3TWXA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human fnbp1 (chimeric peptide)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 51
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twxA00
4ZHBA 4ZFHA 5AARA 2KXPC 5ENOD 1BD8A 1OY3D 3TWSA 1SVXA 2ZGGA 4G8KA 3UI2A 3HG0D 4U96D 4BSZB 2PNNA 5AAOA 2P2CP 4U8VD 2V4HC 2QYJA 5ITZF 2RFMA 1BI7B 2XEEA 5KBAA 1BU9A 5FIOA 3ZUVB 2DZNA 4UUCA 1G3NB 4HB5A 2ETCA 3LJNA 1YCSB 1N0RA 3F6QA 4F6RD 4YDWA 4A63B 4BESA 1BI8B 2AJAA 3J5PA 3T8KA 3ZNGA 5BXUA 3IXEA 3NOGD 3TWWA 5CERB 3V31A 3AJIA 2DWZA 5EIDA 2Y1LE 3V79K 2VGEA 3D9HA 4HLLA 3UTMA 4HRNA 1K3ZD 4NIKA 1YYHA 1MJ0A 5JMND 4O60A 4LG6A 4RLYA 3T9KA 4K5CA 2DVWA 5ENPD 1IXVA 4DX2A 5EYPF 5EN5D 3Q9NC 2MYOA 5BXOA 4F1PA 4O1PA 4YDYA 3V30A 3JXJA 1MYOA 5KNGA 4K5AB 2XZDG 3B7BA 4OAVB 2Y0BG 4DUIA 1DC2A 1UOHA 4CYMD 2F8YA 4DX5D 1S70B 3W9GA 5CBNA 1A5EA 3TWQA 5FINA 3Q9UC 1IKND 4ATZD 4BETA 2J8SD 1NFIE 4B93B 5AQ9A 3V2XA 3TWXA 3EU9A 3DEPA 5CEDB 3B95A 4HI8A 3TWTA 2FO1E 4GPMA 2DZOA 2ZGDA 1D9SA 1MX4A 2B0OE 1DCQA 4BEPA 3J5QB 1WG0A 4CZ2D 1BLXB 3ZKJA 1MX6A 1SW6A 2ETAA 2QC9A 4QFVA 5HS0A 1K1AA 4Z68A 5ENSD 5AQ7A 1K1BA 1AP7A 4BERA 3AAAC 2XENA 1AWCB 2BKKB 2XEHA 3EHRA 3KEAA 3TWUA 2HE0A 3HRAA 2JABA 4GMRA 4J8YA 3ZU7B 2RFAA 3C5RA 5AQAA 5CEAA 4K5BA 1YMPA 4HRMB 5HRYA 1MX2A 2BKGA 5KWDA 3TWRA 4N5QA 4DX6D 5ENRD 5ENQD 4HQDA 3W9FA 5CECB 4J7WA 1N11A 5EIBE 1TR4A 4OAUC 5KNHD 4C48B 3EHQA 4U95D 3NBNB 4HNAD 2XZTG 2F8XK 3JXIA 1WDYA 2V5QC 4LSZE 3SO8A 2F37A 3JUEA 4G8LA 2A5EA 4QQIA 2L6BA 3UXGA 5EILA 5HKPA 5CBOA 4DRXE 4TUMA 3NOCD 1IHBA 4U8YD 4DX7D 1N0QA 2KBXA 5JA4D 4HI9A 4HRLA 4JB8P 5AQBA 5AN8A 3TWVA 5EYLA 5D66A 1QYMA 4LNUD 4O1OA 4DX1A 2NYJA 3DEOA 4HBDA 2ETBA 3V2OA 1OT8A 5ENTD
chains in the Genus database with same CATH superfamily
2R03A 2XEVA 4G26A 4CCAA 4F6RD 4UQXA 3RRUA 3ZNGA 2QYUA 3B7SA 3NF1A 3FTZA 1FPPA 3DXKG 1IHGA 2J08A 4NIKA 3KSLA 5CMYA 3LY9A 4ATGA 1UW4B 1YA0A 3RRNB 4U63A 5EKQD 4WNEA 1UG3A 2KCVA 4W9RA 2P9LG 3TWXA 2WQHA 4GYYA 4G11A 4KYOB 3RAUA 1MQSA 3PZ1A 2P9PG 4MS6A 2I2OA 1SZAA 4JD2G 3SHFA 3Q15A 5HS0A 3PUKA 1HX8A 4M7CA 4BERA 4WWOA 1Q2ZA 3CVXA 3KEAA 4GMRA 3FUKA 4AXHA 5AYWD 3KEZA 4LEUA 3MV3B 2OEWA 2YINA 3OXFA 3JUIA 2VSNA 2IOLA 4EECA 3TG5A 2WXMA 1D8EA 3E34A 2WXGA 2WPVA 4DLOA 3UKUG 3AG3E 3CQGB 4GZCA 4ZHBA 1JCRA 4E6HA 1KZPA 3RIBA 1N4QA 3FP3A 3GZ1A 3CK7A 3HG0D 4TRQA 2P2CP 3K9IA 4Y6CA 2IFUA 2X3MA 3ZFWA 1WAO1 3ZXSA 3BEEA 4KBQA 4ILHB 3ZYKA 4JL0A 2QZAA 2CHXA 1EPUA 3HXDA 1O5MA 4I6JA 1HU3A 2MYOA 4A1GA 2IU1A 2PL2A 5AJDA 5LFAA 4IYPA 1S70B 2XS8A 4GZ3A 4OVVA 1FT1A 2GW1A 3PEVB 5T8IA 3QAQA 5BT1A 1TNBA 2FO7A 3FH5A 2XPYA 3I4RB 3NQPA 3S7DA 5CHEE 1VDYA 4DI4A 2XRZA 1AP7A 5KJLA 2EIME 2JABA 4PUCA 3HVEA 3CHPA 1MX2A 2BKGA 2OOEA 3GZSA 4I6EA 1Y6IA 4FA6A 4J0UA 2XZTG 2L6BA 2WXRA 2DIWA 4U07A 2IQCA 1N0QA 2BEDA 3UMVA 3X2QE 1QYMA 4UWGA 2H6HA 4HOUA 3QKYA 4U04A 2P9NG 4GU5A 4ME2A 4LUNU 5C2YA 2ETCA 4LNBA 2HM8A 3F6QA 1UJJA 2LNIA 3U64A 1N4PA 4TV3A 3ABME 2DWZA 4F7AA 4GMJA 4KMOA 3IEGA 2PQNA 4K5CA 4G25A 5G05J 4FJYA 2P9IG 3CVYA 4K5AB 4DUIA 1UOHA 2WVIA 4YDOA 3TWQA 3FTYA 2XS1A 3IHVA 3KAEA 5LCWJ 3Q73A 3APCA 1JUQA 4BTBA 1MHQA 4CZ2D 1LF8A 1OWNA 3I4GA 4Z68A 3CEQA 4B8AA 1Y8MA 2HE0A 3Q79A 3D9KA 3ZGQA 2F8XK 4EZJA 3URZA 3JQ1A 1EF1C 1E90A 5C1DA 2WQ6A 4U8YD 1KLXA 3GYZA 1MZCA 5AN8A 5BUZA 5EYLA 2CFZA 2WXQA 5G05C 2C2LA 4RSYA 3DPDA 1Z6TA 4ZFHA 1TNOA 4JA9A 3CVWA 2VGXA 4G8KA 1OCZE 3ZPJA 3CKBA 4U0SA 3JCKC 5FTPA 4LERA 1TJFA 1N0RA 5LCWC 3ULYA 4UI9K 5KJKA 3R7RA 3DRAA 4O60A 1WY6A 4DX2A 3SI5A 3JXJA 2VTBB 3B7TA 3AU4A 5FQ7A 2F8YA 3UT8A 5IY5E 4A55A 4ATZD 3PH0C 3D9NA 4FC8A 2NC9A 3AS5A 2ZGDA 2LAIA 1WG0A 1U3DA 3QC1A 2ETAA 2B6CA 1S64A 3FU0A 2YQ8A 4JPSA 2IO2C 2BKKB 3PRZA 5CEAA 4K5BA 2P58C 3BG1B 4GMLA 4XZ4A 3EIQC 4GZ6A 4XI0A 4DX6D 4UI9J 3CHQA 5ENQD 4H7XA 3FUMA 2WXNA 4TUUA 3MZLB 4URKA 3ASDA 2LUHA 3NZSA 2YHEA 3OAWA 3MGBA 4DX1A 4JEHA 4GTSA 4LNGA 2KXPC 4GTQA 2I1JA 4UWHA 1L5JA 1N52A 2JEKA 1TN6A 3UKRG 4GYWA 4UUCA 4XKBA 2C0LA 3MJWA 2Y3AA 4CDMA 4GB9A 3D9PA 2X6FA 2GRQB 2HR2A 2NXPA 4JXTA 4XE0A 5KJNA 1YYHA 1MJ0A 4JZYA 4L1BA 3BG0B 4HXIA 4CDNA 1JWFA 2OEVA 3ONKA 4WAFA 4C9BB 1A5EA 3ZW3A 1N4SA 4UI9C 3FU3A 1P5QA 4F3VA 4GZ5A 2QFCA 1HF8A 5ARFA 3TXMA 3QK0A 3Q47B 4LCTA 5ENSD 3ASHA 1H2TC 4ANXA 2V8SE 5FWQA 3AG1E 3E37A 3TWUA 2RFAA 3ML9A 4EZLA 3Q4AB 2J07A 2VQ2A 3W9FA 1N11A 2EINE 4C48B 4LSZE 5CCLA 2AW6A 3LEWA 1UN8A 3UT4A 5H7PA 1OWLA 3ASNE 5AQBA 3R7QA 3QWWA 2ILRA 2H6GA 2XPIA 1N4RA 2P9SG 1BD8A 3RO2A 4KT6B 4TXQA 3HXBA 2R59A 2IEJA 3ZUVB 2RD0A 4XIFA 3ABKE 2AJAA 5BXUA 2L0IA 3IKOB 5BPPA 1JPLA 1QZ2A 3UTMA 4U7EB 3RSEG 1E8YA 1O1RA 3CVUA 3FU6A 4L9PA 4NQ0A 1HE8A 2KZTA 3OTNA 4FADA 3W9GA 3I5PA 3E30A 4L7TA 3RU0A 4B93B 3DSXA 3CKCA 4I1AA 3TWTA 2F0YA 4GA1A 4BT9A 3EIJA 2VSYA 3J5QB 3DSUA 1OUVA 3UUXA 3HXCA 5E76A 3UM2A 4PS7A 3FTUA 1LTXA 2J49A 4HLEA 2LXLA 3DSVA 4HRMB 3FUIA 3FUNA 3DPYA 4HVBA 2AVPA 4N5QA 2KC7A 4AM9A 4HNAD 3FTVA 2V5QC 3SO8A 3S7FA 4KVOA 5CBOA 4DRXE 2BUGA 2KBXA 2E0IA 3CLJA 2V0PA 5FQ6A 4LNUD 1RW2A 4MLPA 3P2BA 1ZU2A 5CRUA 5A6CA 5ENOD 2UY1B 3FUDA 2J9QA 1LD8A 4ACKA 4CDRA 1XGWA 2XEEA 3VTYA 1BU9A 1U2VG 3ZYLA 3G2VA 4AEZC 3NAWA 4PH4B 4NRHB 1XNFA 4YDWA 1BI8B 3J5PA 3V31A 1KT0A 3FU5A 2WMNA 4XEIG 2P9KG 4R7LA 4EZKA 2WXKA 1NP7A 4Q96A 4EBAA 4KXKB 5CBNA 1S0PA 5FINA 4HOTA 2L0TB 3SFZA 3DXMG 2KCKA 4HOSA 4A3VA 3FUFA 2JLBA 4N2SA 1U3CA 1BPOA 4F1SA 2VSOE 2FULA 3SGHA 3LYAA 1SW6A 1N94A 4I43A 2BTDA 3TG4A 5ENNA 4FHKA 2H6FA 3MKQA 3UT7A 3ZU7B 2ONDA 2E2EA 4KVMA 3FDHA 3LS8A 3TGOA 3PNTB 2WXIA 1E7UA 3CHSA 4PDXA 4CGVA 3ONLA 2KM4A 5KJMA 4AVXA 2I6HA 4QQIA 3UXGA 3SF4A 3NOCD 1H2UA 4U8HA 3ZHEA 3UM1A 3L08A 1OCOE 3EJNA 4MKTA 3CHRA 3V2OA 3LY7A 3MKRA 1OXJA 1OY3D 4BTAA 5D0OD 3FFLA 1ELWA 2QYJA 4L2YA 5KBAA 1OWPA 3FUJA 3TAXA 5A7DB 4J8SA 3D9IA 5BV1A 4FHJA 1QNFA 3ESLA 5CERB 2H6IA 2WM9A 3SD5A 4H7YA 5JMND 2OVBA 2V5FA 2L6JA 4J6IA 5KNGA 3ASFA 4XKCA 4D10C 4DPRA 4I9CA 1IKND 5FT9A 4A3TA 3FUEA 3CSTA 4IRUA 4APOA 1LD7A 2CHZA 3C3RA 5T4YA 1FVFA 3BUAA 3Q75A 2GRMA 1O1TA 3SBTB 4DLQA 3DBSA 4FULA 3UM0A 1K1BA 2A5UA 3AAAC 4U0UA 4I2WA 2R2LA 1ZB1A 3G2WA 5AIJA 4OVUA 3G2SA 1HS6A 3B7UX 3ZYMA 2Y4TA 3TJPA 3PUJA 2XCBA 3G2TA 3EHMA 3CGHA 1TNYA 4TUMA 4TXRA 5FJYA 4HI9A 4GTTA 1TJCA 5D66A 2UY1A 3SFYA 4AV7A 3TWSA 2ZIRA 3PZ4A 5ITZF 3GW4A 5AENA 1JWGA 3FY4A 2WQ7A 1G3NB 5JHBA 1YCSB 2LSVA 3ZIMA 3AS8A 3LDZA 5D2MC 4NACA 2QY7A 1OWOA 1E8ZA 4XX5A 2I9CA 4G24A 4G2VA 3FHEA 1D8DA 1Z5SC 2C0MA 2LSUA 5J90A 1PY1A 3ML8A 4GTPA 1OCRE 3JYSA 1KZOA 3ZKJA 4ILGA 3ZVVA 3RKVA 4XI9A 5EX0A 1K1AA 1K8KG 2ZU6B 3T5VA 2RKKA 1KT1A 2XENA 3KD7A 1AWCB 4M3OA 4BT8A 5JJ7A 4GCOA 2XQ0A 5HRYA 1HO8A 2IO3C 2R05A 5ENRD 1GW6A 2Y4UA 4UWFA 2XRYA 3KSQA 3NBNB 4N2QA 4RG9A 2EILE 3UX4A 4MRUA 2OV8A 2VSXE 2HO1A 3FUHA 4FU3A 5ENTD 3WG7E 4APFA 4N39A 4J8FA 3MYVA 4ILIA 4CGWA 2RFMA 4Y6WA 5JHAA 2MRIA 1SA5A 3JQ0A 4HB5A 1EDUA 2BF0X 2R17C 2LXMA 3CSFA 4NURA 3D9OA 1PC2A 2WXFA 3TWWA 4K03A 3Q7FA 5EIDA 3EU5A 3HDXA 1IYGA 3HXEA 4KZCA 3Q9NC 4CRWA 2GROB 3B7BA 1V55E 4WNFA 4GTMA 3S7BA 4GYOA 3UIPC 3CVQA 1HXIA 1N9AA 1TN8A 2XHEA 2VGYA 3PEUB 3APDA 4AP2A 4C0MA 5FQ4A 3CQCB 4HI8A 2IF4A 2DZOA 3PZ2A 4YDEA 3E32A 3S2AA 1NA0A 3FTXA 3HIZA 3PVLA 2QC9A 3P1UA 1OCCE 3PE3A 2J09A 4WWNA 3CHOA 4B89A 4BWRA 4Q94A 4L2LA 4J8YA 3SBSA 5ARGA 1DVPA 4EQFA 3TXNA 4J7WA 5EIBE 4E85A 2WXLA 3CK9A 3JXIA 3ZEFA 2IOSA 3UINC 4G8LA 3L9TA 3RO3A 4IN3B 4K0RA 4JB8P 4YNDA 2Y69E 3AS4A 3DSSA 4KZ0A 3O4ZA 1TEZA 2NYJA 3KS2A 4HBDA 2ETBA 3C72A 5AARA 5CMWA 3ISMC 4JHRA 4U96D 2V4HC 4C0EA 3B13A 1WM5A 1H0AA 3QNKA 2L9BA 3L6AA 3QB2A 3SY2A 3ULQA 2OVFA 3QOUA 3Q7AA 2CFUA 3D9HA 1N95A 4RLYA 1IXVA 1UN9A 3Q5MA 5CRVA 1DNPA 3E4BA 3SQVA 2XZDG 3ZRHA 5LX8A 3D3MA 4PS3A 5G04C 3Q9UC 4BETA 2J8SD 2WXOA 1NFIE 2J4DA 3V2XA 2XGOA 3ASGA 3C3OA 5A23A 2HYZA 1X81A 3LVRE 4DI3A 3TL5A 2B0OE 2VTBA 2EIKE 2FEZA 4QFVA 1V54E 3AU5A 3O48A 2YHCA 4AY6A 3C5RA 1E96B 4CEMA 3IBEA 4A1SA 2Q7FA 4GPKA 4I9EA 1RZ4A 1FCHA 1PAQA 4UQZA 4FP7A 3ABLE 2I1KA 2GRLA 4BFRA 2X6KA 4WUYA 4N3AA 5JA4D 4RVBA 3L54A 2DBAA 3LPZA 3L17A 2R5SA 1NI1A 4O1OA 4WWPA 1OT8A 1SVXA 5BNWA 4HFGA 2AXUA 2PZIA 3LJNA 2NSZA 3LY8A 1W3BA 4PS8A 4HORA 1N54A 3T8KA 5JJ6A 3NZUA 4JHJA 3FH8A 2Y1LE 3V79K 3G2UA 4UWKA 4JA7A 5EYPF 1ELRA 5BXOA 4F1PA 5ANRA 3MV2B 1TYQG 4YDYA 1H6KA 1X5BA 4OYSA 2VYIA 3WXXA 5AQ9A 2WB2A 1E8WA 2MHKA 3N71A 4JC8A 3B95A 2FO1E 3ZN3A 3T8MA 3QJZA 1HZ4A 3UM3A 4EBAG 5E75A 5B3SE 2PM6A 2XEHA 1A17A 4I6GA 3CV0A 2FI7A 3TWRA 3L82A 4LRZA 3U9WA 1FT2A 1B89A 4ANVA 2WXHA 3L13A 4U95D 3UPVA 3LKUA 4I17A 2MOWA 3DSTA 3PREA 2VGXB 2F37A 3QARA 2A5EA 2IONA 1UJKA 3ESKA 2AXZA 2X38A 2WXPA 4GA0A 4G1TA 3S7JA 2IJGX 3PE4A 4BSZB 3DSWA 1BI7B 4I1MA 5DIZA 1QBQA 3RJVA 4YVOA 3B7RL 2GGFA 3CVPA 2ZXWE 2X6IA 4GTRA 4AIFA 4EPZA 3FH7A 1SQMA 4JW1A 4GZDA 1HH8A 2XCCA 4AJWA 2Y0BG 4CT0A 4CYMD 4DX5D 2FBNA 5G55A 2X6JA 3R9MA 4J8EA 1NZNA 3EU9A 4GPMA 4O6FA 1MX4A 3D9MA 3MCXA 4JHKA 3VLEA 3FULA 3C98A 5AQ7A 1H6OA 4AOFA 2FF4A 3CHMA 2YNQA 3EHRA 3C3QA 1TNUA 5CCMA 5AQAA 5KWDA 4JVSA 4RG6A 4HQDA 4RQIA 5BV0A 4EHMA 3MA5A 4DX7D 4HRLA 2UWJG 3L22A 3DEOA 3VLDA 5JJTA 3ASOE 1Z3XA 4CT4A 2LAHA 4JEUA 5KCMA 4BESA 2CHWA 3IXEA 3CIAA 3I3NA 3UIOC 2VGEA 3R9AB 2WXJA 4UQYA 5T3RA 4HRNA 2AWIA 3PDNA 3T9KA 2DVWA 2CG2A 4O1PA 1HG5A 4F53A 3CVNA 1NL4A 4WNDA 2PM7A 5DBKA 2R02A 3FTWA 3QDNA 2IY0C 3ENEA 4AY5A 4V3IA 2J4BA 3EDTB 1D9SA 4GTOA 4N3CA 1DCQA 1JCSA 4MBGA 4BX9A 3EHNA 5HI7A 2ZISA 4DK5A 1SA4A 4B0ZA 4G23A 1YMPA 3QWPA 3RK6A 4FLHA 3T5XA 1JCQA 4HOQA 4TXPA 3IV0A 3JUEA 5EILA 5HKPA 1H6PA 1IHBA 4ANWA 3ULEG 4YVQC 3D9JA 3HYMB 2A4ZA 1DCEA 2VJ8A 2CG3A 4B94A 3HHMA 3SNXA 1HG2A 3LVQE 2ZGGA 3UI2A 4N3BA 3PZ3A 5AAOA 4U8VD 1O1SA 3SZ7A 5FIOA 5BW8C 4P29A 2XPZA 3GZ2A 1OWMA 2KZTB 4A63B 4I2ZA 3CK8A 1TNZA 3NOGD 4U0ZA 3HXFA 3ZXPA 5EDSA 4HLLA 3APFA 2PQRA 1QQEA 5EN5D 1HFAA 1MYOA 4FLBA 1DC2A 3AG2E 3OXLA 4DJAA 3PZDA 3SFXA 4UWLA 3CVLA 3Q78A 3Q49B 2GRNB 3U3WA 2GRPB 2V4LA 3LJ3A 4GA2A 3PNLB 3BU8A 4IULA 4ANUA 1ELKA 5B1BE 4BEPA 1MX6A 1NA3A 2WMOA 2DYSE 4FJZA 4GAAA 4GCNA 2X6HA 3CR3A 4BSXA 2KCLA 2DCPA 3FEYA 2RG8A 3LXUX 3CVVA 1H2VC 3VLFA 5FZSA 5LOZA 3PS6A 1E8XA 3MEKA 4BY6A 5G04J 3BQOA 3FTSA 2PNNA 3EUVA 3OXGA 2DZNA 2M63A 1IQUA 3U4TA 1ZBPA 4J8DA 3IHYA 3DWLG 1FVHA 1EYHA 3AJIA 3QWVA 4BX8A 3FEXA 1E7VA 3AG4E 3RRMB 1K3ZD 1SZ9A 4LG6A 5ENPD 1S63A 3V30A 4OAVB 4L23A 5ANLA 3L16A 4B8CB 5FQ8A 3NB2A 2GRRB 4ABNA 2XGMA 4N5CA 3MKQB 3DEPA 5CEDB 3U66A 5FZQA 4GTVA 5LP0A 3E33A 1TN7A 4Q69A 5J08A 1BLXB 2P9UG 5D0QD 5EX3A 3FWVA 4ACLA 3ZYQA 3HRAA 2EIJE 5FZRA 2DYRE 3ZHEB 3VTXA 2KATA 4I1OB 2OCCE 5CECB 3HVEB 3LCAA 2AXVA 3UQ3A 1INZA 1TR4A 4OAUC 5KNHD 3EHQA 1WDYA 5AJLA 2LO6A 5B1AE 1H19A 3D9LA 5HQ8A 1KPSB 2XGSA 4X8QA 2EQXA 4WNGA 3TWVA 3MX3A 5G2NA 4HS2A 1IQRA 5M72A 1Z3YA
chains in the Genus database with same CATH topology
4ZHBA 4ZFHA 5AARA 2KXPC 5ENOD 1BD8A 1OY3D 3TWSA 1SVXA 2ZGGA 4G8KA 3UI2A 3HG0D 4U96D 4BSZB 2PNNA 5AAOA 2P2CP 4U8VD 2V4HC 2QYJA 5ITZF 2RFMA 1BI7B 2XEEA 5KBAA 1BU9A 5FIOA 3ZUVB 2DZNA 4UUCA 1G3NB 4HB5A 2ETCA 3LJNA 1YCSB 1N0RA 3F6QA 4F6RD 4YDWA 4A63B 4BESA 1BI8B 2AJAA 3J5PA 3T8KA 3ZNGA 5BXUA 3IXEA 3NOGD 3TWWA 5CERB 3V31A 3AJIA 2DWZA 5EIDA 2Y1LE 3V79K 2VGEA 3D9HA 4HLLA 3UTMA 4HRNA 1K3ZD 4NIKA 1YYHA 1MJ0A 5JMND 4O60A 4LG6A 4RLYA 3T9KA 4K5CA 2DVWA 5ENPD 1IXVA 4DX2A 5EYPF 5EN5D 3Q9NC 2MYOA 5BXOA 4F1PA 4O1PA 4YDYA 3V30A 3JXJA 1MYOA 5KNGA 4K5AB 2XZDG 3B7BA 4OAVB 2Y0BG 4DUIA 1DC2A 1UOHA 4CYMD 2F8YA 4DX5D 1S70B 3W9GA 5CBNA 1A5EA 3TWQA 5FINA 3Q9UC 1IKND 4ATZD 4BETA 2J8SD 1NFIE 4B93B 5AQ9A 3V2XA 3TWXA 3EU9A 3DEPA 5CEDB 3B95A 4HI8A 3TWTA 2FO1E 4GPMA 2DZOA 2ZGDA 1D9SA 1MX4A 2B0OE 1DCQA 4BEPA 3J5QB 1WG0A 4CZ2D 1BLXB 3ZKJA 1MX6A 1SW6A 2ETAA 2QC9A 4QFVA 5HS0A 1K1AA 4Z68A 5ENSD 5AQ7A 1K1BA 1AP7A 4BERA 3AAAC 2XENA 1AWCB 2BKKB 2XEHA 3EHRA 3KEAA 3TWUA 2HE0A 3HRAA 2JABA 4GMRA 4J8YA 3ZU7B 2RFAA 3C5RA 5AQAA 5CEAA 4K5BA 1YMPA 4HRMB 5HRYA 1MX2A 2BKGA 5KWDA 3TWRA 4N5QA 4DX6D 5ENRD 5ENQD 4HQDA 3W9FA 5CECB 4J7WA 1N11A 5EIBE 1TR4A 4OAUC 5KNHD 4C48B 3EHQA 4U95D 3NBNB 4HNAD 2XZTG 2F8XK 3JXIA 1WDYA 2V5QC 4LSZE 3SO8A 2F37A 3JUEA 4G8LA 2A5EA 4QQIA 2L6BA 3UXGA 5EILA 5HKPA 5CBOA 4DRXE 4TUMA 3NOCD 1IHBA 4U8YD 4DX7D 1N0QA 2KBXA 5JA4D 4HI9A 4HRLA 4JB8P 5AQBA 5AN8A 3TWVA 5EYLA 5D66A 1QYMA 4LNUD 4O1OA 4DX1A 2NYJA 3DEOA 4HBDA 2ETBA 3V2OA 1OT8A 5ENTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHB A;  4ZFH A;  5AAR A;  2KXP C;  5ENO D;  1BD8 A;  1OY3 D;  3TWS A;  1SVX A;  2ZGG A;  4G8K A;  3UI2 A;  3HG0 D;  4U96 D;  4BSZ B;  2PNN A;  5AAO A;  2P2C P;  4U8V D;  2V4H C;  2QYJ A;  5ITZ F;  2RFM A;  1BI7 B;  2XEE A;  5KBA A;  1BU9 A;  5FIO A;  3ZUV B;  2DZN A;  4UUC A;  1G3N B;  4HB5 A;  2ETC A;  3LJN A;  1YCS B;  1N0R A;  3F6Q A;  4F6R D;  4YDW A;  4A63 B;  4BES A;  1BI8 B;  2AJA A;  3J5P A;  3T8K A;  3ZNG A;  5BXU A;  3IXE A;  3NOG D;  3TWW A;  5CER B;  3V31 A;  3AJI A;  2DWZ A;  5EID A;  2Y1L E;  3V79 K;  2VGE A;  3D9H A;  4HLL A;  3UTM A;  4HRN A;  1K3Z D;  4NIK A;  1YYH A;  1MJ0 A;  5JMN D;  4O60 A;  4LG6 A;  4RLY A;  3T9K A;  4K5C A;  2DVW A;  5ENP D;  1IXV A;  4DX2 A;  5EYP F;  5EN5 D;  3Q9N C;  2MYO A;  5BXO A;  4F1P A;  4O1P A;  4YDY A;  3V30 A;  3JXJ A;  1MYO A;  5KNG A;  4K5A B;  2XZD G;  3B7B A;  4OAV B;  2Y0B G;  4DUI A;  1DC2 A;  1UOH A;  4CYM D;  2F8Y A;  4DX5 D;  1S70 B;  3W9G A;  5CBN A;  1A5E A;  3TWQ A;  5FIN A;  3Q9U C;  1IKN D;  4ATZ D;  4BET A;  2J8S D;  1NFI E;  4B93 B;  5AQ9 A;  3V2X A;  3TWX A;  3EU9 A;  3DEP A;  5CED B;  3B95 A;  4HI8 A;  3TWT A;  2FO1 E;  4GPM A;  2DZO A;  2ZGD A;  1D9S A;  1MX4 A;  2B0O E;  1DCQ A;  4BEP A;  3J5Q B;  1WG0 A;  4CZ2 D;  1BLX B;  3ZKJ A;  1MX6 A;  1SW6 A;  2ETA A;  2QC9 A;  4QFV A;  5HS0 A;  1K1A A;  4Z68 A;  5ENS D;  5AQ7 A;  1K1B A;  1AP7 A;  4BER A;  3AAA C;  2XEN A;  1AWC B;  2BKK B;  2XEH A;  3EHR A;  3KEA A;  3TWU A;  2HE0 A;  3HRA A;  2JAB A;  4GMR A;  4J8Y A;  3ZU7 B;  2RFA A;  3C5R A;  5AQA A;  5CEA A;  4K5B A;  1YMP A;  4HRM B;  5HRY A;  1MX2 A;  2BKG A;  5KWD A;  3TWR A;  4N5Q A;  4DX6 D;  5ENR D;  5ENQ D;  4HQD A;  3W9F A;  5CEC B;  4J7W A;  1N11 A;  5EIB E;  1TR4 A;  4OAU C;  5KNH D;  4C48 B;  3EHQ A;  4U95 D;  3NBN B;  4HNA D;  2XZT G;  2F8X K;  3JXI A;  1WDY A;  2V5Q C;  4LSZ E;  3SO8 A;  2F37 A;  3JUE A;  4G8L A;  2A5E A;  4QQI A;  2L6B A;  3UXG A;  5EIL A;  5HKP A;  5CBO A;  4DRX E;  4TUM A;  3NOC D;  1IHB A;  4U8Y D;  4DX7 D;  1N0Q A;  2KBX A;  5JA4 D;  4HI9 A;  4HRL A;  4JB8 P;  5AQB A;  5AN8 A;  3TWV A;  5EYL A;  5D66 A;  1QYM A;  4LNU D;  4O1O A;  4DX1 A;  2NYJ A;  3DEO A;  4HBD A;  2ETB A;  3V2O A;  1OT8 A;  5ENT D; 
#chains in the Genus database with same CATH topology
 2R03 A;  2XEV A;  4G26 A;  4CCA A;  4F6R D;  4UQX A;  3RRU A;  3ZNG A;  2QYU A;  3B7S A;  3NF1 A;  3FTZ A;  1FPP A;  3DXK G;  1IHG A;  2J08 A;  4NIK A;  3KSL A;  5CMY A;  3LY9 A;  4ATG A;  1UW4 B;  1YA0 A;  3RRN B;  4U63 A;  5EKQ D;  4WNE A;  1UG3 A;  2KCV A;  4W9R A;  2P9L G;  3TWX A;  2WQH A;  4GYY A;  4G11 A;  4KYO B;  3RAU A;  1MQS A;  3PZ1 A;  2P9P G;  4MS6 A;  2I2O A;  1SZA A;  4JD2 G;  3SHF A;  3Q15 A;  5HS0 A;  3PUK A;  1HX8 A;  4M7C A;  4BER A;  4WWO A;  1Q2Z A;  3CVX A;  3KEA A;  4GMR A;  3FUK A;  4AXH A;  5AYW D;  3KEZ A;  4LEU A;  3MV3 B;  2OEW A;  2YIN A;  3OXF A;  3JUI A;  2VSN A;  2IOL A;  4EEC A;  3TG5 A;  2WXM A;  1D8E A;  3E34 A;  2WXG A;  2WPV A;  4DLO A;  3UKU G;  3AG3 E;  3CQG B;  4GZC A;  4ZHB A;  1JCR A;  4E6H A;  1KZP A;  3RIB A;  1N4Q A;  3FP3 A;  3GZ1 A;  3CK7 A;  3HG0 D;  4TRQ A;  2P2C P;  3K9I A;  4Y6C A;  2IFU A;  2X3M A;  3ZFW A;  1WAO 1;  3ZXS A;  3BEE A;  4KBQ A;  4ILH B;  3ZYK A;  4JL0 A;  2QZA A;  2CHX A;  1EPU A;  3HXD A;  1O5M A;  4I6J A;  1HU3 A;  2MYO A;  4A1G A;  2IU1 A;  2PL2 A;  5AJD A;  5LFA A;  4IYP A;  1S70 B;  2XS8 A;  4GZ3 A;  4OVV A;  1FT1 A;  2GW1 A;  3PEV B;  5T8I A;  3QAQ A;  5BT1 A;  1TNB A;  2FO7 A;  3FH5 A;  2XPY A;  3I4R B;  3NQP A;  3S7D A;  5CHE E;  1VDY A;  4DI4 A;  2XRZ A;  1AP7 A;  5KJL A;  2EIM E;  2JAB A;  4PUC A;  3HVE A;  3CHP A;  1MX2 A;  2BKG A;  2OOE A;  3GZS A;  4I6E A;  1Y6I A;  4FA6 A;  4J0U A;  2XZT G;  2L6B A;  2WXR A;  2DIW A;  4U07 A;  2IQC A;  1N0Q A;  2BED A;  3UMV A;  3X2Q E;  1QYM A;  4UWG A;  2H6H A;  4HOU A;  3QKY A;  4U04 A;  2P9N G;  4GU5 A;  4ME2 A;  4LUN U;  5C2Y A;  2ETC A;  4LNB A;  2HM8 A;  3F6Q A;  1UJJ A;  2LNI A;  3U64 A;  1N4P A;  4TV3 A;  3ABM E;  2DWZ A;  4F7A A;  4GMJ A;  4KMO A;  3IEG A;  2PQN A;  4K5C A;  4G25 A;  5G05 J;  4FJY A;  2P9I G;  3CVY A;  4K5A B;  4DUI A;  1UOH A;  2WVI A;  4YDO A;  3TWQ A;  3FTY A;  2XS1 A;  3IHV A;  3KAE A;  5LCW J;  3Q73 A;  3APC A;  1JUQ A;  4BTB A;  1MHQ A;  4CZ2 D;  1LF8 A;  1OWN A;  3I4G A;  4Z68 A;  3CEQ A;  4B8A A;  1Y8M A;  2HE0 A;  3Q79 A;  3D9K A;  3ZGQ A;  2F8X K;  4EZJ A;  3URZ A;  3JQ1 A;  1EF1 C;  1E90 A;  5C1D A;  2WQ6 A;  4U8Y D;  1KLX A;  3GYZ A;  1MZC A;  5AN8 A;  5BUZ A;  5EYL A;  2CFZ A;  2WXQ A;  5G05 C;  2C2L A;  4RSY A;  3DPD A;  1Z6T A;  4ZFH A;  1TNO A;  4JA9 A;  3CVW A;  2VGX A;  4G8K A;  1OCZ E;  3ZPJ A;  3CKB A;  4U0S A;  3JCK C;  5FTP A;  4LER A;  1TJF A;  1N0R A;  5LCW C;  3ULY A;  4UI9 K;  5KJK A;  3R7R A;  3DRA A;  4O60 A;  1WY6 A;  4DX2 A;  3SI5 A;  3JXJ A;  2VTB B;  3B7T A;  3AU4 A;  5FQ7 A;  2F8Y A;  3UT8 A;  5IY5 E;  4A55 A;  4ATZ D;  3PH0 C;  3D9N A;  4FC8 A;  2NC9 A;  3AS5 A;  2ZGD A;  2LAI A;  1WG0 A;  1U3D A;  3QC1 A;  2ETA A;  2B6C A;  1S64 A;  3FU0 A;  2YQ8 A;  4JPS A;  2IO2 C;  2BKK B;  3PRZ A;  5CEA A;  4K5B A;  2P58 C;  3BG1 B;  4GML A;  4XZ4 A;  3EIQ C;  4GZ6 A;  4XI0 A;  4DX6 D;  4UI9 J;  3CHQ A;  5ENQ D;  4H7X A;  3FUM A;  2WXN A;  4TUU A;  3MZL B;  4URK A;  3ASD A;  2LUH A;  3NZS A;  2YHE A;  3OAW A;  3MGB A;  4DX1 A;  4JEH A;  4GTS A;  4LNG A;  2KXP C;  4GTQ A;  2I1J A;  4UWH A;  1L5J A;  1N52 A;  2JEK A;  1TN6 A;  3UKR G;  4GYW A;  4UUC A;  4XKB A;  2C0L A;  3MJW A;  2Y3A A;  4CDM A;  4GB9 A;  3D9P A;  2X6F A;  2GRQ B;  2HR2 A;  2NXP A;  4JXT A;  4XE0 A;  5KJN A;  1YYH A;  1MJ0 A;  4JZY A;  4L1B A;  3BG0 B;  4HXI A;  4CDN A;  1JWF A;  2OEV A;  3ONK A;  4WAF A;  4C9B B;  1A5E A;  3ZW3 A;  1N4S A;  4UI9 C;  3FU3 A;  1P5Q A;  4F3V A;  4GZ5 A;  2QFC A;  1HF8 A;  5ARF A;  3TXM A;  3QK0 A;  3Q47 B;  4LCT A;  5ENS D;  3ASH A;  1H2T C;  4ANX A;  2V8S E;  5FWQ A;  3AG1 E;  3E37 A;  3TWU A;  2RFA A;  3ML9 A;  4EZL A;  3Q4A B;  2J07 A;  2VQ2 A;  3W9F A;  1N11 A;  2EIN E;  4C48 B;  4LSZ E;  5CCL A;  2AW6 A;  3LEW A;  1UN8 A;  3UT4 A;  5H7P A;  1OWL A;  3ASN E;  5AQB A;  3R7Q A;  3QWW A;  2ILR A;  2H6G A;  2XPI A;  1N4R A;  2P9S G;  1BD8 A;  3RO2 A;  4KT6 B;  4TXQ A;  3HXB A;  2R59 A;  2IEJ A;  3ZUV B;  2RD0 A;  4XIF A;  3ABK E;  2AJA A;  5BXU A;  2L0I A;  3IKO B;  5BPP A;  1JPL A;  1QZ2 A;  3UTM A;  4U7E B;  3RSE G;  1E8Y A;  1O1R A;  3CVU A;  3FU6 A;  4L9P A;  4NQ0 A;  1HE8 A;  2KZT A;  3OTN A;  4FAD A;  3W9G A;  3I5P A;  3E30 A;  4L7T A;  3RU0 A;  4B93 B;  3DSX A;  3CKC A;  4I1A A;  3TWT A;  2F0Y A;  4GA1 A;  4BT9 A;  3EIJ A;  2VSY A;  3J5Q B;  3DSU A;  1OUV A;  3UUX A;  3HXC A;  5E76 A;  3UM2 A;  4PS7 A;  3FTU A;  1LTX A;  2J49 A;  4HLE A;  2LXL A;  3DSV A;  4HRM B;  3FUI A;  3FUN A;  3DPY A;  4HVB A;  2AVP A;  4N5Q A;  2KC7 A;  4AM9 A;  4HNA D;  3FTV A;  2V5Q C;  3SO8 A;  3S7F A;  4KVO A;  5CBO A;  4DRX E;  2BUG A;  2KBX A;  2E0I A;  3CLJ A;  2V0P A;  5FQ6 A;  4LNU D;  1RW2 A;  4MLP A;  3P2B A;  1ZU2 A;  5CRU A;  5A6C A;  5ENO D;  2UY1 B;  3FUD A;  2J9Q A;  1LD8 A;  4ACK A;  4CDR A;  1XGW A;  2XEE A;  3VTY A;  1BU9 A;  1U2V G;  3ZYL A;  3G2V A;  4AEZ C;  3NAW A;  4PH4 B;  4NRH B;  1XNF A;  4YDW A;  1BI8 B;  3J5P A;  3V31 A;  1KT0 A;  3FU5 A;  2WMN A;  4XEI G;  2P9K G;  4R7L A;  4EZK A;  2WXK A;  1NP7 A;  4Q96 A;  4EBA A;  4KXK B;  5CBN A;  1S0P A;  5FIN A;  4HOT A;  2L0T B;  3SFZ A;  3DXM G;  2KCK A;  4HOS A;  4A3V A;  3FUF A;  2JLB A;  4N2S A;  1U3C A;  1BPO A;  4F1S A;  2VSO E;  2FUL A;  3SGH A;  3LYA A;  1SW6 A;  1N94 A;  4I43 A;  2BTD A;  3TG4 A;  5ENN A;  4FHK A;  2H6F A;  3MKQ A;  3UT7 A;  3ZU7 B;  2OND A;  2E2E A;  4KVM A;  3FDH A;  3LS8 A;  3TGO A;  3PNT B;  2WXI A;  1E7U A;  3CHS A;  4PDX A;  4CGV A;  3ONL A;  2KM4 A;  5KJM A;  4AVX A;  2I6H A;  4QQI A;  3UXG A;  3SF4 A;  3NOC D;  1H2U A;  4U8H A;  3ZHE A;  3UM1 A;  3L08 A;  1OCO E;  3EJN A;  4MKT A;  3CHR A;  3V2O A;  3LY7 A;  3MKR A;  1OXJ A;  1OY3 D;  4BTA A;  5D0O D;  3FFL A;  1ELW A;  2QYJ A;  4L2Y A;  5KBA A;  1OWP A;  3FUJ A;  3TAX A;  5A7D B;  4J8S A;  3D9I A;  5BV1 A;  4FHJ A;  1QNF A;  3ESL A;  5CER B;  2H6I A;  2WM9 A;  3SD5 A;  4H7Y A;  5JMN D;  2OVB A;  2V5F A;  2L6J A;  4J6I A;  5KNG A;  3ASF A;  4XKC A;  4D10 C;  4DPR A;  4I9C A;  1IKN D;  5FT9 A;  4A3T A;  3FUE A;  3CST A;  4IRU A;  4APO A;  1LD7 A;  2CHZ A;  3C3R A;  5T4Y A;  1FVF A;  3BUA A;  3Q75 A;  2GRM A;  1O1T A;  3SBT B;  4DLQ A;  3DBS A;  4FUL A;  3UM0 A;  1K1B A;  2A5U A;  3AAA C;  4U0U A;  4I2W A;  2R2L A;  1ZB1 A;  3G2W A;  5AIJ A;  4OVU A;  3G2S A;  1HS6 A;  3B7U X;  3ZYM A;  2Y4T A;  3TJP A;  3PUJ A;  2XCB A;  3G2T A;  3EHM A;  3CGH A;  1TNY A;  4TUM A;  4TXR A;  5FJY A;  4HI9 A;  4GTT A;  1TJC A;  5D66 A;  2UY1 A;  3SFY A;  4AV7 A;  3TWS A;  2ZIR A;  3PZ4 A;  5ITZ F;  3GW4 A;  5AEN A;  1JWG A;  3FY4 A;  2WQ7 A;  1G3N B;  5JHB A;  1YCS B;  2LSV A;  3ZIM A;  3AS8 A;  3LDZ A;  5D2M C;  4NAC A;  2QY7 A;  1OWO A;  1E8Z A;  4XX5 A;  2I9C A;  4G24 A;  4G2V A;  3FHE A;  1D8D A;  1Z5S C;  2C0M A;  2LSU A;  5J90 A;  1PY1 A;  3ML8 A;  4GTP A;  1OCR E;  3JYS A;  1KZO A;  3ZKJ A;  4ILG A;  3ZVV A;  3RKV A;  4XI9 A;  5EX0 A;  1K1A A;  1K8K G;  2ZU6 B;  3T5V A;  2RKK A;  1KT1 A;  2XEN A;  3KD7 A;  1AWC B;  4M3O A;  4BT8 A;  5JJ7 A;  4GCO A;  2XQ0 A;  5HRY A;  1HO8 A;  2IO3 C;  2R05 A;  5ENR D;  1GW6 A;  2Y4U A;  4UWF A;  2XRY A;  3KSQ A;  3NBN B;  4N2Q A;  4RG9 A;  2EIL E;  3UX4 A;  4MRU A;  2OV8 A;  2VSX E;  2HO1 A;  3FUH A;  4FU3 A;  5ENT D;  3WG7 E;  4APF A;  4N39 A;  4J8F A;  3MYV A;  4ILI A;  4CGW A;  2RFM A;  4Y6W A;  5JHA A;  2MRI A;  1SA5 A;  3JQ0 A;  4HB5 A;  1EDU A;  2BF0 X;  2R17 C;  2LXM A;  3CSF A;  4NUR A;  3D9O A;  1PC2 A;  2WXF A;  3TWW A;  4K03 A;  3Q7F A;  5EID A;  3EU5 A;  3HDX A;  1IYG A;  3HXE A;  4KZC A;  3Q9N C;  4CRW A;  2GRO B;  3B7B A;  1V55 E;  4WNF A;  4GTM A;  3S7B A;  4GYO A;  3UIP C;  3CVQ A;  1HXI A;  1N9A A;  1TN8 A;  2XHE A;  2VGY A;  3PEU B;  3APD A;  4AP2 A;  4C0M A;  5FQ4 A;  3CQC B;  4HI8 A;  2IF4 A;  2DZO A;  3PZ2 A;  4YDE A;  3E32 A;  3S2A A;  1NA0 A;  3FTX A;  3HIZ A;  3PVL A;  2QC9 A;  3P1U A;  1OCC E;  3PE3 A;  2J09 A;  4WWN A;  3CHO A;  4B89 A;  4BWR A;  4Q94 A;  4L2L A;  4J8Y A;  3SBS A;  5ARG A;  1DVP A;  4EQF A;  3TXN A;  4J7W A;  5EIB E;  4E85 A;  2WXL A;  3CK9 A;  3JXI A;  3ZEF A;  2IOS A;  3UIN C;  4G8L A;  3L9T A;  3RO3 A;  4IN3 B;  4K0R A;  4JB8 P;  4YND A;  2Y69 E;  3AS4 A;  3DSS A;  4KZ0 A;  3O4Z A;  1TEZ A;  2NYJ A;  3KS2 A;  4HBD A;  2ETB A;  3C72 A;  5AAR A;  5CMW A;  3ISM C;  4JHR A;  4U96 D;  2V4H C;  4C0E A;  3B13 A;  1WM5 A;  1H0A A;  3QNK A;  2L9B A;  3L6A A;  3QB2 A;  3SY2 A;  3ULQ A;  2OVF A;  3QOU A;  3Q7A A;  2CFU A;  3D9H A;  1N95 A;  4RLY A;  1IXV A;  1UN9 A;  3Q5M A;  5CRV A;  1DNP A;  3E4B A;  3SQV A;  2XZD G;  3ZRH A;  5LX8 A;  3D3M A;  4PS3 A;  5G04 C;  3Q9U C;  4BET A;  2J8S D;  2WXO A;  1NFI E;  2J4D A;  3V2X A;  2XGO A;  3ASG A;  3C3O A;  5A23 A;  2HYZ A;  1X81 A;  3LVR E;  4DI3 A;  3TL5 A;  2B0O E;  2VTB A;  2EIK E;  2FEZ A;  4QFV A;  1V54 E;  3AU5 A;  3O48 A;  2YHC A;  4AY6 A;  3C5R A;  1E96 B;  4CEM A;  3IBE A;  4A1S A;  2Q7F A;  4GPK A;  4I9E A;  1RZ4 A;  1FCH A;  1PAQ A;  4UQZ A;  4FP7 A;  3ABL E;  2I1K A;  2GRL A;  4BFR A;  2X6K A;  4WUY A;  4N3A A;  5JA4 D;  4RVB A;  3L54 A;  2DBA A;  3LPZ A;  3L17 A;  2R5S A;  1NI1 A;  4O1O A;  4WWP A;  1OT8 A;  1SVX A;  5BNW A;  4HFG A;  2AXU A;  2PZI A;  3LJN A;  2NSZ A;  3LY8 A;  1W3B A;  4PS8 A;  4HOR A;  1N54 A;  3T8K A;  5JJ6 A;  3NZU A;  4JHJ A;  3FH8 A;  2Y1L E;  3V79 K;  3G2U A;  4UWK A;  4JA7 A;  5EYP F;  1ELR A;  5BXO A;  4F1P A;  5ANR A;  3MV2 B;  1TYQ G;  4YDY A;  1H6K A;  1X5B A;  4OYS A;  2VYI A;  3WXX A;  5AQ9 A;  2WB2 A;  1E8W A;  2MHK A;  3N71 A;  4JC8 A;  3B95 A;  2FO1 E;  3ZN3 A;  3T8M A;  3QJZ A;  1HZ4 A;  3UM3 A;  4EBA G;  5E75 A;  5B3S E;  2PM6 A;  2XEH A;  1A17 A;  4I6G A;  3CV0 A;  2FI7 A;  3TWR A;  3L82 A;  4LRZ A;  3U9W A;  1FT2 A;  1B89 A;  4ANV A;  2WXH A;  3L13 A;  4U95 D;  3UPV A;  3LKU A;  4I17 A;  2MOW A;  3DST A;  3PRE A;  2VGX B;  2F37 A;  3QAR A;  2A5E A;  2ION A;  1UJK A;  3ESK A;  2AXZ A;  2X38 A;  2WXP A;  4GA0 A;  4G1T A;  3S7J A;  2IJG X;  3PE4 A;  4BSZ B;  3DSW A;  1BI7 B;  4I1M A;  5DIZ A;  1QBQ A;  3RJV A;  4YVO A;  3B7R L;  2GGF A;  3CVP A;  2ZXW E;  2X6I A;  4GTR A;  4AIF A;  4EPZ A;  3FH7 A;  1SQM A;  4JW1 A;  4GZD A;  1HH8 A;  2XCC A;  4AJW A;  2Y0B G;  4CT0 A;  4CYM D;  4DX5 D;  2FBN A;  5G55 A;  2X6J A;  3R9M A;  4J8E A;  1NZN A;  3EU9 A;  4GPM A;  4O6F A;  1MX4 A;  3D9M A;  3MCX A;  4JHK A;  3VLE A;  3FUL A;  3C98 A;  5AQ7 A;  1H6O A;  4AOF A;  2FF4 A;  3CHM A;  2YNQ A;  3EHR A;  3C3Q A;  1TNU A;  5CCM A;  5AQA A;  5KWD A;  4JVS A;  4RG6 A;  4HQD A;  4RQI A;  5BV0 A;  4EHM A;  3MA5 A;  4DX7 D;  4HRL A;  2UWJ G;  3L22 A;  3DEO A;  3VLD A;  5JJT A;  3ASO E;  1Z3X A;  4CT4 A;  2LAH A;  4JEU A;  5KCM A;  4BES A;  2CHW A;  3IXE A;  3CIA A;  3I3N A;  3UIO C;  2VGE A;  3R9A B;  2WXJ A;  4UQY A;  5T3R A;  4HRN A;  2AWI A;  3PDN A;  3T9K A;  2DVW A;  2CG2 A;  4O1P A;  1HG5 A;  4F53 A;  3CVN A;  1NL4 A;  4WND A;  2PM7 A;  5DBK A;  2R02 A;  3FTW A;  3QDN A;  2IY0 C;  3ENE A;  4AY5 A;  4V3I A;  2J4B A;  3EDT B;  1D9S A;  4GTO A;  4N3C A;  1DCQ A;  1JCS A;  4MBG A;  4BX9 A;  3EHN A;  5HI7 A;  2ZIS A;  4DK5 A;  1SA4 A;  4B0Z A;  4G23 A;  1YMP A;  3QWP A;  3RK6 A;  4FLH A;  3T5X A;  1JCQ A;  4HOQ A;  4TXP A;  3IV0 A;  3JUE A;  5EIL A;  5HKP A;  1H6P A;  1IHB A;  4ANW A;  3ULE G;  4YVQ C;  3D9J A;  3HYM B;  2A4Z A;  1DCE A;  2VJ8 A;  2CG3 A;  4B94 A;  3HHM A;  3SNX A;  1HG2 A;  3LVQ E;  2ZGG A;  3UI2 A;  4N3B A;  3PZ3 A;  5AAO A;  4U8V D;  1O1S A;  3SZ7 A;  5FIO A;  5BW8 C;  4P29 A;  2XPZ A;  3GZ2 A;  1OWM A;  2KZT B;  4A63 B;  4I2Z A;  3CK8 A;  1TNZ A;  3NOG D;  4U0Z A;  3HXF A;  3ZXP A;  5EDS A;  4HLL A;  3APF A;  2PQR A;  1QQE A;  5EN5 D;  1HFA A;  1MYO A;  4FLB A;  1DC2 A;  3AG2 E;  3OXL A;  4DJA A;  3PZD A;  3SFX A;  4UWL A;  3CVL A;  3Q78 A;  3Q49 B;  2GRN B;  3U3W A;  2GRP B;  2V4L A;  3LJ3 A;  4GA2 A;  3PNL B;  3BU8 A;  4IUL A;  4ANU A;  1ELK A;  5B1B E;  4BEP A;  1MX6 A;  1NA3 A;  2WMO A;  2DYS E;  4FJZ A;  4GAA A;  4GCN A;  2X6H A;  3CR3 A;  4BSX A;  2KCL A;  2DCP A;  3FEY A;  2RG8 A;  3LXU X;  3CVV A;  1H2V C;  3VLF A;  5FZS A;  5LOZ A;  3PS6 A;  1E8X A;  3MEK A;  4BY6 A;  5G04 J;  3BQO A;  3FTS A;  2PNN A;  3EUV A;  3OXG A;  2DZN A;  2M63 A;  1IQU A;  3U4T A;  1ZBP A;  4J8D A;  3IHY A;  3DWL G;  1FVH A;  1EYH A;  3AJI A;  3QWV A;  4BX8 A;  3FEX A;  1E7V A;  3AG4 E;  3RRM B;  1K3Z D;  1SZ9 A;  4LG6 A;  5ENP D;  1S63 A;  3V30 A;  4OAV B;  4L23 A;  5ANL A;  3L16 A;  4B8C B;  5FQ8 A;  3NB2 A;  2GRR B;  4ABN A;  2XGM A;  4N5C A;  3MKQ B;  3DEP A;  5CED B;  3U66 A;  5FZQ A;  4GTV A;  5LP0 A;  3E33 A;  1TN7 A;  4Q69 A;  5J08 A;  1BLX B;  2P9U G;  5D0Q D;  5EX3 A;  3FWV A;  4ACL A;  3ZYQ A;  3HRA A;  2EIJ E;  5FZR A;  2DYR E;  3ZHE B;  3VTX A;  2KAT A;  4I1O B;  2OCC E;  5CEC B;  3HVE B;  3LCA A;  2AXV A;  3UQ3 A;  1INZ A;  1TR4 A;  4OAU C;  5KNH D;  3EHQ A;  1WDY A;  5AJL A;  2LO6 A;  5B1A E;  1H19 A;  3D9L A;  5HQ8 A;  1KPS B;  2XGS A;  4X8Q A;  2EQX A;  4WNG A;  3TWV A;  3MX3 A;  5G2N A;  4HS2 A;  1IQR A;  5M72 A;  1Z3Y A; 
#chains in the Genus database with same CATH homology
 4ZHB A;  4ZFH A;  5AAR A;  2KXP C;  5ENO D;  1BD8 A;  1OY3 D;  3TWS A;  1SVX A;  2ZGG A;  4G8K A;  3UI2 A;  3HG0 D;  4U96 D;  4BSZ B;  2PNN A;  5AAO A;  2P2C P;  4U8V D;  2V4H C;  2QYJ A;  5ITZ F;  2RFM A;  1BI7 B;  2XEE A;  5KBA A;  1BU9 A;  5FIO A;  3ZUV B;  2DZN A;  4UUC A;  1G3N B;  4HB5 A;  2ETC A;  3LJN A;  1YCS B;  1N0R A;  3F6Q A;  4F6R D;  4YDW A;  4A63 B;  4BES A;  1BI8 B;  2AJA A;  3J5P A;  3T8K A;  3ZNG A;  5BXU A;  3IXE A;  3NOG D;  3TWW A;  5CER B;  3V31 A;  3AJI A;  2DWZ A;  5EID A;  2Y1L E;  3V79 K;  2VGE A;  3D9H A;  4HLL A;  3UTM A;  4HRN A;  1K3Z D;  4NIK A;  1YYH A;  1MJ0 A;  5JMN D;  4O60 A;  4LG6 A;  4RLY A;  3T9K A;  4K5C A;  2DVW A;  5ENP D;  1IXV A;  4DX2 A;  5EYP F;  5EN5 D;  3Q9N C;  2MYO A;  5BXO A;  4F1P A;  4O1P A;  4YDY A;  3V30 A;  3JXJ A;  1MYO A;  5KNG A;  4K5A B;  2XZD G;  3B7B A;  4OAV B;  2Y0B G;  4DUI A;  1DC2 A;  1UOH A;  4CYM D;  2F8Y A;  4DX5 D;  1S70 B;  3W9G A;  5CBN A;  1A5E A;  3TWQ A;  5FIN A;  3Q9U C;  1IKN D;  4ATZ D;  4BET A;  2J8S D;  1NFI E;  4B93 B;  5AQ9 A;  3V2X A;  3TWX A;  3EU9 A;  3DEP A;  5CED B;  3B95 A;  4HI8 A;  3TWT A;  2FO1 E;  4GPM A;  2DZO A;  2ZGD A;  1D9S A;  1MX4 A;  2B0O E;  1DCQ A;  4BEP A;  3J5Q B;  1WG0 A;  4CZ2 D;  1BLX B;  3ZKJ A;  1MX6 A;  1SW6 A;  2ETA A;  2QC9 A;  4QFV A;  5HS0 A;  1K1A A;  4Z68 A;  5ENS D;  5AQ7 A;  1K1B A;  1AP7 A;  4BER A;  3AAA C;  2XEN A;  1AWC B;  2BKK B;  2XEH A;  3EHR A;  3KEA A;  3TWU A;  2HE0 A;  3HRA A;  2JAB A;  4GMR A;  4J8Y A;  3ZU7 B;  2RFA A;  3C5R A;  5AQA A;  5CEA A;  4K5B A;  1YMP A;  4HRM B;  5HRY A;  1MX2 A;  2BKG A;  5KWD A;  3TWR A;  4N5Q A;  4DX6 D;  5ENR D;  5ENQ D;  4HQD A;  3W9F A;  5CEC B;  4J7W A;  1N11 A;  5EIB E;  1TR4 A;  4OAU C;  5KNH D;  4C48 B;  3EHQ A;  4U95 D;  3NBN B;  4HNA D;  2XZT G;  2F8X K;  3JXI A;  1WDY A;  2V5Q C;  4LSZ E;  3SO8 A;  2F37 A;  3JUE A;  4G8L A;  2A5E A;  4QQI A;  2L6B A;  3UXG A;  5EIL A;  5HKP A;  5CBO A;  4DRX E;  4TUM A;  3NOC D;  1IHB A;  4U8Y D;  4DX7 D;  1N0Q A;  2KBX A;  5JA4 D;  4HI9 A;  4HRL A;  4JB8 P;  5AQB A;  5AN8 A;  3TWV A;  5EYL A;  5D66 A;  1QYM A;  4LNU D;  4O1O A;  4DX1 A;  2NYJ A;  3DEO A;  4HBD A;  2ETB A;  3V2O A;  1OT8 A;  5ENT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...