3TX8A

Crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
360
structure length
360
Chain Sequence
b'DLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNVLARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLATSTELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLRIKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGVANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQVTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVAAILKQYLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate desuccinylase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Hydrolase
total genus 92
structure length 360
sequence length 360
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tx8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3tx8A01
3LWUA 2ZEOA 3VATA 3CDXA 2ABZA 4A94A 4PQAA 2JEWA 2PJ7A 2PJAA 3V7ZA 2F8HA 4Z65A 2GLFA 2CTCA 4OIDA 2AFMA 1YW6A 2V8GA 1AMPA 3WABA 2BCOA 4ZY0A 3SJXA 4A38A 4R76A 4UIBA 4ZY2A 3KHXA 2VL1A 3NA6A 3RZAA 4MHPA 3FEEA 3TX8A 3B7IA 3VH9A 2WYRA 2OOTA 3GUXA 3FMCA 4FAIA 3TC8A 4ZY1A 4GM5A 2BOAA 3IJ3A 3B2YA 4A39A 3B3TA 4BD9A 4ZX9A 5LYIA 1FT7A 4P4DA 4B6ZA 4Q7AA 2PJ8A 3PEIA 4NGTA 3K9TA 3FVLA 4PPZA 3VARA 1Y7EA 4DJLA 2CF4A 4LQGA 1PYTB 2J9AA 3PBBA 3ISZA 2ZOGA 3I1UA 4P45A 2RFHA 4NGRA 4OMEA 4O23A 4OKOA 4MCQA 2ZEGA 4P6YA 3FJUA 1DE4C 1VIXA 1PCAA 4FUUA 2FVGA 1TF9A 2POKA 1F57A 1IY7A 1OBRA 4IAVA 1HDUA 3KR4A 4MHNA 3D66A 3D67A 1NSAA 3PB8X 1BPNA 2V8DA 3BXMA 3FF3A 5ELYA 1YMEA 3ISXA 2PVVA 4NGNA 1Z5RA 3KASA 5LYFA 1Z2LA 4R7MA 4JYWA 4H2KA 4CPAA 2ANPA 2ZEPA 4K3NA 2PIZA 1H8LA 2AFUA 1CPSA 3WT4A 1CPXA 1Q7LA 3D4UA 4OC5A 3PB7X 1EE3P 1CBXA 2QYVA 1R3NA 3KQXA 4ONWA 2CIJA 4P4JA 3PBEA 2GU2A 2PRQA 1CP6A 3FEDA 2AFOA 4X3RA 3NH8A 2PJ0A 4F9VA 4PXCA 5J1QA 5K8MA 2AFWA 3SJGA 1YLOA 1YSJA 3S9MA 3B3CA 4P44A 2PE3A 3PB9X 3N5FA 3BHXA 4JZ0A 2CTBA 2ZEDA 1CP7A 3LMSA 4UEZA 5D29A 2PJ1A 2QVPA 1IGBA 1FNOA 4NGMA 4WWVA 1VGYA 3NFZA 2RB7A 2Q4ZA 3PB6X 3FX6A 3KL9A 3PRTA 2XEFA 4ZI6A 1TKJA 3DLJA 3NH4A 1YW4A 3GB0A 4OC4A 4X2TA 2PJBA 3V38A 4IHMA 4OIWA 1LFWA 3KI9A 3WC7A 5LRKA 3H8GA 1ZG9A 3CPXA 2C6GA 2AFSA 3MRUA 4MCRA 3SI2A 5LRJA 2PCUA 1ARLA 4KSIA 1TF8A 4OP4A 2JBJA 1VHOA 2XEJA 4OC0A 4MHZA 1KWMA 1RTQA 5F09A 2EK9A 1DTDA 1Y0YA 4EWTA 2Q51A 4YWYA 3HUVA 3H8EA 4W9YA 3BI0A 1XBUA 5I4MA 5HVHA 2PJCA 3QNVA 2EWBA 2O4HA 2PJ9A 4ZYQA 4P4EA 1TKHA 3RBUA 1LANA 3FECA 1LAMA 3MN8A 3IFEA 3NH5A 5IB9A 3D68A 2IMOA 1R43A 2C6CA 3PFEA 1XJOA 3WC5A 2IQ6A 5THWA 2V77A 3IWWA 3DGVA 5DS0A 4RUHA 2XEIA 4X8IA 4P4FA 4IK2A 3SJEA 2ZEEA 2EK8A 1Z8LA 8CPAA 7CPAA 2XEGA 5LYDA 5HVGA 2ZOFA 4G1PA 1VHEA 4F9UA 1JQGA 2DEAA 4MCSA 4NGQA 3PB4X 1QQ9A 2BO9A 2Q43A 1ELLP 3CT9A 5K8OA 1LOKA 4FBEA 2C6PA 3KGQA 5CPAA 4PXEA 1BAVA 4ZX8A 3FH4A 3IC1A 1Y0RA 1BLLE 1ZLIA 4R6TA 3IIBA 4EFDA 4OC3A 2WZNA 1HDQA 2AFXA 2OR4A 4PXBA 1LCPA 4DYOA 2GLJA 4UF4A 4YU9A 2PJ2A 3H8FA 2PVWA 3D7GA 1BPMA 4NGSA 3SJFA 4TNUA 1CG2A 1TXRA 4MXUA 3D7FA 2F7VA 4OC2A 5JM6A 3BI1A 3L2NA 5K8NA 3KQZA 4F8ZA 1QMUA 4NJRA 1XMBA 2ZEMA 2V8VA 4P10A 3S9LA 4A37A 4TWEA 1ZLHA 5HVFA 1TKFA 4MRIA 4NGPA 4P4IA 2PJ4A 3B3SA 1ZG8A 3SI1A 1LAPA 2AFZA 2O53A 4AXVA 3K2KA 1HEEA 2IJZA 3GLJA 4DUKA 4MCPA 2PJ5A 3IEHA 2V8HA 2ZEHA 3KHZA 2GREA 3B35A 1M4LA 1F2PA 1XRYA 1CX8A 2PJ6A 2C1CA 5JGFA 2HC9A 3KR5A 5K8PA 4UEFA 2QJ8A 2ZELA 5LRGA 1ZG7A 3S9NA 4MHYA 4MMOA 3IO1A 3SI0A 3JRUA 5HXDA 2G9DA 1F2OA 1ARMA 5LYLA 5JH9A 4PXDA 2NYQA 3T8WA 4WJBA 3RAMA 2PIYA 2HB6A 1AYEA 3CPAA 4P4BA 3WC6A 5D8NA 4FWUA 2JBKA 3KZWA 3HLPA 3PFOA 3D7DA 4OC1A 4UEEA 6CPAA 3B3VA 2I3CA 4NJQA 1ELMP 1XFOA 2PJ3A 3D7HA 1GYTA 2ZENA 4NFRA 3B3WA 4R8FA 4UIAA 2ZEFA 1UWYA 5CBMA 2NSMA 4EMEA
chains in the Genus database with same CATH superfamily
4KGMA 4ALZA 4M6HA 4IDKB 3V6DA 1RT4B 4A94A 1R0BG 2CRLA 3HO1A 1VQLS 4L72B 5E0OA 2QMWA 1OPZA 1DTTB 1B4SA 2VPYB 3AJ1A 2Z3KA 3TJ8A 2P6FA 2F4VF 1X4FA 3POTB 4ZVTB 1HFEL 1JJCB 3GYNA 4UIBA 3KHXA 2DITA 3K5MA 1K1QA 1U09A 1HNXF 2VA3A 4QC6A 2HZCA 1S6QB 4F04B 2ALZA 4QUSA 1PYTA 2OMOA 3TAMA 2C28A 3BQ0A 3RW7A 4X65F 1YG0A 3LALA 2EBGA 4K2XA 1VQ8S 3FDSA 4Y34A 4M5JA 3K9TA 3OLAA 2XYGB 2UXDF 2E1PA 3DSBA 2RHQB 3FGVA 3OR1A 1MSWD 1LKZA 4XPEA 4CLUA 2BJEA 3UWTA 5KFIA 4QU6A 2XY7A 4IFYA 3PDNA 5CYJA 1AFJA 1URRA 2K1RB 2P9GA 1KQKA 3X3UA 4PPDA 4C0BA 3CGIA 2DGTA 1FFGB 1KD1T 4IYQA 1FDAA 1Z2LA 3GYGA 3CCWA 3CJ0A 2XS5A 2R2RA 2ZEPA 1JIHA 5KTQA 2V2ZA 3HP6A 3VGUA 2ZITA 4QBUA 1UETA 4RKUC 3MM6A 2V4JB 4K8RA 1YX0A 1Q95G 1N5YA 1EJ7L 1T02A 5CAAA 1W2BR 3VVTA 2IY5B 2W24A 5F8IA 3UR3C 1CP6A 1X4DA 3KNGA 2QN6B 1RB0A 4LFAF 3HI9A 3GIKA 5B0CA 4XPDB 1RT5A 3SCJE 3MAAB 2AFWA 4DUZJ 3PTWA 3RBXA 2NUHA 2VDHA 1AROP 3V4IB 1Y11A 2CQCA 3CZXA 4R8UB 5L39A 1CPZA 4ZOSA 4V1Ak 3NFZA 2HWHA 4JI5F 4HTJA 5F9LA 3TTHA 1OMSA 1ZS6A 4X2BA 1ULRA 4P71A 1LWCA 3L7UA 4FF1A 1UEVA 3I5BA 3MRUA 2KXFA 2MKCA 5L1IA 2NMTA 4CLYA 4QYZJ 1S72S 2W25A 2HUZA 4J37A 4MHZA 1XR7A 3QZ7A 3MM8A 1QDUB 1CSJA 3V2UC 4ED3A 5EC4A 3SCLE 2PJ9A 5KFCA 4OI4A 1NPRA 1FJEB 1LANA 3MN8A 4TYAA 2HRUA 4ZJQA 4B10A 1UJ5A 4ILLA 2OPQA 3BYPA 5G1ZA 1YRTA 3M32B 3CEDA 4AL5A 3NGUA 2L48A 1QE1A 4AB7A 2AJ0A 1UVJA 2YNGB 3QT5A 3UNYA 4NEXA 4DV2J 3UY5A 4NLVA 2CAJA 2IC3B 3M9NB 2HAIA 1KLMA 4A8OA 2WSCC 3DN9A 2AEFA 5K8OA 4KGKA 1VIOA 4ZPDA 3KYLA 4QIEA 4TKTA 4CWBA 1VYAA 1WC0A 3CJSA 1Z4RA 2GHPA 5C25A 3DOLA 2FIWA 4DYOA 4ZCKA 2EFGA 1FFSB 4UZBA 1QSRA 1LWFA 3IP0A 1CJTA 3K2YA 4USVA 4WFXA 3H0PA 4UZCA 5EN1A 3QPIA 3KLHB 4JI7F 3QZ8A 3SJFA 1IBKF 3TARA 4DUYF 4IRDA 4C8KA 2WPXA 1S9GA 1IQZA 2O28A 4YRHA 1IBLF 3OTOF 2V5HG 5HVFA 4C97A 4MRIA 4LF5F 5HI7A 4ED6A 2CXAA 2H5EA 1UKUA 5E3PA 2W2MP 3TYTA 2QIFA 2PJ4A 5DZ6A 1LAPA 4CRZB 3EWGA 3O5TB 3RB0A 2QJ3A 2PJ5A 4MK7A 2D74B 4AQYJ 1D09B 4EFAC 4CLTA 1GXTA 2VA2A 1HWUA 2GQQA 1JB0C 3HM9A 4ANCA 1B3TA 4WTYA 4GKJJ 2DIUA 3KR5A 2Y3YA 2ILYA 1ZG7A 1RWWB 4FN5A 5DDRC 4AVBA 3H4DA 1RA7A 1RT1B 4PG5A 3AJDA 2WVFA 1URNA 1HNZJ 3CD5A 1YK3A 2CFXA 1RBAA 3SFGA 1RABB 4WTOB 2W9CA 3Q8PB 1N34F 1IBCB 2HNZB 1V3RA 3MZIA 3M8ZA 3W5YA 3D0GE 3DLHA 3HHNB 2AYEA 1O6XA 1D9DA 3IGVA 4IOCQ 1IN0A 4V19J 3JYTA 2BEFA 3CMES 3P6YC 4C68A 4K4WA 4O44B 5F48A 2JEWA 2Z2YB 1YVKA 3MUVP 3UE2A 3NCPA 4I2PA 2D69A 1H3DA 3TA1A 3GIUA 4KV8B 3D2MA 5AXMA 3C66A 2WVDA 1B0PA 2ZH9A 1HD1A 3R1HA 1Q5YA 4ZY0A 2FVQA 5KFQA 2GHVC 3ET6A 2ARHA 3MGJA 1U4BA 4LFBF 2CJ9A 4C7QA 3HHEA 3FEEA 4Y6IA 3VH9A 2JVOA 2NR0A 3EM1A 3GJQB 4U96A 2CJKA 3Q8UA 3IWNC 3BSAA 3G71S 4RJVA 2KYXA 1DJ0A 5LYIA 4DV3F 1NO8A 4DR3F 2YVSA 4HHHA 4JV0A 4JV5F 1F3FA 4AG7A 2XMVA 4MKYA 1SJ4P 5LL6d 3R9EA 3CULA 5AXNA 3NMRA 4L74A 4I1TA 2DBBA 4FF2A 3Q86A 1PCAA 5H86A 2CNNB 4IAVA 5CYMA 1MROB 3ENAA 4NA2A 5DLFA 2M70A 4DU7A 2QC3A 2RRAA 2M8HA 2H4WB 3ISXA 5LSLA 2AU0A 3M1VA 3NL0A 4HI1A 1YLEA 1QAXA 4LF7J 4HH0A 2VJVA 4PZVA 4X4UA 2PIZA 4ZCMA 4NX9A 2RF2A 3PB7X 1PJ6A 3MOJB 3CJTA 3HZGA 3SCIE 2HFVA 4O4GA 4WZMA 4NXMJ 4G1QA 4USTA 4R5PB 2YNCC 1S59A 2Z58B 1YITS 3NH8A 3TQEA 1Y3KA 1S57A 4EI2A 4K5RA 2PO4A 1Q86T 4PWWA 4KUAA 2OHDA 3C16B 3I0SB 4P44A 2CTBA 5F46A 2ZEDA 1HBMA 1OY6A 3I5CA 3KDOA 4Y3CA 1CEZA 1JLCA 4WWVA 1FNOA 4PABA 2DYAA 4LRBA 3P2FA 1ZAXA 3ZXWA 3KL9A 1FNMA 3M4XA 4CYQA 1ZTWA 1FJ7A 4QW8A 2N3LA 2HHHF 3DOMA 3FMWA 3PEHA 4CNYA 3Q24A 1S5ZA 2WCXA 5FVJA 3MUMP 2PCUA 4OP4A 1QSOA 3W9JA 4IRKA 1U0HB 3CCTA 3A13A 1YRUA 3FZBA 2VBXA 2ZWPA 2OJ3A 4ZPVR 4HNYB 5DZ7A 3CDWA 3FECA 2RUSA 4H54A 5I42A 3VGSA 4WP3A 1S99A 2IIHA 1DBDA 1FRIA 3H2LA 1WG5A 5HQLA 3CC7S 1N6QA 2V77A 1KP6A 2R3VA 2W1BA 3QGPA 1TR0A 4OZ2A 1IWAA 4XDDA 2VG5B 7CPAA 4UCNA 1DAXA 2MDAA 1U1NA 3JSYA 2GGPB 4M8LA 2DB1A 3EDQB 1SJRA 2E7XA 2MZJA 5E3RA 3O8WA 2FJXA 2DNMA 1NB2A 1N52B 4IFVA 2WBRA 1BAVA 2EKNA 4PAAA 4W98A 1RAAB 2LA4A 3QJPA 2Y8YA 4DQQA 5DDOC 2W7PA 3U1NA 3FBEA 1J5EF 5HJYA 2EK6A 1U1LA 1HI0P 2JZ5A 2OGUA 4TNUA 1N32F 4C3KA 2HBQB 2XULA 4P2FA 3PW7A 2M88A 3P45B 1S60A 1Q7YT 5ETVA 4KHMA 4ECWA 3SQOP 3L7PA 1DQAA 3NS6A 5D78A 1TL7B 1GT8A 1VS3A 3G6VA 3B3SA 3T6JA 3MM5A 4LIWA 2HBZB 5D3GB 3K2KA 3W60A 1HEEA 3DM2A 5HMZA 1NB7A 5AT1B 2PC1A 2ZEHA 3TZWA 1I6JA 2W9AA 4H4KA 4IH6A 5SUHA 3QATA 3TOQA 3G6XA 1VHIA 2PJ6A 4ED4A 1P9QC 1RWVB 1VJWA 5CCMA 2GW8A 2M0GB 3T1YF 1ZM3A 4OHWA 2V9WA 4PK3A 3THVA 2EI5A 2UVVA 3JRUA 1HNVB 2Z3NA 1WUUA 1VKCA 2CPIA 3C6TA 1S1UA 2VPXB 5CCLA 2KJWA 4JI3F 4OYZA 2DH9A 5G22A 2R8KA 2JBKA 2I3CA 3W63A 2XQCA 2LA6A 2JJ4D 1FJGF 3AHPA 1UWYA 2AJFE 4K0KF 4MY3A 5B0GA 2YX4A 5E3QA 1U02A 2VXKA 1U0SA 1U7LA 1W25A 4F6AA 2L08A 3NMAA 1YX2A 3I5AA 2BE7D 1H6KX 1FKOA 2B5JB 1U1QA 3RYOA 4Y2KA 2V4RA 3SJXA 3GFZA 3RB4A 2VL1A 3CMAS 2X7BA 1M1DA 1HL6A 2U2FA 2YNHA 4DG1B 3UQSA 1T05A 1D9FA 3M2RB 4ZY1A 5GMDA 4OI0A 3AH6A 3HVWA 2R2SA 2F4FA 3J7YI 3SEOA 2PJ8A 3PEIA 4CDIA 4M5DB 4J9MA 4GKJF 2WSAA 4K4SA 4AXIA 2XB2D 3ILLA 1ZPVA 2B43A 3K89A 1TQLA 3H40A 1S0MA 3ISZA 3CCSS 2LQ8A 3CNQP 1KVKA 1RT3B 2BXJA 1HNZF 4CAFA 4P6YA 2NXEA 5GAHU 2FVGA 2ACYA 4II9A 1GMWA 1IY7A 2YKPA 1Q2CA 1RDRA 1R0CB 1LV5A 4JI2J 3CCZA 3RU0A 2V8DA 2ZHOA 3HVTB 2JFKA 1RTIA 2GC8A 4DFKA 3QYYA 1CS4A 2SXLA 4WFAQ 4EK2A 1CC7A 4JYWA 2YKNB 3LP1B 3DGPB 2OTJS 2DVIA 4F3QA 4RBUA 2KG0A 3I56S 1V3SA 3OL8A 4NXNF 2HZVA 3TUJC 4KLVA 4AL7A 4M5GA 3AJ2A 4DL4A 4EO6A 3CE8A 3TEHB 1X7VA 3IU1A 2HFUA 2U1AA 2DNYA 1FHTA 1AUDA 3W62A 2J7WA 3CWJA 3SXOA 1HA1A 4CO2A 5H9FK 1YLOA 2NXUA 2J8MA 1RQ0A 1RT2A 2PE3A 1IR1A 3DRSB 2HQIA 4CM2A 4RO0A 4RX6A 2Z0ZA 2FHJD 1X9WA 4FD4A 5IV4A 5D4NA 2RB7A 3HHKA 1RTDA 4Q8FA 3A9LA 4HKFA 1P1LA 4DV5J 3L09A 2CNOB 4OC4A 1KRPA 4ECTA 4DPOA 5AXKA 3SI2A 3PJWA 2VG6B 3O1LA 4P6QA 4C0HA 1S76D 2WOMB 2GIRA 1K4JA 4ANDA 3PXGa 1R7IA 2XLIA 2VKRA 1FESA 1VFJA 3HLUA 1D8ZA 2Z57B 1RTJA 2D7SA 2RHSB 3I9V9 1V5VA 5A0YA 1XJOA 3EZOA 3W5ZA 1A0OB 5L8RC 4LF7F 1XNQF 4IR1A 3R96A 1REVB 2W8KA 1T9WA 4NLOA 3EVWA 2YTCA 5D4PA 2OZUA 3TAQA 1GXUA 2EFPA 2GVDA 4TYBA 1QVFR 1MW7A 5CQGA 2PR1A 1OYEA 4WFNQ 2OPSB 3DLKB 1E6VA 1PUAA 1MN7A 1M5SA 4ZGYB 2GO8A 2IFXA 4WCEQ 5CPAA 2CQDA 3M30A 2Q3PA 1Y0RA 3W7BA 3FMBA 4M6IA 4X4VA 3DFEA 4CLSA 4MFLA 3CW2C 1JJ2R 5GMEA 4YU9A 3LAMA 3DRYA 4I69A 2V34A 1BXNA 2UUTA 3CF5Q 2BYCA 4MAKA 4LRCA 5E41A 5DLGA 4ECQA 2DHAA 1BQXA 1UTAA 1K9MT 1NCLA 4ZJOA 3GFYA 4NCGA 3C19A 2GA7A 2MTLA 2C3MA 3PRBA 5DO2A 2OPPA 4B02A 4L73A 1KDNA 1Z8TA 3CJKA 3DLGA 3N79A 1SKSA 2LXFA 6AT1B 2UXBF 3LP0B 3QIDA 1Z8WA 4R3KA 4NLRA 4L3NA 3A12A 1FX4A 2UUAJ 4P72A 2PMHA 1YBAA 1H2TZ 1IKYB 3T5LA 3R97A 3M8RA 3B35A 4QOTA 2QLXA 3ILOA 2FZKB 4TLQA 2RT3A 2NXNA 4FYDA 4B3SF 5AG6A 1C4CA 5C24A 4DPXA 1SXLA 3FCHA 5L1JA 1S0NA 3FZ2A 3NG8A 5IFMA 3R9LA 3DI6B 4H4OB 2ZJQQ 5C88A 2Z56B 1XC9A 4PR6A 1S97A 1Q2YA 3MR7A 3AOBA 5JPHA 1WI6A 1MLAA 5HL7Q 3FEZA 3ZO7A 3ZZIA 1MU2B 3GFHA 3WC6A 4LF2A 4YHHJ 5KFHA 3PFOA 3D7DA 3R2DJ 3BEGB 4WZQA 1C1CB 3G86A 5KG7A 1T0TV 3KHRA 3H59A 1SJQA 2ZHBA 3BGRB 3ZZRA 3W2WB 4TU9A 3BBCA 4RW7B 4DV4F 4CRYB 3VAJA 2VONA 2R7XA 3POTA 4JJXA 2E7WA 1WKKA 1PJ5A 1J5OB 2GQ2A 2W8LA 5HROA 3RR8A 4B3RF 4OIDA 1RT6B 4B5PB 2RVJA 3DRPA 1TTHB 2JWNA 4A38A 2HFOA 4WP8A 3L95X 1QM9A 2WONA 3TX8A 1RCOB 4N5SA 1WF1A 4IF5A 4NASA 1RWKB 3FMCA 2JLGA 1G3OA 4FPIA 1N8RT 2QECA 3TO8A 5A28A 4HT5A 4CLLA 3GFXA 1FK9B 2CNTA 1JLEA 2B4PA 3ITHB 1NSLA 2G2OA 5KFLA 2ASLA 4K4VA 1Y7EA 4I7FA 4N7TA 2OFHX 1IKVA 1HIYA 3CC4S 3I1UA 2LQBA 2E5GA 1UCNA 1B87A 1B64A 3BGFA 2B58A 1MK4A 2QSFA 1Y10A 1BUXA 4R57A 2FHKA 1XK8A 5KG5A 3MI7X 3QAEA 1SI9A 3MM9B 2EUIA 2Y9HA 3C14B 1SC4B 2ZH5A 4A48A 3OL9A 1YJ9S 2O3DA 3MECA 5E96A 1C1BA 3VV2B 1ROFA 2J7KA 1HBOA 4NWBA 2ILZA 3QNWB 1T94A 2LECA 1X12A 2IYIA 1WHVA 4C2ZA 4ZDNA 2DNKA 4KC5A 3OXGA 3HDSA 1MWYA 4PUOA 2EO8A 3MDFA 4R0JA 1IKWB 4DN0A 3W66A 1OY8A 4Q0BA 2GU2A 2PRQA 4DL0C 4AVAA 1VRQC 1XOVA 4AL6A 4R8UA 2PJ0A 1DZ5A 2DEJA 5K8MA 5KT3A 4ED8A 4JI0J 4DV1J 4QBJA 3MEGB 3PB9X 4ICLB 4MKBA 2IDEA 5IV3A 2J9EA 1Q5VA 2PJ1A 3NGRA 1VGYA 2Q4ZA 2UUBJ 1S1VB 1Y9KA 4MFKA 1X5PA 2IJFA 4X2TA 3BO2A 1V6HA 2L41A 4LX9A 1S6PA 5HLFB 2XEJA 4A31A 1KWMA 3IM8A 4K50A 2WZ1A 4DF8A 4LF8F 1NAQA 1GX6A 4W9YA 3R5DA 1YIJS 2B5GA 3FSIA 4NI2B 5IB9A 1Q78A 2OO4A 2DGVA 4Z7YA 2XG8A 3ZZPA 2HQFA 3KKFA 3PFEA 1SQEA 4NRTA 2DNPA 1S6OA 3FBBA 4J3GA 2DD8S 3T41A 3K7RA 3QGHA 4RS2A 1UEUA 3QRRA 1E6YB 1BMQB 1RBOB 4U8VA 4H6UA 3F73A 1Q0NA 3V5RA 1Z8LA 4N47A 4LT6A 2ZOMA 2DGUA 3ETOA 3ZTSA 2H5MA 1T9TA 4ZP6A 2ZOFA 4JI4J 2IVFB 4R0EA 3TJAA 5A2QU 3KG4A 2JRSA 1VBYA 5GAGU 3I0RB 2BJ3A 2AGQA 2MYFA 4LSNB 1KTQA 3N01A 1NZAA 1BQMB 2GVZB 5KFWA 1WEZA 3P5TL 1IVZA 1LXJA 2WVEA 3V6DB 5JVGQ 2BRKA 3ZZUA 3MEEB 2V8VA 1X4CA 1YLXA 5KG4A 1MJ9A 5KFDA 3SZ2A 5ETPA 2C2KB 2IJZA 1MJAA 3A3NB 4RW8A 4F3MA 1NRKA 1DQ9A 4NA1A 4FD5A 3JXOA 2CA9A 3O3LA 4UOCA 2H65B 3BQ1A 2ZH4A 4RNFA 3H8YA 5CXTA 2KVQE 3TAMB 2Q44A 3R5AA 4PG7A 5HATA 4KOVA 2HNZA 4MHYA 1U2CA 1KHWA 1Q8IA 3OFEA 2DIVA 2HHPA 5HXDA 2VPZB 3IR6B 3OR1B 2ZEJA 4OFZA 4XNHB 2F3JA 3E3XA 2MQNA 3NNHA 4KHPJ 4JP8A 4ELTA 3R8YA 4IFYB 4FF4A 4OHYA 4L76A 4UEEA 3T1HJ 3AODA 1WTBA 2PJ3A 4A30A 1Y9OA 2ZENA 2PFDA 1XERA 3UW1A 3BO3A 3HKWA 2ZW5A 1TAQA 2GHWA 1FX2A 1H73A 2ABZA 1WI8A 4ZK7M 1V3ZA 4DLGA 3ZZTA 2Q7SA 3T9YA 2O67A 4X4SA 1Y3JA 4M5MA 3R27A 3JTKA 1WHWA 3QSIA 2W01A 3MM6B 4ECZA 4BWJA 2AFMA 4DQIA 2MY8A 3OBIA 3WABA 1DARA 5IT4A 1OSDA 3CMQA 1L3UA 4JLYA 2FD2A 2FVSA 2PSWA 3OW2R 5HMWA 3D7SB 2J8SA 3MCMA 4ZLLA 2JLMA 2J7UA 5BYSA 3CO0P 1RT5B 3IJ3A 2BW2A 1RADB 3B2YA 2BM1A 4C2YA 2AX0A 3P4UB 4O3NA 3FVLA 4QWAA 2AW0A 1DHMA 2F1FA 4QWBA 5J2QA 1NSKL 2G0JA 1N0UA 4UCPA 3PX0A 2XZDB 4DL2A 3MMCA 4OZ1A 2Z8QA 2PDOA 3EFAA 4ED5A 2XSFA 1RACB 1LWCB 3VQTA 3IA0A 4K5SA 4C8NA 2HHSA 2VODA 3D67A 1CJWA 3TAPA 2C2DA 3MM8B 5GVQA 4MHDA 3BH7B 4N76A 4YDXA 4RW4A 3D3BJ 2DY9A 2VQFF 2NXJA 1P27B 1Y9WA 4USUA 1VC0A 2VFVA 4C2MA 2FGCA 3PJXA 2XM3A 1XF8A 2VKZG 1CPSA 4U9ZA 4AUKA 3ETMA 2XLJA 1HYSA 3TNVA 1QE1B 2G2YA 2QYVA 2YQ3A 5F8MA 1HR0J 4EU0A 2HQYA 2UU9J 2HHUA 2PC6A 2Z3OA 1RHQB 5L9NA 5E5NA 4LUBA 3BQ2A 1TELA 3B3CA 4RNHA 1SH0A 5LSOA 2F65A 1CP7A 2GCFA 5D29A 3DOLB 1N4LA 1NK8A 1LWFB 1WF2A 1CJTB 4YB6A 2IHR1 1VR6A 1PJ7A 3AXMA 4L8AA 4EMDA 3IWXA 1BQNA 1MMDA 4NSQA 4NLYA 1U25A 1S9GB 3PYEA 4KSFA 4CGMA 2HHQA 1TL1A 3KK3A 3M9MB 4DR5J 3P8BB 2UZAA 2EKYA 4F26A 3NOCA 2FJVA 2B8PA 3QRPA 4KUBA 3F5BA 2DPSA 3QAHA 5D77A 5C42A 4J9VA 1NM2A 2MEWA 4ID8A 4F0HA 1R43A 2M3DA 4LBPA 4NOHA 3JSMA 2DTJA 2J6UA 3THTA 4NL5A 5THWA 4WKRA 1CLFA 2G4BA 1RTHA 4LBIA 3TWZA 1SIWB 4RUHA 1BHNA 4YB1P 2YGWA 5GADU 4H4KC 1RA6A 2JL9A 3GKRA 3LWMA 4OJ3A 3B54A 1N33J 5E3CA 4HKQA 4OX8A 2QT7A 2ZW4A 2PE8A 4PWDB 1QTMA 2DK2A 2HQ3A 2KXHA 5LXYA 3MTJA 1HQEA 1LK7A 1TMJA 1YVOA 4O3OA 4J9RA 2W9CB 3AA8A 3FH4A 3BGUA 3GSIA 4RUAA 1ZLIA 1XR6A 2QMUB 5BYRA 4RL1A 4OLPA 3WDOA 4NXYA 3DR6A 3EUNA 3H8FA 3D3CJ 3JYTB 1YGYA 3MEDB 2E44A 1LW2A 4PYAA 3KHLA 2QL5B 5D0GA 4DQSA 1VLYA 3QIPA 4MXUA 2Z0GA 5B0FA 2LQJA 2Z10A 3BI1A 2AV5A 3DLEA 4I2PB 1TKZA 5BXIA 1BWEA 2R1IA 3LPEA 4DZ6A 2ZH2A 2YH0A 3C15A 2NXCA 5KFFA 3TFYA 1EETA 3SI1A 2BW7A 4CYOA 3FJ2A 1N36J 3HVAA 1Z4EA 3KHZA 1NNDA 5IWAJ 5KFSA 2A1BA 2CJQA 5T7LA 2X1BA 3IR5B 1P9YA 2AGOA 5K14A 2OD4A 1JLQA 1HMVB 3FBFA 5CA5A 1VISA 4DR2F 5AE3A 2FE7A 2G3TA 3WR7A 5EDWA 3IO1A 2Q1LA 1N5VA 3UDVA 4F2SA 2Q6CA 2DT9A 2FJDB 4DSFA 1ZYQA 2H1YA 2VOPA 2BE2A 2C2ZB 3HHLA 1N88A 5D0HA 3VAGA 3H5YA 3C6UA 3AD9C 4OX9F 5F8JA 3R5BA 2W2NP 3ZTOA 3DRXA 2VBZA 1BOBA 3JS9A 5CYMB 2QLFB 3CCLS 3B3WA 1FI4A 4FF3A 1C0TA 4IG0A 4WU2A 2GNKA 3HJVA 3EVMA 1XTZA 2W4PA 1FWLA 2OKQA 3CDXA 1BD6A 3M1VB 4MK9A 4X4NA 3EY5A 1AXQA 1A9NB 3GCXP 2BMBA 2GLFA 5H1SV 5KFJA 3E01A 3PR5B 4NCZA 1YR0A 1RAJA 3D0IE 1ZM9A 2RF2B 5HAOA 2V8GA 4I64A 5EMIA 2FGOA 5HMXA 4R3LA 4O4GB 1K73T 2OIHA 1FERA 1PYOB 4G1QB 1F3VA 1ZPWX 4X4TA 4KY3A 2J0SD 1TV6A 1TU0B 2ZH7A 2B3TB 2CQ4A 3DMJA 3K5OA 3IR7B 3TVZA 3EGVA 1JXEA 3W1YC 4XAKA 2DHGA 2XHCA 4DJLA 4IQXA 2FB0A 1AUSL 4B17A 1J27A 4WKYA 4P73A 3GJRB 3TJ9A 5HQMA 5LMNF 3AAWB 4NGRA 3KTQA 3PX4A 3SYZA 1GTHA 2IA6A 3ICLA 4NYOA 4WK3A 3DOMB 4DEZA 1U1KA 1VIXA 2VFSA 4OJ1A 4KHPF 2IM3A 2PA8D 2ATCB 2JC1A 1Y5LB 1YJUA 3UN5A 3R1LA 2XI2A 1BPNA 3AB4B 3BXMA 1SH3A 4FPRA 5RUBA 2DNGA 2WVCA 2UUCJ 2KG1A 3LP2A 2MQ8A 3KASA 3CDUA 4F0XA 5LYFA 1FDDA 5AE2A 1UPPA 2NCKL 3OVAA 4Y2AA 1LW0B 2B4UA 1GK8A 2A10A 4FXDA 2AFUA 3KWMA 4DX7A 4KKOA 4X62F 1N6QB 1Q7LA 3TUPA 4OV1A 4DR6J 1WC5A 2CDRB 2V63A 4OI6A 2IPOB 3CDAA 3BSOA 3BM7A 3IBWA 4M5IA 3GR0A 2R7SA 4RI1A 1BGXT 4JB8B 3W8GA 2YNDA 3DNSA 1YSJA 4IFVB 3MPUB 4DN9A 1NEEA 1NMTA 4P2SA 1HWIA 3PW4A 1ZZFA 1WKJA 5FD1A 1H74A 2VG6A 4B9SA 2HZAA 1W2IA 2D41A 1IXKA 2WOMA 4TU8A 2DY1A 3Q8YA 2DGSA 1ZG9A 1TK5A 1HNXJ 4YR0A 3VZIA 1RTQA 4X64F 1DTDA 3KUGA 2VIHA 3WC0A 1RO5A 2WBMA 3VF0B 4CO4A 2Y0BB 4PSXA 2O4HA 3LOUA 2CWXA 4X65J 3MM5B 1REVA 3CTRA 3DM2B 1PYSB 5ETLA 2EVNA 2XMTA 2HGNA 2MKKA 2UXDJ 4LF4J 2I6WA 4M5KA 4B11A 2FHOB 4ZVHA 4DNCA 5KFEA 3TVKA 4KOWA 4ECYA 1RWMB 3OSNA 2QMXA 2VD3A 3IS9A 2OPSA 1VQPS 2CQHA 3TZZA 5U47A 1VJQA 4OHZA 2IM2A 4USHA 2MKSA 2DNZA 2XMMA 3C6TB 1S1UB 1GTEA 4FBEA 2LKZA 2XC9A 2CPZA 2C6PA 2CPJA 4IQMA 3S6GA 2Q4VA 3GILA 3R5CA 1CJKA 1TL3A 4ILMA 1RWPB 1TKTA 1DTQA 1LEOA 3A3PB 2PJ2A 5DG8A 2ZBIA 1XMOF 5ETRA 4E2AA 1FXDA 2Z2MA 3NY0A 3NNAA 2ZH6A 5JQ4A 2W7OA 4DV6F 2XMKA 4NLPA 5HMNA 2RRNA 3M7VA 4CAWA 4DL3A 9ATCB 4F8ZA 3DRRA 1GMWD 1XMBA 4LFAJ 4ENOA 4JI8J 2IRUA 1YDLA 1FKOB 1HWKA 2XLKA 3DU5A 2AX1A 3JB9k 3BGOP 3VAIA 2VV5A 4RN7A 2CZ4A 2BX6A 3VAFA 4H6ZA 3IEHA 3PV8A 1APSA 2ASDA 2YNHB 3DI6A 5HSPA 4KZTA 2QMLA 1T05B 4ZVFA 2FLPA 4JI5J 1D3WA 1RP5A 1QSTA 1Y00A 2EBJA 2DISA 3ZZYA 3G6YA 1UJ6A 2AHOB 5ETSA 3F56A 4OI2A 2YKOA 2N4DA 2E5LF 3GIRA 5H84A 1L3KA 3NGKA 4NCAA 4R9MA 2OEMA 1Y0HA 5HP1A 3IRWP 3M8YA 2VC0A 1VDHA 2ZZTA 4KSEB 3HX9A 1N33F 3IGNA 2LCWA 1N71A 3H5ZA 4WJBA 1ZTTA 2FZCB 4OLOA 5CYQA 2OSQA 4U5YA 2HRYA 3M05A 4GVBA 4AE5A 1ELMP 5JVHQ 3BSCA 4OHVA 3RTVA 4OYXA 2YBVA 3TR5A 2XY6A 5CBMA 3WBZA 4WIQA 3EYZA 3PNIA 1CS4B 1RU2A 3BPSP 2G1DA 4RNOA 1RT6A 2PSZA 4EGLA 2CG4A 2E1CA 4C98A 4OZJA 4WXWA 3RG6A 3BO4A 1FF2A 3D0HE 2F40A 3VQSA 1NXIA 2QLWA 5KFGA 4CNZA 3VAHA 1H0HB 5IZHA 2ZDPA 4JD6A 2FJBB 5KG2A 3KDNA 2LQ5A 3FB3A 2Q66A 4JI6F 5J8CA 1OWXA 4I2QB 4XPDC 4JI7J 3CDBA 4LFCF 1IBKJ 2HURA 1S48A 4DUYJ 1XIQA 4KB7A 3F8KA 1JWQA 2W2OP 1Q81T 2HMIA 1K1SA 1VRTA 8AT1B 1JMTA 2WTFA 3M2VA 3EE3A 1RAHB 1U8SA 2CADA 4IG3B 3OTOJ 2GX8A 2VG7A 3PW2A 1RTDB 4FYYB 1R8CA 2X1FA 2YKAA 4XDCA 4USJC 4ZMMA 2XS2A 1RI7A 1SJFA 5M2RA 3MR2A 4A8WA 2P9EA 2X3GA 1TL5A 2EEYA 3LGNA 5C2GA 2I1RA 1T9VA 4F25A 5HK4A 4FS2A 1KUXA 3BJ8A 5GAEU 4QW9A 2C3OA 2B8QA 2RU9A 2HLUA 3IBFB 5IC4B 2VHGA 2AIRB 5A0YB 4QIVA 1X5SA 3HT3A 4KPCA 1NHVA 1LRZA 3K9UA 2RS8A 3CSKA 3PCOB 4YMEA 1N34J 1S0VA 4X5KA 4TVAB 7AT1B 1MN9A 5ETOA 2GVDB 1MMLA 3G2XA 4ITSA 1M4GA 4X3RA 1CJVA 4K4XA 3EGNA 4JYAJ 5D15A 3SJGA 3KLVA 2HWIA 1R31A 1S1VA 4J9SA 3M30B 1LNQA 3H98A 4ZVEA 1B7FA 3MMBB 4H89A 3CIZA 2APOA 1R8PA 2MHEA 1FEEA 2GIQA 2HNDA 2EG1A 3OJUA 4URSA 5HLFA 3PRTA 1R8BA 1T7PA 4N8NA 5C7PA 2G0BA 5IB0A 2E1RA 2GMLA 2D4PA 3MMJA 2R7VA 4NCGB 4LFBJ 3AOAA 4C3LA 2IJRA 2XZWA 2OPPB 3QGIA 2ASJA 4Y2MA 2GV1A 1U1MA 1T3OA 3CJKB 3DLGB 3UN2A 1Z8XA 2Q51A 3LPYA 1GHEA 1JXVA 5I4MA 4DV3J 4DR3J 5DJBA 4QWCA 1X31C 1LQ9A 4IOBA 1YGHA 2DF5A 3QBCA 3UO0A 3BF4A 2F8MA 4I68A 3BGLA 3IXQA 1UA0A 1X4EA 3W8PA 5C24B 1X8DA 4PYDA 1TK0A 3DGVA 1S6UA 3S6FA 3H25A 1SKWA 4QR2A 2Q0YA 2WK4A 4CAEA 4DR6F 1DLOA 1X4BA 1T03B 3CJ5A 2WB1D 3OR2A 1QUPA 4NZ7A 4M85A 5BR8J 4F9UA 3C3LA 4FZVA 1EARA 3FVYA 1QQ9A 1VQNS 1BQMA 4JBCA 2VZYA 1RU1A 3SCKE 2ALYB 3BN7A 2HS0A 2GLJA 1S10A 4DDFA 5BWAB 2VFTA 3MEEA 2RMLA 2QFJA 4NGSA 4I6YA 1RK8A 2IM0A 2MKHA 4GRSA 2VFRA 2R42A 4X4QA 1ZOTA 1F0XA 2PDAA 5HROB 2FVRA 1XMQJ 1ELOA 4GC6A 3ZZOA 4P4IA 3K8VA 1I1DA 1R57A 3DRPB 2HK3A 2I0XA 2QO3A 3L7OA 2WONB 1KFSA 3QMQA 1SPBP 2GZOA 1XWLA 1D9AA 4YEAA 4LF4F 3G82A 2HHHJ 2R2UA 1F9EB 1HI1A 1JLEB 3BR9A 1HQUB 3A8IA 2DGWA 5K8PA 3MURP 5LRGA 2DR5A 3OHBA 3MD3A 3TANA 4ZLJA 3QJJA 2NSCA 4I7FB 1IKVB 2W4CA 3MWBA 4LQ9A 4HDGA 2FUG9 4PG6A 5JH9A 4ZP8A 4KFBA 3BLNA 3T9ZA 3QO9A 3THPA 2KTQA 1NJIT 5D8NA 2O5DA 4HLBA 1FRLA 4NJQA 5J1NA 1KHVA 4CLZA 1IIDA 3J81j 2M2BA 2NSMA 3MECB 1RJJA 4EMEA 1C1BB 2OPRA 3H5SA 4OHXA 2PRBA 1HBOB 1WG4A 3OT9A 4PQAA 2KM8C 1NKCA 4P52A 1SBRA 1VRUA 3RW6A 2B56A 4TY8A 3W64A 3V7ZA 1V0CA 3KK1A 5J1PA 1Z4UA 4RW9A 2D3ZA 2CNSA 3MAQA 3SSSA 4PUOB 4JI8F 2CPFA 1HPZB 1Y5IB 4RWXA 4R87A 3NA6A 2QLJB 2VBQA 3RZAA 4Q0BB 2ZH8A 1MG7A 1RLDA 3K5PA 3MOZA 1J5EJ 2DNQA 1FRXA 1LK5A 1YZ7A 2V50A 2BOAA 4F7VA 1CULA 3N6MA 1N5QA 1N32J 4WYWA 4P4DA 2P0WA 1FFWB 2C3YA 3NGDA 1U2RA 3PJ9A 1NMEB 1QSSA 2ROEA 5G20A 3VARA 1RWNB 2BUNA 4BHQA 2DGOA 5F8GA 3HK2A 3PRDA 3FSXA 2ZOGA 2M4MA 3MTKA 1EKSA 1Q79A 2Z3MA 4GO7X 1FD8A 2PA3A 5EX3A 1Q4RA 1W7WA 4MCQA 2AYBA 3SDEA 5I3PA 3UN3A 5CABA 4YR3A 5D6GA 5DS7A 1S6PB 1GQEA 3D66A 1RWUA 4CYUA 4Q2MA 5D4LA 2J9CA 1GAOA 4AG9A 3T1YJ 3OSPA 2B5GB 1I3OB 3MCOA 2XHWA 1DURA 4MY0A 4PEOA 1RKJA 4HYKA 4ZHRA 3IWLA 1YTYA 1H8LA 1AZSB 4FDFA 3JTPA 4DWIA 1UVKA 5LJ5Y 1F9FA 1G2EA 2RAQA 4JI3J 1UP1A 2YQ1A 2HHVA 1M5HA 1EB0A 4WIIA 2FJEB 3PKMA 4WFZA 1FJGJ 3X1LB 3V81A 4K0KJ 1S7KA 1SC1B 1HWJA 3CC2S 5HQ8A 4G6VB 1NK5A 4YR2A 3NGTA 3MM7A 3EO4A 1N54B 3CJ4A 4MFBA 4DCJB 3DDDA 3C8YA 4P9SA 1UVMA 4FNIA 2AQ4A 4KE5A 3R6GB 1TKJA 4OAEA 1TKXA 3ZTQA 1M44A 2PJBA 4OIWA 1LFWA 3RRGA 4Y28C 4NZ6A 3LUYA 1NK4A 2C6GA 1UFWA 2AFSA 4QU7A 1F5AA 4HHUA 1FD2A 1L3VA 5F09A 5F3TA 3UD5A 2IAJA 2YWKA 4HTIA 4OYAA 3QNVA 1HKAA 1FDNA 3WX4A 2DR7A 2JSXA 1YBUA 3RGIA 5CZVA 2VH7A 1RAIB 4URGA 3IFEA 4RW8B 2Y8WA 4ZVQB 3EXCX 2DCUB 3D68A 4EZ6A 5IQ6A 4QQBA 4IUSA 4V19X 5JUMA 1H7XA 2JDCA 2FTRA 1WORA 1C0UB 2HQDA 4PWDA 4YQWA 5HMYA 1IYKA 2FPHX 1U1PA 1J2VA 2XEIA 2MQMA 2XGPA 1L3SA 4F4YA 4LF1A 3TOAA 3BDEA 1WOPA 4IRCA 2RKIA 3DXSX 1Y5NB 4G1PA 2IL4A 4HL9A 1Q16B 1HWLA 4P7VA 1WD6A 2CVEA 1GFWB 3MEDA 4M6GA 3MEKA 2E9RX 4JYAF 4B12A 1SQGA 2ATLA 3FBCA 4Q43A 2QYCA 5LSRA 3Q8SB 4KGXB 2XEXA 3HHLC 5B0AA 4JUZA 2NLWA 4E2FB 4NXNJ 3CIMA 2HS4A 1U48A 2NZ4A 1TXRA 2V0NA 3CCMS 3FQKA 5L46A 1SJ3P 3BR8A 4RNNA 3DLLQ 3KQZA 1QMUA 2KDOA 2QX0A 4QYRA 3B78A 4P10A 3GG0A 3QAYA 4TWEA 4J90A 4CLKA 2G9OA 1ZG8A 2XSJA 2DCLA 4TXSA 1OYDA 2QRRA 3GLJA 1M90T 3ENVA 6FD1A 2LDIA 2HGLA 4CTAA 1HMVA 3J80U 3VGTA 3AA9A 2R8JA 2GIFA 2JEFA 5T14A 5KFRA 1F6TA 3PEJA 5LJ3Y 1GH8A 2Y1LB 1SV5A 4UA3A 4EBDA 3FFIA 5HBMB 2PR8A 3W61A 3MPWA 1RBLA 3MMAA 3SI0A 3R2CJ 4NA3A 1NK6A 1X5OA 3R3TA 1ZBTA 2MQOA 1HHTP 5J2QB 5I0CA 4M95A 1YJ7A 2AGPA 4CGOA 4CH0S 2VI7A 5MLCV 2OU2A 5A2QY 1YI2S 3MMCB 5BR8F 4QIWD 1JLAA 3RAMA 1NDPA 5SZTA 3CPAA 1UZHA 2Z4PA 1KLNA 1NJWA 3GMGA 3EDRB 3EXYA 1I12A 2YKMA 2YNFA 2J6SA 4PQUB 2KM8B 4BS2A 1HBUA 4R8FA 4OZNA 1XNQJ 4RW4B 1X9MA 5KG1A 3TEGA 5A8KA 4ZIVA 2MMYA 4ES3A 2OEJA 3OQ2A 2XNRA 2PJAA 4P75A 2ZFHA 3CD0A 2CTCA 2XI3A 5AG7A 5KT2A 2FC8A 1HYSB 1S1TA 3SXLA 3HSDA 1XMQF 4A8QA 2HFNA 3NAHA 2N3OA 4MHPA 3NGSA 3R95A 5DG7A 2OOTA 1OIAA 4FNHA 5C82A 3J7AN 3ZTPA 4ZS6A 2PD1A 2JLEA 2Z11A 3I82A 3WX8A 2A18A 2V67A 3D1QA 1NU4A 2V2QA 2IRXA 4LR9A 4NGTA 5ETMA 2QFIA 3EVOA 3S1TA 3KG1A 5EWGA 3H7HB 2J9AA 2UXBJ 1OJ4A 2AF6A 5KFTA 2OZHA 1VQ7S 2QSWA 2ZKUA 2Z3PA 1QLNA 4OKOA 1BQNB 1KOHA 1AUGA 1ZO0A 4NMXA 3N6NA 4OYOA 1DE4C 2KRRA 3IMQJ 1UFLA 2ZVIA 4ED7A 1M5OC 1TL1B 4LUAA 3KK3B 4B3SJ 5KFKA 2DXFA 1WEYA 4CGNA 1LW0A 3ADAC 3PP9A 3LAKA 5KT7A 2XYPB 3G8QA 2H48B 3MCNA 4Y2IA 1VOMA 2MSSA 2GFFA 5C42B 3QRQA 1F60B 1HQ2A 1IBMF 5F9NA 1ITPA 5IT9U 2QTWA 1ZETA 2DNNA 4UTGA 3JSMB 2DNRA 4DR4F 1HD0A 4Z7CA 4KOSA 1NPKA 1A6LA 4NF1A 1RTHB 1C4AA 3TRGA 4DLEA 1R3NA 3QT7A 4ONWA 1R89A 2ZBPA 3PBEA 1RCXB 2V68A 2RH3A 3GU0A 2O1PA 1PIEA 4YB5A 3D1OA 3KHGA 1HQEB 4J9QA 4L75A 1RGVA 4CT8A 4OJGA 4DV4J 4HR2A 3MAHA 3N5FA 3LODA 2ZBCA 3EXNA 2MKJA 1U2FA 1NLKL 2MJNA 5T41A 3VVUA 3OVSA 2Y1RI 2BABA 3GG1A 3AD8C 4B3RJ 4DV7J 2FS5A 2ADCA 1YBTA 5J2NA 4B9TA 3I4HX 3HHLD 1LW2B 4F4AA 4M5LA 2E66A 3MF5A 3QIPB 3C46A 3V38A 1YJTA 3O2IA 2BVZA 2P6GA 3BBFA 3OXFA 2QA2A 4KSIA 3DLEB 2HEKA 1TKZB 3C15B 2QL7B 2K06A 1ZH5A 4QWEA 3OTBA 3H8EA 1EETB 1QSYA 2CWKA 4C8ZA 4MYTA 1RHMB 2K3IA 2VQEF 4OZ0A 4XO0A 2I00A 2EK1A 1FXRA 3BB5A 3U1MA 1RISA 2HQGA 1FRHA 5T7LB 1SIZA 2BE9B 5K14B 2ZJRQ 2ROGA 2WRMA 3I9ZA 3SBMA 3DDKA 1JLQB 3M6WA 5DS0A 2OTLS 2KKHA 3D9BA 1UFKA 4UOGA 1SUQB 2BQUA 3SJEA 4NPOA 4B3MF 3PKYA 3F0AA 4RW6A 3OV7A 3I32A 4MCSA 3DYAA 3FC9A 1N0VC 2BE2B 4LJMA 3HHLB 2B0GA 3N4WA 3NS5A 4ECSA 3C6UB 5ITHA 1S1WB 2DEIA 2XO6A 3JAMU 4E0DA 3UCZP 1LCPA 1F1BB 1Y7RA 4KORA 2B4VA 2RSQA 4CLWA 1C0TB 4IG0B 5L9XA 3KUHA 1UVIA 2AYMA 2RD5C 4QZVB 4DU8A 3BBBA 3TQ1A 2GANA 2B7BB 4C11B 1L5UA 2IMWP 5K8NA 1YZ6A 1JXLA 3ZZZA 4LQ6A 3E01B 1H98A 2ZH1A 3HCXA 2R7QA 5ETQA 1NDCA 3AD7C 4DR7F 4ORFA 4F36A 4ECXA 1T11A 2R98A 1WWZA 2ZM6F 3IG1A 1SQHA 3CJQA 4JI1F 1XRYA 5EHHA 1QSLA 5G4DA 1TV6B 1KVIA 2GMJA 2C1CA 3TI0A 1B70B 3ZC4A 3DMJB 2P5VA 3RYLA 3R5GA 2RIJA 2EWHA 3BN4A 3UVJA 2WSFC 2G9DA 2Q79A 4LF8J 1Z9UA 4EBEA 1SVDA 4DL6A 4C4WA 1K47A 2NYQA 2VU5A 3PO4A 1TUVA 5F0WA 3CJ3A 2PIYA 1Q82T 4F0MA 2HGMA 2LYVA 4ECRA 1GYTA 4NFRA 2KT2A 1F9HA 4HHJA 2L9WA 4QB9A 3MUTP 2IM1A 2ACMA 5K20B 2Z2LA 1LWEA 1ON0A 4F02A 4DPTA 2QYGA 4X66F 4UQGA 2DHXA 3LP2B 1ACMB 1PO6A 5KFPA 4LSLB 2PJ7A 5KFVA 5AGEA 3IRXA 1RHRB 4TNOA 2F8HA 2V9KA 3DHXA 4YB7A 2EFOA 4FYVB 3KK2B 4PRFA 3JSBA 3NE7A 9RUBA 4KKOB 4WE1A 1Q7LB 4MFZA 4I2QA 4MTPA 5HANA 2DH7A 4DHVA 3EZUA 5F8HA 2J9DA 4ZPAA 2MZTA 4MIAA 2BJ8A 4UY85 2ZE2B 1RZMA 4IG3A 4FAIA 2WW8A 3U1LA 2O66A 2NYIA 4LF6F 4WXOA 4LF9F 3OTCA 4A39A 3W3SA 2QE5A 2F5IA 1JJHA 2B6AA 4B3OA 1FT7A 2MJUA 3P96A 4Q7AA 4KGZB 4O0IA 2I8EA 1HBNA 1S9EA 2FT0A 3AT1B 4MJKA 4B9VA 4DPWA 3VWSA 4YUDA 2CF4A 1YQHA 2ROPA 5E7OB 3S8SA 2CQPA 3ZFVA 5J8FA 2W9BA 4C48A 2UVUA 1XEBA 4DZDA 3MR5A 1D1UA 3GV5B 2Z3LA 1P1TA 3DOKB 4ATNA 2VOOA 3IU2A 3R7NB 2EC0A 2CYYA 2ZPAA 2PI4A 4DUTA 2LLZA 4DL7A 4HDHA 2UV8G 4B3TF 2UUWA 1U6BA 2D9OA 4JXQA 2MZ1A 2PVVA 4IKAA 4WK1A 2H5IB 4RUBA 1FKPB 2J0QD 3WT4A 4BC9A 2H3EB 1N5SA 4QVTA 3IS9B 2BKNA 5GADI 3HF5A 2RDIA 3OHAA 3ULHA 1OPIA 3TO6A 5D0RA 2WVBA 4Y0FA 1UPMB 1FJCA 2CUYA 2FVPA 3MMBA 2BV3A 2E1AA 2MSTA 4U7CA 5AJ3F 1VC5A 4F9VA 4C8MA 4EO8A 5J1QA 3P49B 2FHMA 4WPAA 4DSKA 4JZ0A 4CRJA 1TP7A 1FRKA 2K7JA 4ZPCA 4WWSA 1CJKB 1XNRF 1TL3B 3M9OB 1WDTA 1Y4ZB 2DNHA 1TKTB 1DTQB 1KONA 4NGMA 1IJEB 1NJZA 4O3PA 4C2XA 3D2PA 4O3RA 5CH7B 1WC4A 5C2CA 1WOSA 4CI0B 3NH4A 1JLGA 1YW4A 3PYGA 3GB0A 2D3O1 1XR5A 3OVBA 5LRKA 4A8YA 5KFBA 1JWWA 3KJVA 3DRRB 5IM0A 4OX6A 5H9EK 4C8OA 2JNJA 1TFWA 5IV0A 1KFDA 4ZBGA 4U7UD 3BSNA 2EWBA 1U47A 4ZYQA 1I94F 4P4EA 3H4QA 3RBUA 4U6PA 4C7HA 3CCUS 2P2CB 1UL3A 5L1KA 4A33A 4XPCA 3SQGA 1T03A 3FYNA 4M94A 2J76E 3SXNA 1CC8A 2ZXVA 3RAQA 4X4RA 2FVCA 2WSEC 2J8RA 2CG8A 4IK2A 1CQNA 4DV0J 2M7SA 4DS4A 1K44A 5HP1B 3UDEA 5HVGA 2YWHA 2HQCA 4XNHC 1N56A 2P8IA 1LOKA 3JQMA 2VQFJ 4CH1A 2OH1A 3KGQA 4CP5A 2JHEA 4PCQA 3IC1A 5CYQB 3IIBA 1EAYC 4W90B 3FRYA 4LBHA 2JFDA 4F4XA 4GVBB 4UF4A 3KMQA 4F8RA 2F9DA 4CYNA 2KFZA 3PACA 3GQCA 4KPYA 5CNPA 1P6TA 4A8MP 4DV7F 3Q0AA 1CJUB 3D7FA 2ZD1B 4KIAA 4NYZA 1BY9A 5GCNA 1H2UX 4I6AA 5FLXU 1UMJA 4KO0A 4F50A 4A37A 7FD1A 1JNRB 2XO7A 4NGPA 4NLGA 4O4RA 4ZPTR 3TE4A 4AXVA 2N4CA 3U27A 3CD7A 2LU2A 2LP4A 1HQUA 1YHQS 2V2KA 1B0TA 3M6XA 4DSLA 2UXCF 1WC1A 3RB3A 2AJ1A 3G8WA 1YJRA 4N8OA 2HRTA 2QLBB 2HMIB 1VRTB 2ZELA 3KLFA 2OSRA 3M2VB 2LQ9A 3UCGA 4XIUA 1PC5A 4UQTA 4S0MA 2VG7B 2JX2A 5A76A 1ARMA 2V69A 4U9YA 4C7IA 4TLRA 1M1KT 3B8GA 4O3SA 4PG4A 4MIWA 3CCJS 1SL0A 3MHYA 2DXQA 2DNLA 5CHCB 5JMNA 2CDQA 6FDRA 4OC1A 4IOAQ 1YWXA 4CLPA 1YJNS 4DQPA 2FYXA 2YNIA 4I0WA 3RAXA 4UIAA 2JEJA 2KL8A 3RBEA 3DLBA 2VBWA 4M63A 4RU2A 2LDYA 1HPZA 2QGFB 3A1YG 3J7Z5 1V9OA 2WB4A 4DPYA 3TZYA 3H2UB 4NEZA 5KT4A 2XMAA 1S7HA 1JK9B 2IRYA 3FRZA 3NKYA 2HHTA 4C8YA 1AMPA 3TA0A 2E5HA 3QFWA 4R76A 2XBPA 1G6BA 3D6FB 3ELHA 4KGVB 3AB2B 4ONUA 3D3SA 5L1LA 2Q6BA 3K0JA 2IVYA 2BR0A 1AB8A 1CJVB 1VQ5S 2C22A 2BANA 3QAUA 4U95A 4UBRA 4NLSA 1QAJA 4BD9A 3M8PA 2CQ0A 1HHQA 4U8YA 4MJ8A 2CXEA 4ID5A 1YJWS 2LMIA 2HNDB 1JLFA 2CVIA 1VQSA 1YREA 4ILRA 3A4TA 2AZ3A 4AVCA 3EPGA 2KN4A 4PSWA 4OMEA 4PK2A 4O23A 3J7A1 4ETXA 1PILA 4JV2A 1B0VA 4DJBA 3GYAA 4FUUA 2POKA 1VQMS 2EC2A 2CIMA 2D4OA 3FIXA 1IOFA 4NEYA 5ETKA 1NSAA 2EFNA 2CJXB 4KS9A 4KHRA 3FBUA 1AZSA 4DR2J 1S1XA 2QIRA 2W2PP 4KOYA 4DFMA 1P4NA 2ABYA 1UEKA 4H2KA 2PQ8A 2G2ZA 2D3OR 3RRKA 2ANPA 2YH1A 2AEMA 4USMA 2ZKTA 1CBKA 1XMTA 4DR1F 5B09A 2OZGA 4OX9J 3FSYA 2NPIA 2VBYA 3KQXA 4ZVUB 4C6AA 2CIJA 1DLOB 1IKXA 1NK7A 4KSAA 4P4JA 3JTNA 2C2RA 2J8NA 3LF0A 3OR2B 4HT7A 5KAKA 4KVXA 3OTDA 2AMCB 1RWOB 2DJWA 5KG6A 4PXCA 4DMZA 3G4SS 1HLWA 2QA4G 4HH1A 1RSCA 2IJNA 4DI6A 4KH1B 2BZ2A 4AT1B 4M5NA 3JVNA 5KFZA 5I3QA 1QUVA 2ZVSA 4ZCLA 3T6BA 3OFHA 3PHTA 4NMLA 5I3UA 3ISNC 3CXCR 3DLJA 3QT6A 2BJDA 5DGAA 4GS4A 3FRMA 3Q23A 1NZ8A 3TX0A 1TF8A 3W2VB 1M5KC 3QWUA 1NSQA 4KTQA 2VZZA 2YWFA 5B0DA 3U7JA 5HVHA 1VLOA 1IU8A 1C0UA 2R8GA 1NH8A 2V6AA 1NHUA 5LMUF 1BWVA 2DHHA 3FNCA 2BKOA 2YWWA 2R7HA 2IMOA 1NK0A 2P6EA 2VICA 3NRBA 5LMNJ 2CNKB 4AYBD 3G82B 2ZZNA 4CCHA 2D1CA 2EW9A 1T9UA 1XQIA 4ERDA 1PKUA 4EEYA 5KG3A 4DFJA 3I9SA 3D6HB 5LYDA 3GWCA 5KFXA 4OYBA 3M2UA 1N48A 1WHXA 2RRBA 3PR4A 1B99A 1VHEA 1TVRA 2HVHA 2FDNA 2VFUA 1EP4A 2BO9A 4KFBB 5KOWA 4AD6A 3US5A 3QO9B 2ODFA 2DR8A 4WYLA 3PGPA 2CZ9A 1EZZB 1BLLE 1MWQA 2DO4A 1TUWA 2J5AA 2EG2A 4X62J 1TFYA 2PVWA 2M9KA 2JVRA 2LVWA 1BPMA 2G3AA 5CZXA 2OPRB 3EX7B 4U7UK 2AJ6A 4CH7A 5A6PA 4RZRA 2KCWA 3NP5A 1M1GA 4OC2A 2G13A 1VRUB 4TY8B 3PHEA 3KK1B 3JTOA 5DQGA 4RW9B 3E51A 4UUXA 1DFDA 4B14A 3BKUA 4FXWA 3FCWA 1U26A 3KLGA 3ONQA 2EBEA 1GEHA 3P5BP 2G1HA 4MCPA 5HBMA 4XK8C 3M6VA 3WZ0A 3A8KA 5J2PA 4CO0A 1R27B 1FVSA 2MGZA 2LXIA 1CULB 3I3GA 2GE3A 5JGFA 3QLHA 4MH8A 4UEFA 1SKUB 2OB0A 3A8JA 2DRBA 3EJMA 3ZJ0A 1FVQA 1KC8T 4P7TA 1BC6A 4X64J 4ZP9A 1AT1B 4DV0F 3HSJA 4PQUA 1HHSA 4PXDA 1TKDA 1KQFB 3BYRA 1N5TA 4YY3J 3T8WA 4FXVA 3SDEB 2HB6A 1AYEA 2GAGC 2ZUGA 4FWUA 3PYDA 1UVNA 1XJWB 5GAEI 1T95A 1QAIA 4ES2A 4CYUB 2R9LA 2HVEA 3KLEA 2ZEFA 4CAXA 1JLBA 5BJRA 3KLIA 4OJHA 1M4DA 3H5UA 4DUZF 3F41A 3UNGC 2ZEOA 1Q8LA 1EX8A 2LFVA 4JXRA 1YJVA 4KVOE 2J6TA 2X1AA 1O0PA 4N41A 4ZHRB 2HAFA 2JOQA 4ZVPB 4C0OC 5KFNA 3DKDA 2BJ7A 1RXOB 1FXLA 1YW6A 1VI7A 1I21A 2P6SA 5ADZA 2C27A 2I2YA 3UCUP 1TK8A 4TQSA 4HI2A 2AJ4A 1F2HA 2RQKA 3JQJA 3CUNA 2WYRA 3GUXA 3EMTA 1XMOJ 3V81B 1UA1A 3GY9A 3M8QA 4DBQA 1M5PC 5K9FA 3LWLA 4DV6J 4ZX9A 5G0RA 2P9CA 4DSEA 2HV2A 4W92B 2DH8A 3MM7B 4OZ5A 5BYQA 4K30A 3PRVA 3BS9A 4MFBB 2Q4YA 4LQGA 3HPOA 5AG5A 2FSRA 2LEPA 4ZPBA 3OUYA 1I51B 3HFKA 1TKXB 5JXSA 1KNZA 4CYPA 4C8LA 4GVLA 3ISND 3GSDA 3FJUA 3AXKA 2FLNA 1X10A 4ZA1A 1TF9A 2E29A 4DS5A 4N56A 4DV2F 2R8VA 3KR4A 1HW8A 2IAJB 4LSZB 1KR4A 3W5XA 5KFYA 3KMSA 5AE1A 2ZBQA 2NQPA 1RT7A 2CNLB 2BQRA 2BOPA 5B0BA 1KTVA 2E5LJ 2MZSA 4FP9A 4DPUA 1RAOA 1EQMA 2O01C 4K3NA 4USKA 3T5HA 3JQKA 4JOUA 4DFPA 3S6EA 3J81U 3HD2A 2I9SA 5DWMA 1Y7PA 2HKEA 4KAIA 1SC6A 3LH2S 1T9YA 3R9FA 1LXNA 1Z2ZA 4W4MA 1OO0B 2C3PA 1HNIA 1IM4A 3CDEA 1EQ0A 1X5TA 2RKIB 1R0AA 3ENQA 4FBTA 3W6XA 2B7CB 3RJMB 2CQ1A 4Z37A 4DL5A 2KT5A 4GO5X 4IO9Q 1WOOA 5KT6A 1X60A 5EUHA 3CPWR 4WU3A 1ZA2B 5E3AA 4NRUA 2HNYA 1JX4A 4AQYF 3K17A 1IGBA 4HACA 4G3IA 4KVME 3FX6A 1RWXB 5FIIA 1I1GA 1WSVA 2GQCA 2AD9A 3PIOQ 3O44A 2GFQA 4IHMA 3KI9A 1ZZNA 4AFFA 1ARLA 4K2JA 3FQLA 1FWPA 1NSPA 4JI6J 1VHOA 4KT0C 1Y0YA 2DPTA 4LFCJ 4KLWA 2HVZA 3BI0A 1XBUA 1WNEA 1REGX 2XSJB 5IT0A 2MB0B 2X51A 3NLCA 3TOBA 3DU6A 4CTAB 1R8HA 5J2MA 2HW3A 3NH5A 1ZA1B 1SUQA 2V4QA 2C6CA 5ETTA 1KS2A 2A3JA 3WC5A 4A46A 3W9IA 4FD7A 4ZN3A 3I87A 3G9CA 2HVIA 5DG9A 1KUVA 3K57A 1SV5B 1F5BA 4OV6A 4MYUA 2MZQA 3FFIB 3OJSA 4P4FA 3MMAB 1S1WA 2XEGA 4H4MA 4YP3A 1IWGA 2IA0A 3LW5C 2Q43A 1NK9A 3VTIA 2YKQA 1ELLP 4CS0B 1IJFB 1JLAB 2BEIA 5B08A 4R6TA 1SCJB 1UW9A 4CO3A 4PXBA 1JNZB 1WG1A 2YKMB 4C11A 2YNFB 4WF9Q 3TUZC 2WW4A 4G65A 1HBUB 3D7GA 3HULA 1OQ3A 2CQ2A 3OTEA 3QFHA 2YX7A 3CCQS 1CG2A 2EPIA 4ZCIA 4NE9C 3VZHA 5A8KB 2J0WA 2JEIA 4L89A 2ADBA 2HPUA 1A7GE 2DRDA 2MZRA 5JM6A 2OEKA 2PFFB 1S3ZA 2HVDA 2ZW6A 3VWDA 2KI2A 2BJ1A 4Q8EA 1PC4A 2ZNYA 1J4JA 2GJIA 3HD1A 4J91A 2GO9A 2YWGA 4B9MA 3IWGA 1S1TB 4KOTA 4UW2A 1ZM2A 5FDLA 2ZZMA 4CGPA 2C2MB 2V8PA 2NYHA 5GMKa 5H9FJ 3RO0A 2MHNA 2I5JA 2PMZD 2XTJP 2QJ8A 2HBRB 2XWXA 2B4BA 1RYSA 3W65A 4J9NA 4A8KA 3UI3A 1R6YA 1WC6A 1UWAA 2RJZA 3VALA 2R7WA 4QPTA 2ZC3A 1VC6A 4EYHB 3E8OA 3Q89A 3K5LA 2MLYA 1UWBB 4P4BA 2VJUA 4NLWA 4BCAA 2JEGA 4LREA 4NXMF 1R6VA 3HLPA 4OADA 3B3VA 3NEKA 4ES1A 4LSLA 3D4JA 4TQRA 4MK8A 3ZTRA 2HYIB 2ZWOA 2CPHA 3VWEA 3KK2A 4YFUA 1X9SA 2R8IA 4MKVA 3QT8A 4DSJA 5DRKA 4KQZA 4MT1A 1T9XA 2OP5A 4LVOP 4JWPA 2E9ZA 4LR7A 4GC7A 2Y1JA 4YFJA 2ZE2A 2CKWA 4FS1A 2BCOA 3J80Y 3TZXA 1AFIA 3NXZA 2B4DA 1PAEX 3T19A 3GV7B 3NNCA 1WKLA 5E33A 4E0AA 2KFNA 4KOUA 3CXSA 1P8GA 1UJ4A 2KH9A 5J1EA 4O0NA 4F3OA 3V4MA 3EC4A 4OZ3A 2MLZA 1TAUA 4ZP7A 4RPFA 1KZFA 1U6ZA 1WF0A 1U1OA 3IGRA 1VK3A 4Q44A 4ZLPA 2H9ZA 4OI1A 1WSRA 5CD4A 3HXMA 2ZUAA 4YDDB 2CJAA 3DOKA 3PIPQ 5J2NB 1VQYA 3TUIC 5LM7E 2KU7A 4ZKAA 1KEKA 2QEXS 3DC2A 5FJ4A 4YY3F 3FEYB 3HHDA 3IAM9 1RUSA 1OBRA 3R5JB 1FKPA 2R8HA 1ZM4A 3BREA 4X4OA 5EWEA 3PB8X 2Z30B 1QVGR 1NUEA 5H9EJ 2JDJA 2MKIA 4IDKA 1RT4A 3GPAA 5DDQC 3VHQA 4CPAA 2D3UA 3JUWA 4UT4A 5KFAA 3QJLA 1U6MA 1DTTA 1WK4A 1Q1KA 1IM6A 3GV8B 3NWRA 4R25A 3R6LB 1EKRA 1T8EA 3GIMA 1DRZA 4ZPWR 2NREA 4U67Q 3ENWA 1KKHA 4RW6B 4RLEA 3B4MA 3B4DA 1S6QA 1HI8A 2AFOA 1TZ0A 5HO4A 1RAGB 3DYAB 1ICEB 4DX5A 3I31A 3S9MA 2XNQA 4ZITA 4Z2XA 4QIFA 3IBCB 3FK4A 1JKHB 1NDKA 3LA0A 3G8SA 1FY7A 1IB1E 2FY8A 3VR1A 4CAVA 3SMZA 2AYGA 2RQMA 4EYIB 2WUUA 1SB6A 1MMNA 1RHKB 4BBYA 3NCQA 2BUEA 2I79A 1YVFA 4ZVSB 3UR0A 2PGCA 2RQCA 4ZIWA 4PKDB 2BKPA 4MCRA 3NWGA 5LRJA 2K1RA 4QJVA 2KJVA 2JBJA 4MKAA 3Q22A 4M5HA 4USIA 4BINA 1U45A 1NJXA 3G87A 4YWYA 1I5OB 2G0IA 3KFWX 4ANEA 1S12A 4Y00A 4RBTA 3SSRA 1FDBA 1H2VZ 5IT9Y 2HK2A 1S77D 3B6BA 5A8RB 3IG1B 1CM0A 1EHWA 2IDLA 3FEXB 5CD4H 2V4JA 4OYPA 5A8WB 1SC3B 3PW0A 4NLXA 1O51A 1KQSR 2K3KA 3HFZB 1OS5A 4X8IA 1PGZA 1XBWA 1U8WA 1XE4A 2ZEEA 3I55S 8CPAA 2BBEA 2EVZA 3UVJB 4NGQA 1IR2A 4OX7A 3MAAA 1RYRA 3F44A 2A6MA 2V94A 4FBUA 2RDJA 4QPXA 2MPUA 3V4IA 4ZVOB 2C2NA 1CJUA 4OYMA 1X4GA 5F8LA 2ZD1A 2REFA 2KVIA 2XWYA 4J9OA 4X4PA 2VF3A 2B9YA 3MXHP 1LWEB 2GJFA 2CQBA 3ZZ0A 2F7VA 4ETZA 2ZW7A 1X4HA 4KOXA 5EX0A 3IRXB 1G1XA 3GIJA 4Q38A 5ISVA 3HSGA 3VAMA 1TKFA 3MFHA 4NYPA 4WE1B 4EBCA 4RBVA 4J5OA 2BRLA 2CQ3A 3HT0A 3A3OB 2O53A 3DCAA 1TL4A 1KN6A 5E2QA 2A2DA 1RXTA 4KYZA 1M1HA 1WEXA 3LANA 4DCPB 2MXYA 2XMJA 2KXNB 4L6V3 4JI2F 3QB8A 1NH7A 3M32A 1M4IA 2QA1A 2B6AB 4B3OB 4LMZA 4Y2CA 1VBXA 1K0VA 3F0NA 2RS2A 1HNWJ 2E1MC 2YNGA 1HBNB 1S9EB 2XMUA 4MMOA 4E8UA 4BMHA 5KFMA 1YQEA 2IC3A 1M0SA 4EZ9A 3HZEA 2MKYA 3GZ7A 3D5MA 2DR9A 3OPKA 2W9BB 4PV6A 3JAMY 4DQRA 1PU9A 4GMKA 2PIIA 5IX3A 2R7RA 3WC2A 3AFGA 1XFOA 1QAYA 5KTDA 3A8EA 3M6UA 2PI5A 3KLHA 3G8TA 2FIUA 4M1KA 2R7OA 5KT5A 1UFHA 4ECVA 3B82A 2RUGA 3PYFA 4G1IA 4J9LA 5KTAA 2A0FB 4EUVA 2B51A 3NBPB 1C2PA 2HFZA 4DV5F 2V2VA 1RHUB 3BV8A 3C2PA 3RRHA 4Q2LA 1WTFA 2VB6A 2DNOA 1F2GA 2RC4A 3RB6A 5AXLA 4GM5A 3TO9A 2CQGA 2COLA 4TN2A 4K4UA 2OAUA 1P0HA 1SJ1A 4PPZA 4GKKJ 4DX8H 4BC7A 2CQIA 1S5KA 1QY7A 1RT1A 1PYTB 3PBBA 4Q45A 1S0OA 2AJ2A 2RFHA 1G7CB 1JLGB 2E5JA 5IXUA 3P3DA 4WFYA 2H54B 2ZEGA 4YOEA 3PO5A 2B9EA 2GJ2A 3BJYA 3LACA 2H4YB 2FLLA 3KJVB 4CLFA 5IM0B 1LWXA 3WHIA 1HDUA 3KNAA 2ZBRA 4MHNA 4B08A 1UVLA 3Q2TC 3S7RA 3HFVA 2DR6A 5DGBA 1YMEA 4NGNA 4DCOB 1D0EA 4O44A 3ILJA 1VQOS 2QA4S 1FT8A 1KVJA 4E98A 3I6PA 4F0YA 4B9UA 3SQGB 4KV8A 5KFUA 4A4JA 5D4OA 1GNKA 4U9RA 1KQGB 4HVZA 3VCDA 2REEA 1EE3P 2QG9B 4J9KA 3GJTB 4LRFA 1CBXA 2DO0A 3D1HA 1X4AA 3KHHA 3H4BA 1FNXH 2R4FA 2L9NA 4BBHA 2OFGX 4ELVA 2NZCA 4MFJA 4FYWB 4Q36A 1N5YB 3C26A 5KFOA 2I38A 5IC6B 1GMUA 3GONA 4DX6A 4I56A 2IBOA 3DNCA 2ZNZA 2UUAF 2KB2A 2RDDA 3J7YU 2H51B 4UEZA 3EICA 2WHOA 4F4KA 2W4DA 3E2EA 5EWFA 3N9UC 4WFBQ 3W2VA 3PB6X 3AY0A 3KUEA 1WHYA 4XTTA 3DHWC 3WC7A 1H7WA 2NS1B 4FVCA 2EXUA 4NCBA 1OZPA 2RILA 1S7IA 2R7UA 4KH0B 1QTNB 1MROA 4KO0B 3E0KA 2YXLA 1AA1B 1VQKS 1VQ6S 4BWMA 2E9TA 2KZMA 2X3DA 4YHHF 2N82B 2PEHA 1QSMA 4GXHA 1U24A 3G3SA 3KOAA 4ZN1A 4CQ1A 4BDPA 4D3HA 4OMFG 4CT9A 4ZVRB 3TO7A 1IR0A 2K2PA 3KLFB 3GR1A 1Q53A 5GAHI 2XCAA 4P2MA 4R5PA 4WBFA 1O8BA 2UP1A 2OPQB 1FTRA 2AJQA 5A6WA 2M5YA 5B0EA 2N7YA 4J9UE 3MFIA 1U1RA 3C16A 2B9XA 4ZX8A 3I0SA 4HNXB 4ZLNA 2FL4A 4CIOA 2W7AA 5F49A 2DGQA 4ED1A 3D6MB 4F4WA 1IBMJ 2WZNA 2L3MA 1S7FA 4RU9A 1KLMB 4CO1A 4DR4J 1S9FA 3Q2SC 2YNIB 2XY5A 1UW4A 3GIIA 4DF4A 1PSDA 4QYZK 2ZC4A 5C25B 1NDLA 3V6JA 1XN9A 3IM9A 4A8SA 3ZNUA 4RNMA 3L2NA 5IQQA 2L9DA 4B13A 4FKXA 2A2CA 4I49A 1U0HA 3GCWP 2ASYA 1AW0A 3N5BA 2HIYA 1K0TA 3FUYA 4DUKA 1V5IB 4F0KA 3TA2A 3RUBL 4QIGA 4A95A 2VEZA 1VHSA 2M8DB 1Q8KA 1Q2DA 4M3SA 4FD6A 4RR5A 3CO9A 3GP9A 1F2PA 4KJIA 1A2ZA 3MR3A 1GMVA 2BANB 4HEA9 2AZ1A 2FY1A 2OELA 2JC0A 3D54A 3H20A 3M8PB 4KR0B 5F3ZA 2K8GA 3NCRA 1EIYB 3S9NA 4ID5B 2VG5A 4USWA 4IH5A 1JLFB 5F47A 2GGPA 5G21A 3GTYX 4B5OA 2QV6A 1GX5A 4LR8A 3CXPA 3DR8A 2PMWA 4L3KA 3S6KA 2D9PA 1SQFA 2VQEJ 4CGLA 3GYXB 3T9NA 3NE8A 6CPAA 2C3UA 1NPPA 1RAFB 3QGGA 1ZAVA 2J9DE 4JI0F 3LWUA 1S1XB 3VATA 4DV1F 4EVYA 1NHKL 4B3MJ 1YKWA 4ER8A 5FLXY 2YPZA 5C5JA 2DGXA 3K58A 3GJSB 1FEHA 1FWKA 2Z2ZA 1M5VC 1XIXA 1TL7A 2UUBF 2C2EA 3R1KA 5D3GA 2WAQD 2VUGA 4ZY2A 3V8IA 2BDPA 2FIAA 1IKXB 2GIVA 5D8HB 4LVNP 3G6ES 2VDIA 3BKTA 1CVJA 4IR9A 2PT0A 4B9NA 5D0EA 2HHXA 2A4NA 1MJBA 3ET6B 4DSIA 2PEBA 3B3TA 2X7IA 3H2VE 4MI4A 1S7NA 2FLOA 2NPFA 1U6FA 2DXEA 5LT5A 3HJFA 4NZ0A 3PW5A 5HN0A 2ERRA 1HNVA 1HNWF 2CZVC 3ZNJ1 4HPSA 1PBUA 3IN5A 1FCAA 5F0UA 5AG4A 1SL1A 3R7BB 5I3UB 4I6WA 5JJBA 1BE4A 4P45A 4K7QA 1VQ4S 5IOLA 4DR7J 1LOUA 4HNWB 3UD3P 3FXTA 2ZM6J 3CCES 4OI3A 3SHPA 3WIVA 4JI1J 3NS7B 3EZ5A 3LQVA 1FKAF 4JI4F 1Z1ZA 3UPFA 5ELYA 2HHWA 4I67A 2DRAA 4R7MA 1QD1A 2KZZA 2ATRA 2XGQA 2C42A 3LD2A 3CJ8A 3MPVA 2MY7A 4QWDA 1CPXA 4A47A 3U02A 4A32A 2B5JA 4OC5A 2BA9A 4BLGA 3HKZD 1IYLA 2DPIA 3BH6B 1PG5B 3Q8QB 1B6BA 1O5JA 1PBAA 1WJ9A 4E8OA 4DG1A 2Y1IA 3M2UB 3FNNA 3M2RA 1TVRB 3N0VA 3O6QA 1EP4B 3T90A 3TVYA 1XEZA 3R9GA 4X66J 3V6HA 3EGWB 4K59A 5KOXA 4UCMA 4M5DA 1D8YA 4FYXB 3H5XA 2YQ0A 3BDPA 3W91A 2KT3A 1UZDA 4GKKF 1HARA 4ZI6A 3UD4P 2KYZA 3OFGA 5EBVA 1HBMB 1RT3A 4NLUA 3M8SA 2LXUA 1FRJA 3IWEA 1JLCB 3KJNB 2HG4A 1Q8BA 1S4EA 2CNMA 2XCPA 3BPDA 4P74A 2EK9A 2EFQA 4LF6J 4LF9J 3NOGA 3HUVA 5KTCA 2HFSA 3HVTA 4CO5A 3LO3A 2ZJPQ 3KLGB 4MFPA 4ED2A 4UY8T 2HWTA 2XMWA 1LAMA 3PVXA 2YKNA 2FQQB 3LP1A 3DGPA 4B9LA 2C2OB 3L4BC 3T1HF 1TIQA 5J2PB 2F63A 3CD6S 2YNCA 2Q04A 2IQ6A 3HVRA 2MGZB 2EFVA 4OYWA 3S01A 4Q5VA 4YGOA 3IWWA 1YRXA 3QLHB 2B9WA 4K4TA 5I42B 1TUGB 4URQU 4Y49C 7FDRA 4ED0A 2EK8A 2YWEA 5DETA 4A2ZA 3MD1A 3KJQB 1U49A 2K5TA 3HMJG 1JQGA 3CT9A 4B3TJ 1S4FA 4UFXA 2CJBA 3P2HA 4X84A 3WQPA 1S7LA 3D28A 3OFFA 3DRSA 4EFDA 4UWIA 2AFXA 2ZH3A 4J9PA 2OR4A 4QCLA 1HW9A 2YX1A 4OL8A 4QR1A 2OMLA 4LRDA 3SV3A 2K7KA 2R2TA 3KLEB 2OLWA 2DHSA 1JLBB 3KLIB 1NKEA 2YY3A 3K5NA 1IOIA 2IVMA 4UOFA 1X0PA 2OUGA 5AJ3J 2OI2A 1TMMA 3S9LA 2F4VJ 3CJRA 3PG9A 2B4OA 2MLXA 3AQPA 1MNEA 2AFZA 2LEAA 2N7CA 3D6TB 4K4YA 3T5JA 1XNRJ 4D3GA 5DM6Q 2V8HA 2BQ3A 2MQQA 3BZQA 2F9JA 3PY8A 4WP9A 2E5IA 2Q7BA 2JLFA 2DKOB 1VQ9S 1SH2A 1VCTA 3M8QB 2GMHA 3MPYA 2B3UA 4RWWA 5G0RB 4OIXA 2HC9A 2OD6A 4KRWA 3CXQA 2AE6A 4NLQA 1UAWA 1NBEB 2W2QP 3AQOA 2FHJA 3QSYB 1UWBA 4ELUA 3LTOA 4KBIA 1W26A 4LRAA 4MIBA 2CY2A 3DLKA 3MR6A 1H38A 3M8WA 2JDDA 3UDLA 3OUYB 1I94J 5M2UA 4OLLA 3S6HA 1KSPA 2UVRA 1WELA 3UFCX 2MQLA 3KZWA 1RHJB 1HR0F 2VQYA 1K8AT 2QZ8A 1WWHA 4QR0A 2CPYA 2UU9F 3D7HA 5ETNA 1OSCA 3NAIA 1KUYA 1RT7B 2NSBA 4TY9A 3I96A 4A8FA 1GXLA 1RKIA 4K4ZA 2KRBA 8ATCB 3QWPA 2NUUG 1G4CA 3OL6A 3SSQA 4Z65A 2HBYB 3RNZA 4NLTA 2KO1A 1DY3A 3LP0A 5MAOA 1VBKA 3CCRS 3D2WA 1YK9A 3L3CA 2YPYA 2FCKA 5GAGI 5L38A 1S79A 1IKYA 1HNIB 2LEBA 1L3TA 3B7IA 2FZGB 3BJ7A 1R0AB 4UWJA 3TC8A 4DR5F 2X1GA 2Y0SD 1WDDA 5IS2A 4LQ3A 2RNEA 4FKYA 3L9ZA 2AP6A 2HS3A 1MWZA 1KOOA 4B6ZA 8RUCA 4H4OA 3RR7A 2GS8A 1CQMA 2HNYB 3SFUA 4XPKA 3CB4A 4AXJA 4HACB 3OD2A 1F5CA 2DXDA 3SIPB 2IBKA 4I4BA 2OH2A 1SL2A 3H42A 3N7ZA 1RLCL 4IO1A 1MU2A 2E7VA 2CPXA 2DPJA 1F57A 2AT1B 1S49A 1C1CA 2UXCJ 2MQPA 2G0CA 3BGRA 3W2WA 1R8AA 3FF3A 3OWCA 1FE0A 2VASA 4RW7A 1B7YB 4F2RA 1Z5RA 4F67A 1RAEB 1WC3A 5J2MB 1FTCA 3MPDA 1DQ8A 5B7WA 4O3QA 1J5OA 5LOQA 1RTIB 4YN3B 2P6TA 4TU7A 2GAHC 2J0XA 3B8HA 4PWUA 3MGDA 3D4UA 4XPLA 4B5PA 3TP2A 1H72C 1RTZA 4JV1A 2B3VA 1RE1B 2WPWA 2CPDA 4C9DA 2C1EB 2FXFA 5F41A 1OY9A 3Q8VA 1JKHA 4H4MB 2UVWA 3FEDA 2J8AA 4UOHA 3CCVS 3RBDA 3DDNA 2VZ9A 2BACA 1FK9A 3CJ2A 3LGHA 2FJWA 2BL1A 3BHXA 5LXRA 3ITHA 3KJFB 1NE9A 3WIUA 2A6OA 3LMSA 3AOCA 1N36F 2QVPA 5IWAF 3DXBA 3R7SB 2AEJA 2Y0MA 3BKFA 3PX6A 1RT2B 2XEFA 3SV4A 1IBLJ 3J7ZT 4F4ZA 3SI8A 3HSZA 3H8GA 3CPXA 1X0FA 3FKBA 3Q83A 1IQTA 4LF5J 2BM0A 3N28A 1KBRA 4OC0A 4EWTA 3N6LA 3MM9A 5A8RA 1BO4A 4MBUA 2HSEB 3C14A 4N77A 3GE9A 2CJYB 3H90A 4NLDA 2PJCA 2XYHB 4UUWA 4UFVA 4J7CA 5DQHA 1TKHA 5A8WA 3VGVA 2JH3A 4LIRA 5EGYA 5FDLB 4Y49B 4OYIA 3J81Y 4Y65A 2HIQA 2I5JB 4FVMA 2KFYA 1IICA 1RTJB 3MCSA 2F5GA 1IKWA 2M52A 2RU3A 5KG0A 2XZTB 1FE4A 3TCVA 4MFQA 4RUCA 3KG0A 4P2XA 3JSRA 2DEAA 3PB4X 2JEVA 5DQIA 1NKBA 1QJHA 2LU1A 3TT2A 3IAS9 4PXEA 3MEGA 2XS7A 4ICLA 4OC3A 1HDQA 3PZJA 1FO1A 1E6VB 5DM7Q 1VHFA 2F8EX 4OQJA 2VC1A 2CPEA 1VBZA 2ZHAA 5DDPC 2AWZA 4C3MA 3OLBA 4DR1J 3FCVA 3I4PA 5A27A 3ILIA 2H5JB 1L0CA 1LFPA 3PM9A 1T3NA 2IYGA 3K8WA 5K5MA 4NJRA 2RQ4A 4CZCA 1VK8A 2ZEMA 2KHCA 3KXDA 3T5KA 4PG8A 4IH7A 1ZLHA 4IUFA 3DDIA 4ZVGA 5DWNA 3EGZA 3Q8RB 3LGMA 4NI2A 2B4DB 2QL9B 2GREA 3OL7A 1M4LA 3K59A 2HLTA 4OZLA 1CX8A 2FC9A 5J1EB 5F8NA 4A8XA 3OXLA 4ECUA 5HH1A 2YNEA 4DOZA 3QQCD 2KHDA 3CVKA 3RBZA 2UUCF 1WACA 3T1AA 4JV5J 1E6YA 1BLUA 3T3FA 1JJ4A 1NJYA 2RE1A 4UFWA 1PAUB 3PZPA 1OQ6A 3W6SA 1F2OA 2BJ9A 5LYLA 2FJAB 2PN6A 1FA0A 3V6KA 1SKRA 1VMBA 3EPIA 4YS2A 5LMUJ 1FRMA 2BSWA 5HJXA 3I0RA 3UDCA 3G96A 4CM0A