3TX8A

Crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
360
structure length
360
Chain Sequence
DLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNVLARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLATSTELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLRIKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGVANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQVTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVAAILKQYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate desuccinylase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Hydrolase
total genus 92
structure length 360
sequence length 360
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tx8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3tx8A01
3PB9X 1TF9A 1Y7EA 4P6YA 5K8PA 1H8LA 4ZY2A 5LYIA 2V77A 4GM5A 5K8MA 2O4HA 4H2KA 3PBBA 4MCRA 4A37A 4A94A 1Y0RA 4A39A 3SJEA 2XEGA 3CPAA 3KR4A 1XFOA 3NFZA 1AYEA 3PBEA 4FUUA 4OKOA 3GLJA 3V7ZA 2V8HA 4NJQA 4OC0A 4IAVA 4ZY1A 2ZEMA 3VARA 2VL1A 3IO1A 3S9NA 4UIBA 4MXUA 5HVGA 3PB7X 2BO9A 3HLPA 2PE3A 3WC6A 1FNOA 2PVWA 5D8NA 4MHYA 5LYLA 4WJBA 4MCQA 1IGBA 2Q4ZA 2EWBA 1Q7LA 3GUXA 3KI9A 3B3SA 3JRUA 3RBUA 2CIJA 2I3CA 3SJGA 1IY7A 3TC8A 4ZX9A 4G1PA 2AFZA 4DUKA 4YWYA 4CPAA 1VHOA 4BD9A 2HB6A 3D68A 1ARLA 1PCAA 3K2KA 2PJAA 4NGNA 1CX8A 3SJFA 2C6PA 5CPAA 1F2PA 2PJ6A 3PB6X 3FF3A 2AFSA 5DS0A 4UEFA 4X8IA 1AMPA 5LRGA 4DJLA 3FH4A 4X3RA 2F7VA 3D66A 3BXMA 3KL9A 2ZOFA 2PJ5A 4MHNA 3KQXA 3B35A 2PJ2A 1Z8LA 1LAPA 2NYQA 4P44A 5HXDA 4KSIA 3ISXA 4UEZA 2OOTA 4IHMA 3LWUA 2PJ0A 4YU9A 1VGYA 4TNUA 2PJ3A 3I1UA 3IEHA 3B3CA 3VH9A 4PXBA 4JYWA 1YW4A 3RAMA 1HDQA 2GLJA 4P4IA 5CBMA 2PJ8A 2PJ7A 4P10A 1ZLIA 3SI2A 3PFEA 2PJCA 1TKHA 3KGQA 3TX8A 2GU2A 2JBJA 3B3VA 4NGMA 5I4MA 2ZENA 3DLJA 4P4EA 2RB7A 5HVFA 1EE3P 1FT7A 2CF4A 4NJRA 5JM6A 3IWWA 4ZX8A 2CTBA 2PJ4A 1YW6A 5K8OA 5HVHA 5LYDA 3IC1A 3GB0A 3IIBA 3RZAA 1RTQA 1ZLHA 4W9YA 3B3TA 3D7FA 2XEFA 1KWMA 3D4UA 3QNVA 4Q7AA 3K9TA 2ZEHA 4OMEA 4B6ZA 1CP6A 3H8GA 1YSJA 1GYTA 2JBKA 2OR4A 4DYOA 2G9DA 1CP7A 3H8EA 4JZ0A 5ELYA 5F09A 4PPZA 4NFRA 1OBRA 1TF8A 2EK9A 4Z65A 5LRJA 8CPAA 4F9VA 3D67A 1LOKA 3SJXA 2QYVA 2ZEGA 1LFWA 5LRKA 4FBEA 1BAVA 1M4LA 3V38A 4R8FA 4FWUA 4R6TA 3BHXA 4TWEA 1QQ9A 2V8GA 4ONWA 3S9MA 5IB9A 4F8ZA 3MRUA 2WYRA 3D7GA 5LYFA 2XEIA 2POKA 4P4JA 1HDUA 4ZY0A 1F57A 4LQGA 3PB4X 3N5FA 4EWTA 3B3WA 4P4FA 3NH5A 5JGFA 4EFDA 2AFWA 4R76A 1ELMP 3CDXA 4IK2A 3B2YA 1XMBA 2PJ1A 3KQZA 1CBXA 3CT9A 2QJ8A 5THWA 3MN8A 4PXEA 3D7DA 4MCPA 3SI0A 2PVVA 2ZEEA 3VATA 3FJUA 4UEEA 3CPXA 2NSMA 1XRYA 3WT4A 1Z2LA 3KHXA 3SI1A 3WC7A 4MRIA 1PYTB 3KR5A 4OIWA 2HC9A 4MCSA 4NGSA 2GREA 2PIYA 2ZOGA 2AFUA 3NA6A 4F9UA 4OC3A 2DEAA 4PQAA 1DE4C 1VIXA 2O53A 2WZNA 2AFMA 1QMUA 1HEEA 2BCOA 3KHZA 2IMOA 1TKJA 2PRQA 3LMSA 3S9LA 4OC5A 1CPXA 3BI1A 2XEJA 2J9AA 2C6CA 4P45A 4AXVA 2PCUA 2QVPA 1DTDA 2Q51A 3FX6A 3WC5A 4ZYQA 4PXCA 3D7HA 4OC4A 1F2OA 3NH8A 1LAMA 1R3NA 4RUHA 5K8NA 3IFEA 3FECA 3PRTA 2ZELA 3WABA 2AFOA 2BOAA 1YMEA 4EMEA 1VHEA 2JEWA 2PJBA 1TKFA 2RFHA 2Q43A 1ZG9A 3IJ3A 4R7MA 1LANA 4PXDA 3PFOA 2PJ9A 2GLFA 4NGRA 5D29A 4OIDA 3FMCA 4P4DA 1ZG7A 3B7IA 4X2TA 1YLOA 4MHZA 4NGTA 3FEDA 2V8DA 1ELLP 1UWYA 2CTCA 3FVLA 5J1QA 4MMOA 3FEEA 1NSAA 3KZWA 3L2NA 2IQ6A 2ZEDA 3H8FA 2ABZA 4A38A 1BPMA 2PIZA 3BI0A 2V8VA 2C6GA 4UF4A 2IJZA 3PB8X 2ZEPA 2EK8A 4MHPA 4NGPA 4OC1A 4OC2A 4WWVA 1TXRA 3DGVA 4NGQA 2ANPA 1BLLE 1Z5RA 1CPSA 1XJOA 3NH4A 1BPNA 1Y0YA 4FAIA 4OP4A 1JQGA 1XBUA 4P4BA 5JH9A 3ISZA 3PEIA 2FVGA 4O23A 2AFXA 2ZEOA 4UIAA 2F8HA 3T8WA 1LCPA 3HUVA 2C1CA 1R43A 7CPAA 6CPAA 1CG2A 2ZEFA 1ZG8A 1ARMA 4ZI6A 4K3NA 3KASA
chains in the Genus database with same CATH superfamily
4L73A 4PG8A 2MQ8A 3DRSA 3P4UB 2FZKB 5F8IA 4RW6A 4FZVA 1E6VA 7FDRA 4F36A 2OPPB 2MLXA 3SJEA 5HN0A 1CC7A 3NRBA 2BA9A 3BPSP 3GP9A 1REGX 2ILYA 3V7ZA 2M2BA 2VKZG 4A8OA 3W6XA 3C16B 1QJHA 5IM0A 3U1LA 2REFA 3UVJB 2AGQA 2CQBA 2YKMA 1TK0A 3I32A 1FJ7A 2AT1B 2B4OA 1Q7LA 4NXYA 1Y0HA 1MROB 3KLIB 2J6UA 5E2QA 4YY3J 1RA7A 3S6EA 4AL6A 2AJ1A 1W2IA 4YS2A 1VHFA 2OI2A 3I4HX 3BYPA 5FLXY 3MPWA 2CPJA 2VV5A 1IXKA 1CJVB 3C19A 3M8QA 1JLEA 3H4BA 3D0IE 3NP5A 3CJ2A 2C6PA 1VI7A 1SQGA 2DR7A 2J7UA 3H4QA 5DS0A 1YZ7A 1S0VA 3KLVA 1AMPA 5LRGA 2OPRB 2ZHAA 3EVWA 3SEOA 2V8PA 3BS9A 2IM0A 2VONA 4F0HA 5KT5A 2CPFA 4B08A 1S77D 1GX6A 2YGWA 5L1KA 1LAPA 4M5LA 2R1IA 5G1ZA 4OI4A 4CO5A 3K5MA 3EYZA 4LSNB 5E7OB 2WSAA 1N33J 3HSZA 1SC3B 3I9V9 3IBCB 2KZZA 1BWEA 3N6MA 5J1NA 2GLJA 2NZ4A 4Y2AA 4NEXA 2YY3A 3PTWA 1TKHA 2OEKA 2GC8A 4IG0B 1GXLA 2B3UA 2HAIA 4IOBA 2Z2MA 3HXMA 1KUVA 1T9YA 3JSBA 4DV6F 2PDAA 1QSOA 3WX8A 4CAVA 1IKVB 2CZ9A 2CF4A 4JI2J 2DXEA 3CB4A 1X9MA 3SXLA 2R7OA 3B8HA 4CM0A 2LMIA 2H5IB 2B9YA 2LYVA 2ZOMA 2CPYA 1Z4RA 1U7LA 1TQLA 1TK8A 4AUKA 4L89A 3CC7S 1YSJA 4KAIA 2KJVA 3MM7A 1NHUA 3PHEA 4KLWA 1U26A 1QSLA 1R27B 4Z65A 8CPAA 2LDIA 3KLHA 4IFVA 3MMBB 4ELTA 4LF9J 2XMAA 1SJFA 1BAVA 4KGXB 2FXFA 4KYZA 3BHXA 1PJ5A 3FCVA 3LTOA 2HWHA 3Q8YA 4NLYA 1WI6A 4LFBF 5CQGA 2AJQA 4WKYA 3I4PA 4ONWA 1QDUB 5AG5A 4CTAB 5IB9A 3NWRA 2PSZA 2DKOB 1FRIA 2CPXA 1B64A 4RW8B 4LF2A 3SHPA 4TYBA 2FL4A 4OX9J 3FRYA 3PACA 3R6LB 3FJ2A 1NUEA 4DMZA 2RD5C 3KHHA 1N32F 2C1EB 4DV1J 3IWEA 3R2CJ 2DNZA 2XZTB 3C3LA 4KS9A 4W90B 1C0UB 5KG4A 2PVVA 1S10A 4FYVB 1V0CA 4PRFA 4URGA 4MIBA 2H4YB 2B56A 1HR0F 3DLEA 1RTIA 5KTAA 3WT4A 2J8AA 2V4JB 1PYTB 3KKWA 3CDBA 4KOSA 3U1NA 1FY7A 3DGPB 4LUBA 5HH1A 4B5PB 1NNDA 2AJ6A 1TKZB 4DF4A 4NL5A 2YTCA 3RUBL 3BSAA 1TKXB 1TL1B 3GMGA 3TZXA 3JQMA 1U6FA 2AFMA 2LEBA 2M3DA 4DV0J 1R8PA 1R8BA 3PR4A 4K30A 2XYGB 3MAHA 4UQGA 3B78A 2E9RX 4P74A 4RU2A 2N82B 5DQGA 4KSEB 2WB1D 4CDIA 3PRTA 1X0FA 2B5JB 4PKDB 3T9ZA 4M94A 2BE2A 2M70A 3ET6B 1HBMA 4I2QA 4C11A 4P6QA 2KG1A 3BQ0A 1UVIA 3K5PA 2VFSA 3T6BA 1U4BA 2QMUB 1U0HA 2B5GB 2HWIA 4RW9A 4DOZA 5HSPA 1KVKA 3A8IA 3EGZA 3RNZA 2F9JA 2K1RB 3QGHA 5E96A 2LQJA 3SMZA 1YREA 5F8LA 1SI9A 5EGYA 4JI5J 1NSAA 4G1QA 2ZZNA 1ZAWA 1YRUA 2HLTA 1CSJA 1HLWA 4MT1A 2ROEA 4DR3F 3ENWA 4OC2A 5F9NA 1G2EA 1T03A 2JFDA 2DY1A 5IS2A 1NO8A 3JSRA 1Y0YA 1QVGR 2GS8A 1M1GA 5IQQA 3EC4A 1RTJA 2ZDPA 4F02A 2GAGC 4Y2MA 1NJXA 1AFJA 1ZS6A 2BRKA 2R8JA 4NCBA 4MY0A 1F6TA 4PWWA 3RB0A 5A28A 1RXTA 3NS5A 3MAAA 3R3TA 2XS2A 4A94A 3US5A 2P6FA 2C2ZB 3KFWX 1ICEB 1CLFA 3FQLA 1S9FA 1R0AA 3KJNB 4X66J 3W2WB 3DYAB 4ED3A 2ZEMA 3VWEA 4DR1F 2D3ZA 1WC0A 4V19X 4ZVTB 2DGTA 5HVGA 2W7OA 1T9VA 2OUGA 3WC6A 2GMJA 3TEHB 3DU5A 5C7PA 4B5OA 4I7FA 2J8MA 5C24B 3KI9A 4MFBB 4H6UA 1BE4A 2IVMA 5KFSA 3QWUA 1RAJA 1FTRA 1IY7A 5JPHA 4OHVA 1VHOA 1E6YB 1AW0A 1TKTA 4OI1A 1KC8T 4NGNA 2BEFA 3SJFA 1DTQB 3EZOA 1N54B 1S6QB 4IDKA 3IGRA 3DOMA 3OHAA 4OZLA 5AGEA 4X8IA 3PY8A 1VLYA 3VR1A 2P6SA 4GVBA 2EVNA 4CO1A 1TL7A 4G6VB 1UETA 3NLCA 4ZP8A 4O44B 1RBOB 1WJ9A 3DLKA 2DH8A 2HQ3A 4JV5F 1HMVA 1EQ0A 4HT7A 5L39A 3H5ZA 2PJ8A 4OJ3A 2MKIA 2RC4A 3PFEA 4CGMA 2QO3A 3EWGA 2CNMA 1TU0B 1UAWA 2GAHC 4OI3A 2DK2A 2FJXA 2FVPA 2G0IA 2G1DA 4PWDA 4NLPA 2I5JB 2ATLA 5C2CA 3G8TA 2BBEA 2G2OA 4DV2J 3MPYA 1KLNA 4W9YA 4C6AA 5KFHA 1FKPA 2QE5A 3UE2A 1F3FA 3V8IA 4AVBA 3ZTOA 4BWMA 4A8FA 5AE1A 1NJYA 3SSRA 5IX3A 2J6TA 2AF6A 1M4LA 3NKYA 4OAEA 1KQSR 3T19A 4OZJA 2V69A 1QQ9A 2FVRA 4N7TA 2NYHA 2HMIA 4ZHRA 1VLOA 2CG8A 2RMLA 1NM2A 3PZPA 1YBTA 1VQ9S 2QA2A 1CS4A 2KXNB 1F57A 1YIJS 3UDEA 1X7VA 1IYLA 2KYZA 1YQEA 3FSYA 2HEKA 4RWWA 4EFDA 3DRSB 1YJTA 2J9DA 4RW6B 1E6VB 4JV2A 1D09B 2EK6A 2R8GA 2V4RA 5EWFA 1F1BB 2F1FA 4ID8A 3RAXA 5C88A 1MLAA 4PZVA 2HFUA 3GV8B 2BSWA 3EFAA 3WC7A 1JJ2R 3CIMA 4A8WA 2J8NA 4EZ6A 1NU4A 2BACA 5IM0B 1U2CA 1NPPA 3PR5B 2CVIA 4JB8B 5ETQA 2YKMB 4J9RA 3TQ1A 4DV4F 2JOQA 4CLKA 4RL1A 2CQ0A 1O8BA 1G6BA 3HSGA 1Q7LB 3RRGA 1WEZA 4CH0S 3HHLC 4IF5A 4TLRA 2CJBA 4RZRA 4FYWB 4U5YA 2J9AA 2FC9A 2ZBCA 1HWJA 4MIAA 3ICLA 1NJZA 3M8QB 2HV2A 1JLEB 1FX4A 5B0GA 4ZYQA 1YJ9S 4C8ZA 4OC4A 2FQQB 2AD9A 3IBWA 2D41A 2EPIA 4X62F 2B0GA 4QBJA 1R3NA 3MUVP 1NXIA 1M5KC 1VBYA 3QJJA 4B3SJ 2MKJA 2CQDA 4U7UK 4C2XA 2RDDA 1VQLS 3HLUA 2WK4A 1OO0B 5HROA 4PR6A 5ETRA 4EVYA 5I0CA 1Y9KA 3NMRA 4CAEA 4U8YA 1RB0A 4CGOA 1X9WA 3R5DA 4BINA 4ETZA 5E3QA 1P8GA 1RWUA 2VUGA 2CDRB 4O3QA 2IJZA 2DJWA 2DPTA 3LALA 5D3GA 4MHPA 2H5EA 1CQMA 2PT0A 2VPWB 1JXVA 5IV0A 4FAIA 4V19J 2RNEA 5HLFA 1NRKA 4UZCA 4J9SA 4CLZA 4ZPTR 1TL4A 5EDWA 1HI0P 3MM7B 6CPAA 4N56A 4BHQA 4DV5J 4Y0FA 2FD2A 4WU2A 3EE3A 4YB6A 5U47A 2V77A 5D8HB 3KLHB 1XERA 4GM5A 4LBHA 4IFVB 4ZVEA 1W7WA 5F9LA 4I67A 4P2XA 4DL0C 2UUTA 2F4VF 4HT5A 4IAVA 3DRRA 2ZPAA 4UUXA 1EAYC 2W7AA 4MXUA 3ELHA 3MI7X 1KOHA 2Q6CA 2PE3A 1H73A 4UWIA 1FO1A 1LW0A 2OLWA 2YNIA 4OLLA 2IM2A 4A8KA 3JTOA 4C48A 1RP5A 3MHYA 3TANA 2BM0A 2HZAA 2X3GA 2IIHA 1JIHA 4ZLPA 4RNFA 4U6PA 5F0WA 4ZX9A 1Y3JA 2F40A 3VZIA 3KK2A 5G22A 4YWYA 4OI6A 4BD9A 2DNNA 3AODA 1SXLA 3JXOA 1PCAA 1UVLA 3KG4A 1S48A 2ADCA 2B3TB 3DLEB 1IQTA 2JEVA 1RTIB 3MEDA 1I1GA 2C22A 3FEYB 3R9LA 2FPHX 1KUYA 4DSLA 4GS4A 3NAIA 1CQNA 3TFYA 3G8QA 3D66A 3BN7A 1OPZA 3OFEA 1Q53A 4A48A 1NEEA 4L75A 2KM8C 1SQEA 1VGYA 3NOCA 3G6VA 3SV3A 1AROP 2QFJA 4ZP7A 2LLZA 5HQ8A 5CNPA 4AVCA 3GR0A 1DLOA 4CZCA 3SI2A 2ZNYA 2LDYA 3ZZPA 5BR8J 1SJ4P 7FD1A 2ZENA 3R7SB 1QSMA 4CO4A 1RWMB 2WSCC 1PIEA 5HJXA 2BE2B 1HBMB 4V1Ak 4X4QA 3CF5Q 4I2QB 2UXCF 2BW7A 4NJRA 4C11B 3H5XA 4MK9A 4R0EA 2MJUA 4EYIB 4CI0B 2XGQA 2ZM6F 1U0HB 2MLZA 4RW9B 1KD1T 3TVZA 1SKWA 4A2ZA 4LF6J 3KUHA 3R5JB 4C7IA 4E8OA 1P6TA 3ILJA 2HHUA 3VALA 1UJ6A 2C2NA 3Q86A 4G1QB 2HQGA 4PPZA 3MR2A 4BC7A 5DJBA 2ACYA 2K7JA 3LF0A 2QRRA 5HMZA 2HQCA 1VFJA 1OY8A 1FF2A 2MKHA 2WONA 1Y7RA 1T03B 2W7PA 1R7IA 1UVJA 1NDCA 4ZVFA 1Q16B 2WYRA 4Q36A 1RTJB 3OJSA 2XEIA 4B3RF 4QZVB 3TTHA 3A8KA 1GX5A 2EI5A 1UWAA 1FD2A 2VBXA 4UW2A 3MAAB 4ZPAA 5SUHA 4C8KA 2AFWA 1XIQA 3W3SA 1Y9WA 1Y5NB 4KFBA 3KQZA 2V67A 5HANA 2OP5A 1CBXA 1VCTA 1R0AB 4IFYA 2WUUA 1IB1E 3HHLA 2BQUA 3DI6A 4QIGA 2HGNA 5KFDA 5DDPC 3MM8A 4MJ8A 3M8PA 3EO4A 3KR5A 3M9MB 4DR6F 1Q8BA 1Q95G 1P0HA 4I7FB 4LF8F 1XOVA 3CCJS 2E9TA 1FWPA 1XN9A 2GA7A 1VKCA 4KR0B 1I94J 1L3KA 2ZFHA 2F3JA 1IM6A 4FXVA 4KHMA 1F9HA 3IRWP 5KTDA 2BABA 1CPXA 2KZMA 4OC5A 5IT4A 2L08A 4AXVA 4X64F 4DN0A 4OHXA 1TKTB 4N47A 4TQSA 3HM9A 3QT8A 1A9NB 3PYDA 4EZ9A 3O5TB 1ZOTA 2XEXA 3MEGA 4IDKB 3DOMB 2W2NP 3J81U 4GVBB 4JI6J 1OMSA 1TL7B 4YHHJ 2B7CB 1TKFA 1VOMA 2PGCA 4CQ1A 1HD0A 3LP1A 3AJ1A 2J9EA 1U1OA 2OTLS 3KLGA 3DLKB 4NWBA 3H5SA 2B58A 4OZ5A 1HMVB 5HK4A 4AE5A 4B9TA 5HMXA 2XGPA 1KFSA 2HVIA 2M0GB 1U8WA 5A76A 2KYXA 1SL2A 4R57A 2FJWA 2FHOB 1KNZA 4KOTA 2VG7A 3FK4A 3TQEA 1XR6A 2BQRA 1RXOB 3THTA 2F8EX 2ZEPA 3SXNA 2MKKA 2RE1A 2ASJA 2Y8YA 2MQOA 3FZ2A 3U1MA 1S7NA 2BE7D 2CQPA 4PWDB 3M6VA 4O0IA 4RBUA 2CPZA 1YRXA 4USHA 4ETXA 1DRZA 4G3IA 1JQGA 1XBUA 4TVAB 5JH9A 1FKPB 2ZJPQ 1S1UA 1BQXA 2BRLA 3PX0A 1S6OA 2B3VA 3EUNA 3I96A 1ARMA 4DCPB 4DQIA 4RU9A 1TF9A 1BMQB 3IGNA 5KG6A 5KT3A 2O4HA 3PBBA 3QGGA 1VQPS 2R7UA 1KONA 2J0SD 4L76A 3NOGA 1VQMS 3CJTA 1DY3A 2AV5A 3Q24A 2CQ4A 3RJMB 4BBHA 2HMIB 3NMAA 3ZZUA 4ZHRB 3VV2B 4O3PA 4R25A 5D4PA 2XMTA 3PB7X 5AXMA 3H8YA 4I0WA 1CS4B 5M2RA 2J9CA 3BH7B 4IG3A 3PEHA 1WTBA 5IWAF 4X4OA 4OZ3A 3RBUA 2GGPA 3L7PA 5IV3A 3W7BA 4CGNA 3V81A 1UTAA 1WKLA 1FWLA 2FIWA 3FSXA 2UU9F 2MQPA 3F5BA 4DSEA 1ON0A 3CJKA 5E3AA 1SC1B 4IOAQ 3O8WA 4JI7J 3CC2S 5K14A 2WZ1A 3ZZIA 3KL9A 2CJQA 3ZZTA 5KFWA 2E5HA 4FP9A 3LGHA 1T7PA 1L0CA 2W8LA 3LWUA 1S99A 2PJ0A 1NZ8A 5D4NA 2X7IA 3GONA 4WZMA 3IEHA 4OIXA 3KHLA 1ZTWA 1RCXB 4LX9A 1IBCB 4WPAA 1FK9A 3QLHA 1NDPA 4I6YA 5EX0A 2I9SA 3JQKA 2IDLA 3F8KA 1N52B 4KUAA 4P4EA 1MSWD 3QPIA 1XTZA 4RWXA 1FESA 4TU9A 2IPOB 3UCGA 2OTJS 2GJIA 4O4GA 5HROB 2A3JA 4LFAF 4AYBD 5KFVA 3MCNA 3N9UC 1ZH5A 3QNVA 1S6PA 5IC6B 1REVA 2DO4A 5B0EA 3W60A 5LSRA 1FRXA 4HH1A 1Q0NA 2AMCB 2R2SA 3SFUA 3H8EA 3CDAA 4WP3A 2FIUA 4F9VA 4C3KA 4LR9A 2MKYA 1GXTA 3D67A 1IBKF 5ETTA 3RB3A 1ZM3A 5D3GB 1UKUA 2DGWA 1J2VA 4A30A 3DRPA 2FLNA 1OWXA 3K9UA 1S1VA 2ZH5A 1D3WA 2Z3PA 2RUSA 2RKIA 3O3LA 1PYOB 5E41A 3R1KA 5HLFB 4KLVA 4MAKA 1TUWA 1N5TA 2HQFA 3PCOB 1KQFB 1CC8A 3BREA 5KT4A 2Z2ZA 2G3TA 2RQ4A 4DPTA 3NH5A 2KJWA 5JGFA 4M5JA 1YBAA 2ZVIA 3NGUA 4MI4A 1X5OA 1U0SA 5J8CA 2KDOA 1FCAA 2NXEA 3DSBA 4PAAA 1HBOA 2HBRB 3J81j 1HBNA 3CO9A 3RRKA 2LU2A 3S6HA 1B87A 3GYXB 5AG4A 4OZ0A 4GO5X 3DRRB 4M63A 3D6HB 3SCIE 3IM8A 3VGSA 2ZOGA 1LW0B 3H59A 2YNIB 3GILA 4Y6IA 3AOBA 2WZNA 3H98A 1M1KT 4DL3A 3TE4A 3A3OB 3KK2B 3LGNA 2QVPA 3K57A 1PYSB 1TVRA 2YPYA 4MY3A 2AEFA 5JJBA 3MEDB 2CNKB 4YR0A 4UA3A 2AHOB 1YVOA 2UUAF 1N71A 3SSQA 1KFDA 3DRXA 1H0HB 2ZELA 3WABA 4YR2A 4B3MJ 3O2IA 4I4BA 1YMEA 4YB7A 1YHQS 3IWLA 4C2YA 2CJYB 3D2PA 2PJBA 2HIQA 3M8RA 4W4MA 5KFCA 4Z7CA 2FGCA 3HFZB 3SXOA 1HQEA 2JFKA 5A6PA 1NMEB 2X1AA 1RADB 3FMCA 3R9FA 3B4MA 3OL8A 1DLOB 4A8QA 1HBUA 3LP0A 3RBXA 1RT3A 2V8DA 3FFIA 3SDEA 1WHXA 3HP6A 3B6BA 1RHMB 3MMAA 1MMLA 1Q79A 2D4OA 2ZEDA 1Q8KA 1U1LA 2JNJA 1I1DA 1IOIA 3MM6A 4A32A 1VQ5S 3L95X 1PU9A 4NGPA 2QLXA 3FEXB 2Q44A 4OHYA 1RHJB 3UN2A 2HBYB 1JLBA 4NGQA 3UN5A 1BLLE 5CAAA 4DV7F 4DQRA 1DFDA 5HL7Q 1XJOA 4NASA 1GT8A 1WD6A 1G7CB 4H6ZA 1TFWA 4J9QA 1X5TA 4O3NA 3PEIA 2AFXA 3EM1A 3J7A1 2DEJA 4MFLA 2GQ2A 4USUA 3N01A 3GYAA 4HEA9 3VVUA 1NJWA 3T5JA 1M1HA 3M2VB 4II9A 3S6KA 1WKJA 3BSCA 3EGWB 1PJ7A 1OZPA 3W1YC 3GQCA 1LWEA 1WC4A 1RU1A 4OLOA 4OJ1A 1CEZA 1DHMA 2WONB 2UV8A 2VASA 3MECA 4XPDB 3EY5A 4QPXA 4LF5J 2H65B 1TK5A 2ALZA 1HNIA 1N34F 2KFNA 1XEBA 3ULHA 2HNZA 2HHPA 2JVRA 1UP1A 3RR7A 2B9XA 2XS5A 1O6XA 4OLPA 4ED6A 4OC0A 3N6LA 1RAEB 1F9EB 5CCLA 1QVFR 2BANA 1VJWA 3A9LA 4NLRA 5DLGA 3EXYA 2HHSA 1M5VC 4C8YA 4LRAA 2Q1LA 4MFPA 2BW2A 3PYEA 3W61A 3Q83A 4LJMA 1RHQB 4NLOA 2V0NA 4KFBB 2B4UA 3T1YJ 1CJUA 1RZMA 4IFYB 1S6UA 5DO2A 2FVCA 3HHLB 4GKKJ 3R97A 3DI6B 1IM4A 3R7BB 2QMLA 2IRYA 3L09A 1X60A 2LXIA 2PFDA 3MM8B 3NE7A 3BKUA 4YEAA 3M8PB 4A95A 3ZJ0A 2CPDA 4UUWA 4NLSA 2YQ0A 4F3QA 4KT0C 3UQSA 4TXSA 2UVVA 3OW2R 2Q79A 1FHTA 3MD1A 2OOTA 1Q2CA 4GKJJ 4K4ZA 2EFPA 2PRBA 1FFSB 3BR8A 2J5AA 2W9BA 4HACA 3MCMA 1YR0A 4CYNA 1XMQJ 2KH9A 3FRZA 4KZTA 1RT2A 1QUVA 3CSKA 1HDQA 3ZFVA 3T3FA 1N36F 2PJCA 3MEGB 4J9KA 4GRSA 4K0KJ 3WBZA 4ECVA 2FHJD 2VB6A 3THVA 1N5QA 3ZTSA 4CLWA 2VPZB 3LAMA 2CA9A 5F41A 1FJGJ 1ITPA 1EE3P 2QSWA 3GSDA 2Q66A 2ZE2A 3LP1B 4LIRA 1RT6A 2QL9B 4CLLA 3KLGB 1DAXA 4KV8A 3VWDA 4K7QA 1NSPA 5HVHA 1KVJA 2MZTA 3IIBA 1KBRA 3QFWA 3KTQA 2BJ3A 3M30A 1KWMA 3EPIA 3O44A 4JI4J 4OMEA 1M5HA 4ECYA 3KJQB 5KOXA 2B6AA 4MFQA 3GJRB 3OXFA 5F3TA 1JJHA 2VG7B 1OBRA 1TF8A 4KVXA 2C42A 3HJFA 4QWDA 3KHRA 2QYVA 3NGKA 2JHEA 4FBEA 2AJ4A 3HMJG 4YMEA 3PV8A 3CCUS 4MHDA 2HHXA 2XTJP 5HATA 1Z8TA 2YNDA 1EJ7L 3GJTB 1KR4A 4KHPJ 4C2ZA 2A10A 2IDEA 2V8GA 4LT6A 2E9ZA 1HA1A 1PJ6A 2KXFA 3UI3A 1UVKA 2ZZMA 1VS3A 1ZM4A 3FGVA 4CNZA 1S1UB 3RB6A 1YX2A 3A4TA 3PO4A 1YK9A 4IH5A 4F3OA 4P4FA 2AGPA 2CVEA 5HMYA 3VTIA 2CJ9A 1ELMP 4ZOSA 1RTHA 3B2YA 5KG2A 3OQ2A 3V4MA 4G65A 3D7DA 4DJBA 3VATA 3QT6A 2VOOA 2RU3A 3UO0A 1F60B 1FTCA 4K4WA 2PC1A 2HHTA 4LVOP 3DM2A 2DPSA 1T9WA 4IG3B 3RGIA 1JLQA 2O53A 2OFHX 3BJ8A 2K5TA 1SIWB 2VFTA 5G4DA 4B3OA 2GGPB 2BUEA 4DQQA 2DT9A 4U7UD 3R5AA 2YNHA 1HQ2A 1M4IA 3UW1A 1AUSL 2FDNA 4JXRA 4ZCLA 4ZN1A 1X31C 2JWNA 3CJKB 4DHVA 1SH0A 3KG0A 3JAMU 2VJVA 1HWLA 5K14B 2NUHA 4RPFA 1FVQA 1ZZNA 2BOAA 1SL1A 1Q2DA 4C8NA 4KGVB 2IM1A 2V5HG 1BWVA 1EQMA 1AB8A 4J7CA 3HVRA 4RO0A 3IN5A 4OHWA 4A8SA 1LWCA 2HYIB 3LGMA 4LSZB 3V4IA 1GFWB 1I5OB 4QJVA 1FJCA 1MK4A 3J80Y 1GAOA 2RILA 1ZG7A 3R1LA 2XMWA 1JXLA 1FK9B 2JC0A 3QLHB 1WHVA 4ANCA 3FEEA 4WXWA 4TYAA 4X5KA 2IFXA 2X7BA 2Y1JA 2IQ6A 3QATA 4DV6J 3UD5A 3MR6A 4ZVUB 4YFJA 3OFGA 3W62A 2ZW7A 4QWEA 4I56A 5IQ6A 4WWVA 3MEKA 4B3TF 4O4GB 3I9SA 2BJDA 4B12A 2ANPA 4ED0A 3NNCA 2JDDA 3EX7B 4F4WA 2RAQA 4O23A 1S6PB 1REVB 1S7KA 2F8HA 3HUVA 4DUZF 3OR2A 3FUYA 1S0MA 2BDPA 2MZQA 3BF4A 2AU0A 3R9EA 1Y7EA 5K8PA 2GW8A 2WSEC 2UUBF 2FYXA 1EZZB 2A6MA 3TJ8A 3OL7A 3HSJA 4DFPA 3DRPB 4PG7A 2CG4A 2DGQA 3PVXA 4NCAA 1UFHA 1S1VB 3KR4A 3I31A 3CJQA 3PBEA 4FUUA 1W25A 4ZIVA 2CWKA 3M9NB 2RKIB 2CRLA 2XMKA 2PD1A 4LUAA 4IR9A 1WG4A 3WC2A 5AXKA 1TUVA 3MMJA 2HVHA 2Q7BA 1Y5IB 2PMWA 8AT1B 2KVIA 3DHXA 5B0BA 2QLBB 2G2YA 1N32J 4MHYA 2YQ1A 4Q0BA 2NXCA 1V3SA 1IGBA 5D77A 3QAUA 1T05A 2CQGA 2HNDA 1YRTA 1KDNA 1HBOB 3MCOA 1G4CA 1H7WA 1TAUA 5GVQA 2WOMA 3HT3A 2YNFA 3VVTA 1HR0J 1HBNB 2EC2A 5FLXU 4DR2F 2FZGB 1KTVA 4C0BA 4DCOB 1OYDA 2RUGA 3AD7C 1U6ZA 2JRSA 3JS9A 2XO6A 2M8HA 5ETOA 4EEYA 2Z3OA 3MGJA 2PJ5A 3BBFA 1Q5YA 2HIYA 5F8HA 2EXUA 1LXNA 4P44A 2Q0YA 4YUDA 1SQHA 4YU9A 9RUBA 1EX8A 1NSQA 2GVZA 1UFKA 1I6JA 1F5CA 1U2FA 5KFBA 3HF5A 1ZAVA 1N6QA 1YW4A 1YVFA 1TVRB 4OYWA 1RWVB 1NKBA 5J1EA 1ZLIA 1UJ5A 4JLYA 1EIYB 2JBJA 5D4OA 2P6GA 5I4MA 1RACB 2BJEA 3G3SA 5DDQC 3RB4A 3EZUA 1DZ5A 2XYHB 4ZPVR 3KLEA 1VK3A 2E5LJ 5JM6A 1P4NA 5MAOA 3LPEA 4DR4F 2ZJRQ 1HQEB 3IS9A 5KT7A 2RRBA 3DDNA 1NDKA 4DS4A 2LA6A 1HBUB 2PR8A 3LP0B 2RQKA 1RT3B 4RW7A 3D7FA 3FFIB 3SDEB 1Y00A 2JBKA 3MMAB 2EKYA 4JZ0A 1JLAA 2MEWA 2GHVC 3MM6B 2XQCA 4DR3J 4PK2A 1LFWA 4NPOA 5FIIA 2CIMA 2CNNB 5DS7A 1FKOB 4R8FA 4XNHC 4FWUA 1V5IB 4P2MA 4J9PA 1SIZA 2VEZA 3BKFA 5LMUF 4CH1A 5BYQA 4YP3A 2VA3A 3S9MA 5AJ3F 3D7GA 1JLFA 2OMLA 3OWCA 2J8SA 2YNGA 2DHHA 4NOHA 2HK3A 2W9AA 5DM6Q 3C14A 2KTQA 4L3KA 2MDAA 2MY8A 5CZVA 1PC4A 3CGIA 3D5MA 4ONUA 1HNZJ 1LWEB 4CP5A 1JXEA 1U09A 1RAAB 3K89A 4F4KA 3W5ZA 1VYAA 2LECA 3MECB 4NI2A 3CT9A 5THWA 2MKSA 2G9OA 5GAHI 2HZVA 3GKRA 5H9EK 1HNIB 1YJUA 4HPSA 5H9FK 2HNZB 3FBEA 1KLMA 4UEEA 4C2MA 2NSMA 5D0HA 4DR1J 4NEYA 1ULRA 2ZJQQ 1F5AA 4M5IA 3KHXA 4I6AA 4ITSA 4C68A 3I5AA 2BANB 2C3YA 5H84A 2V50A 3C6TA 3Q8RB 2OD4A 3CE8A 4ED1A 3NA6A 2H3EB 2ZH8A 4KBIA 2FLLA 4XDCA 2MZRA 3FZBA 3Q2TC 3MFIA 1L3VA 1CJUB 5KFOA 2YWFA 3GFXA 1F3VA 3FX6A 5F8GA 3EZ5A 1UZHA 4U9RA 5I3QA 4Q2LA 1SBRA 4NE9C 1IIDA 4CH7A 4ER8A 2O01C 5A2QY 2PQ8A 3X1LB 5KOWA 1WORA 4CLYA 1U48A 1D9DA 1JKHA 3HKZD 2Q43A 2ZH3A 2W9BB 1YI2S 1LANA 2R8IA 4HACB 3PNIA 5AXLA 3E3XA 2UXBF 4JV5J 4C0HA 1RT2B 1MWYA 2FJBB 4AL5A 4KTQA 3FEDA 3QO9A 4ENOA 2XY6A 1NHVA 3PRBA 1VC6A 4RI1A 4MKAA 1UW9A 1NAQA 3TUPA 3OLBA 3N4WA 3KOAA 4XPEA 3GJSB 3BI0A 2V8VA 2C6GA 5CABA 3AY0A 4WFZA 4K2JA 4KJIA 2ZE2B 4NA1A 4WP9A 4OC1A 4K4YA 1RT6B 3CD6S 3LA0A 2DGSA 2QA4S 4KV8B 2WSFC 1UA0A 1Z5RA 4EBCA 3BZQA 2FB0A 4U9ZA 3W9HA 2APOA 3QJPA 3G96A 3HT0A 4QCLA 3FMBA 3M30B 4X4UA 2FGOA 2EK1A 1QD1A 1SQFA 2HRTA 2PA3A 2B6AB 3CDUA 3CMQA 3WZ0A 4HR2A 1RT4A 3QGPA 5DZ7A 1IBLF 1D9AA 2DXDA 2RF2A 5ETSA 5LYIA 4X4VA 5HO4A 4ZJLA 4HNXB 4M85A 4H2KA 2XHCA 4A39A 2CUYA 3QMQA 3AJ2A 3HZGA 1FFGB 1RISA 2V2QA 2H5JB 1BOBA 2BEIA 1AYEA 3LPYA 3T9NA 2ROPA 4FVMA 4UFXA 4OYZA 1M5SA 4NLWA 1KOOA 2K8GA 2O1PA 2F4FA 2DBBA 3Q0AA 4IUSA 4FD7A 3SZ2A 3DNSA 4CO2A 1FNOA 3BM7A 1S57A 2OB0A 4DF8A 4NYZA 3T6JA 3U02A 4I69A 5LSLA 1XJWB 3HCXA 5EMIA 4ED7A 1RTHB 4RS2A 1Y3KA 2YKQA 4O3RA 4YB1P 4QYZJ 3KG1A 3NGSA 2BYCA 3E8OA 4I2PA 1Z9UA 3EGVA 2PJAA 1H2TZ 2DNRA 4DWIA 5E3RA 2W4DA 5IT9Y 2PA8D 2PJ6A 2IRXA 3PB6X 4HYKA 3QBCA 4K4VA 2OO4A 4DV4J 2W2PP 2ADBA 3DM2B 5CZXA 2PI5A 3OLAA 1RBAA 1L5UA 4C9DA 3B35A 2AZ3A 4MYUA 1JLQB 2GHPA 2MXYA 5KFXA 4B3OB 4WF9Q 3FIXA 1IR0A 2IRUA 2MY7A 2D7SA 1BD6A 2XLJA 1NCLA 3RW7A 4A47A 2PEBA 3DFEA 1U1RA 5KG1A 4OL8A 5F8NA 2ERRA 4J9VA 3BGFA 4NLDA 1TTHB 5CH7B 4NXMF 4X62J 1VMBA 2YNHB 4JYWA 3KNGA 5CBMA 3UD4P 3GIRA 1S1XA 2CZ4A 1Y7PA 5B0FA 1NH8A 3V5RA 3M6WA 1WDDA 3G82A 5EX3A 1WSRA 4A46A 4OJGA 3PRVA 3D3SA 3P3DA 4W92B 1IR1A 4IH6A 1Y9OA 2YPZA 1FT7A 1NLKL 2UV8G 2R42A 1LWCB 1LEOA 3OSPA 1B7FA 2KHCA 2CTBA 3WQPA 2ASLA 1U24A 1NK8A 5LMNF 4CS0B 2GIQA 4X4NA 3K17A 4QOTA 1U49A 4LFCF 2LU1A 1YKWA 2N4DA 8ATCB 3JUWA 5EWGA 4JP8A 4RUAA 1S7LA 1Z1ZA 5EC4A 2DH7A 5CYJA 5A0YB 2DTJA 1N0UA 1OSCA 1NJIT 1IWAA 4U96A 3BO3A 3M2UA 2K3KA 4YDDB 2OH2A 2Z0GA 1WF0A 2IBKA 3TCVA 2KRRA 4M6GA 3OR1A 2AJ0A 4HTJA 1WACA 5ADZA 1Q78A 4RBVA 1C1CB 3AA9A 2CQCA 2NR0A 2HURA 2Q4YA 2PMHA 3VAJA 3RG6A 3A1YG 1QAIA 4DDFA 3OR2B 1TFYA 4DR7F 1R8HA 1S79A 2DH9A 1M4GA 3B3WA 2EG2A 1DTTA 4NRUA 3IBFB 4NXNF 2J0WA 4R76A 4TN2A 3IAS9 3A13A 3P45B 5GAGI 1XMBA 3VAGA 3L4BC 4B11A 2BXJA 4MKVA 3TAMA 3MN8A 2QN6B 1B0PA 5EBVA 4FDFA 2F4VJ 3ILIA 4MFJA 1MN9A 2ABYA 2JLEA 2CNOB 3TA2A 3MOZA 2P2CB 2Y0MA 2QGFB 1UW4A 4BDPA 3GYNA 4O4RA 2PIYA 4Y49B 2QG9B 4Q0BB 3G9CA 4IUFA 2DNQA 3H20A 3EGNA 1TL3A 1VIXA 3TARA 3M4XA 1T05B 3G6XA 2HNDB 4IYQA 5ETVA 5JUMA 1HEEA 4LQ3A 2XMVA 1UMJA 4HKQA 2G4BA 2WOMB 5I42A 2C6CA 2J9DE 2YNFB 2R2TA 3HVAA 1H7XA 1FRHA 1ZETA 2ZBIA 2K2PA 2F65A 1M1DA 2H5MA 3BB5A 1URRA 4HNWB 1PAEX 2B51A 3MR7A 2WVDA 4J9UE 4ZVRB 2AGOA 4NA2A 5F8JA 6AT1B 2Z10A 4OMFG 5DQIA 4X4RA 5HI7A 2GVZB 2XB2D 4L8AA 2KB2A 3SQGA 1Q8IA 2VBZA 4P4DA 1N6QB 1L3SA 3T5KA 4M1KA 1KS2A 5J1EB 1RJJA 2HRYA 1NK0A 1HW9A 1UWYA 3F73A 3FVLA 2PDOA 2YNCC 3P5BP 5J1QA 3OSNA 1B4SA 2GX8A 1UVMA 3R96A 4WFNQ 4R8UA 3H8FA 2A18A 2J76E 1WSVA 4WTYA 1NK5A 2UXCJ 1XK8A 3TRGA 1GMVA 4A38A 3KLEB 3SCKE 5E3PA 3W6SA 3HI9A 2CJKA 4DR5F 3UCUP 2EK8A 5B08A 3H40A 2ZM6J 3MXHP 3T1HF 4R5PA 1YGHA 2HGMA 2WVBA 2HSEB 3IS9B 2IHR1 3RBDA 4DPWA 2GFQA 2NPFA 3OUYA 3CCTA 2E7XA 3HHEA 4CYQA 4RW7B 3ISZA 3H7HB 4ED8A 2ZWOA 4O3SA 3AQOA 2KFZA 3I82A 1UL3A 1DQ9A 3T8WA 4R9MA 2MMYA 2FVQA 2HFVA 7CPAA 2OZGA 1JLAB 2DR6A 4B10A 4HLBA 2DNPA 1HPZA 1NSKL 3PB9X 2RS2A 4ZY2A 1RDRA 2WVFA 2XLIA 4TLQA 4RNNA 3CPWR 3ZTQA 4J37A 3DRYA 4F26A 3HFVA 5FD1A 1RLDA 3MFHA 5KG7A 1IJFB 2DD8S 2DHXA 3UDLA 3WIVA 3LWLA 3M8SA 3PDNA 2Y1IA 1VIOA 3QIPA 1R31A 4B3RJ 3C15A 1JLFB 2YNGB 1WF1A 3SBMA 3C14B 1IR2A 2EFVA 4NCZA 2YKPA 2VFUA 3VWSA 3IA0A 2JDJA 3D1QA 2FHKA 4LF7F 2ZHOA 1FA0A 4P71A 2BL1A 1D9FA 4NI2B 3PGPA 1MWQA 2C2MB 4Q38A 4LF6F 1KLMB 2NSBA 4XPCA 1CX8A 4XPLA 1SH3A 1KN6A 3ENVA 5C5JA 4DR6J 1ZYQA 3UNYA 5DWMA 3C6TB 2Z11A 2V34A 4JWPA 1LNQA 4QR1A 2R7TA 1SJ3P 3BO2A 1U6BA 3LH2S 4JOUA 1YJRA 3ISXA 4ALZA 1FVSA 2B9EA 3K5NA 3P49B 1T9TA 3MDFA 3NE8A 1XNRF 5F3ZA 4X64J 4QU6A 4WXOA 3VH9A 3FCWA 2COLA 4AG9A 2GHWA 4FN5A 3HZEA 2XCPA 1V3RA 4X4SA 1DQ8A 2CFXA 1NBEB 1N5SA 5HVFA 1JKHB 4HI2A 4ED4A 2W25A 2DNYA 5MLCV 3CMES 5DG9A 1YW6A 2FLPA 2AYGA 2V94A 5DDRC 1X8DA 4TY9A 5LOQA 5LYDA 4CT8A 3ZTRA 4DQPA 4FPIA 1HQUA 1IJEB 5IC4B 1JK9B 2P0WA 3CJRA 3M2RA 3QO9B 4ZVOB 1FWKA 1S9GA 2CQHA 4KOYA 3BKTA 3IRXA 4DYOA 4AD6A 3HD2A 3SSSA 1K0TA 4AXJA 2NREA 9ATCB 1R0BG 3DDIA 2PO4A 2IA6A 4UZBA 2XHWA 2M5YA 3TA1A 2IM3A 2X1BA 4A8MP 3R5GA 2V6AA 4L3NA 4Q8EA 4DX5A 2ZW5A 1VQOS 4QB9A 4PPDA 1N88A 2WB4A 2D69A 2POKA 1K44A 3R8YA 4ZY0A 3R5CA 5KFMA 1RA6A 1X4DA 3UN3A 1RT4B 2HVDA 3OD2A 3N7ZA 3UY5A 2DR5A 2XLKA 4NF1A 3DMJA 2GO9A 2RF2B 3CDWA 1VK8A 4FNHA 3HO1A 3I55S 3QAHA 1S1TA 1TZ0A 3QRPA 1X4HA 3V2UC 2RDIA 3S1TA 1AUGA 4PXEA 3PJWA 2AP6A 1H2VZ 3KK3A 1RBLA 2I79A 2JL9A 1LFPA 1XRYA 1VQYA 5GMDA 4FD5A 3M8YA 1KQKA 5KG3A 1J5EF 5CYMB 2Z2LA 5IWAJ 1MG7A 2HQYA 3UR0A 1DE4C 3M7VA 4DZ6A 1UWBA 4K2XA 1GMUA 5A8KA 2OD6A 2QECA 3NGTA 3ZTPA 3ZZOA 1VQSA 2UU9J 2CZVC 1HI1A 3MR3A 4I2PB 1DTDA 2PCUA 2ZH7A 5T7LA 3S7RA 5GMKa 5AXNA 2NPIA 4LMZA 1LRZA 1LV5A 3SYZA 2VZ9A 3OXGA 1JMTA 3BPDA 3E01A 3NCQA 2XSFA 1QAJA 1A2ZA 5DETA 3G8WA 1XE4A 2DNGA 2E1PA 1VHEA 4USJC 4F3MA 4KGMA 2OPPA 2DR8A 3JTPA 1KEKA 4ED5A 3GIJA 4B9LA 2SXLA 2I00A 4OX6A 1XF8A 4OIDA 4F04B 2HS3A 4ES1A 1YLOA 1S1XB 3V6HA 4OYMA 4USKA 2P5VA 5KFAA 2CQ1A 1OYEA 3G82B 4X2BA 3W63A 2C2DA 2VZYA 2ZH4A 1RK8A 4PUOA 2EFOA 1O0PA 1RAOA 2CYYA 4DX7A 4DSIA 4OZ1A 3PX6A 4KSFA 2MQNA 4LFAJ 5KFEA 1D0EA 3TP2A 4OYAA 1LQ9A 2R4FA 1W26A 4JYAF 1EP4A 3DDKA 3LD2A 4KOWA 3OL6A 1NMTA 4XNHB 1X4CA 3D2MA 3EPGA 1TMMA 4M5HA 3LOUA 3MM5A 2H54B 3S6FA 2GQCA 4ZKAA 4XAKA 1WC3A 1ZPVA 4JI7F 3QGIA 2FUG9 3I5BA 2ZEFA 2QJ3A 4UCNA 5CYQA 1VBXA 1IBKJ 2EWHA 2L9WA 2D9PA 3OHBA 2DB1A 3FBBA 4X65F 2JEJA 3M2UB 5A27A 1WHYA 4FS2A 3W2VA 1HNXF 1Y0RA 2V4QA 3PIPQ 3I5CA 2HLUA 5FDLA 3OR1B 2D3OR 1KVIA 3VAIA 4NLQA 4LF4F 4OHZA 3I0RA 4WK3A 4OJHA 1C4CA 3HLPA 2KG0A 3Q23A 1UZDA 1Q81T 3EJMA 2FC8A 4NEZA 2E66A 3TZYA 4MCQA 4EUVA 2Q4ZA 1DTTB 4Q44A 3GUXA 3RYLA 3BLNA 1JNZB 2IA0A 3BDPA 4RNHA 5IFMA 1CJKA 2NXJA 3SJGA 4P9SA 3TAMB 1QSRA 3RAQA 1I3OB 4DFMA 2D3UA 4ZBGA 5HP1A 2UZAA 2V9WA 3FKBA 2OPQA 4KOXA 5KFQA 2YXLA 4X84A 1K1SA 1V9OA 4FVCA 3TO8A 1FEEA 3KLFA 1X9SA 3C26A 3GFYA 4X3RA 1M5OC 3FNNA 2EFQA 5SZTA 4RBTA 1H72C 3CXCR 3W5XA 2B4BA 2PSWA 3KXDA 1TL3B 2PJ2A 2G0BA 4CLSA 4M5KA 4R3LA 1P1LA 3H42A 2ZW6A 1X4FA 3VGVA 3M9OB 4PWUA 2VBQA 5I42B 3VF0B 2I8EA 1YTYA 5GADI 4FXDA 1EARA 1YG0A 2AEMA 4BS2A 1RAIB 2UUAJ 2DF5A 4NGMA 4NZ0A 3AHPA 4M3SA 2V9KA 2YH0A 3F41A 3KDNA 4OZ2A 2R7RA 1QSNA 1RHUB 1IWGA 2NXNA 4F8RA 2GE3A 1S60A 3BN4A 3WIUA 2L9NA 2FTRA 1BQMA 3D7SB 3SQGB 4KH0B 1HYSA 1RE1B 3MGDA 3TVYA 2AQ4A 2ZEHA 2AX1A 3VGUA 4R8UB 2HS0A 1MMDA 1SC4B 5LRJA 4FF1A 2P6TA 3MTJA 2NS1B 5LRKA 3D28A 4K59A 4DV7J 4R6TA 4R5PB 4ERDA 1M0SA 3UPFA 5D0RA 2DR9A 1T95A 4CLTA 4F67A 2I38A 3OUYB 3CCES 2R7WA 1S76D 1RWPB 2IJRA 2ZC3A 5EUHA 4P4JA 1H2UX 4B3MF 4NMXA 3PB4X 4ICLA 1IBMF 4LSLA 4IO1A 1KTQA 1HPZB 3K59A 4JI0F 1VDHA 2JVOA 2HHHF 3K5OA 1GEHA 1Q2YA 2V2KA 5C82A 2ZD1A 1QSYA 2LCWA 4YGOA 1N34J 2HBZB 1TV6A 1PAUB 1J5OA 2MJNA 1J4JA 2OU2A 3PW0A 1UEUA 3H0PA 2RSQA 3QIPB 1IKWA 3C15B 4XO0A 4M5MA 1GH8A 2YWHA 1MU2A 1QTMA 2RT3A 3OTOF 2AX0A 2BV3A 3NEKA 3LACA 2KKHA 3HHLD 3JYTA 2PRQA 4J9OA 4HHHA 3CWJA 3H5YA 2R7HA 3DOKA 4A4JA 4P45A 1F2GA 1H3DA 3OTCA 3WC5A 4E0DA 4F0XA 2AKWB 4QU7A 3IR6B 2E7WA 1HD1A 3CUNA 2E5JA 3B4DA 4JI3F 1ZM2A 2DIVA 4OQJA 2I6WA 4H89A 2HNYA 1S7IA 5FVJA 4R7MA 2JEFA 4NCGA 3ENQA 2QT7A 1S7FA 3MR5A 2GLFA 2NSCA 4EI2A 3QYYA 2ASYA 1N36J 3EVOA 4X2TA 4DUYF 4PYAA 3CW2C 4TY8A 1KHVA 3UNGC 1U45A 2AWZA 2Z3MA 2NZCA 2ABZA 2QFIA 4P2SA 4ID5A 1BPMA 2C2RA 2KFYA 3NAHA 4IQMA 3TX0A 2ATRA 4ZVPB 2R9LA 1IQZA 1UFLA 1IICA 5AG7A 3BBCA 5DQHA 2XSJA 2QL7B 3TOQA 1HQUB 4YQWA 2V2ZA 4CRZB 5HJYA 5DDOC 3M2RB 3PIOQ 2XMJA 4MH8A 1A7GE 2RU9A 1RWXB 1S9GB 3IRXB 1FRMA 3A12A 4AQYJ 2HUZA 5LJ3Y 1X4EA 1HHTP 3DN9A 4D3HA 1FD8A 1F0XA 4MCRA 5KFUA 4CAXA 1K73T 2ZWPA 1XMQF 5KTQA 2U2FA 3PKYA 1JX4A 4GMKA 3VARA 2DITA 2XMMA 4K0KF 2J7WA 1SH2A 2J0QD 1RTDA 2JH3A 2EC0A 2Z8QA 2KT5A 3NCPA 2CJXB 1LW2A 1BO4A 4QWCA 5C42A 2P9CA 2L48A 1S1TB 1XIXA 2LQBA 2I3CA 1S1WA 1JWWA 1FT8A 2HB6A 4EGLA 4CLPA 4RN7A 4CYUA 3KK3B 4DL5A 4DS5A 4F0KA 4FKXA 2LXUA 2M7SA 1RABB 2CPEA 1QLNA 4MFZA 1C4AA 1O5JA 2FE7A 1RUSA 1BXNA 2EBJA 3FF3A 6FDRA 2DPJA 1GK8A 3BXMA 1X0PA 1D8ZA 1U1MA 5BJRA 4P52A 2HFNA 2W1BA 1XMOF 4Y34A 5E0OA 2W24A 1UWBB 4U7CA 2B4DA 2KU7A 3KKFA 2B8PA 2I1RA 3G4SS 5G0RA 5KFTA 2XZDB 4OYXA 5T7LB 1LKZA 3W8PA 2IAJA 2ZDOA 4YR3A 5GAHU 2M9KA 2WBMA 4RNMA 1WK4A 5J2NA 1ZA1B 2GNKA 3MPDA 4DFJA 4RX6A 3E01B 1HWKA 1Y4ZB 4MKYA 2ZW4A 1PG5B 4PSXA 3G71S 5ISVA 3FVYA 3UFCX 5IZHA 5A8WA 3BSNA 3ZZZA 3HX9A 2OSQA 2QYGA 2ZHBA 2R7QA 4UQTA 3CC4S 4F25A 2P9GA 3EVMA 3BJYA 4QUSA 3VHQA 4DSFA 1RAFB 3M8WA 1Z2ZA 2MHEA 1OJ4A 1LK7A 1U2RA 4DNCA 2U1AA 3A3NB 2YNEA 3OFHA 1YZ6A 4QIFA 2REEA 4K50A 4PUOB 1SUQA 3LAKA 4XPKA 4C97A 4B3TJ 3NXZA 2DNHA 1MMNA 1Z8WA 4UTGA 3AXKA 4F2RA 1RT5A 1EP4B 2ZUGA 2UUCF 3T5HA 3MURP 3QNWB 3P5TL 2R8HA 3KNAA 3MM5B 2WAQD 2LQ9A 4DUZJ 3PG9A 5KFGA 2UVWA 4EWTA 5CYQB 5DLFA 2UUBJ 1MWZA 3EXNA 4HDHA 3MOJB 1RHKB 2MQQA 3DXSX 2PN6A 3Q2SC 4QIWD 2CQ3A 3W2VB 2Z4PA 4JI1F 4URQU 3E0KA 2QJ8A 5FDLB 2YWEA 1GQEA 1KP6A 3H25A 4J91A 4WFBQ 2WBRA 5JXSA 1JWQA 3I0RB 3T1AA 3C8YA 2YX1A 3H2LA 3D6TB 1IOFA 4KB7A 3QZ8A 4DSKA 5KFZA 2AFUA 2BUNA 1W2BR 4OC3A 5IB0A 2IC3A 4RLEA 4IRKA 1CJKB 3QRQA 5L46A 5F47A 1P1TA 1RSCA 3HFKA 4MJKA 4DR2J 3CD7A 4X4PA 4FD6A 2ATCB 5HP1B 1SJRA 2DRDA 4ECXA 2OPQB 2AW0A 2XULA 2QIRA 1YLXA 1GMWA 3KLFB 2VXKA 3NH8A 4RUHA 2A4NA 1B99A 5K8NA 4Y28C 2DO0A 1S0OA 2BMBA 3VQTA 2F5IA 2OH1A 1L3UA 4B9VA 4L6V3 2DVIA 1M44A 1AA1B 3IJ3A 4QW8A 3N6NA 3KYLA 2HK2A 3T9YA 3PJ9A 3AD8C 2W8KA 4F4ZA 3J80U 4KVOE 3HK2A 2KVQE 1WTFA 1S5KA 4ZLJA 4LF1A 4H4MA 5CD4A 3PHTA 2HFSA 4MMOA 3CCWA 4DPOA 1XBWA 1PBAA 1YJ7A 2W4PA 4P7TA 1K1QA 2AZ1A 3ZZ0A 2PIZA 4UF4A 4WFYA 2VQFF 4C7HA 1Q7YT 3G8SA 2ALYB 2BX6A 1QSSA 4DR4J 2K06A 5KFKA 3KUEA 2YQ3A 3GCWP 1BQMB 2RJZA 1FNXH 3AAWB 4X4TA 1VR6A 1BPNA 1HYSB 7AT1B 2BKOA 4JI8F 2CDQA 2KHDA 2DEIA 4K4XA 2VU5A 3NWGA 4MBUA 4KH1B 1S59A 2JLFA 2QA1A 2WTFA 3PM9A 4ZI6A 4CAFA 1BQNA 3CULA 2QIFA 2HVZA 3NCRA 3GU0A 3GIMA 1RAGB 1DQAA 5ETKA 2XEGA 4NZ7A 2OFGX 5LMUJ 1XFOA 3LQVA 4PG6A 5ITHA 4MYTA 3BO4A 4E0AA 5E33A 3GLJA 5AJ3J 4ZY1A 5L1JA 2OAUA 3S9NA 3VAKA 3DLHA 1FE0A 2BO9A 4CM2A 4ICLB 5M2PA 3Q8SB 5D8NA 4LSLB 1BUXA 5LYLA 1ZTTA 1CJTA 3I0SA 3M6UA 3B3SA 3JRUA 2E5LF 3D0HE 1RCOB 2A2DA 1S12A 1QY7A 1K9MT 2ZD1B 2G0JA 4C98A 1I21A 2GJ2A 3S01A 1TV6B 1J5OB 4UBRA 1ARLA 1YVKA 5AE3A 2WPXA 3AB2B 3W8GA 1FX2A 2GO8A 2UUWA 3TO6A 3W9JA 2IMWP 1IKWB 3ONQA 2FJVA 1SV5A 1BLUA 4C3LA 2E44A 2ZEJA 2AE6A 1X12A 2G13A 2P9EA 4A31A 3GE9A 1T02A 1MU2B 2KO1A 4OYPA 2UXDF 3EMTA 1RYSA 4UEZA 1VBZA 2YBVA 1H98A 3NS7B 4JJXA 3JYTB 4ATNA 2AYEA 2PJ3A 3OT9A 1SC6A 3B3CA 3DOKB 4K4SA 5GAGU 5KFYA 5K20B 1PKUA 4GO7X 1O51A 3F0NA 2ZH2A 2PJ7A 5DM7Q 2KCWA 3TT2A 3KGQA 3TX8A 3B3VA 3W91A 4OYBA 2BR0A 3LUYA 4LR7A 4ZVSB 5D78A 4UOCA 2N7CA 2RB7A 1HNZF 1N5VA 3B82A 4XIUA 2NXUA 4DLEA 4CRJA 5KFJA 3POTA 1X5SA 4DLGA 2HNYB 3PW4A 4WTOB 2UXBJ 4NCGB 2RRNA 2GMHA 2ROGA 1HKAA 2X1GA 3IC1A 3RBEA 2ILZA 3EDRB 3BQ1A 2R98A 3B3TA 5D0EA 4ELUA 4TY8B 4DV3F 2D3O1 1CM0A 3MUTP 4HVZA 4OV6A 2G9DA 3DU6A 1R0CB 5GAEU 4NFRA 4ID5B 1K47A 3BJ7A 2ASDA 2JEIA 2BOPA 3Q8PB 1IYKA 1FDAA 2JJ4D 2DIUA 1HNWF 2XSJB 1N5YA 2BKPA 3ILOA 3DOLA 2VQEJ 5HBMA 1JB0C 1HI8A 1VQKS 3W64A 5CHCB 2A0FB 5J2MA 5ETLA 1IBLJ 2DXQA 2Q7SA 3N5FA 1VQ8S 1SB6A 1IKXA 3L9ZA 4UFVA 2WVCA 3Q22A 3MPVA 3U27A 3LW5C 4C8LA 1IKYA 4WFAQ 3QFHA 1SPBP 2VHGA 4Z2XA 4ED2A 2DGXA 2QC3A 4H54A 4KHRA 4ANDA 3IU1A 1Y10A 2XZWA 3JTKA 1VQ7S 3FJUA 3IXQA 2VICA 3D54A 2MQMA 3MM9A 4M8LA 3R1HA 3SI1A 3AOAA 1VRQC 3T41A 1A6LA 1NHKL 4WYLA 3ISND 4ZMMA 1RTDB 1Q86T 4E2FB 5RUBA 3I6PA 3FXTA 4AT1B 1FXLA 1EKSA 1LW2B 3SI8A 1RT1A 2OMOA 4K8RA 4ZJQA 1APSA 3EXCX 1WEYA 4DUTA 5C42B 4ZCIA 1UJ4A 2W2MP 2Z57B 3QRRA 1OPIA 3ETOA 3JSMA 1S1WB 3S9LA 2GMLA 1GHEA 4CYUB 1N0VC 2DHAA 1NB2A 4PXCA 5KFNA 3VQSA 1KRPA 1PC5A 5BYSA 2Q04A 4RW4A 3IFEA 1S49A 4QIVA 2MKCA 2GJFA 4I49A 2O5DA 1TELA 1FDNA 5A2QU 3NBPA 2W2QP 4EMEA 2VC0A 3FYNA 1S0NA 4KQZA 4ZLLA 2QLJB 1EHWA 3IU2A 2DNKA 1IN0A 4UT4A 2B4DB 4PXDA 4NXMJ 5HQMA 5K9FA 4CIOA 5G0RB 3PZJA 2H4WB 5GMEA 5D29A 3G87A 2C3OA 2ZKTA 1U25A 2IAJB 1LXJA 3UDVA 4NGTA 4Q43A 2ZNZA 3GTYX 5J2NB 4CAWA 4FXWA 4XPDC 1VISA 2VDHA 3QAYA 4AL7A 5EHHA 3D6MB 4H4KC 5A8WB 3M32A 5KFIA 5LMNJ 3OJUA 2DISA 4KRWA 1TAQA 2DNLA 2HPUA 3R5BA 4LFCJ 2CADA 3H4DA 4DCJB 2X1FA 2FVGA 4QWBA 3GSIA 2E1AA 1TL5A 2PE8A 3TJAA 3BQ2A 1WC1A 3KJVA 1SVDA 4NLGA 1C1BA 3BGUA 1SUQB 3N5BA 4YB5A 1NE9A 1ROFA 3HVTA 2VODA 3ETMA 4OV1A 1KKHA 3R9GA 3F0AA 1RT5B 4I68A 4WIIA 4WCEQ 1UEVA 4N77A 4DEZA 1NPRA 4LBPA 2VJUA 3RW6A 1N8RT 1ZM9A 4UIBA 4DR7J 2OSRA 3U7JA 1UCNA 4ZLNA 4NXNJ 5B0CA 3CVKA 2YX7A 4C0OC 1AXQA 3UWTA 3SCLE 4GC6A 2VOPA 1PGZA 1NH7A 2CIJA 4Q5VA 3PW7A 1GTHA 3M8ZA 2IYIA 4CPAA 3ITHA 3TZZA 2LQ5A 5CPAA 3MWBA 4HTIA 3CMAS 4B9SA 5IT9U 3FH4A 1T11A 5J1PA 1FXRA 2O3DA 4M95A 4ZGYB 3J7ZT 3MTKA 2LKZA 2DYAA 1Z8LA 3PXGa 2JX2A 2IC3B 2QL5B 4I64A 4NYOA 1XNQF 2BQ3A 3T90A 2CPHA 4HHJA 3L7OA 4Y65A 3RAMA 5JMNA 1D1UA 4BBYA 3NG8A 3E51A 3R7NB 5CA5A 2VPYB 3G6YA 3AB4B 3BV8A 3DLJA 5F8MA 3D1HA 3KMQA 4TU8A 1SCJB 4OFZA 3IG1A 1AZSA 2XYPB 1ACMB 3GFZA 4MFKA 4WU3A 2H48B 1DARA 1U1KA 2DGVA 3V6KA 4F4YA 1GNKA 4WP8A 3TO7A 4O3OA 4USMA 3V81B 1RTQA 3I9ZA 4P7VA 2XEFA 4H4MB 2KM8B 3D4UA 4Q7AA 5B09A 4M5DA 1K8AT 3FQKA 3HHNB 4UY8T 3H90A 1HNVA 2PR1A 4RNOA 4RUBA 4DG1A 4DR5J 5I3UA 4N5SA 2HHWA 3BGLA 1WOPA 2ZEGA 3MAQA 2D74B 3T1HJ 2NLWA 4F0YA 5F0UA 2V63A 2MZ1A 4IR1A 3D6FB 5J8FA 3RO0A 1VRTA 2Z56B 3C6UA 4MTPA 3QWPA 2ACMA 2V2VA 4LRDA 4ZPDA 2PIIA 1BQNB 5C25A 4KGZB 4IQXA 4KUBA 3Q8UA 3TUIC 3CCVS 2JLGA 4YY3F 1OY9A 2XCAA 2CAJA 3SI0A 1X4BA 4PCQA 1FEHA 4PEOA 1JNRB 2OEMA 1PUAA 3FMWA 4OIWA 4Y00A 1H74A 2VI7A 2C2OB 2LXFA 4LF7J 3X3UA 1CJTB 2ZBQA 3I0SB 5J2PA 3IWXA 4IRCA 4PG5A 3D1OA 1Q82T 2BCOA 3K2YA 3KHZA 1N4LA 2ZC4A 3K5LA 3LMSA 2P8IA 3IR7B 3BI1A 4FD4A 3FBFA 4J9MA 2R8VA 1N33F 3BGRA 1FNMA 4LFBJ 3FDSA 5IV4A 4ILMA 2OEJA 4PABA 1FDDA 3W66A 1YJVA 3AA8A 2CKWA 1SV5B 3M2VA 1VJQA 2L9DA 2MQLA 1RLCL 2K7KA 2ZBRA 4QR2A 3ZZRA 3CXQA 1NKCA 2JEGA 3PRDA 2FY1A 2HQDA 2LVWA 4M6IA 4I6WA 2RFHA 4J90A 4ECUA 1TUGB 1XNRJ 4JI2F 1CULA 2DRBA 4H4KA 2E1MC 5LM7E 4ZCMA 3B7IA 2NMTA 1NZAA 2EG1A 1VHSA 4K4TA 3ZC4A 3FCHA 4EO8A 2FJEB 2ZH9A 5F48A 2XNRA 1TMJA 1S4FA 4KORA 4R3KA 4G1IA 3I3GA 2DY9A 3PB8X 2X51A 1QM9A 2R2RA 3POTB 2GIFA 3TUZC 3RU0A 2GCFA 2VG5A 5A6WA 4LF9F 3DGVA 1EETA 2AIRB 4PQUA 2FIAA 1RWWB 2RQCA 4IRDA 4ZVHA 2EFGA 2N7YA 3GIIA 4OP4A 2KI2A 2OIHA 4PV6A 2Z3LA 3UR3C 2C1CA 5GADU 2QV6A 4OX9F 4B17A 2C3MA 1ZG8A 1OIAA 4JV1A 4FNIA 1VRUA 4B9UA 2RDJA 4ZDNA 4DV1F 1WOSA 4N8OA 3HHDA 5G20A 4FPRA 4OX7A 4P2FA 2M4MA 1N5YB 2V8HA 3DOLB 4MIWA 4Y2IA 2VL1A 3N79A 5HBMB 2J8RA 5J2MB 3NL0A 2Y0SD 4QR0A 3PW2A 1IKXB 2CQIA 2R7XA 1YJWS 2J6SA 1IKYB 3TC8A 1ZO0A 3IP0A 2VBWA 4DV0F 1JLGA 3TYTA 4KSAA 3KHGA 1JLBB 2QEXS 4GC7A 3MM9B 4B13A 3RRHA 1WUUA 4LVNP 4DJLA 3J7YI 4EMDA 1J5EJ 2XY7A 4QBUA 2Y1RI 4MKBA 2VFVA 1RT1B 4FYXB 3WX4A 2NYQA 1LK5A 4WKRA 4KSIA 3MZIA 2RRAA 4H4OA 3JSMB 1U6MA 1U1NA 1G1XA 4P4IA 5KTCA 4KGKA 4P10A 2DGUA 3P6YC 1NKEA 1DJ0A 3GV5B 4NX9A 4RW4B 4UOFA 1L3TA 4F0MA 4NLVA 4JI5F 4OI0A 3NBPB 1AUDA 2FCKA 2GZOA 4S0MA 1HIYA 1OQ6A 4LR8A 3SCJE 3FBCA 3CJ0A 3QZ7A 3LWMA 4J9NA 5CCMA 1NDLA 4J5OA 3BSOA 1YJNS 4DN9A 2XI3A 5D4LA 1OSDA 5DWNA 2F9DA 3K9TA 3H2UB 1CVJA 1MJ9A 2AEJA 1ELOA 1T94A 2BE9B 3AOCA 4J9LA 3DLGA 2EK9A 1YBUA 1LOKA 5IOLA 5L9XA 3M32B 4JYAJ 2GVDA 2MGZA 3V38A 3DLBA 4Z37A 3JB9k 2M52A 2YVSA 5ETNA 3GWCA 3ILLA 2R8KA 4KY3A 3GCXP 2Z3NA 5AE2A 4X66F 4YOEA 1IUJA 2XG8A 4Q8FA 2QZ8A 1UFWA 3K7RA 3C2PA 4NSQA 2XO7A 1B6BA 4LREA 2UVRA 3KJVB 2DHSA 3J7AN 5FJ4A 1C1BB 4X65J 4DBQA 4ELVA 1CBKA 1HNXJ 5KG0A 3HVTB 3PP9A 1WI8A 1TKDA 1HHSA 5L1IA 2D1CA 3CCZA 2OELA 2HWTA 4DL7A 2PC6A 4LF4J 3FB3A 1EB0A 2YKNA 3OL9A 2G0CA 3VAHA 5DG7A 3GG0A 1XWLA 4MCSA 3MD3A 2JLMA 1V5VA 3GIUA 2R3VA 4QWAA 4ZN3A 2HFZA 4UCPA 2RS8A 4M5GA 2L3MA 2MB0B 3THPA 4GXHA 1QMUA 2MSSA 2XMUA 3FNCA 2HRUA 4DPUA 2IMOA 3GIKA 1SKRA 1XMTA 3ITHB 2GIRA 1P9QC 3TOAA 2CXAA 3A3PB 5HQLA 3R27A 4QYRA 2DPIA 3MMCA 4ZITA 4EO6A 5JVHQ 3L3CA 2NYIA 3D8PA 3DR8A 1OY6A 1FRJA 4ES2A 3CTRA 3GG1A 5J2QA 2VPXB 3D0GE 4EBEA 1Y11A 3HSDA 5ETPA 2JEWA 1Q8LA 1U02A 3DHWC 2Y8WA 1U8SA 3IR5B 4N41A 3PFOA 2M8DB 5I3PA 1MN7A 1PSDA 4NGRA 4UFWA 2EFNA 2YKAA 2C27A 2KRBA 3BEGB 4DV2F 4CGPA 2FSRA 1LWXA 3D3BJ 1ELLP 2CPIA 3VZHA 5AG6A 3N28A 3W65A 2PFFB 5DGBA 2AYMA 2MTLA 2E5GA 5T14A 3KZWA 1UA1A 1YWXA 2IYGA 4EFAC 2B7BB 3MF5A 4HNYB 2HS4A 1VC0A 3IG1B 1AZSB 1F5BA 2O67A 2HBQB 3GZ7A 5GCNA 2RH3A 3O1LA 5HMNA 3UCZP 3ISNC 1R57A 2F63A 1CPSA 5KT6A 1S72S 2X3DA 3F56A 4CO0A 3TUJC 2Q3PA 1WNEA 1UEKA 4UWJA 2MZSA 3G6ES 4M5DB 4QW9A 3NS6A 1F9FA 1R43A 2BJ8A 1WHWA 1WEXA 1HNVB 4DG1B 1N56A 3RTVA 1YX0A 5I3UB 3I87A 4Z7YA 1S3ZA 4DFKA 1YDLA 4MK7A 1NSLA 3OTEA 2FS5A 4ZA1A 4IO9Q 3VAMA 2BJ7A 3V4IB 2VZZA 3C66A 2Z2YB 1M5PC 4WZQA 5L1LA 2CWXA 3GPAA 1VRTB 1IBMJ 4M6HA 3HD1A 1X4AA 3C6UB 2A2CA 2ZH6A 4N76A 4ZK7M 4JI0J 2HHHJ 3OVSA 4HL9A 4CCHA 4CO3A 3SIPB 5C25B 2G3AA 3PYGA 4C8OA 3KWMA 2IJNA 4G1PA 1RT7A 4DUKA 3D68A 1QTNB 1LWFA 1OS5A 4KKOA 2WW4A 4ORFA 5JVGQ 4CRYB 5LL6d 4C3MA 4NA3A 3MPUB 3TW0A 3JQJA 3OTOJ 3QJLA 3JTNA 1HWIA 4DX6A 5B7WA 4B3SF 5J2PB 2QMXA 2BJ9A 4BC9A 3WR7A 1FKOA 2XC9A 1WDTA 4B9MA 4BMHA 4XDDA 5B0AA 5EN1A 4FF4A 2HHVA 4LRCA 3I1UA 1T3NA 1M90T 1Z8XA 3BGRB 2DCLA 3MEEA 4PXBA 3D2WA 4URSA 3V6DA 2VBYA 3TNVA 4KPYA 4JI3J 2B4PA 2VIHA 2GU2A 4OI2A 2ZKUA 4KE5A 5EWEA 1QAXA 1YK3A 3KK1A 3K58A 4FF2A 1WG1A 2HVEA 3WHIA 2GV1A 4KVME 4ZX8A 3GR1A 1CULB 4HH0A 4CYOA 1T9XA 5K8OA 3DC2A 2KXHA 4C7QA 4DUYJ 3GB0A 2OPSA 2YWKA 2QYCA 2Y3YA 4NMLA 4ZJOA 1WOOA 4B6ZA 1CP6A 3H8GA 1GYTA 1AT1B 2MZJA 2OR4A 5GAEI 2CXEA 4NZ6A 5ELYA 1M4DA 1X4GA 4RJVA 1VQ6S 1WELA 2HAFA 4DV5F 2IBOA 3SJXA 1T0TV 4ECQA 2VG5B 1EETB 4PQUB 3J7Z5 4Y49C 4CYPA 3GFHA 5LXYA 1GXUA 5H9EJ 5H9FJ 4AB7A 4DZDA 3MRUA 3Q89A 4FYYB 5LYFA 4QVTA 3HHKA 5M2UA 3PYFA 5KFRA 4W98A 2UP1A 3AJDA 4ZS6A 4JBCA 5L8RC 1VRUB 3DKDA 1FJEB 1S7HA 2DNMA 2VG6A 4CLUA 4USTA 2EBEA 2ZVSA 2VQYA 2MPUA 5KFLA 4DL4A 4MCPA 1Q4RA 1V6HA 4RR5A 4OYIA 2W9CA 4OZNA 4CT9A 1XEZA 1Z2LA 2EO8A 4JV0A 2RHQB 4MRIA 1RI7A 3AT1B 1FE4A 1WWZA 4CGLA 4R87A 2G2ZA 1KSPA 1X10A 1ZPWX 1QE1A 4K5RA 2RIJA 2KN4A 1C0TA 2HW3A 1OQ3A 3UDCA 1TKJA 4UY85 4P73A 4DSJA 4AFFA 1JLGB 2R7SA 5B0DA 2YWWA 2A6OA 2BJ1A 1Z4EA 1T9UA 5H86A 2F5GA 1FRKA 5HAOA 1F2OA 4P75A 2W2OP 2VA2A 3LP2A 2KT2A 2CNTA 4WYWA 3HULA 3J81Y 4L72B 1U47A 5BR8F 4HI1A 4AQYF 2CQ2A 3D4JA 1XMOJ 3A8EA 2ARHA 5CXTA 3DXBA 5K5MA 2QA4G 4JXQA 1F2HA 4O0NA 1ZG9A 4B9NA 1Y5LB 4H4OB 1JLCA 1MW7A 4AXIA 4E98A 2Q4VA 3DR6A 2A1BA 2WCXA 5G21A 3NNHA 3QT5A 5D6GA 4F50A 3H5UA 5HMWA 4Q45A 3K8VA 3G2XA 2IVYA 3CJ3A 4TNOA 3ZNJ1 2IVFB 1TIQA 1I51B 2FJAB 1UVNA 2AJ2A 4LF8J 3HPOA 1A0OB 3CEDA 3OV7A 1SL0A 3DLLQ 1HHQA 2KL8A 1S9EA 3CJ8A 2C2KB 4DL2A 4OADA 4KPCA 4OX8A 1RO5A 2IJFA 3P96A 3N0VA 3NH4A 1ZZFA 3MUMP 4LQ6A 4K5SA 5DZ6A 4ZPCA 4UOHA 1LOUA 1U1PA 3R6GB 1RGVA 1RKJA 3CIZA 4J3GA 1CG2A 2C3UA 4FBUA 3DLGB 3TI0A 4WWSA 4P6YA 2Y9HA 1H8LA 1Q1KA 3EDQB 4WE1A 5K8MA 1G3OA 2EW9A 2GVDB 2MGZB 4EBDA 4FF3A 3LO3A 2UUCJ 4WFXA 3UD3P 2BM1A 2DXFA 1RU2A 3SFGA 4NJQA 3TZWA 2EUIA 2E5IA 3IO1A 1KZFA 2QLFB 4DQSA 3NGDA 2UVUA 2E29A 2LQ8A 2PVWA 1B7YB 2VDIA 1FXDA 2VD3A 4WJBA 5D0GA 3TWZA 5LJ5Y 4JI1J 4DL6A 2N3OA 1I94F 3VCDA 2YKOA 3IGVA 2AFZA 3IM9A 3EICA 4U95A 3K2KA 2W4CA 3CCMS 1T3OA 2YKNB 2ZH1A 4ECTA 1R6VA 2ZITA 3M1VA 5A0YA 4DI6A 2F7VA 1V3ZA 2LP4A 2FHJA 4ES3A 1HARA 5KG5A 4F4XA 2GQQA 4YDXA 2PI4A 2WW8A 4HDGA 4JI6F 4E8UA 4QYZK 4IHMA 4YHHF 3IAM9 3TVKA 3Q8QB 4TNUA 1H38A 2H51B 5A8RA 1RKIA 1C1CA 4KO0A 1MJBA 4ZVGA 3LANA 5T41A 3MMCB 4WIQA 2PEHA 3ZNUA 1UPMB 3CCSS 2JSXA 4ILLA 5C2GA 1R89A 2WPWA 1VBKA 2VFRA 4KC5A 4ECRA 3PKMA 1J27A 2IL4A 2BZ2A 5J2QB 3L7UA 1NB7A 1FFWB 3PX4A 2QLWA 3GYGA 1BGXT 3HDSA 1VQNS 3IWWA 5L9NA 3G86A 2Y0BB 2Z0ZA 2O28A 1C2PA 8RUCA 1HFEL 1R8AA 2ZXVA 1UPPA 1Q5VA 2XNQA 4ZCKA 4IKAA 3OVBA 3TO9A 2G1HA 5IXUA 4TU7A 4ANEA 2E7VA 5E3CA 3CNQP 1FERA 4ZIWA 1YQHA 5F09A 2FVSA 2CJAA 2VQFJ 4F7VA 3AXMA 1WC5A 1JJCB 2YNCA 1ZA2B 5DG8A 3HJVA 3DNCA 1WF2A 4LRBA 4TWEA 4M5NA 2HGLA 4FS1A 4ILRA 4PYDA 2EVZA 1FDBA 2LEPA 4JI8J 3NNAA 3CO0P 4NYPA 2XI2A 3OTDA 4F8ZA 3AH6A 3C16A 4K4UA 2HZCA 1RWKB 4FYDA 1HDUA 3UVJA 3PO5A 3H2VE 4RUCA 3E2EA 4B02A 5KT2A 1FRLA 3OTBA 4DPXA 1MROA 2FZCB 3KLIA 4WBFA 1HWUA 3IMQJ 1RQ0A 3CDXA 4IK2A 2W01A 2PJ1A 3CCRS 3KUGA 1CJWA 1CJVA 1RYRA 2ZEEA 2V68A 2ZBPA 4E2AA 4GVLA 3NGRA 4Y2KA 1CPZA 1QSTA 5DRKA 4FBTA 2OPRA 4NGSA 1XR5A 2GREA 4BLGA 1NK6A 4U8VA 2ZUAA 2B43A 3JSYA 3FSIA 4PQAA 4CNYA 2HFOA 5KAKA 1WG5A 3CXSA 4LSNA 1P27B 3PEJA 1RT7B 2Q51A 1LWFB 2BVZA 4KKOB 1XC9A 1T8EA 2MSTA 4ZVQB 5DGAA 4EK2A 4ZP6A 1R8CA 3OFFA 3CCLS 2VKRA 1IU8A 4IG0A 3FECA 2XWXA 1WC6A 3ZZYA 2JZ5A 2P6EA 4OYOA 2UXDJ 2WRMA 2AFOA 1RWOB 2VH7A 1GTEA 1IKVA 3AD9C 3QSYB 2R2UA 4DU8A 2OHDA 2YX4A 2RVJA 3LODA 3MEEB 4Y3CA 1XR7A 4AG7A 3V6DB 3FC9A 1RWNB 1FI4A 4EYHB 2CTCA 3CJ5A 4EU0A 3RBZA 2D9OA 3L2NA 3KK1B 3CDEA 3IWNC 1BC6A 4CLFA 4A33A 2B9WA 3MMBA 2WVEA 3KJFB 3Q8VA 1B70B 2QX0A 1TR0A 4HHUA 2OJ3A 1B0TA 4PG4A 2H9ZA 2MYFA 3FEZA 4CTAA 2OPSB 2WHOA 4DV3J 1SJQA 5BWAB 4U9YA 2JC1A 5JQ4A 2Y1LB 4RW8A 5CD4H 1LCPA 3QB8A 2Q6BA 1QAYA 4A8XA 3DCAA 2RHSB 2H1YA 3KASA 3M05A 4F4AA 4QQBA 3V6JA 1KUXA 5BYRA 4LIWA 4N8NA 4A37A 3CD0A 1P9YA 2E1RA 1D8YA 3CPAA 5KFFA 3MCSA 2DNOA 1SKSA 1HNWJ 3QIDA 1C0UA 1VC5A 3DDDA 3NFZA 4IH7A 4DXLA 3HVWA 3CXPA 1BHNA 3GJQB 4NLUA 4CWBA 4OKOA 2D4PA 3R95A 3K8WA 5LSOA 2RQMA 5F49A 2V4JA 1RAHB 1PYTA 2FY8A 4ECSA 2C28A 2XWYA 1H6KX 3DGPA 3BR9A 2IY5B 4B5PA 4USIA 1TKZA 2ODFA 2NQPA 4AVAA 5AT1B 2EWBA 1TKXA 1TL1A 2VG6B 2LFVA 2I0XA 4USWA 4BWJA 2VF3A 1ZBTA 3OXLA 2L41A 2W9CB 4NLXA 3SQOP 3OBIA 1F2PA 3JVNA 3TA0A 1NK4A 2O66A 2AFSA 4HKFA 4QIEA 4UEFA 1KQGB 4WK1A 5ETMA 3GY9A 2B5JA 2ZOFA 2AYBA 4MHNA 5D15A 1QE1B 3FBUA 3KQXA 1U1QA 1DURA 3ET6A 4KIAA 5HXDA 1PO6A 2DHGA 3BDEA 1FKAF 1C0TB 3AFGA 3QSIA 2GIVA 3RYOA 2Z58B 3IWGA 4PK3A 2B5GA 2PMZD 1AFIA 4QC6A 3CZXA 4ZPBA 2K1RA 4DX8H 2VQEF 4KOUA 2C3PA 2QMWA 3LP2B 4XK8C 1N48A 1B0VA 3M6XA 3WDOA 5E5NA 3BBBA 2EKNA 2MHNA 1XQIA 1KHWA 2LA4A 5LT5A 1RHRB 2HHQA 4TKTA 2FJDB 3OVAA 2R7VA 2JDCA 4D3GA 1B3TA 1TP7A 1SKUB 2GFFA 4MK8A 1BY9A 1NPKA 2N4CA 1YLEA 3CD5A 1JLCB 1PBUA 2PJ4A 3VAFA 3ZO7A 3K0JA 4IOCQ 2DGOA 3RZAA 2HG4A 1ZLHA 4LRFA 2YWGA 5H1SV 1IVZA 3CCQS 2C2EA 3QT7A 3BGOP 5CYMA 1RTZA 2OKQA 2HQIA 1K4JA 4DPYA 3P8BB 1CP7A 5LXRA 2AJFE 4Q2MA 2I2YA 3P2FA 3B8GA 1Z4UA 4ECZA 1WKKA 4TQRA 4A8YA 4YRHA 2M88A 3WC0A 1S9EB 3ZXWA 2ZZTA 1R6YA 4LF5F 3W2WA 3DYAA 4Y2CA 2J7KA 3S6GA 1HL6A 2OGUA 6FD1A 3W5YA 3HKWA 4DU7A 3CJSA 2LEAA 2EBGA 2F8MA 4LQGA 2XS7A 2B4VA 1SJ1A 5C24A 1QUPA 2FT0A 4JD6A 3S8SA 1I12A 2GANA 4QPTA 4MFBA 4WE1B 4ECWA 2CY2A 2B8QA 4XTTA 3T5LA 2XY5A 1EKRA 1S5ZA 4L74A 1S4EA 5L38A 1YGYA 3T1YF 3TOBA 1E6YA 1WWHA 2FHMA 4C8MA 3TAPA 1VHIA 3AQPA 3CPXA 4GKKF 2XBPA 1DTQA 4ZP9A 1S6QA 2DRAA 3W9IA 5BXIA 1S97A 2HC9A 3GV7B 4P72A 4PSWA 3D9BA 3PJXA 1MJAA 5IT0A 3VGTA 3C46A 2E1CA 4F9UA 2DEAA 1MNEA 3P2HA 3B54A 5KFPA 2J0XA 1X5PA 4O44A 3NY0A 2OZHA 4GKJF 2CNLB 2XEJA 4BCAA 3SV4A 2EEYA 2Z30B 3KDOA 4LBIA 3RR8A 3F44A 3D7HA 4R0JA 5F46A 3TAQA 1YITS 4U67Q 4YN3B 3JAMY 1LAMA 3TEGA 3BYRA 3M1VB 4I1TA 1ZAXA 4RKUC 4YFUA 3PW5A 3ADAC 2OZUA 4KOVA 1FJGF 1XNQJ 4LQ9A 3DMJB 3FRMA 2Z3KA 3QQCD 2I5JA 1K0VA 2PJ9A 5A8RB 2MLYA 1HW8A 4KO0B 4NLTA 3O6QA 1GMWD 2K3IA 3TJ9A 4MHZA 1PILA 4NRTA 4FKYA 4UCMA 3ENAA 2NCKL 2CNSA 4USVA 4B14A 2HKEA 4JI4F 4JUZA 2DCUB 1NK7A 2VC1A 4UOGA 3J7YU 3OPKA 3D3CJ 2KT3A 2BKNA 2QTWA 1TXRA 4F2SA 3I56S 3A8JA 4C4WA 3TR5A 4ZPWR 1VQ4S 5A8KB 1NK9A 2N3LA