3TX8A

Crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
360
structure length
360
Chain Sequence
DLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNVLARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLATSTELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLRIKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGVANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQVTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVAAILKQYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate desuccinylase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 92
structure length 360
sequence length 360
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tx8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3tx8A01
4FUUA 2PE3A 3QNVA 1QMUA 3D4UA 2Q51A 3B3SA 4PQAA 2ZEHA 4NJQA 4MRIA 2OR4A 4P4JA 2ANPA 1F2OA 2POKA 2PJ9A 3VARA 3KI9A 4ZY0A 1LFWA 1Y0YA 3TX8A 1EE3P 1TKFA 4F9VA 1R3NA 5K8NA 1LCPA 2F7VA 3WC7A 4R6TA 3PB8X 4AXVA 3VH9A 3S9LA 1ZLIA 2JBKA 4JYWA 2ABZA 4P4EA 1LAMA 4EFDA 3KR4A 1ZG7A 5LRJA 3IIBA 2XEGA 3IEHA 7CPAA 2ZENA 3CPXA 2QVPA 1BAVA 4P4BA 2ZEGA 2PRQA 4UIBA 2AFUA 4X2TA 1TF8A 1XRYA 3K2KA 3KQXA 3KL9A 4K3NA 4ZX8A 4ZI6A 4G1PA 4NGRA 5IB9A 3I1UA 1UWYA 4UEFA 1XBUA 1VGYA 2PJ4A 2IMOA 4UEZA 1CP7A 3D66A 3KASA 1YMEA 3WC6A 2ZOGA 2EK8A 4A37A 4MMOA 2XEIA 4P10A 2C6PA 1VHOA 3PBEA 4OC5A 4MHNA 2IJZA 4MCSA 3N5FA 1PYTB 4NGQA 2G9DA 1VHEA 2WZNA 4P4IA 3CDXA 4NGPA 4B6ZA 2PJ6A 4IHMA 4WWVA 4ZY1A 1F2PA 4R76A 1LANA 2ZEPA 5F09A 2Q4ZA 3ISZA 3GB0A 5HVFA 1CBXA 4NJRA 4OP4A 1QQ9A 5JGFA 2Q43A 3HUVA 3BHXA 3KHZA 5K8OA 5HXDA 4OC1A 3B3WA 4OKOA 4X8IA 1ZG9A 2V8VA 2PJ7A 3IFEA 3RAMA 2AFSA 3IO1A 1Z8LA 2JBJA 3D7FA 3PRTA 5CPAA 4UIAA 4ZYQA 2OOTA 4NGSA 4DUKA 2ZEMA 3D7DA 3NH4A 3FEDA 2EK9A 2PJBA 2PJ3A 4TWEA 4CPAA 3MRUA 3T8WA 4IAVA 1Z2LA 1Z5RA 1H8LA 4PXDA 3B7IA 3PFEA 4UF4A 4A39A 3NA6A 4FBEA 4PXEA 1ZLHA 4H2KA 1TF9A 3SJFA 4FWUA 2FVGA 2GLFA 1XMBA 1CP6A 3D7GA 4IK2A 2XEFA 3DGVA 3PB9X 1Y7EA 3IJ3A 2O4HA 1CG2A 2BO9A 3NFZA 4RUHA 2C6CA 5D29A 2C6GA 4TNUA 1FT7A 2QJ8A 2V77A 4GM5A 3VATA 3V7ZA 1BLLE 2XEJA 3S9NA 4MCPA 3PBBA 4OC4A 1F57A 3CPAA 3B3CA 1ZG8A 3FH4A 2O53A 1YLOA 3SI2A 4OC2A 4NGTA 1XJOA 2AFOA 4YU9A 2V8DA 3NH5A 4JZ0A 1HDUA 3SI0A 2PJ8A 4MHZA 1AMPA 2V8GA 4EWTA 3KHXA 3CT9A 3SI1A 3TC8A 4ONWA 4WJBA 5ELYA 1Y0RA 3PFOA 3HLPA 4MCQA 4Q7AA 2PJ1A 3PB6X 4PPZA 4A94A 5LYDA 1LAPA 1BPNA 2HC9A 1IY7A 1NSAA 3LWUA 1ARLA 2AFMA 1TKHA 5K8PA 4P45A 2CF4A 2CTBA 2ZEFA 2PJCA 4KSIA 3WABA 1CPSA 1RTQA 1CX8A 4UEEA 3NH8A 4OC0A 2HB6A 3FEEA 3K9TA 1TXRA 1ARMA 3FMCA 3IC1A 3FX6A 2PJ2A 2NYQA 4X3RA 4ZY2A 3BXMA 5HVHA 1HEEA 3FECA 1XFOA 2J9AA 1JQGA 3SJGA 3FF3A 2RFHA 1HDQA 2PJ0A 5HVGA 4FAIA 2PVWA 4EMEA 5LYLA 3S9MA 3KGQA 2F8HA 1IGBA 3BI1A 3PEIA 3SJXA 1GYTA 2GU2A 1YSJA 4F8ZA 2WYRA 3RZAA 5I4MA 2PVVA 3D68A 5DS0A 4LQGA 2CTCA 5JM6A 2EWBA 1M4LA 4NFRA 5K8MA 3DLJA 1DTDA 2C1CA 2ZELA 3B2YA 2ZEOA 3GLJA 4Z65A 1PCAA 1OBRA 2PJ5A 2RB7A 8CPAA 4PXCA 2PIYA 2PJAA 2BCOA 1R43A 2AFXA 3WC5A 5LRGA 3WT4A 5CBMA 2BOAA 1DE4C 4DYOA 2JEWA 3L2NA 4R7MA 6CPAA 2ZOFA 3H8FA 4ZX9A 5THWA 2V8HA 1YW6A 1BPMA 3FVLA 4R8FA 1TKJA 3B3TA 4O23A 2I3CA 2PCUA 3JRUA 1ELLP 2GREA 1FNOA 2QYVA 3KR5A 1LOKA 5J1QA 4MHYA 3KZWA 5LRKA 3V38A 5LYIA 2ZEEA 4BD9A 3GUXA 3KQZA 2PIZA 3FJUA 5LYFA 1VIXA 4P4FA 4MCRA 4NGMA 3BI0A 4MXUA 1ELMP 5D8NA 4OC3A 3SJEA 4NGNA 1YW4A 4YWYA 4OIWA 1KWMA 3LMSA 2ZEDA 3H8GA 4OMEA 4P4DA 4DJLA 2AFWA 3D67A 4PXBA 1Q7LA 3PB4X 3B35A 1CPXA 3IWWA 2VL1A 4W9YA 2NSMA 3MN8A 2DEAA 1AYEA 4MHPA 3RBUA 5JH9A 4A38A 3D7HA 3B3VA 4P6YA 4F9UA 2GLJA 4P44A 2CIJA 2IQ6A 3PB7X 4OIDA 2AFZA 3ISXA 3H8EA
chains in the Genus database with same CATH superfamily
1WKJA 3SEOA 5A76A 1CM0A 4DG1B 5J1EB 3T1HJ 4MRIA 4DR4J 4JUZA 1J27A 2XQCA 2PFDA 4OJ1A 4IFVB 4CGNA 1IICA 3IN5A 4OI4A 4OL8A 3MEEB 5IWAF 5CXTA 1T94A 2H5IB 4DX8H 1LW2B 2XNRA 2CXAA 4C48A 3KLEB 4DU8A 2M7SA 4ED5A 3WX8A 2VJVA 3LALA 4DQSA 1VQ5S 2PRQA 1S1XB 1VBZA 2UVRA 3OUYB 4IFVA 1Q2YA 5K20B 4YY3F 5LSLA 1KS2A 2FVQA 4GC7A 2DT9A 2QL9B 4X4QA 1XNQJ 3BR9A 1OYDA 3HSZA 4C8OA 4ZITA 4P2MA 2YWWA 3PBEA 1XC9A 2LXFA 1VMBA 2YNCA 2G9DA 1QUPA 2HBYB 1FNXH 4GKKJ 4B6ZA 3GJSB 1IKWA 4RU9A 2HQGA 1X4EA 3HT3A 4CDIA 3QFHA 1BO4A 3DFEA 2WOMB 2W25A 5DWNA 2A3JA 1HQUB 4FKXA 2FL4A 2Q43A 1X8DA 5HQ8A 4CH1A 3RAMA 4UZBA 1Z8LA 3RB4A 2V68A 4IH7A 3PW0A 2R7XA 1M90T 3MRUA 2HURA 1V5IB 2CZVC 2Z30B 1VQYA 5GAEI 4A39A 4KUBA 1JLBA 1WKLA 1XTZA 1P8GA 4LRBA 4CLYA 4URSA 2UXBF 1BQNA 1S12A 5E33A 2F4FA 1G1XA 1CJKB 2BW7A 3R5BA 2YNFA 1CJTA 1KLMA 2R7SA 1KLNA 5DG9A 4D3HA 3US5A 2VJUA 2LU1A 3IR6B 4A31A 3KLHB 4E8UA 1RWMB 3RR7A 4QWBA 2MZJA 4F4YA 3HCXA 4P6QA 5GAHI 1MJ9A 3OTDA 4CLLA 3I55S 1Y7RA 1MNEA 1CC8A 3GIIA 2AGOA 3NH5A 2B51A 4C6AA 1TMMA 4B5OA 4J9KA 5CAAA 4H4KA 3QSYB 4IFYA 3FZBA 1H72C 2QMUB 4OX9F 3M2VB 3W9JA 3NCPA 2DBBA 1WJ9A 2QA1A 2DR9A 2EO8A 1SJRA 3T1YF 1NO8A 1BPNA 1M1HA 1DBDA 1L3UA 2AFMA 3PG9A 2W01A 1GH8A 4R57A 1VI7A 2IAJA 1S1TA 2V9WA 1IR1A 2AJ0A 5KFCA 3H98A 3BKTA 5H9EJ 3HZGA 3DU6A 3EY5A 2Z4PA 5IS2A 1JLFA 3HD1A 3A1YG 1TL1B 4JI7F 2NYQA 4KGVB 2FJXA 3BGUA 1RT1B 2J9AA 5E7OB 3I9V9 4BCAA 3TA1A 4ECTA 3Q89A 1HDQA 2CPEA 2DO4A 1HBMA 2CJBA 2QYCA 4DL7A 4DDFA 3MOJB 1GMVA 2HWHA 4I68A 4ANDA 2FS5A 3TUJC 2COLA 1FDBA 5LL6d 3AA9A 5B0DA 2VQEJ 1YZ7A 4YRHA 1QVGR 2B5JA 3V4MA 1WK4A 3R3TA 2J8SA 2CRLA 2XS5A 3C14B 2BCOA 3CJ4A 5F8IA 3DMJA 1N5TA 4A33A 4WFXA 4F26A 2J8RA 1JLAA 5J2QB 3M8QB 1HWUA 2UUTA 2GAGC 4HH1A 4JP8A 1OJ4A 4ZVPB 3RG6A 2R42A 4PK2A 5B7WA 3TFYA 4MJKA 1R89A 3NGSA 1UFWA 4PG5A 4JI7J 4QYRA 3UCGA 5ETQA 1WHWA 4P2SA 2EFVA 1JLEA 2MPUA 3R7NB 4QIEA 4MCRA 2L9NA 3PW2A 3MPWA 1C1CA 2I9SA 3VF0B 2YNEA 5DQGA 3AJ2A 1RXTA 4WF9Q 2XSFA 4L73A 5MAOA 1FRKA 1KWMA 3J7Z5 3OWCA 2HNDB 4OMEA 2HBQB 3C26A 2AFWA 4DBQA 4PXBA 3B35A 3TW0A 2DEAA 1AYEA 4L6V3 3CNQP 1JXEA 5JH9A 3W61A 2GLJA 2PFFB 1IR2A 2JX2A 4R9MA 5T7LB 4HVZA 3ISXA 4FDFA 3WC2A 1D9FA 2QIFA 2Q4YA 4PQAA 1FRHA 5J2MB 5KFYA 2Z0GA 1ZZFA 4DL5A 5AT1B 4I2PB 3C6UA 3G6XA 3GQCA 4KT0C 4YR0A 2GA7A 4Z2XA 3CO0P 4R8UA 5DQHA 2F4VJ 1VDHA 5ETTA 2VFUA 4CH7A 3ZJ0A 2C2EA 4F0MA 2F7VA 2MSTA 3HK2A 3N28A 3PB8X 3MHYA 3VH9A 1XK8A 4KE5A 4RLEA 3M1VA 1IQZA 1ZG7A 3KR4A 3FYNA 3IIBA 1NJZA 1B0TA 1FESA 3FRYA 2VBYA 1UKUA 3D1QA 1CJVB 2M8HA 1NNDA 4A48A 5HP1B 4QPXA 3KOAA 4K3NA 1S5ZA 1RT6A 1SVDA 3HFKA 2OZHA 1TU0B 3BN7A 2VOPA 4Y2KA 1QSRA 2GQQA 2E5IA 3CIZA 4Y49B 4Q43A 1DZ5A 2JC1A 4RUCA 3LP0B 1YMEA 5FIIA 2OIHA 2QSWA 1EB0A 3OHAA 3HP6A 4B12A 3D6TB 4WK1A 1K73T 4H54A 3U1LA 1YVOA 3IR7B 2GCFA 4F6AA 4PWWA 4RUAA 4DV7J 5C2GA 5LXRA 4FS1A 2YQ3A 3GR1A 1O0PA 1H7XA 5E2QA 3T90A 4HT5A 2HG4A 5A2QY 3EJMA 2DNGA 2IBOA 4ZVFA 2PC1A 4KLVA 1TV6B 3R5JB 4IG3A 1LOUA 2CPYA 2D4OA 2V8VA 1S1WA 4ZP9A 1W26A 3W66A 4USJC 1DY3A 4FYWB 4KVXA 1ROFA 3THPA 4B13A 1HIYA 4N76A 4YFJA 2E66A 3CD0A 4JWPA 4PXDA 3FZ2A 2MKIA 2C2ZB 3DC2A 5IQQA 3VQSA 2KM8B 4CLSA 3R7SB 3N6LA 3TP2A 1VC0A 1ZETA 2PMWA 4WP9A 3AD7C 1TL7B 2CIMA 4OX9J 1Y7EA 4USHA 2DGTA 4HEA9 2NUUG 3Q0AA 3A4TA 4CRJA 3Q24A 1FWPA 3NNAA 3DDIA 1VJQA 3DLGA 4EU0A 4JBCA 4LRFA 2M0GB 2XWXA 2GANA 4DR4F 1IQTA 1NE9A 3JQJA 1T9WA 4YU9A 1JJHA 3KWMA 1JXVA 4JV5F 1FKOB 4MHZA 2KKHA 3CMQA 4K0KJ 3BBBA 4F50A 1SQHA 2JEVA 1N71A 3JYTA 2EUIA 3UD3P 2ZH5A 4RW9B 4KIAA 5LJ3Y 1N5YA 3IBCB 3THTA 2IMWP 1TTHB 2W4DA 5HBMA 4ZCMA 2HC9A 2GVZB 2HVIA 1B0PA 2GJIA 1FEEA 2BL1A 1RT3B 3G82A 5L38A 4ZS6A 2DNKA 4N8OA 2PDAA 2ACMA 5JMNA 4U95A 3RBEA 3PGPA 4LRCA 3HO1A 2BQRA 4AUKA 3LP1A 2MQNA 4ZPDA 1RJJA 2EG1A 2PJ2A 5HAOA 5D4LA 2EPIA 4NLTA 5A0YA 2NXJA 5E41A 3VALA 3QIPB 3DOKA 2C1EB 2K06A 1HNZF 3UCUP 2FZKB 1B7FA 2ZUGA 1EQ0A 4LR8A 3NGRA 4DV1F 3HKZD 4ED2A 3P96A 4HHHA 1LW0A 3H5XA 2ZELA 4ZVQB 1BHNA 2U1AA 4F4ZA 2RB7A 2MY8A 3PJXA 1O8BA 4DUZF 2VFRA 1C2PA 3HSGA 2R2UA 4G1QA 3NWRA 1HWIA 4QU7A 3MM6B 3CJ3A 2OPRB 4EI2A 3L2NA 5J2NB 1X9SA 4R7MA 2VPZB 4USIA 4M6IA 1BUXA 5BYQA 1YW6A 1BPMA 2CJYB 2CQ4A 5A8KA 1TKJA 1SKSA 4OYPA 4JXRA 5D4OA 1SV5B 3DR6A 1LWXA 1C4AA 3IP0A 2VICA 1Z8TA 2FJBB 1TELA 3JAMY 3PKYA 4MKVA 4OX6A 1UJ5A 4E0AA 2HFUA 1C1BB 2B4DA 4RNHA 2YKNA 3QT8A 1XE4A 2DNLA 2H4YB 2GMLA 4A2ZA 3NAIA 2PO4A 4DV0F 2B6AB 3W65A 3IXQA 2KXHA 2AX0A 4WFNQ 3PDNA 1FDNA 4NZ6A 1X0FA 3QO9A 1IWAA 1U0HB 1QUVA 3GIKA 1S6PB 4W9YA 4CAFA 2B8QA 3QZ8A 2P0WA 3MCNA 3DRRB 4TYAA 1X5OA 4L3KA 2P9EA 4ER8A 2LEPA 1I21A 1IKXB 4XNHB 2AZ3A 3B3SA 1WEYA 4JI0F 2RF2A 2IRXA 5EMIA 1WKKA 2J9EA 4WP8A 2W8KA 4UFWA 1XR7A 4C8MA 2EW9A 1WWZA 2N3LA 1ZPWX 4LF6F 2NPFA 3QGIA 1U45A 1K1SA 3TX8A 1FWLA 4ZIWA 1SL2A 2JL9A 2VKRA 3FK4A 2KRRA 2Q7BA 2OKQA 1WTBA 4QYZJ 1RE1B 2VH7A 2M5YA 2DHGA 1QD1A 1SIWB 3ILOA 1VRQC 1DTTB 5ETNA 2SXLA 3S8SA 1UVJA 2F5GA 2JWNA 1NPKA 3DOMB 4EK2A 3ZTPA 1ZAXA 2B4VA 1ZOTA 1U7LA 2DNYA 3I5CA 2GO8A 2FGOA 1RAEB 1RBOB 4L3NA 3KYLA 5H9FJ 4CLTA 4WKRA 2XSJB 5KT4A 2IM0A 4IOAQ 4PR6A 4QWDA 2UP1A 4AT1B 1VHOA 4LF1A 5J1NA 2O67A 3EX7B 2YPZA 2OB0A 3PYEA 3SCIE 4J9RA 5IV3A 4A8WA 1Y9KA 1KNZA 2RUSA 2XHWA 1MJBA 4FD5A 4OI0A 3ISZA 1XBWA 1VR6A 5CYJA 4P2FA 2BUEA 3R9LA 4TQSA 1S1UB 4MFJA 4DL2A 4L8AA 4A4JA 2BX6A 2EFGA 4QWEA 1ELOA 4ED0A 2QMWA 3AHPA 3E01A 3HUVA 4HNYB 2H54B 1ZG9A 2PJ7A 4OJGA 5CPAA 1Q1KA 4NLRA 4KGKA 5L46A 2MGZB 3IWGA 3R1HA 3WBZA 4NEXA 3LP2A 3B7IA 3EFAA 3DRPB 4FBEA 1YBAA 4DV1J 4NF1A 1S7IA 1PAUB 1WC0A 2CZ9A 2B4BA 1NK7A 2FVRA 5HQLA 4B5PB 1MROB 2RC4A 2R98A 3FRMA 2Z56B 2QN6B 3NFZA 2BKOA 3EGWB 4OYOA 5F46A 3BV8A 3CDBA 2XGPA 2HHPA 2QJ8A 1OSCA 4I2QA 1OIAA 5ETRA 1RTHA 3S6EA 3O2IA 2UUAF 1RISA 2B8PA 1VS3A 3GYXB 3KG0A 3MFHA 4KQZA 1ZG8A 1NHUA 3C19A 3DLBA 2AFOA 4KGMA 3W7BA 2BJ8A 3GTYX 4NCGA 3CD7A 1NXIA 2GIVA 2ZJQQ 2YH1A 3DOLB 4ETXA 3H5SA 4MH8A 1N5QA 5C24A 1KC8T 3CT9A 1RK8A 3UQSA 4NLSA 2CYYA 3T9NA 3Q8QB 1N33F 3R9EA 2C2DA 1DHMA 3WC0A 1LAPA 4CGMA 3GG0A 4UQTA 3I9ZA 4I4BA 4CO2A 4K0KF 1U26A 3PNIA 4OYBA 2ZHAA 4BDPA 3MXHP 4ZIVA 1BMQB 4OFZA 1PAEX 2ADBA 4MK7A 1HBUB 3P8BB 2RHSB 2DGXA 4RUBA 5I3PA 1NZAA 4K59A 4W98A 3VAMA 1D8YA 2JSXA 3CZXA 1IJEB 3PACA 3VAKA 4DR2J 4KOTA 2DGQA 3KLIA 3SJGA 3Q2TC 1A2ZA 4RKUC 4USVA 3QQCD 3CXSA 2PVWA 5BXIA 4DUYF 4JI6J 1UJ6A 5DG8A 3KKFA 2WYRA 1PJ6A 3QSIA 3Q23A 5EGYA 5DG7A 1YX0A 2BDPA 1WG5A 3IG1A 2LP4A 3JTNA 5BR8F 3MMAB 2JH3A 2OELA 4II9A 5CBMA 4DPWA 3BGRA 4MFLA 1IVZA 3W2VB 2OD4A 2PEHA 3H4QA 4OQJA 1H2UX 4H4KC 4PABA 3AB4B 1RQ0A 4KUAA 5A28A 4C8KA 1XEZA 2XI2A 3HHLA 3VWDA 4UCPA 2K8GA 4DV7F 2HYIB 3EM1A 1Y11A 3HHLC 1DQ8A 3UY5A 3MTJA 2MZSA 5EDWA 3U02A 1BQXA 3P2HA 4JI4F 2X3GA 2HVHA 3FSXA 2FHKA 2LQJA 1IYLA 3VTIA 2PR8A 3DGPB 4PWDB 5LYFA 3IS9B 1GK8A 2WVBA 1LK7A 3SFUA 3BI0A 3TZXA 2RQCA 1LV5A 1KUVA 3BSCA 4ZBGA 3HD2A 3SJEA 1OY9A 4B3MF 3W91A 2O5DA 1P9QC 2XZWA 1HBOB 1UFLA 2JZ5A 6FDRA 3RB3A 1S0NA 3HPOA 4ZPVR 4U9YA 4NWBA 1WORA 1HR0F 2OPSA 3EMTA 3AY0A 3R6LB 2Y1IA 1HNXF 3KG4A 2WHOA 3Q8YA 3PB7X 4IH5A 3POTB 2CQBA 4D3GA 2LEBA 3T9ZA 2RILA 1RTJB 3Q83A 4RBUA 4PK3A 4TVAB 4Y65A 4LF7J 4NJQA 5KTAA 4P72A 2KRBA 4NLYA 2WVEA 2DNNA 2NSCA 1RTDB 2HUZA 3KLGB 2CNMA 1SKWA 2H48B 4TQRA 2X7IA 4ZY0A 5KFUA 2J9CA 1RCOB 3P3DA 1EE3P 3UNYA 1OQ3A 4M5JA 1VIOA 2Z0ZA 1H2TZ 3NEKA 3EZOA 2F40A 4ZPTR 3JAMU 3TE4A 2OTLS 4MFBA 4R6TA 3S9LA 5L9NA 3C6TA 3R5GA 2ABZA 4EFDA 3J81U 3AD8C 4GMKA 5KFAA 1NH8A 2R7QA 5A2QU 4AYBD 4DN9A 4DCPB 4MIAA 3ZTRA 4Q0BA 4F2RA 5HK4A 2OPQB 4MY0A 1NBEB 3KJVA 5AG7A 1HBNA 1WI8A 3AD9C 4C7HA 5AJ3F 1YX2A 3FIXA 1T9YA 1B6BA 4UEZA 4LF6J 2MQ8A 2ZW6A 4HI2A 1NKEA 2ASYA 4LF5F 2IJZA 3VAFA 1VRUB 1S7HA 3KJVB 4P4IA 2OPQA 1VQ6S 2GE3A 5HLFB 1FKPB 3GE9A 2VBXA 2ZVSA 5HVFA 3WIVA 1CBXA 2QE5A 1YREA 1Y9WA 3M30B 5FVJA 1UA1A 3CJ2A 2V4QA 1Q82T 2J6UA 1FFGB 1RKIA 1FRMA 2VONA 3B3WA 1Q7YT 4RW7A 2LDYA 3N7ZA 3A9LA 3D0HE 2HGLA 3IBWA 3PRTA 1S59A 2UVUA 3SQOP 3KK1B 1CS4A 2JLMA 3SSQA 4O3SA 3ZZZA 1UMJA 3ENWA 4TU9A 2VA2A 4J5OA 4KB7A 4A47A 4I6YA 2BQUA 4RI1A 3I56S 1TF9A 5D8HB 3FJ2A 1Y5IB 3SJFA 4X65J 1XMTA 1T95A 4FF4A 3FQKA 3DGVA 1FRLA 2ZWPA 1X4DA 2WUUA 1KVKA 1U25A 5AXLA 2UU9J 2BO9A 4TNUA 1YBUA 4ECSA 3BS9A 1UVKA 3V7ZA 4F25A 1QAXA 2YXLA 3PW7A 4M5MA 2E5JA 4DL6A 2CPHA 2DTJA 1YZ6A 2PMZD 3CJ8A 4CO0A 4A8KA 3M4XA 3MM9B 5C82A 4NLUA 5G0RB 2A2CA 1QLNA 1XOVA 3IS9A 2BW2A 1BQMA 4XPKA 1KHVA 3DGPA 2DNHA 4URGA 1TAQA 1U2RA 3GYNA 2AQ4A 2HWTA 2MKCA 2BKPA 5DETA 5JUMA 2V69A 2PR1A 3FGVA 1E6YB 3FFIB 2OSQA 3NGDA 4C3KA 3S6FA 4FVMA 3NNCA 2FJWA 1DLOA 1ZM9A 1GAOA 4NLQA 3KTQA 1YJ7A 3MAQA 1RAAB 4OZ0A 3TEGA 3RUBL 3PTWA 3BSOA 2R2TA 1XWLA 4PG4A 4KSIA 5HMYA 2C28A 2FIUA 1PBUA 2XBPA 2V0NA 3GV8B 3TVYA 1IXKA 2JLGA 4OC0A 3FBBA 2ZH7A 2PT0A 1ARMA 5HO4A 1CS4B 5G1ZA 3KK1A 1JLGA 3BQ1A 2HQIA 1FO1A 1H74A 1T11A 4LFAJ 1HL6A 4FF3A 4ZKAA 4HNWB 3D1HA 2ZUAA 2RU3A 5J8FA 3BI1A 2AW0A 2W9CB 2R3VA 1YSJA 3M30A 4LQ9A 3J80U 4OZNA 1TKXA 1WF1A 4IKAA 5LJ5Y 4F4XA 4UT4A 1VQ7S 4CYNA 2IM2A 4DOZA 3A3PB 3UCZP 3MGJA 1FKPA 2ZEOA 4F36A 5HLFA 3BSNA 5KFLA 2ASJA 3L09A 2VBZA 5GADI 1W7WA 2YKOA 3CCWA 2G4BA 4M5KA 2CQCA 2QT7A 2GVDB 1R43A 5D0GA 2X1AA 3PIOQ 2XMMA 1AA1B 3VWEA 3OVAA 1I3OB 4DQIA 4TXSA 4RNFA 3DHXA 1QSNA 2ZH2A 3EGNA 4Y00A 1ICEB 2BBEA 4ECVA 4DV2F 3D6HB 5FLXY 4B08A 2B0GA 5I3QA 3GJRB 3QRPA 1HR0J 1UFKA 4PG8A 2MYFA 3VAIA 2W7AA 3D3SA 4UWJA 4ED4A 3C6TB 2KZZA 4MFBB 2J7UA 1YTYA 2DR7A 3DOLA 3G86A 3MEGB 1V9OA 2UUCF 1VRTA 4ZN1A 3M8ZA 1PGZA 5D8NA 3ZTQA 1HMVA 1RTDA 4NGNA 2Q1LA 4TY9A 1RTHB 1FTCA 2JHEA 2PE8A 2V8PA 2W2OP 1S99A 2OEKA 2MKHA 3KUEA 3Q8UA 5CD4A 1N34J 4CZCA 3POTA 4I49A 4ZA1A 2IRUA 2K3KA 4N77A 5GAEU 3BBFA 1R6VA 3T41A 4OAEA 2G3AA 4J90A 3EYZA 1RYSA 2XY5A 4PKDB 3HHNB 4QVTA 3FRZA 3A8EA 2C2RA 1FXRA 4KH1B 4ZHRB 3D4JA 3FBFA 5K8NA 3BQ2A 5AG5A 1CQMA 4WU3A 2O1PA 1Z1ZA 1VYAA 2CAJA 1YGYA 1IB1E 1QY7A 4ILRA 3V6KA 3L7UA 2E7XA 2HAFA 2WSCC 3F44A 5KFTA 4DUYJ 4P4BA 1V5VA 3HFVA 3EGVA 2KM8C 1IR0A 2CJKA 1IBKF 4DPXA 5IB9A 1RWPB 2AGPA 3TCVA 3PVXA 4NYOA 2PJ4A 2CPJA 2XSJA 1NDKA 4CGOA 3T9YA 2ZOGA 4MYTA 2VF3A 1GMUA 1NK5A 2DIVA 4P10A 1UWAA 1NPPA 5HATA 1R7IA 3NE8A 2VQFJ 1PYTB 4OHVA 1IKYB 5DZ7A 1Q8BA 3D0IE 5IT9U 4FN5A 2RJZA 3M6WA 1G7CB 1Q4RA 3X1LB 3CCES 1S97A 1XNRF 3DYAA 1SC6A 4DSJA 1HI0P 3OR2A 7FDRA 1BWEA 2ZZMA 1M5PC 3NKYA 5C25B 1RHMB 1S9EA 2NYIA 2KU7A 4Y28C 3IFEA 4B3TF 2JBJA 1VBKA 4IO1A 1V3ZA 3EVWA 1U2CA 5KG4A 1S76D 3CC2S 5LXYA 2G2YA 1QAJA 3TO6A 2PJBA 4TWEA 1VC6A 1BD6A 4DZDA 4HT7A 4OI1A 3QGGA 1M0SA 3W60A 2HSEB 4MK9A 3I9SA 1UVIA 4RBVA 1EP4B 3BGOP 5B08A 1X60A 2B7CB 1FKAF 4R5PA 4IK2A 4M85A 2DITA 4P73A 3M05A 2MB0B 5KG2A 2Z57B 4ED6A 2AZ1A 2D9PA 2P6GA 1IBLF 2IPOB 3HVRA 1KUYA 1K47A 2GFQA 1IN0A 1YLXA 2I1RA 1F57A 5D0RA 1KFDA 1R8PA 2I8EA 4RJVA 3VZHA 5E3QA 3B3CA 5E3RA 4NCGB 5A8RA 2LVWA 2FHJD 2D74B 2B4DB 1TK8A 4X84A 1C1BA 2YQ0A 1DTQA 1IKVB 2O01C 3R5DA 1YG0A 2VQEF 1WSVA 4NCZA 2WBMA 1P9YA 1YRTA 3K8WA 4YHHJ 3OFGA 4I2QB 4IQXA 2R7VA 2V9KA 5LYDA 2B4PA 1WC5A 1IY7A 1NSAA 1UFHA 4NLXA 2GQCA 2QRRA 5KFBA 5J2NA 3H2LA 1T7PA 3V6JA 2V50A 1KHWA 3DRPA 5IZHA 5GADU 1GTEA 3LP2B 1IM6A 5ETLA 1T3NA 2HHQA 5D3GA 3ELHA 2FLLA 2HB6A 1WELA 5F8JA 3FEEA 4F0XA 4I64A 1NHVA 3H5ZA 1SH2A 3GY9A 5H9FK 2E7WA 3E01B 4K30A 2B9XA 1URNA 1S1UA 2WCXA 2UVVA 1SKRA 4USWA 1D9DA 2FVSA 4FYXB 3QIPA 4NZ7A 2R8IA 2W2QP 2YNGB 2RS8A 3P45B 1KR4A 2UXDF 1I94J 1U6MA 3WC5A 3QBCA 2QYGA 3ULHA 4J9QA 2PRBA 2Q6CA 1G2EA 2JEWA 3G82B 4AQYJ 4ZVSB 2RIJA 2ZOFA 3DOMA 5F0UA 4ECUA 2GVZA 3QPIA 3W5XA 4EFAC 1DTTA 5HBMB 1TFWA 2XYPB 4QPTA 4JJXA 3JTPA 3FMBA 4MK8A 2MQLA 3KK2B 1JJCB 2BE2B 4AG7A 3U1MA 1OO0B 3RBXA 2KCWA 4ID8A 1J5EJ 1MMDA 1FKOA 2X51A 1XF8A 4GKJF 2XNQA 4UFVA 2KFYA 1X4FA 3KUGA 2AEFA 4DR5F 2IHR1 3WQPA 3W6SA 3NL0A 3VVUA 3IRWP 3IWEA 2Q6BA 3NAHA 2KG0A 4FZVA 4ED1A 2RF2B 4M94A 1YJUA 3O5TB 2IYIA 2J76E 1IKXA 2WB4A 4M5GA 5ETVA 3DRRA 2KJWA 1N48A 4RWWA 1T0TV 5KG6A 5HMNA 2ZBCA 2YX1A 5IC4B 1S9FA 3QNVA 1YJVA 3OR1B 4EVYA 3QO9B 1RADB 4IQMA 3MOZA 3W62A 4N5SA 3CJ5A 4FXDA 3D5MA 2B6AA 1XNRJ 3T5JA 3VARA 2CFXA 1Q8KA 2OZUA 4C0HA 1Y0YA 4EYHB 1LRZA 2KDOA 4NYZA 4QYZK 3LACA 1HWKA 2KVIA 1ZPVA 4KPCA 1VFJA 2JLFA 2YNHA 4IG3B 1TV6A 3DRYA 2JFKA 5GMEA 4NXMF 2D3OR 1FXLA 1RBAA 2I38A 3O44A 1IBKJ 3CMAS 1ZM2A 1UPMB 3GSIA 1XMQF 3O6QA 4HHJA 4G6VB 2WPXA 5A8KB 2VPYB 2YKMA 3K5PA 4KO0B 1EKSA 2PQ8A 1RU2A 3I1UA 3DM2B 2ATLA 3T5LA 1UWYA 1XBUA 2I0XA 2OPRA 2BXJA 4X62F 1FDDA 2A2DA 1F1BB 3LP0A 4KGXB 4DFMA 4ICLB 5CCLA 4CNYA 3HULA 4A8QA 5CYQA 5F3TA 3CDXA 2MEWA 3CW2C 3CCQS 5HP1A 3LPEA 5IXUA 5DDOC 2XMUA 2UUWA 1QE1B 5HANA 3J80Y 5B09A 2VPXB 2MSSA 3M1VB 3ZC4A 2LQ8A 4YB6A 5F47A 4RU2A 3HLUA 4KLWA 4AL5A 2AV5A 4NXMJ 4R8UB 3CCUS 2E44A 4X64F 3D0GE 2PJ3A 3VCDA 3T8WA 2W2NP 3C8YA 1X4GA 4QW8A 3M9NB 2MKYA 3VAGA 3PB9X 1AFJA 3PRBA 5LT5A 1SJFA 2ZH3A 1N5YB 3RBDA 2DYAA 4PWUA 4NLVA 3RGIA 4IR1A 3ISNC 2WK4A 4KAIA 5KG1A 2MZTA 3HFZB 2RUGA 3TVZA 4N41A 2QTWA 2E5LJ 1C1CB 4OC2A 1M5SA 3B8HA 3UDLA 5LSOA 3M2RA 3UD4P 1SB6A 1Q5YA 4Z37A 3MEKA 1FRIA 1AMPA 3P49B 5EC4A 1SPBP 1WC3A 3MM8B 3HLPA 3DLGB 4Q7AA 2HS0A 2PJ1A 4ZVEA 2F5IA 2HHSA 3OFHA 4L74A 1AB8A 3F8KA 1RUSA 2KHDA 3GFYA 4LIRA 3GMGA 1TL7A 1APSA 5GAHU 4X4TA 1TKHA 1UWBB 2XG8A 1PC4A 1U1OA 2M4MA 3DMJB 1HW8A 4LF9F 5A6PA 4H89A 3W1YC 2XMVA 2B43A 2AE6A 3I0SB 1TL4A 3LAMA 1HKAA 5GCNA 1T03A 4DI6A 5KOWA 4UFXA 2B5JB 4XNHC 4DX6A 4A8YA 4YB1P 4EYIB 3IGNA 4PSXA 2NREA 1FF2A 1ZM3A 2Q44A 3O8WA 2K1RA 5G21A 3WHIA 4CS0B 4CAWA 1OZPA 4LQGA 4UUWA 2RRAA 3SHPA 3G8QA 3A8JA 1JLFB 3CJSA 2R7OA 2F8MA 2PIYA 4IUSA 1TR0A 1RHKB 1Z9UA 3CJRA 4M5NA 3OBIA 3MMBA 1OSDA 4K7QA 1S1TB 3I32A 4FPRA 2HBZB 2ZKTA 2FTRA 4J9PA 6CPAA 1Y7PA 4H4MB 3DDNA 5THWA 4OHXA 3FVLA 4YGOA 4JI8J 1CJVA 2XULA 2KT5A 2KL8A 2BJ1A 3OXFA 1QTNB 2KN4A 3FBEA 1YRXA 3SIPB 3TZZA 2IJFA 4KPYA 4KYZA 4C0BA 4RN7A 4IFYB 2L08A 4LFBF 1KD1T 4QUSA 3BPDA 2YNDA 3BJ8A 2Q04A 3TAPA 2ZJRQ 1NB7A 1DARA 4BBYA 1S6UA 3AQOA 2J8MA 5CZVA 2BQ3A 4LUBA 1NDLA 1I12A 4LBIA 2KB2A 1U8WA 5EN1A 4MXUA 3FNCA 4NEZA 4ZPBA 3K17A 2RE1A 1WHVA 1NLKL 3G6VA 3OVSA 4WFZA 3IU1A 1HLWA 4P4DA 3O1LA 1SQFA 3D67A 4KOSA 5EX3A 2NSMA 1EX8A 5T7LA 1U6ZA 4ZPAA 2ZVIA 2JJ4D 4I0WA 4LFCJ 1FK9A 5KTDA 4P44A 2CIJA 1LEOA 3D4UA 4NA1A 3O3LA 5DRKA 3UFCX 2QO3A 5HMXA 2OI2A 2V63A 2HMIB 3H8YA 2OJ3A 1IWGA 4CIOA 1JB0C 3DU5A 2OR4A 3KDOA 3N79A 1U6BA 2ANPA 5DDRC 4DHVA 3RNZA 4J9VA 4HPSA 5EWGA 1LFWA 3F5BA 3BJYA 2R2RA 4F9VA 2B4OA 4M95A 3CD5A 5IFMA 2K3IA 2OEJA 3NCRA 1IBMF 2BZ2A 1XR5A 2XMWA 4U5YA 5L9XA 3OV7A 3MAAA 3LGMA 3MTKA 1N32F 1QVFR 2EKNA 4UIBA 2AFUA 4DX7A 3C46A 1IKWB 2MLZA 4B3RF 1LWEB 5RUBA 2Y3YA 1JLAB 4K4VA 1QSTA 2DRDA 2W7PA 3V4IB 1A6LA 2F65A 2ABYA 1VQPS 1CP7A 1K0VA 3DXSX 2HWIA 4A37A 1YQHA 4S0MA 1MMNA 4DS5A 2XMAA 3N5FA 4DPYA 5KTCA 4IRDA 3P2FA 1B7YB 1VHEA 4DL3A 4LF9J 3OUYA 2EI5A 5EHHA 2VDIA 1LANA 1X12A 2LYVA 2P9CA 2REEA 1WUUA 2BJEA 2ADCA 3KLEA 4JI5J 4F3MA 4KORA 1MMLA 2H5MA 3UVJB 3VVTA 5K8OA 1Z4UA 3GP9A 4CM0A 3TZWA 2EEYA 4B02A 2LXIA 4UIAA 1RDRA 1L3SA 4RR5A 1KFSA 2AMCB 3EXYA 3SSSA 3AOAA 4ES1A 5A8WA 4A32A 2DISA 1YDLA 4DV4J 3I82A 3FCVA 3HHDA 4JV2A 2GLFA 2OU2A 4J7CA 3D3BJ 4JOUA 3QT6A 3MECA 3FBCA 4F3OA 2Q66A 2GMJA 3R2DJ 5KFXA 2CZ4A 4I6AA 4KSEB 1HARA 4QIWD 3BBCA 2C6GA 2M52A 2M2BA 2O3DA 3GV5B 1BLLE 4UOHA 3M2VA 3NGUA 4P7VA 3GILA 2CY2A 1MWQA 1HNWF 4MIBA 4MT1A 3EDRB 1KP6A 4HHUA 2NZ4A 2K7JA 3SI2A 2ZEJA 3MD1A 1EETA 2BE9B 1KQKA 4ED8A 3SDEA 2XMJA 3U7JA 3MFIA 3R7BB 4EGLA 3SQGA 3TUZC 3TYTA 3KUHA 1S7FA 4USTA 2ZW4A 4K2JA 3RBZA 4MFPA 4JV1A 1UZHA 6FD1A 3V5RA 3KLHA 3CXQA 2ZKUA 3JSMA 5IM0B 3OD2A 4KVME 1X5TA 1HI8A 4CI0B 2HFZA 3M9MB 1KLMB 1M5HA 1N56A 2CQGA 1UVMA 3GJQB 4U6PA 4M1KA 4OX8A 4P45A 2DGUA 4HL9A 1RT4B 2OTJS 1YVFA 1R0BG 1RTQA 1R8CA 5G20A 5HMZA 4RO0A 1VBXA 3TARA 4FYYB 2F4VF 4X4OA 1M4GA 3TTHA 2VODA 2WSFC 2A0FB 4FBTA 4Y49C 1CJUA 5KFWA 4MFKA 4ZY2A 2GS8A 3S01A 3QJJA 3TANA 2L41A 2PJ0A 2ZFHA 1HQ2A 4KS9A 3DRSB 4H4OA 1HQUA 1Y00A 4J37A 3B8GA 3Q2SC 4X5KA 2AYBA 3ZNUA 3G71S 5C88A 4NFRA 5AG6A 1N33J 2C1CA 3CEDA 2R8JA 2DR5A 2V4JB 5KG0A 1TVRA 8CPAA 4ELUA 4HYKA 3V81A 2OSRA 2ZNZA 3R96A 3NMAA 2BOAA 2MHEA 1GX5A 3EVMA 2ZDOA 1VJWA 4L76A 3LA0A 4DYOA 4QIFA 3MCMA 2FY8A 5A8WB 4CO1A 1PKUA 1X4CA 1GT8A 1TL3B 1M4DA 2PCUA 2C3YA 2UUAJ 3TX0A 5IV0A 2FGCA 3H5UA 2H4WB 4CWBA 4U67Q 3D2WA 3K58A 1LW2A 2CVEA 2W8LA 4WIQA 4DR6F 3KZWA 2WVCA 3UVJA 3T5KA 1F5AA 3OTOF 2HNYA 3SXLA 4PYAA 3ZTOA 4YHHF 1NCLA 1XR6A 1IBMJ 2XZTB 4P52A 4OADA 3J7YU 4PG7A 4OYAA 4IOCQ 2OMOA 1N54B 5L39A 2CQIA 4NSQA 1GXTA 5J1EA 4CO3A 4UOCA 2VL1A 2VOOA 3TUPA 4U96A 3V4IA 1ZA1B 5D0HA 2C3MA 3JS9A 4F9UA 1U02A 2OH1A 1VQMS 4OYZA 2ZE2B 2C2KB 4AG9A 4K50A 3BKUA 4LF4J 3KJNB 2GJ2A 2QA4G 2EBEA 5D15A 3N5BA 1UEVA 1FERA 1KBRA 3PEJA 2V2VA 3DI6A 2W2MP 5KFEA 2KXNB 3BYPA 4LSLA 2WONB 4AD6A 2YWGA 3BGLA 1N6QA 2EC0A 1Y9OA 5K14A 1SC4B 3SCLE 1CBKA 2P6TA 4L72B 2HZAA 4CLWA 5HJYA 2HMIA 2RDJA 2YY3A 2G1HA 5JPHA 4QQBA 5H9EK 2Y0BB 4V1Ak 2XB2D 1F5BA 3VV2B 3R95A 3ZZOA 1UA0A 1V3SA 4F4KA 1C4CA 1FK9B 3KDNA 2CNLB 2ZH1A 1VHSA 2KZMA 2C22A 3H40A 3T19A 1FD8A 2KH9A 2Q4VA 4NGPA 4ES2A 4C2ZA 1L5UA 4ZVHA 2Z10A 4ZY1A 1N88A 4ZJQA 2DO0A 3I31A 3R9FA 4JD6A 4PEOA 4MFQA 1S7NA 3ILJA 3IAM9 1U24A 3MCOA 2HPUA 1YR0A 2M70A 4NYPA 2CKWA 2Z2MA 1JJ4A 4ZYQA 4KSFA 1R57A 2YNIA 1V0CA 1B3TA 3GPAA 1S4EA 2W2PP 3MR6A 2E5GA 3LWMA 4CPAA 2ZD1A 4YOEA 4IAVA 3QWPA 4H4MA 3WIUA 1UW4A 4CT8A 2CQPA 1Z5RA 1WC1A 3HX9A 2B5GA 2Z3PA 3PKMA 3VZIA 2XI3A 4X2BA 1DQAA 1F9FA 2DF5A 2XYGB 3MMBB 3HXMA 2VFVA 1WHXA 1F0XA 3MUMP 2HHUA 4ZPWR 3BO3A 5HROA 5M2RA 1CJWA 2WVDA 1H3DA 4RW8B 1HYSB 5DLGA 2NSBA 3AH6A 2GC8A 4I7FA 2XEJA 3NMRA 4NA3A 3IM8A 5BYRA 1P6TA 3FDSA 1SKUB 2K1RB 2XZDB 1PO6A 4CM2A 2XLIA 1JKHA 1RWWB 5HMWA 2XY6A 1RBLA 1W25A 1KOHA 4AL6A 3KMSA 1TUWA 3T6JA 3DLEA 4PZVA 3HVTA 4CO4A 3I0SA 2VG7A 5ELYA 3PFOA 4PAAA 1PSDA 2I6WA 4U9ZA 3CTRA 4X62J 1N5VA 3ZZIA 2OFHX 3CD6S 2WPWA 3JSBA 4QW9A 1F9EB 3PW5A 3EZUA 3M6VA 1YBTA 1S79A 1FXDA 4O0NA 2DEIA 5KFIA 4WU2A 4K4YA 3SFGA 4DV2J 1S10A 1TUVA 3QB8A 3SZ2A 1HNIA 3S7RA 3MM8A 2G0IA 1FX4A 4JI5F 2XMTA 2MMYA 3VWSA 3IC1A 5LMUJ 4JI1J 4X3RA 2CPIA 1HI1A 2JC0A 1RA7A 1I6JA 4NX9A 2WB1D 4DFJA 4EMEA 5LYLA 2XLKA 2DPSA 5AE3A 1K44A 4QBJA 3D68A 5JQ4A 1RABB 2RKIA 3UR3C 4IUFA 5AE2A 2UVWA 1DTDA 1QAIA 3B2YA 1Q81T 2YH0A 4DU7A 5JXSA 2ZOMA 2DR6A 1RT5A 2ZHOA 3S6KA 2RQ4A 2LXUA 4FD4A 1M5OC 4IF5A 4RNOA 2B3VA 5A6WA 1KEKA 1D9AA 1RTIB 2A4NA 2BUNA 3WDOA 1PYSB 3MURP 1B87A 1E6VA 2I3CA 3JXOA 5ETSA 5LMUF 3JRUA 1URRA 1TUGB 2R8VA 1FTRA 3PX0A 1TK5A 5D4NA 3UDVA 5CYMA 2QFJA 2CJ9A 5SZTA 1UZDA 3GJTB 2PSWA 1R31A 1QE1A 2HVDA 1AZSA 1S0OA 2A6OA 4M3SA 3F0NA 2BJ7A 3KLFB 3ET6A 3NS7B 4H6UA 1MJAA 2ZEDA 1NSQA 5KFHA 4F02A 4TNOA 1Z8XA 4MKBA 1D8ZA 3PB4X 4UCNA 4TKTA 4ICLA 4K4XA 1YK3A 2Z3MA 4KOVA 2IA6A 2IM3A 1T9TA 3DM2A 4KFBB 4TU7A 2AFZA 4KO0A 2YKMB 2DXFA 4YEAA 3CCJS 2Q51A 2UV8G 3LWLA 3OQ2A 2FJAB 2DCLA 3VGUA 5KT2A 2H5JB 3D54A 4B9MA 2POKA 3TO8A 2PJ9A 1RWXB 1SH0A 2YNHB 1REVA 1AUGA 2EKYA 1TKFA 4O3PA 3PCOB 3M6XA 3HI9A 3N6MA 3LAKA 4GO5X 4CRZB 4Q45A 4AXVA 2JBKA 4WCEQ 1N5SA 2EBGA 2ZENA 2GNKA 2Z2YB 2ZEGA 4DSLA 2UXCF 5G22A 1KUXA 2Y1LB 1S0MA 1BC6A 1VOMA 3KQXA 4OIXA 4QOTA 2MKJA 2ZBRA 3TO7A 2LCWA 2E9ZA 5GMKa 1NRKA 1WD6A 1LXJA 3HHEA 1KZFA 2FZGB 1CULA 4FS2A 4KHPF 4KFBA 2H3EB 3KNAA 4QB9A 3CULA 5D78A 4G3IA 3PEHA 2ZBPA 4WWVA 4NLGA 2V6AA 3Q8RB 1EJ7L 2ASLA 1JJ2R 1ZO0A 2DH9A 1X5SA 1YWXA 3T3FA 3QT5A 4JYAJ 3EPIA 4FPIA 3KK3B 2BE2A 4X8IA 2YX4A 3N01A 4NI2A 4AB7A 4ECYA 5CYMB 1FA0A 2CVIA 1WSRA 4NGSA 3R5AA 1S1VA 3UR0A 4OV1A 5D6GA 1RWKB 3D7DA 4IRCA 2VG5B 3PZPA 3OVBA 2F3JA 5F8GA 2CWKA 3NP5A 3T1AA 2UUBF 3CDAA 2HGNA 4BMHA 4H2KA 3LTOA 4OZ5A 2ZH4A 4KJIA 1MWYA 2WTFA 1RTIA 3BEGB 2YNGA 1ZAVA 2PGCA 3IR5B 1LXNA 1FFWB 1FT7A 2MZQA 1FJEB 2AX1A 2I79A 1RT5B 3CC7S 3M8PB 4LT6A 1CSJA 3FSIA 5JJBA 4ECXA 5M2UA 1IBLJ 3K8VA 3IMQJ 2HK2A 2JDJA 4WXOA 2RQKA 2V8DA 1ZM4A 4A46A 2JDCA 2V8GA 1B0VA 5F8HA 4J9OA 5BJRA 7AT1B 4EUVA 2NQPA 4BHQA 3F41A 2HNZA 1NK4A 1LWCA 5D3GB 1FDAA 4IG0B 1GQEA 3V6HA 1A7GE 2XCAA 2GX8A 4B9UA 1XEBA 3UD5A 4WZMA 5DGBA 1OWXA 1HNIB 3LWUA 3LGNA 4CYPA 1JNZB 2DPJA 2FHMA 3MDFA 2GHWA 5C42A 1SXLA 4KY3A 4DQPA 1RKJA 3W2WA 2XYHB 4N8NA 3WABA 4EBEA 2RSQA 2HHHF 2E5HA 1RAIB 5IC6B 1T9XA 3GCXP 5ETOA 1Q8LA 2AIRB 3VGVA 5CQGA 1U1PA 1JX4A 3MEDB 2YX7A 1IOIA 2ZH6A 2A1BA 3MR3A 2Z58B 3MR5A 4OLPA 2OAUA 3FB3A 1IKVA 1DTQB 4DWIA 5HVHA 3FECA 4Z7CA 1J5OA 4LQ6A 3L9ZA 3HVTB 2F8HA 2HKEA 4DLGA 3SJXA 3G6YA 2FE7A 3LQVA 3PZJA 1LK5A 2E1CA 5AGEA 3TNVA 3HSDA 5KOXA 2ZH9A 1ZZNA 5ADZA 1RSCA 3V6DA 3GLJA 4RBTA 2KFNA 3DNSA 3MI7X 2HBRB 4DFPA 2ZZTA 2DRAA 2RH3A 5I3UB 4DF4A 3J7ZT 2CQDA 2DHXA 1EP4A 1KTQA 3IU2A 2KG1A 4BS2A 2AJ4A 2D69A 3GV7B 5F8LA 2GREA 3D3CJ 4V19J 5HH1A 3GIJA 2FJVA 3QFWA 1HNXJ 3BJ7A 3OPKA 2YKPA 2YNIB 5LYIA 3H4DA 4KSAA 4LVNP 4I1TA 4MIWA 2IL4A 2K2PA 4NGMA 1WNEA 1YJTA 3OR2B 2E9TA 3LF0A 1W2BR 2LECA 3MPVA 3CVKA 4A95A 3ILLA 1N32J 2F8EX 1FRXA 4WK3A 2XTJP 3CCVS 3I3GA 3H8GA 3LPYA 2IYGA 5L8RC 4B10A 4PG6A 3I4PA 4LUAA 4OJ3A 1A9NB 2J0WA 4P6YA 3LANA 5DO2A 4GC6A 1HNWJ 3C16A 2H51B 1TKZA 3FXTA 2V2QA 2OH2A 2A6MA 2XM3A 3OSNA 2P8IA 1FD2A 4ZN3A 3TOBA 1VQ9S 2AYMA 2LLZA 3OTBA 2IA0A 4O0IA 4B14A 2FHJA 1D3WA 2X1FA 4ZHRA 2CUYA 3M32B 1TKDA 1LAMA 4JV0A 4M5LA 4C8ZA 2WONA 2PI5A 4NXNJ 2DNPA 3CDWA 1I94F 3DI6B 1TF8A 4LF8J 1NK6A 5F3ZA 1NPRA 2ZBIA 4DSFA 2YPYA 3J81j 1TQLA 2IC3A 5F9NA 1VGYA 1KRPA 4CLFA 2ZE2A 4IRKA 3OL7A 3KASA 4DCOB 2E1PA 1TKTB 3HF5A 2NXCA 4J9SA 3W3SA 3HVWA 4MHNA 4QR1A 2ODFA 2RMLA 4MCSA 2Y0MA 4HKQA 3PO5A 4QZVB 1HMVB 4UZCA 4JYAF 4IHMA 3AQPA 1FVSA 3PHTA 2CNTA 5C2CA 3LGHA 3MEGA 2GGPA 2AEJA 2QGFB 1R0CB 5E3PA 4TU8A 2ZW7A 4NJRA 1NAQA 4OP4A 2GIQA 1RAGB 1PC5A 5HXDA 3RAXA 2CWXA 3RAQA 2EFNA 1NMEB 4JLYA 1FVQA 1G4CA 2HNYB 3D2PA 2B9EA 2MHNA 5B0GA 4RPFA 2DCUB 1MU2B 1FE4A 2NR0A 4X4NA 3H4BA 4KOXA 2MDAA 1GXLA 5IX3A 3G3SA 2L3MA 2HIYA 4FWUA 4KHMA 3R97A 5LMNJ 1N0VC 1LWFA 2ZNYA 2DHAA 2ALZA 1C0UB 2WW4A 1Y3JA 4IDKA 4KHPJ 1L3KA 1GTHA 2N7CA 1J5EF 4F4WA 4C2XA 1S6OA 5D29A 2JNJA 3V81B 4OYIA 4LF4F 1RT2A 2N3OA 1TVRB 3S9NA 4EBCA 2V4JA 2WZ1A 1C0TB 3R1LA 2QL7B 4MCPA 2VPWB 1YJRA 2M88A 4IYQA 2R7WA 1AW0A 1HNVA 3KJQB 2W9CA 5KFVA 2IDEA 3SXNA 3FC9A 4USKA 2ILYA 1IBCB 1NJWA 2NCKL 1R8BA 3ZO7A 4HACA 3TI0A 4ID5B 1JLGB 2EK6A 1D1UA 3SV4A 3HMJG 4N47A 3AODA 3KHLA 4B3OA 5KT3A 1D0EA 3EVOA 1UVNA 2HQ3A 2M9KA 3IWXA 3CO9A 4MCQA 4ELVA 1DJ0A 4ORFA 2Z3OA 1CJUB 2CNSA 2A10A 1M1KT 1S6QB 4LBPA 3OLBA 3UN3A 1EKRA 2GAHC 4WE1A 4LFBJ 1TIQA 2AJ2A 3BSAA 3NRBA 4M5IA 1TAUA 5GAGU 1SI9A 2RS2A 1RT4A 1VK8A 2PD1A 3Q8PB 3SSRA 1JLQA 2HW3A 2G3TA 4A30A 3K5NA 1E6YA 1HA1A 2I5JB 1HHQA 4JI8F 2E7VA 3M7VA 1TXRA 3FMCA 3HSJA 4AE5A 4I6WA 3OTEA 3ZZYA 3BXMA 5IM0A 3JSMB 1S77D 3PP9A 4Q8FA 4F04B 4PQUB 4G65A 2RFHA 1YJNS 3MM9A 1GYTA 3D6FB 3PX6A 4HH0A 3BKFA 1NDCA 5I4MA 1Q95G 2DNOA 3SDEB 2Y8WA 1Y10A 4ECRA 3MGDA 1IM4A 3BZQA 1OYEA 4QIGA 4I69A 3DCAA 2HHXA 1G6BA 3ITHA 1HQEA 2HVZA 3B4DA 4ILLA 4UY8T 3HT0A 4UCMA 5M2PA 4GVBB 2E1AA 2YKAA 4LREA 3E2EA 4ZVOB 1R27B 2MLXA 4CQ1A 1RHJB 2V8HA 2BJ3A 2HFOA 2VB6A 1RAJA 3HM9A 4O23A 5F8MA 2DPTA 3RYLA 2JDDA 4E0DA 1LOKA 5J1QA 3MUVP 4JI1F 1FI4A 5HSPA 2VFSA 4RW7B 2G2ZA 1N36F 1XIQA 1WC6A 3V38A 2CJXB 1JIHA 1J4JA 1N0UA 1WF0A 2VFTA 5HQMA 2ATCB 1VIXA 1PU9A 3OJSA 1WWHA 3G9CA 5EX0A 5KFSA 5I42B 3IGVA 4FF1A 3U27A 4LJMA 1VRUA 1RHRB 1VBYA 3LMSA 4MFZA 3GIUA 4AVCA 1MSWD 3LO3A 3VGSA 1CPXA 1RACB 2KVQE 2ZWOA 3RB6A 2CADA 3B78A 4DUZJ 3I0RA 3QATA 4A38A 1P0HA 1UEUA 4RW6A 2ZDPA 1SC1B 3CCRS 1WACA 1QMUA 4Q0BB 2CG4A 4CRYB 5CZXA 3M8WA 5KFMA 1U1MA 2MZRA 1LWEA 6AT1B 2PIIA 4NMXA 2W9BA 2BJDA 4X4UA 1Q86T 2HAIA 4JB8B 3FSYA 4OHZA 1MN9A 3ZZTA 1QSOA 3ISND 3AFGA 4F0HA 1WDDA 3MAAB 4CYOA 5EBVA 4DQRA 2BYCA 1KVIA 3MPUB 3S1TA 5FDLA 1P27B 2HEKA 4F67A 2YWHA 3EICA 3CPXA 3CDUA 1BAVA 4KR0B 1FY7A 1O6XA 4Q44A 3TRGA 1JWQA 2XCPA 2BM1A 2CNNB 1RTJA 3IAS9 2R7HA 1JK9B 4G1PA 5HL7Q 3ZZPA 2JEIA 4HR2A 2XY7A 4CT9A 4TY8A 3JTOA 3PXGa 2JOQA 5SUHA 1SL0A 3D66A 3PO4A 4MMOA 3QRRA 3RRGA 1S7LA 3RO0A 1KVJA 3BQ0A 2C6PA 3GYAA 4OC5A 1OPZA 3M8RA 1HBOA 1JNRB 1WEXA 2ZH8A 2Y1JA 2NYHA 2OD6A 2L9WA 3TA0A 1F2PA 4ZJLA 3QLHB 1NJYA 1T9UA 2BE7D 4PWDA 5F9LA 3BDPA 1RWOB 2EFQA 1QQ9A 4XO0A 5JGFA 4Q2LA 4JI3F 3ICLA 2BM0A 5IOLA 1M5VC 4MAKA 2DXEA 2QC3A 4B9SA 4KOYA 1KDNA 2OOTA 3FEZA 2OPPB 3ZNJ1 4ZCIA 3IGRA 1SCJB 2OZGA 2M8DB 3TEHB 3EDQB 3HJFA 2LA4A 4QCLA 1H8LA 3TQEA 3W2VA 4Y0FA 4MKAA 4PXEA 3BGRB 4LSNB 4CH0S 3L3CA 1BOBA 2DY9A 3L4BC 2FVGA 3CXCR 4UA3A 3L7PA 3KG1A 1LKZA 4CP5A 2LKZA 3MMAA 4CLZA 3IJ3A 2PSZA 2R8HA 1L3TA 2M3DA 3IG1B 3QWUA 1NJIT 3EPGA 3K59A 5D4PA 4NE9C 3TWZA 4RUHA 3K7RA 1Q7LB 5IT4A 2CPZA 1YQEA 1OPIA 3LUYA 4AVBA 3VATA 3H90A 2J5AA 5H86A 1PILA 3P6YC 2E1RA 4DFKA 3TAMA 4NGTA 4O4GB 2B4UA 4K5SA 1PJ7A 1X9MA 5KFRA 5J1PA 2PA8D 2HV2A 4JZ0A 3SV3A 2R8GA 3AOCA 4EWTA 4N56A 2XS2A 2Q3PA 3X3UA 4IOBA 4KOUA 3TC8A 3MM7B 2H9ZA 3GIMA 2IVFB 1Y0RA 3RRHA 2Y0SD 4OZ2A 4DR3F 2MXYA 1T03B 1HBUA 3F73A 1U48A 2MJNA 3OFEA 3QIDA 3BO4A 5G4DA 3IWLA 3RU0A 2ZJPQ 3QAEA 1S72S 2J0QD 1CPSA 2X3DA 1P4NA 1UWBA 4ZLNA 3EZ5A 4Q38A 3NH8A 4XPCA 2DGWA 5KFDA 2EXUA 3K9TA 2KT2A 5KG3A 2DXQA 4CTAA 1VQ4S 2HS4A 4BLGA 2NLWA 2ZM6J 1XFOA 2HHWA 3W5ZA 2MJUA 2KYXA 1CVJA 3KGQA 4DLEA 3MWBA 5JVHQ 4DNCA 2UXDJ 5KT6A 4F7VA 4X66F 1F2GA 3H0PA 3W9IA 3S6HA 4U9RA 3ETMA 3M2RB 2G0JA 4OI2A 4U8YA 3CJKB 5J2PB 2LMIA 4DEZA 1JLCB 3C2PA 3KFWX 5K8MA 3AOBA 1TK0A 4R25A 3E3XA 3OTOJ 4B9VA 2EFOA 4DR6J 4B5PA 1NB2A 5ISVA 2ZHBA 3GZ7A 3AA8A 5K5MA 2BKNA 2IJRA 1U49A 4XK8C 1KTVA 3JB9k 1FE0A 1BE4A 2XC9A 4C2MA 5EWEA 2AT1B 2ZITA 1M1GA 1SJ3P 4KV8B 3DR8A 3BF4A 3ENAA 2MGZA 3B3TA 3UN2A 1FNOA 3KR5A 2W4CA 2I00A 1K4JA 1YVKA 5F48A 4MHYA 2FPHX 4LF7F 4NCAA 4DV6F 5H1SV 4BD9A 3KMQA 1F3FA 3N6NA 2MLYA 3VHQA 4OC3A 4M63A 3JQMA 1ZAWA 1RWNB 3N9UC 1WDTA 4LF8F 2BANB 4NXNF 4ZLLA 2QFIA 4EMDA 3EO4A 2J8NA 3HHKA 3NGKA 2G0CA 4EBDA 4DJLA 5E3AA 4DPOA 5E0OA 3IWWA 1F9HA 1Z4RA 1EIYB 4FD7A 1RZMA 2EWHA 3PY8A 1HHSA 5CYQB 4YR3A 2D7SA 3SCJE 2EFPA 2J9DA 2F9DA 1CPZA 2N7YA 5DGAA 3QNWB 5HI7A 1UEKA 2XLJA 1FFSB 1RYRA 4ZVRB 2Z11A 3D28A 5DZ6A 4ELTA 3KI9A 4YDXA 1BGXT 2GFFA 2DJWA 1R3NA 5CHCB 2ALYB 2ZBQA 4O44B 3IM9A 4OZ3A 1SUQB 2C42A 2XO7A 3E8OA 4M6GA 3MMCB 2PDOA 2P2CB 3DXBA 4ZMMA 2DIUA 3IEHA 7CPAA 4HDHA 4Y3CA 2YGWA 1U8SA 2CQ3A 1RT7A 5BR8J 4A8SA 2DB1A 2AGQA 2IFXA 2QMXA 4DJBA 2D3ZA 3HKWA 3OR1A 1IOFA 4M5DA 2NUHA 3IBFB 1GHEA 2EBJA 1S6PA 3WC6A 2FLPA 4M5DB 4NLDA 2W9AA 4X4PA 2XEIA 1U0HA 5CNPA 3QGPA 3CPWR 5KTQA 3OXGA 1NK8A 2JVRA 4NGQA 2CPXA 3H59A 2DGOA 3Q22A 1RT7B 3MM5A 2DNZA 4R76A 3K89A 2YBVA 3TOQA 1YJWS 1JWWA 3FVYA 3K5MA 4AVAA 4CAXA 2WAQD 3MMCA 3UE2A 4ZVUB 2R7UA 3BHXA 4OC1A 4OKOA 2Y9HA 2VG6B 3AXMA 3BLNA 2AF6A 3CUNA 2ZEMA 3K5OA 1SV5A 3FEDA 3KK2A 1Q5VA 3CCMS 1RLDA 4Y2MA 3NA6A 3MM6A 1ZLHA 3PW4A 4QR0A 1VISA 1WC4A 2XEXA 2G2OA 1Q8IA 1V6HA 1Q53A 1QSMA 3OJUA 3D7GA 4JV5J 4ZPCA 3T1HF 3M2UA 4IH6A 1DQ9A 4LMZA 2D9OA 3T6BA 3PIPQ 2J6SA 1LW0B 4J9LA 2BMBA 2RVJA 4GM5A 4A8FA 2VC1A 5CA5A 2HK3A 2IJNA 4ZVTB 4KH0B 2MQPA 3F56A 2PI4A 1NM2A 2ROEA 4O3QA 1HPZA 3DN9A 3FH4A 3V8IA 2R7TA 1PG5B 3UI3A 2HHHJ 5C7PA 1NEEA 1SBRA 4GO7X 5GVQA 1S3ZA 2CNOB 4Q2MA 4OI3A 1U1RA 4IR9A 4ED3A 5A0YB 1SC3B 1HPZB 3KLVA 3SI0A 3SBMA 5KFFA 2WRMA 3MPDA 3KHXA 4YN3B 4GKKF 2B7BB 2QLJB 2LQ5A 2MQMA 3DDDA 3KJFB 1AUDA 2OP5A 1K0TA 1VHIA 3G8SA 4PPZA 4A94A 2G1DA 2UUCJ 2J0XA 3M2UB 4NL5A 1A0OB 2QLFB 1WG1A 2NPIA 3SI8A 2FJEB 5KFNA 2O66A 3BGFA 2H65B 4RW9A 3NOGA 2KYZA 2LFVA 4G1IA 2AWZA 2C2NA 1S4FA 3HZEA 5D0EA 1N4LA 2EK1A 4MHDA 1WG4A 3GONA 1VQSA 5I0CA 4MKYA 3EGZA 3HDSA 4K5RA 1SQGA 4ZCKA 1JLCA 5CCMA 3BM7A 4PPDA 2VG6A 3A12A 4UUXA 4O4RA 1CLFA 3ZFVA 3S9MA 3BH6B 4P9SA 2X1GA 2MZ1A 2C27A 3FQLA 1KONA 4W90B 2IY5B 5DS0A 1Z4EA 1Z2ZA 1AUSL 5A8RB 1M4LA 4R3LA 2GMHA 3MM5B 4RNMA 1WF2A 1XMOF 4WYWA 5ETPA 3W8GA 4GXHA 1X7VA 1GFWB 4DSEA 5IWAJ 4OYMA 3NS5A 3B4MA 1DE4C 1S57A 1GXUA 4LFAF 3W5YA 1OY6A 1T02A 4RZRA 3AJDA 1NJXA 4R5PB 4UQGA 1ZTWA 1JXLA 2CNKB 4WKYA 2C2MB 5B0FA 2RAQA 4WPAA 3CGIA 1ELLP 4KC5A 4UY85 2FCKA 1HFEL 1S1WB 3R6GB 5LRKA 4ZLJA 1U1KA 1SUQA 2ZM6F 1X4BA 3QMQA 4OX7A 4O44A 3KQZA 2BRLA 3OT9A 2CG8A 4P4FA 1ZTTA 4K2XA 1S9EB 3TAMB 5GMDA 1ELMP 1UPPA 1VHFA 2UXCJ 5B0BA 5C25A 1RU1A 4DV6J 4F0YA 3CF5Q 1X5PA 2RU9A 1XMOJ 2HQFA 1Q7LA 1UCNA 3DYAB 4L89A 3N0VA 2XHCA 3UDCA 2FY1A 1IKYA 1PYTA 4IO9Q 1T9VA 4ILMA 3D7HA 3MZIA 4W92B 1RT6B 5DDQC 3H8EA 3DLHA 5H84A 4FUUA 3T5HA 4FVCA 1OS5A 4J9NA 3CIMA 2BABA 4LR7A 1WI6A 1YLEA 3BN4A 2BANA 2UU9F 3RW7A 4NRUA 1X4AA 4P7TA 3D2MA 4FKYA 1RAFB 2BRKA 3PJWA 2QJ3A 2HFVA 1LCPA 2D4PA 3WC7A 3P5BP 1MK4A 2Z3LA 1ITPA 4KVOE 3C6UB 4P4EA 2ZC4A 4LVOP 4I2PA 2Z3NA 2XEGA 3PX4A 5LRJA 4B3MJ 3Q86A 2EC2A 3FEXB 1NSPA 5J2MA 1V3RA 5L1KA 2FC8A 4KV8A 4ES3A 2CA9A 3CWJA 2VBQA 3H2VE 4QU6A 5KFOA 1QJHA 2QV6A 2R4FA 3PYFA 3JVNA 4PSWA 2AHOB 2EK8A 3R2CJ 4CNZA 2WBRA 5K9FA 4TY8B 4YFUA 2RDDA 2F1FA 4Z7YA 3I5AA 2Q7SA 2MKKA 1RP5A 2RRNA 2OGUA 2KFZA 2PJ6A 1FNMA 1N8RT 5EWFA 4YMEA 3ADAC 5F09A 3CJKA 5J2PA 3FCHA 2EG2A 3A8IA 4BC7A 2VEZA 2KI2A 2JLEA 1TL5A 4Y6IA 1EARA 4LF5J 5LMNF 5FDLB 4X64J 1JLEB 1HHTP 4LF2A 2ZXVA 3KHZA 4ZJOA 3BB5A 1MLAA 1UTAA 1VRTB 2YWKA 3UW1A 2P9GA 2RRBA 1RTZA 4ZP7A 4YR2A 2AFSA 4CTAB 1QSSA 2D3UA 1YI2S 2JVOA 2FYXA 2AYGA 3M8QA 1NHKL 1U09A 4OI6A 3WR7A 5E3CA 3PRVA 3PFEA 4UWIA 4CCHA 1U1NA 4GRSA 1TFYA 1SJQA 3H42A 1VLYA 3TJ8A 9RUBA 2R9LA 4BBHA 1ZA2B 2V67A 2VQYA 4CLPA 1M44A 4NXYA 2O4HA 2HLUA 4Y2AA 3NG8A 1NMTA 2C6CA 5DJBA 2AU0A 3MCSA 2GVDA 1H7WA 4WFAQ 2HRYA 2GV1A 4W4MA 3L7OA 3HJVA 2HQCA 1MG7A 3SCKE 3MM7A 4GS4A 5GAGI 5I42A 4HKFA 4F3QA 4OC4A 1KQSR 5DM6Q 4DN0A 2FUG9 1XJOA 2C3UA 3MMJA 4O4GA 1UETA 5ITHA 5EUHA 1RT1A 4UOGA 2DH8A 1TKXB 2R2SA 4L75A 3MAHA 2PJ8A 2UXBJ 4WP3A 3U1NA 3CC4S 4ED7A 3D8PA 3QZ7A 1IIDA 4WJBA 4DV5J 1HD0A 2K7KA 5E5NA 1YIJS 3PB6X 3SYZA 4PV6A 2GHVC 4KRWA 2DNQA 4DPTA 1QTMA 2HGMA 1NUEA 4YY3J 3PRDA 1ARLA 1OMSA 3LH2S 4LSNA 4ECQA 2HHTA 3N4WA 2ATRA 2YQ1A 3EE3A 4QWCA 1QAYA 1DURA 1HNZJ 1HWLA 3EXCX 5AXKA 1I5OB 3P5TL 5KFPA 1DLOB 1ZS6A 2OPPA 1M1DA 1MN7A 2B9WA 3D1OA 2FVCA 4EO8A 4E98A 3CMES 1P1LA 3M8YA 3FFIA 4J9UE 1N34F 1BY9A 3TUIC 1EQMA 4DL4A 1N36J 3FF3A 2P5VA 3UWTA 4C3LA 3K5LA 1HWJA 2GU2A 2X1BA 1QSYA 4DR5J 1NSKL 1BQMB 1J2VA 1X4HA 4TYBA 1FJGF 3GCWP 2O28A 3OLAA 4OHYA 3QLHA 4OZ1A 5G0RA 3DLJA 4FNIA 5IT9Y 1VQKS 5AXNA 4DV5F 2AP6A 5KAKA 4YB7A 2YNFB 2HRUA 2PJAA 4WZQA 4OV6A 2E29A 1GMWA 3H7HB 1JLQB 3NLCA 5CH7B 1RAOA 4JI6F 1BLUA 2KTQA 2ROGA 2FB0A 1FJCA 3QRQA 2YKQA 2ZPAA 3OL8A 4ATNA 3HVAA 3H8FA 1VQ8S 2JEGA 2GJFA 4R8FA 1S6QA 4LSZB 3VGTA 1VLOA 1KN6A 2REFA 2C3OA 2P6FA 1XERA 2NXEA 3KHGA 4B3OB 1UAWA 3UNGC 1KQFB 4ID5A 2WVFA 2AJ6A 4XDDA 3EC4A 2W9BB 4EO6A 2GZOA 1YW4A 3TJ9A 4DZ6A 4EZ9A 2P6SA 1RT2B 4HNXB 2IRYA 2LDIA 4KTQA 2NS1B 4HLBA 3MN8A 1C0UA 2G9OA 4RW6B 1RB0A 1P1TA 3NOCA 3I0RB 3KKWA 2DGVA 2CDQA 4WFYA 2BJ9A 3CJQA 1S1XA 1UVLA 2ZW5A 4DR7F 4OLLA 2FIWA 1MU2A 3ONQA 1HBNB 2DXDA 3DRXA 3GFZA 4E2FB 4KBIA 5DM7Q 1Q16B 3ENVA 3UO0A 3MEEA 1VQNS 1LNQA 4V19X 4H6ZA 2PC6A 2CQ1A 4K4WA 2J7KA 4QC6A 3E0KA 5F49A 2PEBA 3IA0A 1YITS 2GGPB 3CB4A 4DSKA 4RX6A 4DG1A 3VQTA 1JMTA 2VD3A 3M9OB 2KT3A 3KLGA 3JUWA 3B54A 3SMZA 4EZ6A 1X10A 4DQQA 3K2KA 3KL9A 4ZX8A 2QA4S 4YS2A 4UEFA 8AT1B 2DY1A 5LM7E 4J91A 3R9GA 3W63A 4CLUA 1OQ6A 3RR8A 1TKTA 5B0EA 4GVBA 1NSLA 1MW7A 1RI7A 4KZTA 2ROPA 1HQEB 3ITHB 1ULRA 2OPSB 2GO9A 2HVEA 1L3VA 5IV4A 2ACYA 3NS6A 2HHVA 1AT1B 1IU8A 2IM1A 1FEHA 2QIRA 1F5CA 1Y4ZB 4J9MA 2V34A 3NWGA 1TZ0A 1N52B 1FHTA 1Q2CA 4DSIA 2B3UA 3AJ1A 4DL0C 3LODA 4PQUA 1NKBA 4PUOB 5FD1A 1H0HB 1T3OA 4DUKA 3EUNA 3C3LA 3W8PA 1MWZA 1Y0HA 3SXOA 2EK9A 2HLTA 2N4DA 2I5JA 3CCSS 5IB0A 2UZAA 2AYEA 3D7SB 1B70B 1GMWD 2ZZNA 1S48A 1IYKA 2HIQA 4WXWA 1TKZB 3I96A 5DS7A 5LOQA 3HHLB 3C16B 4WE1B 5IT0A 5F8NA 2QA2A 5KFZA 4F4AA 4NOHA 1OY8A 2D41A 4C8NA 2YTCA 5CD4H 4C7IA 1CG2A 2Z2LA 2HZVA 2QEXS 2LEAA 4J3GA 3BREA 2K5TA 4CGPA 4P2XA 2BEFA 3J7YI 3TVKA 1DFDA 1ZBTA 2V77A 3MPYA 3DDKA 3S6GA 5ETMA 2HQYA 4Q36A 3GSDA 3ZZUA 1VC5A 4C98A 2EVNA 4NLPA 4HACB 2VBWA 4XPDC 4UBRA 1YLOA 2IVMA 5FLXU 1SQEA 2B56A 4FNHA 1U4BA 4R3KA 2VU5A 1HNVB 5KT7A 2V4RA 2ILZA 2B9YA 3OHBA 3NGTA 1C0TA 1RWVB 2NXNA 4K4ZA 4LR9A 1NU4A 1S9GB 1Q2DA 3KLIB 2DH7A 3QT7A 2QZ8A 2VZZA 2APOA 2Q0YA 4EEYA 3GFHA 4ETZA 1O51A 4IDKB 1IUJA 3WZ0A 1EAYC 4DMZA 3DKDA 1DRZA 3G6ES 1LWFB 4KGZB 3G87A 3UDEA 1M4IA 3H2UB 4O3OA 2B3TB 2V5HG 2CTBA 4I56A 2PJCA 3C15B 4ZK7M 4C8LA 2E5LF 1S7KA 3KHRA 2Z2ZA 3J7AN 4Y2IA 5L1IA 2XWYA 2XS7A 4NMLA 5T41A 3A13A 4PCQA 4K8RA 3OFFA 3FX6A 1X9WA 2QECA 4B9TA 2GIFA 1XJWB 4RW4B 2IVYA 2R1IA 1R8HA 4ZGYB 3A8KA 1JQGA 1SJ4P 3ZZRA 3OL9A 1CQNA 1R0AB 2HQDA 2EVZA 5C24B 3CCTA 4AFFA 2MY7A 2HZCA 3RZAA 4LX9A 3NNHA 4U8VA 2PVVA 3DLKA 4OZJA 2EWBA 2J8AA 2ERRA 5KFJA 4YUDA 3VR1A 5JVGQ 3ZZ0A 1RAHB 4CLKA 2VV5A 3FCWA 1LQ9A 3WX4A 5A27A 4DV3J 1X0PA 4N7TA 3R8YA 1PJ5A 4XTTA 1MROA 2OEMA 3W2WB 3ILIA 3M6UA 1T8EA 1FCAA 2IC3B 1I51B 4CYQA 3FNNA 1QM9A 4C3MA 4CO5A 5C5JA 4ZX9A 1Q79A 4FYVB 3FMWA 4DR2F 1RO5A 3RB0A 4TLQA 2VASA 3QGHA 4F8RA 2NZCA 3TJAA 5HN0A 2QYVA 2ASDA 3RTVA 5KFKA 1H38A 1REGX 3CCZA 3HHLD 4PRFA 2R8KA 4AL7A 4BINA 2OHDA 1LWCB 3M32A 2HNZB 2QX0A 2V94A 2ZEEA 3G2XA 2BACA 2PIZA 3FJUA 1UL3A 3JSYA 2RD5C 1RHQB 4RS2A 4A8OA 4DR1F 3GWCA 1Q0NA 4Q5VA 2WSEC 4FBUA 1YGHA 3M8PA 4P74A 2E9RX 4OIWA 4C11B 5B0CA 3R27A 3ZTSA 1XMQJ 1WOOA 2KHCA 4C68A 2FVPA 2C3PA 4C7QA 4DV3F 5J8CA 4QBUA 2DNRA 4MHPA 3RBUA 3B3VA 3I5BA 2IBKA 5ETKA 1S49A 2JFDA 1K8AT 2MTLA 4CYUB 5U47A 2CJAA 2PE3A 2D3O1 3NBPB 2ZEHA 4GKJJ 7FD1A 1GX6A 3CJ0A 1H98A 2L48A 4P4JA 2VG5A 5L1LA 1Y5LB 2J7WA 4BWMA 4OYXA 1S1VB 1PUAA 1U47A 4USMA 2FJDB 3FKBA 4E2AA 3MF5A 4DS4A 2GIRA 2NMTA 4P71A 1VKCA 2J6TA 2QMLA 3KK3A 2OUGA 1ZLIA 4LFCF 3K2YA 4M8LA 4AQYF 2OLWA 2PN6A 2QVPA 2YWEA 3FUYA 2BA9A 1F3VA 5LSRA 2FLNA 4FP9A 1T05A 4X2TA 1Y5NB 1KOOA 1AXQA 5AE1A 4MYUA 4WTOB 2XGQA 2Y1RI 4E8OA 1EHWA 3B6BA 2LA6A 2J9DE 3IRXB 3PR4A 2UUBJ 2RT3A 4HTJA 2WSAA 4B3SJ 3G4SS 5I3UA 1YJ9S 4WFBQ 1FX2A 2FQQB 1U0SA 1H73A 2FHOB 3H25A 2I2YA 2FIAA 3FBUA 2YWFA 3V6DB 3R5CA 1YRUA 1BWVA 1I1GA 4K4UA 2Q4ZA 3GB0A 4OZLA 2W4PA 4DXLA 2DVIA 2UV8A 1Y3KA 2BEIA 4U7UD 2J0SD 3H20A 4K4SA 2YKNB 5KFGA 1J5OB 2FT0A 4LRDA 4ZLPA 3D9BA 3IO1A 3D7FA 2CDRB 1HD1A 4XPEA 1IJFB 4YP3A 2ZC3A 2QSFA 3NH4A 3MEDA 2VZ9A 4GVLA 3VAHA 3AT1B 3B82A 1Z2LA 1Q78A 4UF4A 5KFQA 4OLOA 1KSPA 3TR5A 2CJQA 3QYYA 2DPIA 4HTIA 4NZ0A 2JEJA 5MLCV 3PM9A 5C42B 1XMBA 1CP6A 2QLXA 1R8AA 2PA3A 1SH3A 4DR7J 3LW5C 2R7RA 2KO1A 2WW8A 4G1QB 4KKOB 3BDEA 4YQWA 1G3OA 5F0WA 4BC9A 4IG0A 2VKZG 1RHUB 2OO4A 3KNGA 5DWMA 4ZCLA 1UJ4A 3I4HX 3KHHA 3PBBA 3ET6B 2AJFE 3MD3A 3CPAA 1U1LA 1O5JA 2DK2A 4UTGA 3I6PA 2BOPA 4O3RA 4NPOA 2CPFA 2CQ0A 3G8TA 3T1YJ 4LQ3A 1TMJA 3FEYB 3AXKA 4R0JA 3ZXWA 4C2YA 4ONWA 3DOKB 2KXFA 2C2OB 4DV0J 2V2ZA 2BVZA 1I1DA 4JI2F 1WEZA 3QAUA 3LP1B 4LIWA 1TP7A 5T14A 3Q8VA 4NRTA 1VK3A 5K8PA 2D1CA 5KG7A 1WHYA 3GG1A 2CF4A 3K0JA 2ZEFA 4AXJA 4B3TJ 4B9LA 1CX8A 3OSPA 2IIHA 1RT3A 4NLWA 4M5HA 3JYTB 1CEZA 3JQKA 2W24A 4NI2B 1RA6A 4URQU 2VI7A 1NH7A 4FAIA 3NCQA 1W2IA 3F0AA 4ERDA 1IGBA 1GNKA 4XAKA 2CQHA 2ARHA 1YHQS 5KG5A 2VHGA 1RLCL 9ATCB 3LD2A 4DX5A 3G96A 1SJ1A 2W1BA 2FD2A 4KKOA 4DF8A 5AG4A 1R6YA 4I67A 1OBRA 2PJ5A 4YDDB 4ZP8A 4YB5A 4WWSA 2HFNA 1B99A 2G0BA 2RHQB 2NXUA 2AFXA 3P4UB 5LRGA 1CULB 3BH7B 3CXPA 4F2SA 1PIEA 4QIVA 5KT5A 4JXQA 1AFIA 3BO2A 5FJ4A 4OJHA 4B3SF 3K57A 4DR1J 3D6MB 4MY3A 3J81Y 2DKOB 2FC9A 3BPSP 3JTKA 2OFGX 4WIIA 4C8YA 4R87A 3PYDA 2BV3A 3NE7A 3UPFA 3OL6A 4TN2A 1F60B 1XIXA 1XNQF 1ZYQA 3DHWC 1NK0A 3DLEB 5DLFA 4C4WA 1LFPA 1NDPA 2VA3A 4MTPA 2V2KA 4B9NA 4CAEA 3R1KA 4MI4A 3Q8SB 1ACMB 3TT2A 1RWUA 1CC7A 2H1YA 4TLRA 1REVB 1JKHB 5D77A 3TZYA 2Q79A 4B17A 8RUCA 1FJ7A 2HRTA 3TO9A 2B58A 2LU2A 3NXZA 2DD8S 4KHRA 3W6XA 1U6FA 1HYSA 2HFSA 3THVA 4RW8A 4ENOA 5HROB 4Y34A 2AKWB 2IDLA 2G13A 2CPDA 4QR2A 4ZOSA 2RDIA 2BSWA 3IRXA 1S5KA 2Z3KA 3TOAA 5DQIA 4A8XA 3E51A 4OIDA 3MR2A 2X7BA 1T05B 1NZ8A 2MQQA 4UOFA 4NLOA 4KOWA 3MUTP 2KJVA 3PV8A 3QAHA 1WTFA 3KLFA 1F2OA 5HJXA 2FSRA 3W9HA 3EXNA 4WTYA 1S0VA 4B11A 2VC0A 3GKRA 1AZSB 2VIHA 4ECWA 3AB2B 4JI4J 1L0CA 3DNCA 1EZZB 4NEYA 4RWXA 2XMKA 4FXWA 4FYDA 2FZCB 3K9UA 3A3OB 2VXKA 2QLWA 3CDEA 4JYWA 1D09B 1QDUB 1H2VZ 3TA2A 3I87A 1FJGJ 4ALZA 3BYRA 3NBPA 1E6VB 1XRYA 4CYUA 3RYOA 2CQ2A 1WOPA 2N82B 4CGLA 4ZI6A 2QLBB 4NGRA 1VQOS 1RCXB 2BR0A 5IQ6A 3JSRA 2IMOA 4CAVA 2YNCC 4C9DA 3RW6A 5AXMA 4C11A 3J7A1 2WZNA 4P75A 2FDNA 3OXLA 2MKSA 2W7OA 2PMHA 2HNDA 2ZEPA 4QJVA 2RKIB 3QAYA 3GR0A 3CJTA 4FD6A 2LQ9A 4DV4F 3QJLA 4PYDA 4K4TA 4NCBA 2AJQA 4RNNA 1SL1A 5K14B 1QSLA 4ZVGA 4WYLA 4O3NA 4LRAA 1ON0A 4XPDB 4LSLB 3DLLQ 2A18A 4XIUA 4U7CA 3CCLS 4JI2J 3ETOA 4F0KA 2Z8QA 2QL5B 3MR7A 3ENQA 1GEHA 4ITSA 2Y8YA 4ZP6A 1VCTA 5J2QA 4X4RA 2XEFA 2HS3A 2L9DA 3IWNC 1NKCA 2GHPA 1Z8WA 1B64A 3QJPA 4RL1A 4OYWA 3C14A 2VUGA 1WOSA 3DLKB 2VG7B 2DEJA 4ECZA 4X4VA 4OHWA 1B4SA 3G8WA 1U1QA 1DAXA 2JRSA 2N4CA 1F6TA 2O53A 1PBAA 4LBHA 1R0AA 3OW2R 2DHHA 2AD9A 4Y2CA 2FLOA 4C0OC 3UN5A 1M5KC 1HDUA 3C66A 1RXOB 1K9MT 4B3RJ 2DNMA 4RW4A 3NY0A 3A3NB 2GQ2A 5DDPC 1HBMB 3SI1A 4X65F 2P6EA 4C97A 4I7FB 4ANEA 2OMLA 5B0AA 1VQLS 1HW9A 3VAJA 1TL1A 1YK9A 2F63A 3EWGA 3C15A 1XQIA 1TL3A 4X66J 2QG9B 2RNEA 1KQGB 1H6KX 1AROP 2IAJB 1XN9A 5BWAB 1S60A 2B5GB 3BR8A 4UEEA 4A8MP 2AEMA 2E1MC 2ZD1B 3H5YA 1S9GA 4FXVA 4NASA 3CSKA 3PJ9A 3W64A 5E96A 3V2UC 1FT8A 5L1JA 1X31C 1HEEA 8ATCB 4DCJB 5F41A 1U2FA 5HVGA 2XO6A 3PEIA 4H4OB 3DRSA 2AJ1A 4OMFG 3PR5B 4F8ZA 2F9JA 3GFXA 4ZDNA 3DSBA 2CTCA 4NA2A 3LOUA 1NK9A 5JM6A 3GYGA 4DR3J 2FXFA 1FRJA 4DUTA 1PCAA 4Z65A 5AJ3J 1K1QA 2RQMA 4BWJA 4PXCA 3RRKA 5BYSA 1SIZA 4DPUA 4QWAA 3TQ1A 3WT4A 4M6HA 2H5EA 1CJTB 2VDHA 1CJKA 1UP1A 1BQNB 3RJMB 1RGVA 2DGSA 4R0EA 1JLBB 4X4SA 1KKHA 3GIRA 4PUOA 3CE8A 3OTCA 2VQFF 3GU0A 4ONUA 2GW8A 4XPLA 4USUA 3GUXA 3KXDA 2U2FA 3SQGB 1N6QB 4MBUA 4ANCA 2CXEA 4U7UK 2MQOA 4Q8EA 4WBFA 4HI1A 1YKWA 1EETB 4JI0J 2DR8A 4UW2A 2DRBA 2WOMA 5CABA 2JEFA 4MJ8A 4FF2A 4HDGA 1F2HA 2DHSA 4YWYA