEA A;  1EYH A;  2B0O E;  2MHK A;  1MJ0 A;  3FUJ A;  5LP0 A;  1INZ A;  4UQZ A;  4GA0 A;  5FQ4 A;  4A55 A;  3UX4 A;  3CHP A;  3CV0 A;  1BD8 A;  4JB8 P;  5EIL A;  2R17 C;  3PE3 A;  2A5E A;  1UW4 B;  3ASH A;  4I1O B;  2VQ2 A;  1QBQ A;  1IHG A;  5C2Y A;  4F1P A;  4J8E A;  3ESL A;  5KCM A;  2WVI A;  3PZD A;  3QNK A;  3FUM A;  4CZ2 D;  3ZFW A;  4A1G A;  3CST A;  4ANV A;  1N52 A;  4GCO A;  4CRW A;  1FT1 A;  3HXF A;  3Q7F A;  1UJK A;  2YHE A;  4YDO A;  3L13 A;  3R7R A;  5T8I A;  2L0T B;  2WMO A;  3APC A;  4AP2 A;  3D9O A;  1ELK A;  1S0P A;  4GZ5 A;  4BTB A;  4I1M A;  3R9M A;  1D9S A;  3U66 A;  2WQH A;  3ZYQ A;  4QFV A;  3LDZ A;  4QQI A;  5DBK A;  4A3T A;  3CHQ A;  4H7X A;  3SFZ A;  1HS6 A;  1DCE A;  1V55 E;  2JAB A;  4PS7 A;  4APO A;  2IFU A;  3CLJ A;  3HHM A;  4F3V A;  4DX6 D;  1JWG A;  3PZ4 A;  2NYJ A;  4GZD A;  2IF4 A;  4XIF A;  4YDE A;  5AAR A;  1DVP A;  3UT8 A;  3UI2 A;  4MKT A;  2IOL A;  3U4T A;  3JUI A;  1Z3X A;  3B95 A;  2QZA A;  3FTS A;  4L2Y A;  2HR2 A;  4XEI G;  3U9W A;  5CED B;  3CVY A;  4Q96 A;  1TN6 A;  3I5P A;  2KCL A;  3MA5 A;  4F53 A;  4ZHB A;  3LVQ E;  2IJG X;  3TWQ A;  1K1A A;  1ZB1 A;  1XGW A;  2IQC A;  1HO8 A;  5M72 A;  1OCO E;  3SI5 A;  1NFI E;  3LS8 A;  4J0U A;  5DIZ A;  4EQF A;  4Q69 A;  2LXL A;  4PH4 B;  5ENO D;  2XCB A;  2LAI A;  1G3N B;  1HX8 A;  4RQI A;  3AS8 A;  4PUC A;  2I2O A;  2WXJ A;  3ZGQ A;  2ETB A;  4GZ3 A;  1S63 A;  1N94 A;  3UM0 A;  2DBA A;  3UTM A;  4GU5 A;  4DPR A;  2XPZ A;  5J08 A;  1E8W A;  3J5P A;  3MZL B;  1N54 A;  3EHM A;  4HLL A;  3FUE A;  3APD A;  1O5M A;  1E7V A;  1IXV A;  2KXP C;  3IV0 A;  2YIN A;  4FHJ A;  1SA5 A;  3DWL G;  2A4Z A;  5CER B;  4HOQ A;  1IQR A;  1SVX A;  1AWC B;  4U07 A;  3SO8 A;  2FO1 E;  4GTR A;  1HFA A;  3QJZ A;  1MZC A;  5FWQ A;  3ONL A;  3L22 A;  5G55 A;  3S7D A;  5AQ7 A;  4J8Y A;  3JCK C;  4B93 B;  4GMJ A;  1O1R A;  3NAW A;  3BEE A;  4LNU D;  1VDY A;  4DX7 D;  5LCW C;  4JVS A;  3S7B A;  4I6E A;  3ZVV A;  4BT8 A;  4CCA A;  5ENN A;  3WG7 E;  2WXM A;  1B89 A;  4I9C A;  4ME2 A;  4BSZ B;  3MCX A;  4E6H A;  3Q49 B;  4BEP A;  1OT8 A;  5KWD A;  1MX2 A;  4EZL A;  2P9N G;  5ITZ F;  5JJT A;  4G8L A;  2ILR A;  2J4B A;  4IUL A;  2HO1 A;  3KSL A;  2L6B A;  3N71 A;  1TNO A;  3P1U A;  3PH0 C;  5HQ8 A;  3DST A;  4I2Z A;  4JHJ A;  4JA9 A;  3NOC D;  4HOT A;  2QFC A;  2WXF A;  3I3N A;  3ASD A;  3IHY A;  3CK9 A;  3CKC A;  3DXK G;  3C72 A;  2XEV A;  1PY1 A;  1NA0 A;  3C98 A;  4N3A A;  2CHZ A;  4BES A;  1D8D A;  1N11 A;  2X6F A;  4CT0 A;  5JHA A;  4G26 A;  3IXE A;  4UWL A;  3UKU G;  5FQ7 A;  3TWT A;  4MS6 A;  4JEU A;  3ZXP A;  1OCR E;  5CRU A;  2GRQ B;  2P58 C;  4RSY A;  2IO2 C;  1TYQ G;  3HG0 D;  3BU8 A;  1OUV A;  3SQV A;  4EZK A;  3UXG A;  2PM6 A;  2H6F A;  3C3Q A;  3P2B A;  4AXH A;  4XZ4 A;  2LO6 A;  1TJF A;  2IO3 C;  4NRH B;  4L23 A;  2Y3A A;  2J49 A;  2ZXW E;  3ZKJ A;  3HRA A;  2WXP A;  4JZY A;  4O60 A;  3E4B A;  3FUK A;  3VTX A;  3RIB A;  1BPO A;  3UIN C;  5AAO A;  1MHQ A;  1SZ9 A;  5KJK A;  4HB5 A;  3LY7 A;  4FA6 A;  3DEO A;  2XEN A;  2UY1 A;  3LJN A;  4RLY A;  1UN8 A;  3SF4 A;  2R59 A;  1IKN D;  1E8Y A;  5LFA A;  4WNG A;  3D9H A;  3HIZ A;  1A17 A;  4JL0 A;  4WUY A;  2QYU A;  1PC2 A;  2PNN A;  3APF A;  1BI7 B;  1QZ2 A;  4J8D A;  2UY1 B;  5A7D B;  3CSF A;  3KS2 A;  1D8E A;  1DC2 A;  2F37 A;  1H19 A;  2CHW A;  4GZC A;  5G05 C;  4OAU C;  1OWM A;  4U8H A;  4IYP A;  2WXI A;  5ARF A;  3UM3 A;  5ENR D;  1ZBP A;  5J90 A;  2ETA A;  1JPL A;  4DLQ A;  4M3O A;  4U95 D;  3G2T A;  2XEE A;  3DEP A;  2Y69 E;  1Z6T A;  3G2U A;  1FVF A;  4EBA A;  3EJN A;  2VSO E;  4HVB A; 
#chains in the Genus database with same CATH homology
 1QYM A;  4YDW A;  2QYJ A;  3HRA A;  1N0Q A;  2ETB A;  4G8L A;  4BER A;  1S70 B;  2V5Q C;  4U8Y D;  3ZUV B;  4O60 A;  4HNA D;  5AQA A;  1BU9 A;  2L6B A;  4DUI A;  5D66 A;  2ZGD A;  4U96 D;  3UTM A;  2AJA A;  1D9S A;  5AQ9 A;  5AAO A;  4NIK A;  4HB5 A;  4HRN A;  3J5P A;  2RFM A;  2DWZ A;  3AJI A;  4O1P A;  5EN5 D;  4DX1 A;  5JA4 D;  1A5E A;  2DZN A;  2Y0B G;  4QFV A;  3NOC D;  4U8V D;  2V4H C;  4DX5 D;  4F6R D;  1BLX B;  4QQI A;  1SW6 A;  3V79 K;  2ZGG A;  4YDY A;  3T8K A;  4UUC A;  3ZU7 B;  4GPM A;  4HI8 A;  5EID A;  2Y1L E;  4K5A B;  3NOG D;  4ATZ D;  4HLL A;  3DEO A;  5CBN A;  2XEN A;  5FIN A;  2J8S D;  3LJN A;  1MYO A;  4RLY A;  4G8K A;  3KEA A;  2JAB A;  1IKN D;  4BET A;  1MX4 A;  5EYL A;  5ENS D;  1IXV A;  4J7W A;  2B0O E;  2KXP C;  4DX6 D;  5FIO A;  3Q9N C;  2NYJ A;  3V31 A;  4ZFH A;  3T9K A;  3D9H A;  1MJ0 A;  2HE0 A;  4BES A;  4DX2 A;  5CER B;  5JMN D;  3V2O A;  1N11 A;  5AAR A;  2PNN A;  1YYH A;  3AAA C;  4OAV B;  1SVX A;  1AWC B;  3SO8 A;  2FO1 E;  1IHB A;  4HBD A;  3J5Q B;  3UI2 A;  3EHR A;  1BD8 A;  4LSZ E;  1BI7 B;  4A63 B;  3C5R A;  1YMP A;  5HRY A;  5EYP F;  4JB8 P;  5EIL A;  2QC9 A;  1YCS B;  2DVW A;  3IXE A;  5ENP D;  4Z68 A;  4HQD A;  3JUE A;  4HI9 A;  1UOH A;  4LG6 A;  1DC2 A;  5ENQ D;  2A5E A;  5EIB E;  2XZD G;  5AQ7 A;  2XZT G;  3B95 A;  4J8Y A;  2DZO A;  4B93 B;  3TWT A;  4HRL A;  2F37 A;  5KNH D;  3EU9 A;  5CED B;  1N0R A;  3NBN B;  3TWW A;  3ZNG A;  5HKP A;  4TUM A;  3JXI A;  4OAU C;  1WDY A;  4LNU D;  2BKK B;  4HRM B;  1TR4 A;  3F6Q A;  4DX7 D;  4O1O A;  4C48 B;  1K1B A;  3V2X A;  5KBA A;  3JXJ A;  5KNG A;  4CYM D;  5ENR D;  5AQB A;  4ZHB A;  2KBX A;  2ETA A;  2RFA A;  3TWQ A;  1K1A A;  2MYO A;  4GMR A;  3W9G A;  4F1P A;  1AP7 A;  5BXU A;  4U95 D;  1MX6 A;  3HG0 D;  5BXO A;  3TWS A;  1K3Z D;  1NFI E;  4N5Q A;  2VGE A;  4K5B A;  5HS0 A;  3TWX A;  4BSZ B;  5ENO D;  2XEE A;  3DEP A;  1G3N B;  2BKG A;  4CZ2 D;  2XEH A;  5CEA A;  1DCQ A;  3TWR A;  3TWV A;  3UXG A;  3TWU A;  1OY3 D;  4BEP A;  1BI8 B;  2P2C P;  1WG0 A;  2F8Y A;  2ETC A;  1OT8 A;  3EHQ A;  5KWD A;  3Q9U C;  5CEC B;  1MX2 A;  4K5C A;  3W9F A;  4DRX E;  3B7B A;  5ENT D;  5ITZ F;  3V30 A;  5AN8 A;  5CBO A;  3ZKJ A;  2F8X K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...