3TWXA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human fnbp1 (chimeric peptide)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 51
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twxA00
1AWCB 1K1BA 3AJIA 1BU9A 3JXJA 4HRLA 4BETA 2F8YA 2F8XK 2BKKB 5ENQD 3D9HA 1G3NB 2XEHA 4O1OA 4OAVB 2RFAA 4YDYA 5HS0A 4TUMA 3W9GA 4HI8A 1WG0A 3F6QA 2JABA 3TWXA 2QC9A 4YDWA 4HB5A 5EIBE 4CYMD 3TWQA 2XEEA 2KBXA 4HNAD 1K1AA 1BLXB 4QQIA 1MJ0A 3TWVA 1N0QA 3HRAA 2PNNA 5CECB 3TWWA 2MYOA 1BI7B 5ENRD 5BXOA 2FO1E 5ITZF 2ETCA 3ZKJA 3T9KA 5KWDA 4GMRA 3JXIA 3LJNA 2Y1LE 3C5RA 4N5QA 4J8YA 1SW6A 3TWRA 5EYLA 4CZ2D 1WDYA 5CEDB 3T8KA 3V79K 1BI8B 2NYJA 2QYJA 5ENPD 3TWSA 3EHRA 1A5EA 3W9FA 3EHQA 5EIDA 4HQDA 3TWTA 3V2OA 5KNGA 1N11A 5HRYA 4K5AB 2L6BA 3ZU7B 5EYPF 3UTMA 2V5QC 1QYMA 4DX7D 5AQ7A 4HRNA 4DX6D 2DVWA 5CERB 5AQAA 3ZNGA 5JA4D 1MYOA 3KEAA 4BEPA 2J8SD 4DX1A 4Z68A 1OY3D 2RFMA 1IKND 5ENSD 4LSZE 5HKPA 4F6RD 2XENA 3UI2A 1IXVA 4NIKA 3SO8A 4O60A 5CBOA 2VGEA 5KBAA 1K3ZD 3AAAC 3IXEA 3Q9UC 2F37A 4B93B 2B0OE 4K5BA 5CBNA 1OT8A 3HG0D 2Y0BG 1YYHA 3B7BA 3UXGA 1IHBA 2DWZA 4U96D 1MX6A 2DZNA 1N0RA 1DCQA 3ZUVB 4ZFHA 1MX2A 5EN5D 4BSZB 4HLLA 4GPMA 4K5CA 3J5QB 5FIOA 3NOCD 4OAUC 5AARA 3B95A 3DEPA 1YMPA 4HRMB 3DEOA 3JUEA 4QFVA 2ZGGA 4U8VD 5AAOA 2XZTG 2AJAA 2DZOA 4HI9A 4O1PA 1TR4A 1NFIE 4DRXE 5JMND 2HE0A 4HBDA 3V30A 5AN8A 4A63B 2A5EA 2V4HC 4BESA 5AQBA 1SVXA 5D66A 5FINA 3NOGD 4JB8P 4LG6A 4BERA 5BXUA 2BKGA 3TWUA 2XZDG 2ZGDA 5ENTD 4DX5D 4U8YD 4G8LA 5KNHD 4ZHBA 4DUIA 4F1PA 4ATZD 3NBNB 4UUCA 1DC2A 4LNUD 1BD8A 3J5PA 5ENOD 2ETBA 4RLYA 1D9SA 3V31A 4U95D 5EILA 4DX2A 2KXPC 1MX4A 4J7WA 1UOHA 3V2XA 3Q9NC 5CEAA 1S70B 2P2CP 3EU9A 5AQ9A 1AP7A 2ETAA 4C48B 4G8KA 1YCSB
chains in the Genus database with same CATH superfamily
5LCWJ 4HRLA 2BKKB 3D9HA 2GRPB 1WG0A 5FT9A 2XCCA 2B6CA 3FWVA 2BEDA 4AY5A 1OCZE 3BU8A 1BI7B 3DSUA 4CRWA 3ML8A 2FI7A 4YVOA 3B7UX 1XNFA 2L6BA 3LKUA 5EYPF 3G2WA 5FTPA 1HF8A 3FHEA 3MEKA 4HOUA 1ELKA 4U63A 3B7SA 3L54A 4I2ZA 4I9EA 3B13A 3L9TA 1H2TC 5CBOA 5CBNA 4DPRA 2Y0BG 1N54A 5EX3A 1MX6A 1N0RA 1MX2A 5B1AE 5EN5D 2CG2A 4GPMA 4OAUC 3NZSA 2CHXA 5G04J 3CK7A 2WXMA 3SZ7A 4W9RA 5T3RA 5CCMA 4A63B 2KM4A 3QWWA 4BESA 5AQBA 3UKUG 3MZLB 3RO2A 4B0ZA 2QYUA 3P1UA 3TXMA 4U95D 1N95A 1UJKA 2H6FA 5CERB 4F6RD 4GA2A 3LEWA 1SZ9A 4XI0A 4AOFA 2H6HA 3CSFA 2PQRA 4E85A 3MCXA 2I9CA 4G2VA 3FTUA 4YDYA 5CRVA 2WMOA 3ZHEB 4OVUA 3NQPA 4YDWA 4X8QA 4EZLA 4JW1A 4APOA 2UWJG 3UIOC 4ANWA 3I4GA 3TXNA 3R9MA 2IQCA 3ASHA 3PUJA 3DXMG 1X81A 2V8SE 2M63A 4EBAG 2QY7A 3ESLA 2J09A 3CHMA 1MYOA 3KEAA 2MRIA 4I2WA 3CVQA 4O60A 4JD2G 3HG0D 4WNEA 5CHEE 3Q49B 4HLLA 2ZISA 2P58C 3ASNE 1KPSB 4XE0A 3DEOA 3JUEA 4C0EA 1TR4A 2DCPA 4GMLA 5G2NA 1D8EA 5FJYA 3UUXA 2VSYA 4YNDA 4J6IA 3Q7AA 4DX5D 2FULA 4ZHBA 1JCQA 4UQXA 3CV0A 3LY8A 3JUIA 3LVRE 1OCRE 1EYHA 1OXJA 3JXJA 1Z3XA 2VYIA 1G3NB 1DNPA 3AS4A 2H6IA 4IYPA 4ILHB 1O1RA 4HB5A 5A7DB 5EIBE 1N4RA 3D9NA 4RG6A 2R05A 2C2LA 3DSSA 5G55A 5BV0A 4JA7A 2ETCA 2YNQA 3T9KA 4L2LA 1N9AA 1EDUA 2LAHA 1SW6A 3G2SA 1WM5A 1S64A 4N39A 3LJ3A 3EHRA 2VTBB 3TWTA 1N11A 2QZAA 2LXLA 2P9UG 4AJWA 2PL2A 2EIKE 2L0TB 3UM3A 2CHWA 1GW6A 5J08A 4ANXA 4L9PA 2WXNA 2XPZA 4XI9A 1H6OA 3KD7A 4U96D 2EILE 4F1SA 4LERA 2BF0X 2WB2A 4HOTA 1OCCE 2HO1A 2V5FA 2X3MA 3C3OA 1NI1A 4L7TA 5JMND 4GPKA 4JHRA 3O48A 4B89A 2V4HC 3PZ3A 4HFGA 3CKBA 1DC2A 4TUUA 3SFYA 3AS8A 3ZHEA 3CK9A 2JLBA 2DYRE 1AWCB 3FTXA 2PM7A 3GZ1A 4GTPA 1E90A 3PZ1A 2RFAA 3UM2A 4CDRA 3D9OA 4CYMD 3HVEA 4I1AA 1TNYA 3FU6A 3APCA 3TWRA 2NYJA 2YHCA 3JYSA 3B7RL 4PUCA 1EF1C 3E30A 4A3VA 1H2VC 5AQAA 2J8SD 3WG7E 4DX1A 5KJNA 5HKPA 2XGMA 4HVBA 3UI2A 3SO8A 3FEYA 3IXEA 2R02A 4UI9K 2B0OE 2AXZA 2DYSE 3ABLE 2A5UA 3CHQA 5M72A 1YYHA 4RVBA 1NA3A 2ZIRA 4A55A 5EDSA 1HG5A 3MV3B 4M7CA 2IY0C 4L1BA 3RSEG 3ASOE 3B95A 3S7DA 3CK8A 5AAOA 2AJAA 2DZOA 5KJKA 4GU5A 3PZ4A 4J8DA 4CDMA 1TEZA 4XX5A 3ZYMA 2QFCA 2XRYA 4U0UA 2IOLA 1QQEA 2OV8A 4XKBA 4OYSA 1QZ2A 3ULYA 5EILA 2KXPC 4I43A 3RKVA 2CFZA 3KSLA 3LPZA 4BETA 2WQ6A 2F8YA 2IONA 1TN8A 4BWRA 3PRZA 3CHOA 4O1OA 4N2SA 5C2YA 4I6JA 1ZB1A 4CEMA 3ZKJA 1PY1A 3HXBA 3OAWA 3CVYA 3T8KA 4MRUA 4AVXA 3FUIA 3MKRA 1A5EA 3VLDA 5KNGA 4K5AB 3DSWA 5E76A 3Q4AB 4XZ4A 4PS8A 4DX6D 1SA5A 5ENSD 4MLPA 3N71A 3FY4A 3VLEA 3U66A 5KJLA 4B93B 2XS8A 1L5JA 2DZNA 3ZW3A 3PNLB 2WQHA 3L08A 2RD0A 5FIOA 2UY1B 2DIWA 5LX8A 1HFAA 5FQ8A 3BEEA 5KJMA 3HYMB 2J4BA 1RZ4A 1N52A 1KT1A 3MX3A 5H7PA 5ENNA 4KVMA 1Z3YA 3PREA 2GW1A 3CGHA 5CMWA 4DUIA 2WXFA 3NBNB 3MYVA 4FJZA 4DX2A 3ABME 1IQUA 4G8KA 2X38A 2P9NG 1D8DA 3CVLA 5CRUA 3Q75A 4DI4A 5HS0A 4EZKA 4ILGA 4GZDA 2WXHA 3HXDA 1FT1A 4WNDA 2KBXA 3IV0A 1K1AA 4UWGA 3OXLA 5CECB 5AIJA 3I4RB 2R5SA 2CG3A 4EHMA 4N5QA 3ZRHA 5EYLA 1ELRA 3UT8A 4GTRA 4U07A 3D9KA 5CMYA 3ZNGA 2KC7A 4JPSA 1V54E 4LSZE 3K9IA 2LXMA 1KT0A 4K5BA 4GA0A 1NZNA 3FTSA 4ZFHA 3FH7A 1Z5SC 4GYWA 3TGOA 3NOCD 5FZSA 1TJFA 3DEPA 3RRMB 2XZTG 1NA0A 4TRQA 4F3VA 2F0YA 5BW8C 1OWOA 4BERA 4KT6B 3ZFWA 1TNUA 4PH4B 5ANRA 4I6EA 4LNUD 3ASGA 1N4PA 4B8AA 3TG4A 1PAQA 1YA0A 2KZTA 1BPOA 1JWFA 2ONDA 4J0UA 4CDNA 3HIZA 4F53A 2Y4UA 3UKRG 1MQSA 2WQ7A 4TUMA 3PEVB 4K0RA 3DXKG 3E33A 4XIFA 5BNWA 1Y8MA 4O6FA 3PZDA 5BXOA 5LOZA 2FO1E 3HDXA 4GTSA 4FULA 4U8HA 1U3DA 3C5RA 4RSYA 1BI8B 3E4BA 3SHFA 2AW6A 1ZU2A 3W9FA 2WXLA 3CVUA 2KATA 5FZRA 1QYMA 4Q69A 3QJZA 5JA4D 1S63A 4C9BB 1IXVA 2X6IA 3BUAA 3RJVA 1FCHA 2MOWA 3UM0A 2F37A 3EJNA 2I1KA 4BTBA 3LDZA 4L23A 4GYOA 3OXGA 4CT0A 1UG3A 2IO3C 4Y6WA 3FUHA 3AS5A 1HH8A 2YHEA 3FH5A 3DPYA 2ZGGA 1KLXA 3CHPA 3LCAA 3GZSA 4AY6A 5FINA 4GMJA 5HQ8A 1U3CA 4F1PA 4R7LA 4ME2A 4UQYA 1D9SA 3L16A 5AYWD 1N4QA 1TNBA 2P9SG 3KSQA 3EU5A 3C3QA 3UPVA 3EIJA 2BUGA 1S70B 4KZCA 4K03A 3FTYA 3RRUA 3APFA 2F8XK 4PS7A 3JCKC 2R2LA 4GZ5A 4BT9A 2J08A 2CHZA 5BPPA 3CLJA 3TWVA 2XRZA 2PNNA 2MYOA 5IY5E 3FH8A 2IO2C 4JHKA 4GMRA 3R9AB 2VTBA 4A1GA 3C3RA 3UQ3A 3FUEA 5D2MC 3R7RA 2A4ZA 1TNOA 3ENEA 4EQFA 4AXHA 3U3WA 3TL5A 2FF4A 2R03A 2RFMA 1IKND 3SBSA 1A17A 4KYOB 5KBAA 2IF4A 1E8ZA 1OT8A 4LRZA 1QBQA 3CQGB 1DCQA 3DSXA 3KAEA 3LS8A 4MS6A 4GB9A 4U8VD 2R59A 3KS2A 3BQOA 4APFA 4UI9J 4WNGA 5AN8A 3FTVA 5BXUA 4Y6CA 1W3BA 2ZXWE 1Q2ZA 5ENOD 4J7WA 3Q47B 2ETAA 1FT2A 1YCSB 4JVSA 3CVNA 3AJIA 2XS1A 3GZ2A 5FWQA 3Q5MA 4G25A 4DI3A 1DVPA 3R7QA 2KZTB 2H6GA 3G2VA 2XPIA 2Y69E 3SGHA 3Q7FA 4TXPA 2GRRB 1E8XA 2Q7FA 4UQZA 2AXVA 3QARA 3O4ZA 3SI5A 3G2TA 3V79K 3HVEB 3MGBA 1IYGA 4AM9A 4U04A 3Q73A 4EECA 3UTMA 3FULA 3SD5A 1OWPA 4WNFA 3T5XA 4GZ3A 4MBGA 3LY7A 2GRMA 4FC8A 2R17C 4LEUA 3SY2A 2XENA 2P9IG 2LSUA 1ZBPA 2I6HA 5G04C 3TG5A 1MZCA 3B7BA 4BFRA 2WMNA 3Q78A 1INZA 2PQNA 2E0IA 4UI9C 1FVFA 3FUFA 3NZUA 4GTTA 1NFIE 3L17A 4FJYA 4I6GA 1OWMA 5FZQA 2OCCE 2FBNA 3IBEA 1BD8A 4RLYA 3S7BA 2LSVA 2BTDA 4ILIA 4IN3B 4KBQA 3AU4A 1HS6A 3W9GA 2WM9A 3F6QA 3TWQA 3UIPC 2OVBA 1N0QA 3ISMC 3ZYKA 4EZJA 3UM1A 2XQ0A 4NURA 3JXIA 2OVFA 5CEDB 2ILRA 5ENPD 2PZIA 3FU3A 4GYYA 3D9IA 2PM6A 4J8SA 3I5PA 1IQRA 3IEGA 4UWLA 4FADA 4HQDA 3CVXA 3L22A 5J90A 4LCTA 4M3OA 4BY6A 4YVQC 3ZGQA 4WWPA 4GTOA 3Q9UC 3RIBA 4GZCA 1VDYA 1N4SA 2NSZA 3LXUX 1B89A 4K5CA 1DCEA 1SQMA 5FQ7A 2Y3AA 4WUYA 5AARA 3JQ0A 1OUVA 1TN7A 5G05J 4GCNA 3C98A 2CFUA 4HI9A 2WXKA 3V30A 1UN8A 2XZDG 1E8WA 2VSXE 5ENTD 4L2YA 1HU3A 3ONLA 4WAFA 1K8KG 4HORA 2P2CP 1BU9A 1OWNA 3CVWA 3UT7A 4BTAA 4WWOA 1H0AA 2NXPA 4HI8A 4U7EB 2JABA 4JZYA 1P5QA 3HRAA 3Q15A 3PVLA 5ENRD 5AJLA 5KWDA 3D9PA 3ULEG 4IRUA 3SFXA 2XCBA 1WDYA 1H19A 3URZA 4FU3A 2WXGA 3SFZA 3HXEA 3V2OA 3UT4A 4P29A 4DK5A 3E37A 3ZU7B 3BG0B 4GA1A 4XKCA 3UX4A 3DRAA 4BEPA 4I17A 4Z68A 4FLHA 2P9PG 4KXKB 5FQ4A 1K3ZD 2IU1A 5CCLA 3VLFA 4UWFA 2GGFA 1X5BA 5G05C 3ZUVB 3D3MA 4BSZB 3PUKA 3DBSA 3HHMA 3B7TA 1UW4B 4LUNU 1E7UA 4KMOA 3MJWA 3UMVA 2IEJA 3IKOB 4TXQA 2HE0A 2AXUA 5ANLA 3GW4A 3DWLG 4LG6A 4U8YD 3X2QE 3RAUA 3VTXA 2KCVA 3G2UA 5EX0A 4ATGA 4FHKA 1AP7A 2YINA 1K1BA 5JHAA 2GRLA 5JHBA 4FHJA 5ENQD 1UJJA 4DLQA 2L6JA 4OAVB 1JWGA 2UY1A 3AU5A 4FLBA 3L6AA 4U0ZA 4WWNA 5LCWC 2MHKA 3SQVA 5DIZA 5T8IA 3EHNA 3TWWA 4H7XA 3ABKE 5A23A 4CCAA 2L9BA 4MKTA 4LNGA 1S0PA 1KZOA 4JA9A 3EHQA 3RRNB 2EQXA 4ABNA 3FUKA 5B3SE 4DX7D 3FU0A 2X6HA 4B94A 2I2OA 4URKA 3T5VA 4KZ0A 3C72A 4FA6A 3HXCA 3ASFA 1H6PA 1HXIA 1IHBA 3QOUA 2RG8A 3U4TA 3SNXA 2J4DA 4IULA 4QFVA 4RG9A 4O1PA 4JEUA 1O5MA 4UWHA 3S7JA 4DRXE 4HS2A 3FUNA 4ANUA 1HZ4A 1NL4A 3QKYA 4GZ6A 4JEHA 1QNFA 2BKGA 3TWUA 4UUCA 2ETBA 4FP7A 5HI7A 2VGXB 1MX4A 3QWVA 3BG1B 3FTWA 3OTNA 4A3TA 4N3CA 4JHJA 2XEVA 3S7FA 4PS3A 4GTMA 2EIME 2XEHA 5DBKA 3T8MA 3QB2A 2I1JA 5C1DA 4F7AA 4G1TA 1U2VG 3CSTA 3ML9A 3CHSA 4AIFA 2ZU6B 5ITZF 3EHMA 2WXRA 3U9WA 4I1OB 2Y1LE 3RK6A 4J8YA 3ONKA 4CZ2D 3FTZA 4G26A 1HX8A 3QNKA 3TWSA 4HOSA 1TNZA 3PZ2A 3FUJA 3PH0C 3CIAA 1TJCA 5FQ6A 1Z6TA 5BT1A 2WXIA 2IJGX 1LD8A 2HYZA 1MHQA 2VGEA 4C0MA 3AAAC 2X6KA 4NRHB 3E34A 3TJPA 2DWZA 3AG1E 5D0QD 4V3IA 2X6FA 2AVPA 3LY9A 2GRNB 2L0IA 2GROB 4CGWA 4HXIA 4YDEA 2WXJA 3CEQA 1NP7A 1OCOE 3JQ1A 4NQ0A 1IHGA 4XEIG 4GAAA 4I9CA 4A1SA 5D66A 4JB8P 1TYQG 4G8LA 1SZAA 2OEWA 2J49A 3CQCB 3D9MA 3FU5A 5AQ9A 4C48B 2WXOA 3TAXA 5LFAA 2XHEA 3VTYA 2RKKA 1FVHA 4TV3A 4QQIA 3ZPJA 1MJ0A 3PE4A 1FPPA 4GTQA 3ZYLA 4DJAA 1Y6IA 3SBTB 3LJNA 1HE8A 3MV2B 2XGSA 3CHRA 2JEKA 4N3BA 4N5CA 5EIDA 2C0LA 4RQIA 3AG3E 3FEXA 3ZEFA 2V5QC 4ACLA 3CKCA 4B8CB 4AEZC 4HRNA 2DVWA 5A6CA 1RW2A 3QC1A 4NIKA 1SA4A 4HLEA 3RU0A 3APDA 3UXGA 2FO7A 4CT4A 1O1SA 3FP3A 3MKQA 2V0PA 3J5QB 3RO3A 1V55E 3MA5A 1YMPA 1PC2A 5E75A 3D9LA 2VGYA 3CR3A 2IFUA 3QK0A 2LUHA 2VQ2A 4U0SA 4HBDA 3LVQE 4G11A 5BUZA 4G23A 4Q94A 3ZN3A 2WVIA 2P9LG 1ELWA 4PDXA 3J5PA 4GCOA 2HM8A 4BX8A 2KCKA 2LO6A 5LP0A 3V2XA 3QAQA 5CEAA 1WAO1 2LAIA 3S2AA 4EBAA 3EDTB 3WXXA 2EINE 3Q79A 3AG4E 2OEVA 3DPDA 3L13A 2VGXA 2GRQB 1JCRA 2QC9A 4D10C 1H2UA 2IOSA 2XEEA 4KVOA 2VJ8A 3CVPA 4HNAD 1BLXB 3OXFA 3ASDA 4DLOA 3PE3A 1H6KA 4JL0A 3ZXSA 5AJDA 5T4YA 2NC9A 1TN6A 5KCMA 1KZPA 3HXFA 3PEUB 5HRYA 3I3NA 3DSTA 4CGVA 4TXRA 4AV7A 2Y4TA 4OVVA 2YQ8A 3FFLA 1OY3D 2VSOE 4GTVA 4YDOA 3L82A 3LYAA 3IHYA 1E96B 1O1TA 4ACKA 3KEZA 4Q96A 2E2EA 3P2BA 3IHVA 3PNTB 1HG2A 3QDNA 5JJTA 3FUMA 5B1BE 1E7VA 3ESKA 2C0MA 1LD7A 4BX9A 4AP2A 1E8YA 3NOGD 3NB2A 2ZGDA 4J8FA 3EUVA 4G24A 1HO8A 4ATZD 2XPYA 3NAWA 3PDNA 5JJ6A 5EKQD 1UOHA 1LF8A 4N3AA 2FEZA 3EU9A 2V4LA 4N2QA 2DBAA 3AG2E 2X6JA 2AWIA 2OOEA 2P9KG 2HR2A 3TWXA 1LTXA 3SF4A 2XGOA 4LNBA 3MKQB 3ZVVA 2LNIA 1JPLA 2KCLA 1WY6A 2J9QA 3DSVA 2QYJA 3ULQA 1EPUA 4ANVA 3D9JA 1XGWA 3FDHA 2EIJE 3E32A 5AQ7A 3CVVA 3ZYQA 3U64A 5ARFA 1UN9A 2WXPA 3GYZA 4BT8A 3QWPA 4J8EA 2WPVA 4NACA 5JJ7A 5AENA 3NF1A 4I1MA 3ZIMA 3ZXPA 5D0OD 4JC8A 1OWLA 4HRMB 4E6HA 4H7YA 2WXQA 2A5EA 1JUQA 2J07A 4BSXA 1N94A 1JCSA 1SVXA 3PS6A 2VSNA 5KNHD 3EIQC 3FUDA 3UINC 4UWKA 4HOQA 3V31A 4JXTA 5ARGA 4EPZA 3Q9NC 5BV1A
chains in the Genus database with same CATH topology
1AWCB 1K1BA 3AJIA 1BU9A 3JXJA 4HRLA 4BETA 2F8YA 2F8XK 2BKKB 5ENQD 3D9HA 1G3NB 2XEHA 4O1OA 4OAVB 2RFAA 4YDYA 5HS0A 4TUMA 3W9GA 4HI8A 1WG0A 3F6QA 2JABA 3TWXA 2QC9A 4YDWA 4HB5A 5EIBE 4CYMD 3TWQA 2XEEA 2KBXA 4HNAD 1K1AA 1BLXB 4QQIA 1MJ0A 3TWVA 1N0QA 3HRAA 2PNNA 5CECB 3TWWA 2MYOA 1BI7B 5ENRD 5BXOA 2FO1E 5ITZF 2ETCA 3ZKJA 3T9KA 5KWDA 4GMRA 3JXIA 3LJNA 2Y1LE 3C5RA 4N5QA 4J8YA 1SW6A 3TWRA 5EYLA 4CZ2D 1WDYA 5CEDB 3T8KA 3V79K 1BI8B 2NYJA 2QYJA 5ENPD 3TWSA 3EHRA 1A5EA 3W9FA 3EHQA 5EIDA 4HQDA 3TWTA 3V2OA 5KNGA 1N11A 5HRYA 4K5AB 2L6BA 3ZU7B 5EYPF 3UTMA 2V5QC 1QYMA 4DX7D 5AQ7A 4HRNA 4DX6D 2DVWA 5CERB 5AQAA 3ZNGA 5JA4D 1MYOA 3KEAA 4BEPA 2J8SD 4DX1A 4Z68A 1OY3D 2RFMA 1IKND 5ENSD 4LSZE 5HKPA 4F6RD 2XENA 3UI2A 1IXVA 4NIKA 3SO8A 4O60A 5CBOA 2VGEA 5KBAA 1K3ZD 3AAAC 3IXEA 3Q9UC 2F37A 4B93B 2B0OE 4K5BA 5CBNA 1OT8A 3HG0D 2Y0BG 1YYHA 3B7BA 3UXGA 1IHBA 2DWZA 4U96D 1MX6A 2DZNA 1N0RA 1DCQA 3ZUVB 4ZFHA 1MX2A 5EN5D 4BSZB 4HLLA 4GPMA 4K5CA 3J5QB 5FIOA 3NOCD 4OAUC 5AARA 3B95A 3DEPA 1YMPA 4HRMB 3DEOA 3JUEA 4QFVA 2ZGGA 4U8VD 5AAOA 2XZTG 2AJAA 2DZOA 4HI9A 4O1PA 1TR4A 1NFIE 4DRXE 5JMND 2HE0A 4HBDA 3V30A 5AN8A 4A63B 2A5EA 2V4HC 4BESA 5AQBA 1SVXA 5D66A 5FINA 3NOGD 4JB8P 4LG6A 4BERA 5BXUA 2BKGA 3TWUA 2XZDG 2ZGDA 5ENTD 4DX5D 4U8YD 4G8LA 5KNHD 4ZHBA 4DUIA 4F1PA 4ATZD 3NBNB 4UUCA 1DC2A 4LNUD 1BD8A 3J5PA 5ENOD 2ETBA 4RLYA 1D9SA 3V31A 4U95D 5EILA 4DX2A 2KXPC 1MX4A 4J7WA 1UOHA 3V2XA 3Q9NC 5CEAA 1S70B 2P2CP 3EU9A 5AQ9A 1AP7A 2ETAA 4C48B 4G8KA 1YCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWC B;  1K1B A;  3AJI A;  1BU9 A;  3JXJ A;  4HRL A;  4BET A;  2F8Y A;  2F8X K;  2BKK B;  5ENQ D;  3D9H A;  1G3N B;  2XEH A;  4O1O A;  4OAV B;  2RFA A;  4YDY A;  5HS0 A;  4TUM A;  3W9G A;  4HI8 A;  1WG0 A;  3F6Q A;  2JAB A;  3TWX A;  2QC9 A;  4YDW A;  4HB5 A;  5EIB E;  4CYM D;  3TWQ A;  2XEE A;  2KBX A;  4HNA D;  1K1A A;  1BLX B;  4QQI A;  1MJ0 A;  3TWV A;  1N0Q A;  3HRA A;  2PNN A;  5CEC B;  3TWW A;  2MYO A;  1BI7 B;  5ENR D;  5BXO A;  2FO1 E;  5ITZ F;  2ETC A;  3ZKJ A;  3T9K A;  5KWD A;  4GMR A;  3JXI A;  3LJN A;  2Y1L E;  3C5R A;  4N5Q A;  4J8Y A;  1SW6 A;  3TWR A;  5EYL A;  4CZ2 D;  1WDY A;  5CED B;  3T8K A;  3V79 K;  1BI8 B;  2NYJ A;  2QYJ A;  5ENP D;  3TWS A;  3EHR A;  1A5E A;  3W9F A;  3EHQ A;  5EID A;  4HQD A;  3TWT A;  3V2O A;  5KNG A;  1N11 A;  5HRY A;  4K5A B;  2L6B A;  3ZU7 B;  5EYP F;  3UTM A;  2V5Q C;  1QYM A;  4DX7 D;  5AQ7 A;  4HRN A;  4DX6 D;  2DVW A;  5CER B;  5AQA A;  3ZNG A;  5JA4 D;  1MYO A;  3KEA A;  4BEP A;  2J8S D;  4DX1 A;  4Z68 A;  1OY3 D;  2RFM A;  1IKN D;  5ENS D;  4LSZ E;  5HKP A;  4F6R D;  2XEN A;  3UI2 A;  1IXV A;  4NIK A;  3SO8 A;  4O60 A;  5CBO A;  2VGE A;  5KBA A;  1K3Z D;  3AAA C;  3IXE A;  3Q9U C;  2F37 A;  4B93 B;  2B0O E;  4K5B A;  5CBN A;  1OT8 A;  3HG0 D;  2Y0B G;  1YYH A;  3B7B A;  3UXG A;  1IHB A;  2DWZ A;  4U96 D;  1MX6 A;  2DZN A;  1N0R A;  1DCQ A;  3ZUV B;  4ZFH A;  1MX2 A;  5EN5 D;  4BSZ B;  4HLL A;  4GPM A;  4K5C A;  3J5Q B;  5FIO A;  3NOC D;  4OAU C;  5AAR A;  3B95 A;  3DEP A;  1YMP A;  4HRM B;  3DEO A;  3JUE A;  4QFV A;  2ZGG A;  4U8V D;  5AAO A;  2XZT G;  2AJA A;  2DZO A;  4HI9 A;  4O1P A;  1TR4 A;  1NFI E;  4DRX E;  5JMN D;  2HE0 A;  4HBD A;  3V30 A;  5AN8 A;  4A63 B;  2A5E A;  2V4H C;  4BES A;  5AQB A;  1SVX A;  5D66 A;  5FIN A;  3NOG D;  4JB8 P;  4LG6 A;  4BER A;  5BXU A;  2BKG A;  3TWU A;  2XZD G;  2ZGD A;  5ENT D;  4DX5 D;  4U8Y D;  4G8L A;  5KNH D;  4ZHB A;  4DUI A;  4F1P A;  4ATZ D;  3NBN B;  4UUC A;  1DC2 A;  4LNU D;  1BD8 A;  3J5P A;  5ENO D;  2ETB A;  4RLY A;  1D9S A;  3V31 A;  4U95 D;  5EIL A;  4DX2 A;  2KXP C;  1MX4 A;  4J7W A;  1UOH A;  3V2X A;  3Q9N C;  5CEA A;  1S70 B;  2P2C P;  3EU9 A;  5AQ9 A;  1AP7 A;  2ETA A;  4C48 B;  4G8K A;  1YCS B; 
#chains in the Genus database with same CATH topology
 5LCW J;  4HRL A;  2BKK B;  3D9H A;  2GRP B;  1WG0 A;  5FT9 A;  2XCC A;  2B6C A;  3FWV A;  2BED A;  4AY5 A;  1OCZ E;  3BU8 A;  1BI7 B;  3DSU A;  4CRW A;  3ML8 A;  2FI7 A;  4YVO A;  3B7U X;  1XNF A;  2L6B A;  3LKU A;  5EYP F;  3G2W A;  5FTP A;  1HF8 A;  3FHE A;  3MEK A;  4HOU A;  1ELK A;  4U63 A;  3B7S A;  3L54 A;  4I2Z A;  4I9E A;  3B13 A;  3L9T A;  1H2T C;  5CBO A;  5CBN A;  4DPR A;  2Y0B G;  1N54 A;  5EX3 A;  1MX6 A;  1N0R A;  1MX2 A;  5B1A E;  5EN5 D;  2CG2 A;  4GPM A;  4OAU C;  3NZS A;  2CHX A;  5G04 J;  3CK7 A;  2WXM A;  3SZ7 A;  4W9R A;  5T3R A;  5CCM A;  4A63 B;  2KM4 A;  3QWW A;  4BES A;  5AQB A;  3UKU G;  3MZL B;  3RO2 A;  4B0Z A;  2QYU A;  3P1U A;  3TXM A;  4U95 D;  1N95 A;  1UJK A;  2H6F A;  5CER B;  4F6R D;  4GA2 A;  3LEW A;  1SZ9 A;  4XI0 A;  4AOF A;  2H6H A;  3CSF A;  2PQR A;  4E85 A;  3MCX A;  2I9C A;  4G2V A;  3FTU A;  4YDY A;  5CRV A;  2WMO A;  3ZHE B;  4OVU A;  3NQP A;  4YDW A;  4X8Q A;  4EZL A;  4JW1 A;  4APO A;  2UWJ G;  3UIO C;  4ANW A;  3I4G A;  3TXN A;  3R9M A;  2IQC A;  3ASH A;  3PUJ A;  3DXM G;  1X81 A;  2V8S E;  2M63 A;  4EBA G;  2QY7 A;  3ESL A;  2J09 A;  3CHM A;  1MYO A;  3KEA A;  2MRI A;  4I2W A;  3CVQ A;  4O60 A;  4JD2 G;  3HG0 D;  4WNE A;  5CHE E;  3Q49 B;  4HLL A;  2ZIS A;  2P58 C;  3ASN E;  1KPS B;  4XE0 A;  3DEO A;  3JUE A;  4C0E A;  1TR4 A;  2DCP A;  4GML A;  5G2N A;  1D8E A;  5FJY A;  3UUX A;  2VSY A;  4YND A;  4J6I A;  3Q7A A;  4DX5 D;  2FUL A;  4ZHB A;  1JCQ A;  4UQX A;  3CV0 A;  3LY8 A;  3JUI A;  3LVR E;  1OCR E;  1EYH A;  1OXJ A;  3JXJ A;  1Z3X A;  2VYI A;  1G3N B;  1DNP A;  3AS4 A;  2H6I A;  4IYP A;  4ILH B;  1O1R A;  4HB5 A;  5A7D B;  5EIB E;  1N4R A;  3D9N A;  4RG6 A;  2R05 A;  2C2L A;  3DSS A;  5G55 A;  5BV0 A;  4JA7 A;  2ETC A;  2YNQ A;  3T9K A;  4L2L A;  1N9A A;  1EDU A;  2LAH A;  1SW6 A;  3G2S A;  1WM5 A;  1S64 A;  4N39 A;  3LJ3 A;  3EHR A;  2VTB B;  3TWT A;  1N11 A;  2QZA A;  2LXL A;  2P9U G;  4AJW A;  2PL2 A;  2EIK E;  2L0T B;  3UM3 A;  2CHW A;  1GW6 A;  5J08 A;  4ANX A;  4L9P A;  2WXN A;  2XPZ A;  4XI9 A;  1H6O A;  3KD7 A;  4U96 D;  2EIL E;  4F1S A;  4LER A;  2BF0 X;  2WB2 A;  4HOT A;  1OCC E;  2HO1 A;  2V5F A;  2X3M A;  3C3O A;  1NI1 A;  4L7T A;  5JMN D;  4GPK A;  4JHR A;  3O48 A;  4B89 A;  2V4H C;  3PZ3 A;  4HFG A;  3CKB A;  1DC2 A;  4TUU A;  3SFY A;  3AS8 A;  3ZHE A;  3CK9 A;  2JLB A;  2DYR E;  1AWC B;  3FTX A;  2PM7 A;  3GZ1 A;  4GTP A;  1E90 A;  3PZ1 A;  2RFA A;  3UM2 A;  4CDR A;  3D9O A;  4CYM D;  3HVE A;  4I1A A;  1TNY A;  3FU6 A;  3APC A;  3TWR A;  2NYJ A;  2YHC A;  3JYS A;  3B7R L;  4PUC A;  1EF1 C;  3E30 A;  4A3V A;  1H2V C;  5AQA A;  2J8S D;  3WG7 E;  4DX1 A;  5KJN A;  5HKP A;  2XGM A;  4HVB A;  3UI2 A;  3SO8 A;  3FEY A;  3IXE A;  2R02 A;  4UI9 K;  2B0O E;  2AXZ A;  2DYS E;  3ABL E;  2A5U A;  3CHQ A;  5M72 A;  1YYH A;  4RVB A;  1NA3 A;  2ZIR A;  4A55 A;  5EDS A;  1HG5 A;  3MV3 B;  4M7C A;  2IY0 C;  4L1B A;  3RSE G;  3ASO E;  3B95 A;  3S7D A;  3CK8 A;  5AAO A;  2AJA A;  2DZO A;  5KJK A;  4GU5 A;  3PZ4 A;  4J8D A;  4CDM A;  1TEZ A;  4XX5 A;  3ZYM A;  2QFC A;  2XRY A;  4U0U A;  2IOL A;  1QQE A;  2OV8 A;  4XKB A;  4OYS A;  1QZ2 A;  3ULY A;  5EIL A;  2KXP C;  4I43 A;  3RKV A;  2CFZ A;  3KSL A;  3LPZ A;  4BET A;  2WQ6 A;  2F8Y A;  2ION A;  1TN8 A;  4BWR A;  3PRZ A;  3CHO A;  4O1O A;  4N2S A;  5C2Y A;  4I6J A;  1ZB1 A;  4CEM A;  3ZKJ A;  1PY1 A;  3HXB A;  3OAW A;  3CVY A;  3T8K A;  4MRU A;  4AVX A;  3FUI A;  3MKR A;  1A5E A;  3VLD A;  5KNG A;  4K5A B;  3DSW A;  5E76 A;  3Q4A B;  4XZ4 A;  4PS8 A;  4DX6 D;  1SA5 A;  5ENS D;  4MLP A;  3N71 A;  3FY4 A;  3VLE A;  3U66 A;  5KJL A;  4B93 B;  2XS8 A;  1L5J A;  2DZN A;  3ZW3 A;  3PNL B;  2WQH A;  3L08 A;  2RD0 A;  5FIO A;  2UY1 B;  2DIW A;  5LX8 A;  1HFA A;  5FQ8 A;  3BEE A;  5KJM A;  3HYM B;  2J4B A;  1RZ4 A;  1N52 A;  1KT1 A;  3MX3 A;  5H7P A;  5ENN A;  4KVM A;  1Z3Y A;  3PRE A;  2GW1 A;  3CGH A;  5CMW A;  4DUI A;  2WXF A;  3NBN B;  3MYV A;  4FJZ A;  4DX2 A;  3ABM E;  1IQU A;  4G8K A;  2X38 A;  2P9N G;  1D8D A;  3CVL A;  5CRU A;  3Q75 A;  4DI4 A;  5HS0 A;  4EZK A;  4ILG A;  4GZD A;  2WXH A;  3HXD A;  1FT1 A;  4WND A;  2KBX A;  3IV0 A;  1K1A A;  4UWG A;  3OXL A;  5CEC B;  5AIJ A;  3I4R B;  2R5S A;  2CG3 A;  4EHM A;  4N5Q A;  3ZRH A;  5EYL A;  1ELR A;  3UT8 A;  4GTR A;  4U07 A;  3D9K A;  5CMY A;  3ZNG A;  2KC7 A;  4JPS A;  1V54 E;  4LSZ E;  3K9I A;  2LXM A;  1KT0 A;  4K5B A;  4GA0 A;  1NZN A;  3FTS A;  4ZFH A;  3FH7 A;  1Z5S C;  4GYW A;  3TGO A;  3NOC D;  5FZS A;  1TJF A;  3DEP A;  3RRM B;  2XZT G;  1NA0 A;  4TRQ A;  4F3V A;  2F0Y A;  5BW8 C;  1OWO A;  4BER A;  4KT6 B;  3ZFW A;  1TNU A;  4PH4 B;  5ANR A;  4I6E A;  4LNU D;  3ASG A;  1N4P A;  4B8A A;  3TG4 A;  1PAQ A;  1YA0 A;  2KZT A;  1BPO A;  1JWF A;  2OND A;  4J0U A;  4CDN A;  3HIZ A;  4F53 A;  2Y4U A;  3UKR G;  1MQS A;  2WQ7 A;  4TUM A;  3PEV B;  4K0R A;  3DXK G;  3E33 A;  4XIF A;  5BNW A;  1Y8M A;  4O6F A;  3PZD A;  5BXO A;  5LOZ A;  2FO1 E;  3HDX A;  4GTS A;  4FUL A;  4U8H A;  1U3D A;  3C5R A;  4RSY A;  1BI8 B;  3E4B A;  3SHF A;  2AW6 A;  1ZU2 A;  3W9F A;  2WXL A;  3CVU A;  2KAT A;  5FZR A;  1QYM A;  4Q69 A;  3QJZ A;  5JA4 D;  1S63 A;  4C9B B;  1IXV A;  2X6I A;  3BUA A;  3RJV A;  1FCH A;  2MOW A;  3UM0 A;  2F37 A;  3EJN A;  2I1K A;  4BTB A;  3LDZ A;  4L23 A;  4GYO A;  3OXG A;  4CT0 A;  1UG3 A;  2IO3 C;  4Y6W A;  3FUH A;  3AS5 A;  1HH8 A;  2YHE A;  3FH5 A;  3DPY A;  2ZGG A;  1KLX A;  3CHP A;  3LCA A;  3GZS A;  4AY6 A;  5FIN A;  4GMJ A;  5HQ8 A;  1U3C A;  4F1P A;  4R7L A;  4ME2 A;  4UQY A;  1D9S A;  3L16 A;  5AYW D;  1N4Q A;  1TNB A;  2P9S G;  3KSQ A;  3EU5 A;  3C3Q A;  3UPV A;  3EIJ A;  2BUG A;  1S70 B;  4KZC A;  4K03 A;  3FTY A;  3RRU A;  3APF A;  2F8X K;  4PS7 A;  3JCK C;  2R2L A;  4GZ5 A;  4BT9 A;  2J08 A;  2CHZ A;  5BPP A;  3CLJ A;  3TWV A;  2XRZ A;  2PNN A;  2MYO A;  5IY5 E;  3FH8 A;  2IO2 C;  4JHK A;  4GMR A;  3R9A B;  2VTB A;  4A1G A;  3C3R A;  3UQ3 A;  3FUE A;  5D2M C;  3R7R A;  2A4Z A;  1TNO A;  3ENE A;  4EQF A;  4AXH A;  3U3W A;  3TL5 A;  2FF4 A;  2R03 A;  2RFM A;  1IKN D;  3SBS A;  1A17 A;  4KYO B;  5KBA A;  2IF4 A;  1E8Z A;  1OT8 A;  4LRZ A;  1QBQ A;  3CQG B;  1DCQ A;  3DSX A;  3KAE A;  3LS8 A;  4MS6 A;  4GB9 A;  4U8V D;  2R59 A;  3KS2 A;  3BQO A;  4APF A;  4UI9 J;  4WNG A;  5AN8 A;  3FTV A;  5BXU A;  4Y6C A;  1W3B A;  2ZXW E;  1Q2Z A;  5ENO D;  4J7W A;  3Q47 B;  2ETA A;  1FT2 A;  1YCS B;  4JVS A;  3CVN A;  3AJI A;  2XS1 A;  3GZ2 A;  5FWQ A;  3Q5M A;  4G25 A;  4DI3 A;  1DVP A;  3R7Q A;  2KZT B;  2H6G A;  3G2V A;  2XPI A;  2Y69 E;  3SGH A;  3Q7F A;  4TXP A;  2GRR B;  1E8X A;  2Q7F A;  4UQZ A;  2AXV A;  3QAR A;  3O4Z A;  3SI5 A;  3G2T A;  3V79 K;  3HVE B;  3MGB A;  1IYG A;  4AM9 A;  4U04 A;  3Q73 A;  4EEC A;  3UTM A;  3FUL A;  3SD5 A;  1OWP A;  4WNF A;  3T5X A;  4GZ3 A;  4MBG A;  3LY7 A;  2GRM A;  4FC8 A;  2R17 C;  4LEU A;  3SY2 A;  2XEN A;  2P9I G;  2LSU A;  1ZBP A;  2I6H A;  5G04 C;  3TG5 A;  1MZC A;  3B7B A;  4BFR A;  2WMN A;  3Q78 A;  1INZ A;  2PQN A;  2E0I A;  4UI9 C;  1FVF A;  3FUF A;  3NZU A;  4GTT A;  1NFI E;  3L17 A;  4FJY A;  4I6G A;  1OWM A;  5FZQ A;  2OCC E;  2FBN A;  3IBE A;  1BD8 A;  4RLY A;  3S7B A;  2LSV A;  2BTD A;  4ILI A;  4IN3 B;  4KBQ A;  3AU4 A;  1HS6 A;  3W9G A;  2WM9 A;  3F6Q A;  3TWQ A;  3UIP C;  2OVB A;  1N0Q A;  3ISM C;  3ZYK A;  4EZJ A;  3UM1 A;  2XQ0 A;  4NUR A;  3JXI A;  2OVF A;  5CED B;  2ILR A;  5ENP D;  2PZI A;  3FU3 A;  4GYY A;  3D9I A;  2PM6 A;  4J8S A;  3I5P A;  1IQR A;  3IEG A;  4UWL A;  4FAD A;  4HQD A;  3CVX A;  3L22 A;  5J90 A;  4LCT A;  4M3O A;  4BY6 A;  4YVQ C;  3ZGQ A;  4WWP A;  4GTO A;  3Q9U C;  3RIB A;  4GZC A;  1VDY A;  1N4S A;  2NSZ A;  3LXU X;  1B89 A;  4K5C A;  1DCE A;  1SQM A;  5FQ7 A;  2Y3A A;  4WUY A;  5AAR A;  3JQ0 A;  1OUV A;  1TN7 A;  5G05 J;  4GCN A;  3C98 A;  2CFU A;  4HI9 A;  2WXK A;  3V30 A;  1UN8 A;  2XZD G;  1E8W A;  2VSX E;  5ENT D;  4L2Y A;  1HU3 A;  3ONL A;  4WAF A;  1K8K G;  4HOR A;  2P2C P;  1BU9 A;  1OWN A;  3CVW A;  3UT7 A;  4BTA A;  4WWO A;  1H0A A;  2NXP A;  4HI8 A;  4U7E B;  2JAB A;  4JZY A;  1P5Q A;  3HRA A;  3Q15 A;  3PVL A;  5ENR D;  5AJL A;  5KWD A;  3D9P A;  3ULE G;  4IRU A;  3SFX A;  2XCB A;  1WDY A;  1H19 A;  3URZ A;  4FU3 A;  2WXG A;  3SFZ A;  3HXE A;  3V2O A;  3UT4 A;  4P29 A;  4DK5 A;  3E37 A;  3ZU7 B;  3BG0 B;  4GA1 A;  4XKC A;  3UX4 A;  3DRA A;  4BEP A;  4I17 A;  4Z68 A;  4FLH A;  2P9P G;  4KXK B;  5FQ4 A;  1K3Z D;  2IU1 A;  5CCL A;  3VLF A;  4UWF A;  2GGF A;  1X5B A;  5G05 C;  3ZUV B;  3D3M A;  4BSZ B;  3PUK A;  3DBS A;  3HHM A;  3B7T A;  1UW4 B;  4LUN U;  1E7U A;  4KMO A;  3MJW A;  3UMV A;  2IEJ A;  3IKO B;  4TXQ A;  2HE0 A;  2AXU A;  5ANL A;  3GW4 A;  3DWL G;  4LG6 A;  4U8Y D;  3X2Q E;  3RAU A;  3VTX A;  2KCV A;  3G2U A;  5EX0 A;  4ATG A;  4FHK A;  1AP7 A;  2YIN A;  1K1B A;  5JHA A;  2GRL A;  5JHB A;  4FHJ A;  5ENQ D;  1UJJ A;  4DLQ A;  2L6J A;  4OAV B;  1JWG A;  2UY1 A;  3AU5 A;  4FLB A;  3L6A A;  4U0Z A;  4WWN A;  5LCW C;  2MHK A;  3SQV A;  5DIZ A;  5T8I A;  3EHN A;  3TWW A;  4H7X A;  3ABK E;  5A23 A;  4CCA A;  2L9B A;  4MKT A;  4LNG A;  1S0P A;  1KZO A;  4JA9 A;  3EHQ A;  3RRN B;  2EQX A;  4ABN A;  3FUK A;  5B3S E;  4DX7 D;  3FU0 A;  2X6H A;  4B94 A;  2I2O A;  4URK A;  3T5V A;  4KZ0 A;  3C72 A;  4FA6 A;  3HXC A;  3ASF A;  1H6P A;  1HXI A;  1IHB A;  3QOU A;  2RG8 A;  3U4T A;  3SNX A;  2J4D A;  4IUL A;  4QFV A;  4RG9 A;  4O1P A;  4JEU A;  1O5M A;  4UWH A;  3S7J A;  4DRX E;  4HS2 A;  3FUN A;  4ANU A;  1HZ4 A;  1NL4 A;  3QKY A;  4GZ6 A;  4JEH A;  1QNF A;  2BKG A;  3TWU A;  4UUC A;  2ETB A;  4FP7 A;  5HI7 A;  2VGX B;  1MX4 A;  3QWV A;  3BG1 B;  3FTW A;  3OTN A;  4A3T A;  4N3C A;  4JHJ A;  2XEV A;  3S7F A;  4PS3 A;  4GTM A;  2EIM E;  2XEH A;  5DBK A;  3T8M A;  3QB2 A;  2I1J A;  5C1D A;  4F7A A;  4G1T A;  1U2V G;  3CST A;  3ML9 A;  3CHS A;  4AIF A;  2ZU6 B;  5ITZ F;  3EHM A;  2WXR A;  3U9W A;  4I1O B;  2Y1L E;  3RK6 A;  4J8Y A;  3ONK A;  4CZ2 D;  3FTZ A;  4G26 A;  1HX8 A;  3QNK A;  3TWS A;  4HOS A;  1TNZ A;  3PZ2 A;  3FUJ A;  3PH0 C;  3CIA A;  1TJC A;  5FQ6 A;  1Z6T A;  5BT1 A;  2WXI A;  2IJG X;  1LD8 A;  2HYZ A;  1MHQ A;  2VGE A;  4C0M A;  3AAA C;  2X6K A;  4NRH B;  3E34 A;  3TJP A;  2DWZ A;  3AG1 E;  5D0Q D;  4V3I A;  2X6F A;  2AVP A;  3LY9 A;  2GRN B;  2L0I A;  2GRO B;  4CGW A;  4HXI A;  4YDE A;  2WXJ A;  3CEQ A;  1NP7 A;  1OCO E;  3JQ1 A;  4NQ0 A;  1IHG A;  4XEI G;  4GAA A;  4I9C A;  4A1S A;  5D66 A;  4JB8 P;  1TYQ G;  4G8L A;  1SZA A;  2OEW A;  2J49 A;  3CQC B;  3D9M A;  3FU5 A;  5AQ9 A;  4C48 B;  2WXO A;  3TAX A;  5LFA A;  2XHE A;  3VTY A;  2RKK A;  1FVH A;  4TV3 A;  4QQI A;  3ZPJ A;  1MJ0 A;  3PE4 A;  1FPP A;  4GTQ A;  3ZYL A;  4DJA A;  1Y6I A;  3SBT B;  3LJN A;  1HE8 A;  3MV2 B;  2XGS A;  3CHR A;  2JEK A;  4N3B A;  4N5C A;  5EID A;  2C0L A;  4RQI A;  3AG3 E;  3FEX A;  3ZEF A;  2V5Q C;  4ACL A;  3CKC A;  4B8C B;  4AEZ C;  4HRN A;  2DVW A;  5A6C A;  1RW2 A;  3QC1 A;  4NIK A;  1SA4 A;  4HLE A;  3RU0 A;  3APD A;  3UXG A;  2FO7 A;  4CT4 A;  1O1S A;  3FP3 A;  3MKQ A;  2V0P A;  3J5Q B;  3RO3 A;  1V55 E;  3MA5 A;  1YMP A;  1PC2 A;  5E75 A;  3D9L A;  2VGY A;  3CR3 A;  2IFU A;  3QK0 A;  2LUH A;  2VQ2 A;  4U0S A;  4HBD A;  3LVQ E;  4G11 A;  5BUZ A;  4G23 A;  4Q94 A;  3ZN3 A;  2WVI A;  2P9L G;  1ELW A;  4PDX A;  3J5P A;  4GCO A;  2HM8 A;  4BX8 A;  2KCK A;  2LO6 A;  5LP0 A;  3V2X A;  3QAQ A;  5CEA A;  1WAO 1;  2LAI A;  3S2A A;  4EBA A;  3EDT B;  3WXX A;  2EIN E;  3Q79 A;  3AG4 E;  2OEV A;  3DPD A;  3L13 A;  2VGX A;  2GRQ B;  1JCR A;  2QC9 A;  4D10 C;  1H2U A;  2IOS A;  2XEE A;  4KVO A;  2VJ8 A;  3CVP A;  4HNA D;  1BLX B;  3OXF A;  3ASD A;  4DLO A;  3PE3 A;  1H6K A;  4JL0 A;  3ZXS A;  5AJD A;  5T4Y A;  2NC9 A;  1TN6 A;  5KCM A;  1KZP A;  3HXF A;  3PEU B;  5HRY A;  3I3N A;  3DST A;  4CGV A;  4TXR A;  4AV7 A;  2Y4T A;  4OVV A;  2YQ8 A;  3FFL A;  1OY3 D;  2VSO E;  4GTV A;  4YDO A;  3L82 A;  3LYA A;  3IHY A;  1E96 B;  1O1T A;  4ACK A;  3KEZ A;  4Q96 A;  2E2E A;  3P2B A;  3IHV A;  3PNT B;  1HG2 A;  3QDN A;  5JJT A;  3FUM A;  5B1B E;  1E7V A;  3ESK A;  2C0M A;  1LD7 A;  4BX9 A;  4AP2 A;  1E8Y A;  3NOG D;  3NB2 A;  2ZGD A;  4J8F A;  3EUV A;  4G24 A;  1HO8 A;  4ATZ D;  2XPY A;  3NAW A;  3PDN A;  5JJ6 A;  5EKQ D;  1UOH A;  1LF8 A;  4N3A A;  2FEZ A;  3EU9 A;  2V4L A;  4N2Q A;  2DBA A;  3AG2 E;  2X6J A;  2AWI A;  2OOE A;  2P9K G;  2HR2 A;  3TWX A;  1LTX A;  3SF4 A;  2XGO A;  4LNB A;  3MKQ B;  3ZVV A;  2LNI A;  1JPL A;  2KCL A;  1WY6 A;  2J9Q A;  3DSV A;  2QYJ A;  3ULQ A;  1EPU A;  4ANV A;  3D9J A;  1XGW A;  3FDH A;  2EIJ E;  3E32 A;  5AQ7 A;  3CVV A;  3ZYQ A;  3U64 A;  5ARF A;  1UN9 A;  2WXP A;  3GYZ A;  4BT8 A;  3QWP A;  4J8E A;  2WPV A;  4NAC A;  5JJ7 A;  5AEN A;  3NF1 A;  4I1M A;  3ZIM A;  3ZXP A;  5D0O D;  4JC8 A;  1OWL A;  4HRM B;  4E6H A;  4H7Y A;  2WXQ A;  2A5E A;  1JUQ A;  2J07 A;  4BSX A;  1N94 A;  1JCS A;  1SVX A;  3PS6 A;  2VSN A;  5KNH D;  3EIQ C;  3FUD A;  3UIN C;  4UWK A;  4HOQ A;  3V31 A;  4JXT A;  5ARG A;  4EPZ A;  3Q9N C;  5BV1 A; 
#chains in the Genus database with same CATH homology
 1AWC B;  1K1B A;  3AJI A;  1BU9 A;  3JXJ A;  4HRL A;  4BET A;  2F8Y A;  2F8X K;  2BKK B;  5ENQ D;  3D9H A;  1G3N B;  2XEH A;  4O1O A;  4OAV B;  2RFA A;  4YDY A;  5HS0 A;  4TUM A;  3W9G A;  4HI8 A;  1WG0 A;  3F6Q A;  2JAB A;  3TWX A;  2QC9 A;  4YDW A;  4HB5 A;  5EIB E;  4CYM D;  3TWQ A;  2XEE A;  2KBX A;  4HNA D;  1K1A A;  1BLX B;  4QQI A;  1MJ0 A;  3TWV A;  1N0Q A;  3HRA A;  2PNN A;  5CEC B;  3TWW A;  2MYO A;  1BI7 B;  5ENR D;  5BXO A;  2FO1 E;  5ITZ F;  2ETC A;  3ZKJ A;  3T9K A;  5KWD A;  4GMR A;  3JXI A;  3LJN A;  2Y1L E;  3C5R A;  4N5Q A;  4J8Y A;  1SW6 A;  3TWR A;  5EYL A;  4CZ2 D;  1WDY A;  5CED B;  3T8K A;  3V79 K;  1BI8 B;  2NYJ A;  2QYJ A;  5ENP D;  3TWS A;  3EHR A;  1A5E A;  3W9F A;  3EHQ A;  5EID A;  4HQD A;  3TWT A;  3V2O A;  5KNG A;  1N11 A;  5HRY A;  4K5A B;  2L6B A;  3ZU7 B;  5EYP F;  3UTM A;  2V5Q C;  1QYM A;  4DX7 D;  5AQ7 A;  4HRN A;  4DX6 D;  2DVW A;  5CER B;  5AQA A;  3ZNG A;  5JA4 D;  1MYO A;  3KEA A;  4BEP A;  2J8S D;  4DX1 A;  4Z68 A;  1OY3 D;  2RFM A;  1IKN D;  5ENS D;  4LSZ E;  5HKP A;  4F6R D;  2XEN A;  3UI2 A;  1IXV A;  4NIK A;  3SO8 A;  4O60 A;  5CBO A;  2VGE A;  5KBA A;  1K3Z D;  3AAA C;  3IXE A;  3Q9U C;  2F37 A;  4B93 B;  2B0O E;  4K5B A;  5CBN A;  1OT8 A;  3HG0 D;  2Y0B G;  1YYH A;  3B7B A;  3UXG A;  1IHB A;  2DWZ A;  4U96 D;  1MX6 A;  2DZN A;  1N0R A;  1DCQ A;  3ZUV B;  4ZFH A;  1MX2 A;  5EN5 D;  4BSZ B;  4HLL A;  4GPM A;  4K5C A;  3J5Q B;  5FIO A;  3NOC D;  4OAU C;  5AAR A;  3B95 A;  3DEP A;  1YMP A;  4HRM B;  3DEO A;  3JUE A;  4QFV A;  2ZGG A;  4U8V D;  5AAO A;  2XZT G;  2AJA A;  2DZO A;  4HI9 A;  4O1P A;  1TR4 A;  1NFI E;  4DRX E;  5JMN D;  2HE0 A;  4HBD A;  3V30 A;  5AN8 A;  4A63 B;  2A5E A;  2V4H C;  4BES A;  5AQB A;  1SVX A;  5D66 A;  5FIN A;  3NOG D;  4JB8 P;  4LG6 A;  4BER A;  5BXU A;  2BKG A;  3TWU A;  2XZD G;  2ZGD A;  5ENT D;  4DX5 D;  4U8Y D;  4G8L A;  5KNH D;  4ZHB A;  4DUI A;  4F1P A;  4ATZ D;  3NBN B;  4UUC A;  1DC2 A;  4LNU D;  1BD8 A;  3J5P A;  5ENO D;  2ETB A;  4RLY A;  1D9S A;  3V31 A;  4U95 D;  5EIL A;  4DX2 A;  2KXP C;  1MX4 A;  4J7W A;  1UOH A;  3V2X A;  3Q9N C;  5CEA A;  1S70 B;  2P2C P;  3EU9 A;  5AQ9 A;  1AP7 A;  2ETA A;  4C48 B;  4G8K A;  1YCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...