3TX8A

Crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
360
structure length
360
Chain Sequence
DLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNVLARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLATSTELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLRIKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGVANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQVTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVAAILKQYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate desuccinylase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 92
structure length 360
sequence length 360
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tx8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3tx8A01
3PB7X 1AYEA 4P4JA 4MRIA 1OBRA 5K8NA 3TX8A 2GLJA 3D4UA 1CP6A 3IFEA 2AFOA 2OR4A 3SI2A 1ZG8A 1TF8A 1LAPA 4P4FA 2ZENA 2EWBA 3D67A 2Q51A 4X8IA 4Q7AA 1AMPA 4PQAA 1TKHA 3H8FA 2C6GA 2AFSA 3HLPA 4OC1A 3SJGA 2ZEMA 3WT4A 4ZI6A 2GLFA 4NGRA 3PRTA 4P4DA 4UIAA 4PXCA 2O53A 2CF4A 1ARMA 7CPAA 2OOTA 1FT7A 3D7FA 3KR5A 1BPNA 2RB7A 2C1CA 2WZNA 3DGVA 3PB8X 3WC7A 3D7HA 4OP4A 3PFOA 4PXDA 3IEHA 4UF4A 3B35A 5LRJA 3RBUA 4NFRA 1CP7A 3FH4A 2V8GA 1CPXA 1XMBA 2ZEOA 3IC1A 4G1PA 3MN8A 1R43A 2PRQA 3B3CA 2G9DA 2PJ3A 3KHZA 4P4EA 4R6TA 3VARA 1ARLA 5D8NA 3LMSA 4IAVA 2DEAA 2PVVA 1BLLE 4WWVA 4MHPA 3FVLA 2XEIA 1EE3P 4OC5A 2O4HA 2PJ6A 2V8HA 4MCSA 4NJRA 4NGSA 4UEFA 3MRUA 1DTDA 4GM5A 1H8LA 3PBEA 3KZWA 1HDQA 1F57A 4PPZA 2BO9A 3GLJA 3PB6X 3B3VA 5DS0A 3HUVA 1Z5RA 5HVGA 4W9YA 4MHYA 1YMEA 3SI1A 1YLOA 1UWYA 2PJ5A 4TNUA 4MHNA 1Y0YA 2ZEDA 3CPXA 1CPSA 2ZEHA 3NH8A 4MCRA 4UEEA 1QMUA 4FAIA 2BOAA 3FMCA 1NSAA 3BHXA 2QJ8A 3FJUA 2PVWA 4A37A 1IGBA 1HEEA 3CPAA 3NH4A 4F9VA 1LANA 2ZEEA 2PIYA 4F8ZA 3DLJA 3T8WA 1KWMA 3SJEA 5HXDA 2J9AA 3IO1A 2EK8A 2ZOGA 3L2NA 4FWUA 2I3CA 2PE3A 1XJOA 4OMEA 1PCAA 4TWEA 1QQ9A 5LRGA 3KQZA 1TKFA 4OC2A 5HVFA 4A39A 4P4BA 4EFDA 1BPMA 2PJ2A 2PJ8A 3I1UA 4NJQA 5F09A 2F7VA 4R76A 4ZX9A 2AFXA 4P44A 3SJFA 3KQXA 2FVGA 2PJ4A 5D29A 1Q7LA 3D68A 2ANPA 4X3RA 3KHXA 3WC5A 2QVPA 2ZEFA 5K8OA 4P10A 4OC4A 3D7GA 2QYVA 2ZOFA 1RTQA 1CG2A 4DYOA 3FF3A 3NA6A 3K2KA 2HB6A 1LAMA 4FUUA 4OKOA 3KI9A 1F2OA 1Y0RA 3SI0A 2XEJA 3FEDA 8CPAA 2POKA 3PB9X 2AFWA 1LOKA 3QNVA 1YW6A 3D7DA 2ZEPA 5HVHA 3B3TA 4ZY0A 2V8DA 2RFHA 3JRUA 3FEEA 1XBUA 3BXMA 3LWUA 5IB9A 2ABZA 5THWA 4ZY1A 4R8FA 3ISXA 3PEIA 4NGNA 4IK2A 4BD9A 1ZLIA 4OIDA 3WABA 2PJBA 2PJ0A 3RAMA 4P45A 4NGQA 1IY7A 2JBJA 3FECA 4YU9A 6CPAA 3KASA 4MCPA 2AFZA 2BCOA 3K9TA 3VATA 3FX6A 1HDUA 3SJXA 3NH5A 1TKJA 2PJ9A 1LCPA 1FNOA 2HC9A 2XEGA 2Q43A 3PB4X 2NYQA 1BAVA 4H2KA 5LRKA 2GU2A 2ZELA 2CTCA 2AFMA 4UEZA 4MCQA 3ISZA 4B6ZA 2F8HA 2PJAA 4ZY2A 2ZEGA 3H8GA 4AXVA 2VL1A 1VIXA 3B2YA 1VHEA 2JBKA 3VH9A 3S9NA 5CBMA 3S9MA 3IJ3A 4EMEA 4DUKA 3IWWA 1GYTA 3V38A 4MMOA 1ZLHA 2GREA 4IHMA 3V7ZA 4R7MA 3CDXA 1M4LA 4ZX8A 1ZG9A 3NFZA 2WYRA 2NSMA 3B3SA 3S9LA 4PXEA 2PIZA 5JGFA 2PCUA 4NGTA 1DE4C 2IJZA 1F2PA 3IIBA 1XRYA 4MXUA 5K8PA 1R3NA 5LYDA 3TC8A 4FBEA 5J1QA 4X2TA 3N5FA 1YW4A 4WJBA 1ELLP 2PJ7A 1Z2LA 5LYLA 4K3NA 3D66A 2C6PA 3GUXA 4NGMA 4OC3A 1JQGA 3GB0A 1YSJA 3PBBA 5LYIA 1VGYA 2V77A 5JH9A 4O23A 3KGQA 1Z8LA 4NGPA 4JYWA 1ELMP 1TF9A 3RZAA 5LYFA 3PFEA 2CIJA 2IQ6A 2PJCA 1CBXA 4OC0A 1VHOA 1TXRA 1ZG7A 3WC6A 1Y7EA 4ZYQA 2AFUA 1CX8A 5K8MA 4P6YA 5I4MA 4Z65A 2JEWA 2Q4ZA 2C6CA 5JM6A 4A38A 4YWYA 2PJ1A 5ELYA 2V8VA 2CTBA 3CT9A 4JZ0A 2XEFA 3BI1A 2IMOA 4DJLA 1PYTB 4MHZA 2EK9A 4A94A 4PXBA 3KR4A 1XFOA 3B7IA 4KSIA 3KL9A 3B3WA 1LFWA 4EWTA 4RUHA 4ONWA 3BI0A 4OIWA 4UIBA 4CPAA 4LQGA 4P4IA 3H8EA 4F9UA 5CPAA
chains in the Genus database with same CATH superfamily
2FZKB 1WHXA 1AYEA 3VQSA 2AHOB 1SB6A 3N6NA 3MMBA 2MSSA 3KLHA 3QAUA 1F9EB 4B9MA 3QYYA 4DG1A 2Q51A 2VH7A 4I2PB 1KP6A 1OY6A 4DBQA 1NH7A 2J7KA 2DH8A 4EVYA 4IR1A 2CKWA 1NRKA 3HZGA 2OZUA 5E3AA 1IKVA 5DLGA 2OPRA 3WT4A 4E2FB 3PRTA 3DYAB 3O1LA 3I3GA 3CEDA 2ATRA 2ZM6F 2CJBA 5J2NB 2B7BB 4TVAB 1BGXT 2YNHB 4O3RA 3C6TA 5KAKA 2YKOA 2H5MA 3IEHA 1AB8A 4K4ZA 2DHXA 3EDRB 2XSFA 3K89A 3M8WA 2HRYA 3HHLC 3PRBA 3SXLA 2W1BA 3LTOA 3BREA 2BM0A 2WCXA 1IKYB 3H2VE 1QVGR 1ZAXA 5KFJA 2QMWA 4NLUA 4RNOA 1WG4A 2O5DA 2DEAA 2EBGA 1G1XA 4LR7A 4H4KC 4ECZA 2J9EA 2IC3A 2P0WA 3PACA 4IH6A 3PCOB 3C66A 3VVTA 1GHEA 3MRUA 5I3UA 4RW8B 1IICA 3HM9A 2YKNA 3KLGA 1S76D 3G4SS 2F8MA 4PPZA 3KOAA 4NLPA 1HWIA 3MUVP 3M2RB 1VBXA 1OPIA 3QT5A 3A9LA 3HDSA 3KNGA 1QSOA 2MJUA 3P96A 1H6KX 3IM8A 4E8OA 3HMJG 2LXUA 2GMJA 2OH2A 3HVWA 4KKOB 3K5OA 1YK9A 1LEOA 3FMCA 2V63A 2QJ8A 1JJCB 1RADB 4OAEA 3FNNA 2JEJA 2FHMA 1H2TZ 3DMJA 1GMWD 2GMLA 4ZBGA 3UVJA 2EK8A 2XZTB 3MD1A 4B3SF 1DJ0A 4NLOA 1UEVA 1LWEB 2YKMA 1QQ9A 4QBUA 3KJNB 4DX7A 3KQZA 4A39A 2W8KA 2PJ2A 2LEPA 1VRUA 4DV7F 1Y5IB 1RU1A 2WRMA 2PJ4A 1X4GA 4B14A 1Q95G 3ZZ0A 2I1RA 1BO4A 1M4DA 4RUBA 4RW6A 2CZ4A 5HBMB 1CG2A 3KK3A 1JNRB 1EZZB 4CLLA 4Z7YA 1WUUA 5AJ3J 3KI9A 2OMLA 4HH1A 3RG6A 3AH6A 4LRFA 1UVNA 4QWDA 1LWFB 2KJWA 3FSYA 3MMCA 2LMIA 4JOUA 1HNWJ 3WIVA 4ICLB 4C8YA 1BOBA 2Z3LA 1AZSA 2FSRA 1BQNB 1ROFA 1HI8A 2RKIA 3LWUA 4J3GA 3OHBA 1YZ6A 3MMAA 4ZY1A 4DR7J 2KYZA 2W9BA 2R8IA 4NGNA 1ZLIA 4IRCA 2N3OA 4NWBA 5ETLA 1S12A 3C19A 4KZTA 3FBEA 3KLEA 4M5LA 1KUXA 4DQIA 4YU9A 3TJAA 3ZZYA 4IQXA 3GILA 1PIEA 4PEOA 3N01A 2V94A 3D54A 3NH5A 2PJ9A 4LBIA 4QW9A 2RHSB 4ILMA 1HHTP 3RRKA 3GIJA 3Q83A 3UR0A 5J2QA 4EI2A 1QAXA 1FK9B 4GKJF 4IG3A 5LRKA 4RO0A 5KFWA 4IO9Q 4P52A 3R9FA 4UEZA 1AXQA 2ACMA 2HKEA 4OX6A 1VHEA 4H6UA 3IRXB 2CNNB 4DZDA 3IXQA 3WDOA 4AUKA 1AT1B 3IJ3A 2ACYA 1FVQA 3PO4A 1X31C 2XC9A 3Q2TC 3DRRB 2GZOA 1EP4A 5LMUF 3OUYB 1K0TA 5KFHA 1P1LA 3GIUA 2NSMA 4Q45A 2B8PA 3S9LA 2QC3A 3UD3P 1XMOJ 3TR5A 3BJ7A 2IJZA 3C2PA 4B3MJ 2VPWB 2I6WA 3NNAA 4RLEA 1Y4ZB 3ZTRA 5I42A 2N3LA 1V3SA 1X7VA 1HR0F 3LH2S 3IGRA 1QE1B 5B08A 3H8YA 3IWNC 4M5JA 1YR0A 1JLFA 2EVNA 5E3QA 1HBNB 2NXUA 4X84A 2ALYB 2BACA 4HDGA 2G2OA 4LJMA 1SKWA 2FLNA 3PHTA 3JSRA 3W61A 3AB2B 1Q81T 4AVBA 5A28A 3KWMA 2BYCA 2YNEA 2DNZA 1GQEA 5GAEU 2CTBA 1E6YB 2HS4A 4CLTA 3BDPA 3SSQA 2D3OR 3OQ2A 2FY1A 2OZHA 2N7CA 4ZLNA 3TZZA 2FPHX 3KHGA 2ZVSA 4IRKA 4B9TA 4KSAA 3HK2A 4A8MP 2BKNA 3P45B 1VHSA 3H8EA 2HHHJ 2JFDA 4X65F 1R0AB 1NCLA 2OR4A 3BQ1A 1NK9A 4J9NA 2V67A 4G65A 4PG5A 3HT0A 4PRFA 3NOGA 2GIQA 1N0VC 2RF2A 4FYVB 4KGMA 4DR2J 2HBZB 4U7UD 5IC6B 2AGQA 5LSRA 4NI2A 4HDHA 2F4VJ 2KO1A 5HSPA 1QLNA 5J2NA 3VZHA 4C9DA 4OC1A 5EBVA 2VDIA 3BR8A 4LUBA 1S10A 4NE9C 1LK5A 1BHNA 3M9NB 3OTCA 3CCES 2R2RA 3OVAA 4ECUA 4EO8A 4CNYA 2D74B 3TWZA 4CWBA 3BO3A 1OQ3A 4PXDA 1M0SA 2F5IA 1NDPA 2G0CA 4X2BA 4WTOB 5KG2A 2JVOA 4LF4J 3D0HE 3ENWA 5C2CA 3EGVA 2CPHA 2H5IB 1RAAB 5IM0A 2J0WA 1UA1A 1QDUB 4YR2A 5KFEA 1ZETA 2J0SD 4ZPVR 4YOEA 4C7IA 3DDIA 4QR1A 1S1UB 4WXWA 4K59A 2Z3MA 1IBLF 4WP3A 4CO0A 3M8RA 2FLLA 3OR2B 2BDPA 4W92B 2AWZA 3LPEA 4LRDA 4GM5A 4DCPB 1T02A 1NH8A 2BUEA 2Y8WA 1IM6A 2HFZA 1F57A 2LQJA 5AE3A 1HL6A 5K9FA 2Z2MA 3BM7A 2B4UA 4IRDA 3GV5B 4MHYA 2EXUA 2FGOA 3J7Z5 1H73A 1K44A 5G4DA 2B4VA 4FKXA 3LP1B 2H48B 3PW5A 3AXMA 4MKBA 4LFBF 4F4AA 3C14A 4A95A 2BOPA 4FAIA 2JRSA 4DSKA 1MMDA 2CQ4A 4DPWA 4FKYA 1S6OA 4OYWA 2ZEEA 2IVMA 1TL7B 1TU0B 3R7BB 3TO7A 2ZVIA 2CPJA 3T8WA 3H2UB 3CCUS 2ZH5A 4CYPA 4DEZA 2HRUA 2I3CA 2I79A 3PKYA 3ICLA 3GIIA 5LRGA 3HLUA 1UFLA 4P73A 1VRTB 4I2PA 1TV6A 3BBBA 2ZHBA 3QT7A 1M5OC 4LFCJ 1LWXA 1HD1A 2UV8A 4Y2MA 1D8ZA 3SV3A 4QVTA 3TA2A 3PRVA 2PO4A 2IL4A 3IN5A 5GAHU 2LA6A 2H3EB 4DR5J 2HGMA 3KDNA 3M30B 8CPAA 1VC5A 1R31A 5B7WA 3PB9X 5HMWA 1FCAA 3V8IA 3CJ2A 2C3YA 4CO3A 3GIMA 4J9KA 4UFVA 2UU9J 3HKWA 4I64A 4LRBA 4NXYA 1N4LA 3E2EA 2C3OA 2MGZA 4Q2LA 1R6VA 2WVEA 4IOBA 3RBXA 1S1WA 3VV2B 4L72B 2G4BA 1T9TA 5THWA 1U1QA 3UDLA 2ZW6A 1OPZA 1O51A 2KYXA 2H54B 3OFEA 5HH1A 3H42A 4WIQA 3EUNA 3R5BA 2LDIA 1S1UA 3LQVA 1JXEA 1X12A 1B0TA 4EBDA 3VZIA 3SHPA 5EN1A 1WC3A 2HNDA 2DY9A 1IQZA 2C2RA 2M3DA 1R27B 2AFMA 3SCLE 2UUAJ 4AQYF 1RAEB 1Z9UA 3DLBA 2ZEGA 1DAXA 3NRBA 2B8QA 4U7CA 1VIXA 2XYGB 4DQSA 1MJAA 3Q8UA 5KFMA 4L74A 2VBXA 4UCPA 1X4FA 2HHXA 4DR5F 3FBUA 3GWCA 2BVZA 2HFOA 4X65J 1F9HA 4ZKAA 2XS7A 1T11A 1VI7A 1XJWB 1FTRA 1HBOA 1O0PA 2C2EA 4RW9B 2Y0BB 3D8PA 1XRYA 4MXUA 4CM0A 3S8SA 1RT7A 3FK4A 4K3NA 2BEIA 2B4PA 3QO9B 2BBEA 1WELA 2ZD1B 3Q8YA 3Q86A 2KCWA 3HJFA 3A3PB 4DFPA 4DLEA 4OC0A 1JLFB 2GIFA 3I6PA 4AVCA 1YGYA 3L7UA 4TNOA 4RS2A 5DDPC 3TQ1A 2OPQB 2V8VA 2HFSA 2XULA 1WHVA 4GO7X 4JZ0A 4K4UA 4KFBB 2FDNA 1Q7LB 2JEVA 2WONA 1S7KA 2X7IA 2XMTA 1I5OB 4UZBA 3A12A 4ANEA 5G21A 1HWKA 2KXFA 5FLXY 3NBPA 2G0IA 3DI6B 3CXCR 1DQAA 1YRXA 1N5VA 3D0GE 3TX8A 5SZTA 4WFYA 1REGX 2AGPA 1VR6A 2PT0A 1MN9A 3CD6S 4CRZB 2P8IA 1AMPA 2AJ6A 2JDJA 3DDDA 4OYAA 1OJ4A 3R7SB 4NGRA 2HWIA 4PR6A 2IJNA 3R9EA 1KNZA 2YKPA 3MDFA 4M94A 2E9TA 4R57A 2RB7A 4CYOA 4U5YA 1GTHA 1RWOB 1YWXA 3WIUA 4OI0A 4HPSA 4NFRA 1KONA 4YB1P 3EGZA 1UWBA 3AFGA 2WVCA 3MR5A 1S3ZA 1XMBA 1SQEA 3EJMA 4LQ6A 1NK6A 4OYPA 4CS0B 2X51A 2CY2A 1WC1A 5E0OA 4F6AA 5EX0A 4KAIA 3UCUP 2VZYA 4YB6A 4MFPA 5C42B 4KOWA 1S5ZA 3V4MA 2D9PA 1UETA 4QYRA 1L0CA 2JC0A 4ZPTR 4X66J 1N33J 3U7JA 3V5RA 1M5HA 1PJ5A 3RBZA 1D9FA 2QMXA 2DNMA 3BEGB 2H1YA 2ZUAA 2AF6A 4F0XA 3KKFA 4JI2F 4P6QA 5LM7E 1CJUA 4X5KA 4RW9A 5CYJA 5C7PA 3WX8A 3MEEB 4E0DA 3HUVA 2HIYA 1YMEA 3NGUA 2MYFA 4L75A 5DWMA 5KT6A 1U1LA 4QWEA 1D0EA 4MCRA 2RMLA 1ZOTA 4QYZJ 4LF5J 5H9EK 4MFLA 3DOLB 2VQEF 1NSAA 2B4DA 4JI2J 3BHXA 2HUZA 1OQ6A 4USKA 3VWSA 3V81B 2DVIA 1UFHA 1S9GB 4K30A 2VBWA 5KG4A 3D0IE 3EPIA 2ZOGA 4WP8A 1WKJA 2GIRA 1RAFB 3C14B 3LAKA 1SQFA 4B3SJ 3GYGA 2HZVA 3JVNA 1RT3A 2F7VA 2MHNA 5AG7A 2EUIA 2IBOA 1X4DA 3EZOA 1MWYA 1S5KA 1Q7LA 2V6AA 3IWEA 3FMBA 3HD2A 1HBMA 1G3OA 1RTHB 2VBQA 2UVWA 2PIIA 5C88A 4OKOA 4JWPA 1URRA 1PU9A 1HARA 4QWAA 3SI0A 3BN7A 4RW7B 3GU0A 2POKA 1OS5A 3QNVA 3LOUA 2VD3A 4FYWB 3GJQB 3QIPA 4LFBJ 3CJ0A 1YW6A 2VPZB 2FGCA 2IYIA 4YR3A 4UUXA 2RRBA 3WC0A 3WQPA 4NF1A 3ZTSA 4A2ZA 3ENAA 1VQ6S 1RA7A 2YNHA 3RO0A 1U6ZA 1S1XB 2OEKA 2W01A 4R8FA 3PEIA 3OV7A 3GFZA 4NLYA 4KVOE 4F0YA 3F73A 4DV0F 2BE9B 2GJ2A 1RQ0A 1FHTA 3KASA 1PO6A 5KFNA 2PA8D 5JPHA 4C68A 4C11A 3MD3A 3KFWX 4KGXB 4PWDA 1RBAA 4H2KA 2V2KA 2AIRB 4W4MA 4DV4J 2ZBIA 3J81U 1PYTA 3EXYA 2Z58B 2WK4A 3WHIA 4JI7F 4J9QA 1CC8A 1HLWA 1PAUB 2RC4A 4LF9F 1VCTA 3NS5A 2E1AA 3MWBA 3EE3A 4JXRA 1FDNA 5FLXU 4C8ZA 3P5BP 3M6UA 1UEUA 3IRWP 4O0NA 4NZ7A 4OZNA 3B78A 3D1HA 3RBDA 3DU5A 4UY8T 2YXLA 4ELVA 4ZCKA 4O3SA 4LRCA 1HHSA 2QTWA 1N0UA 5KT5A 4A8WA 2PDAA 4I6AA 3RBEA 3TFYA 2C2DA 2B0GA 3TP2A 3MECA 4DSFA 5E2QA 2ZH1A 5D78A 4DV3J 2V0NA 2JJ4D 1YSJA 1S9EB 4YS2A 3EICA 3MM8B 2C2MB 5U47A 2EBEA 4WIIA 1TF9A 4AYBD 1HW9A 1YBAA 1Q79A 2IQ6A 3K5PA 2R3VA 4A30A 2AP6A 4HI1A 3RR8A 2C6CA 1KKHA 1LWCA 2AV5A 2DGSA 2PJ1A 1IJFB 2FHJD 3CT9A 3IU2A 2EK9A 3W64A 3NAHA 1S7HA 2AX0A 3C8YA 4KIAA 3TVZA 3HHEA 4UIBA 1KUVA 2OSRA 1XN9A 4XNHB 3CULA 1CP6A 2AFOA 2YWHA 1KC8T 3P6YC 1K9MT 2IVFB 4L3NA 3G82A 4ILRA 2J5AA 4OQJA 1G4CA 3KK2A 5D4NA 1U2CA 4B13A 3M8SA 2DGTA 3MPDA 3VCDA 3M32B 3G8TA 2D3ZA 5DM7Q 3M1VA 1N33F 5HK4A 4NYPA 2GQ2A 1LWFA 3TJ8A 1XERA 2MKCA 3G71S 3DLKA 3N5BA 1X0PA 2C3MA 5JUMA 4B3RF 1FD8A 2B9XA 1Q1KA 2EO8A 1BMQB 2P6FA 1VOMA 1HWLA 4L6V3 2E9ZA 2YWFA 4BMHA 2F5GA 4C98A 2P9EA 4BCAA 1CP7A 2HHVA 4OJGA 1UVKA 1XEBA 2ERRA 4UTGA 2VDHA 3TZWA 1M4IA 1YK3A 3M8PB 4G1PA 3MMAB 3MMBB 3I87A 2EK1A 3VARA 2VPXB 2P6SA 5KFPA 4RX6A 4WWVA 2XCPA 4DN9A 3P4UB 3HCXA 2R7RA 2FJDB 2JLEA 5D6GA 3H7HB 1UZHA 1AUSL 2C42A 2GFFA 4DR4J 5EC4A 1H8LA 3PBEA 3G6YA 4WKRA 4HR2A 1U48A 1QSSA 2V50A 2HVZA 1QVFR 3PW7A 4K4WA 1RABB 1XWLA 4W9YA 4B17A 1CJTB 4ZLLA 3BSOA 3G2XA 1JLBB 3I56S 3EZUA 1HQ2A 2ATLA 2UXDJ 1CPSA 3QAYA 3Q89A 4U6PA 1H2VZ 3QGHA 4M5IA 2ZE2A 2YKNB 3ZTOA 2PRBA 2GHWA 5LOQA 2FYXA 1HEEA 1RP5A 3PTWA 4F9VA 4ANCA 4FD7A 3DLJA 2FLOA 2DR6A 4ZJQA 5IT0A 2ZKTA 4E8UA 2MHEA 3AHPA 1YX2A 1WC0A 2WPWA 4CO1A 1NJYA 1S49A 2DYAA 2DHHA 3HXMA 2YNGB 2LQ9A 3CJKA 4CCHA 5HQ8A 2FCKA 2NSCA 2VASA 3DR6A 1C0UB 2B5JB 2BJ7A 5DRKA 4P10A 2HS3A 3IR5B 3W3SA 4B02A 4CLZA 3L7PA 3ZZPA 2ZW7A 3BJ8A 2WTFA 1JXLA 1TUGB 2D3O1 2R2UA 4JV5F 3AY0A 1T94A 4RW4B 3MUMP 5H84A 2BW2A 4P2SA 4U9ZA 2VZ9A 3MEGA 2E5LF 4ZY0A 2FJEB 1U45A 4MBUA 1R8CA 3KLFA 2OPQA 2Q04A 1MW7A 1TQLA 4JI8F 4TQSA 2Q4VA 1KHVA 1RT2A 3T5HA 1Y9WA 3CC7S 2UUBF 2JDCA 2JBJA 4NLVA 1XMQF 3QT6A 2HAFA 1U49A 3K9TA 2PQ8A 1NKBA 4HVZA 4ZIWA 2RUGA 3OL8A 2Q43A 2NXNA 3MZIA 2HNZB 3UDCA 4OIXA 2FQQB 3HHLB 2AJ4A 4KHPF 4B9UA 4J9SA 3H8GA 5HI7A 2R7QA 2WHOA 3C46A 4AG7A 3UY5A 4XPKA 4M5NA 3UNYA 1SJ3P 1ZPVA 3M8QA 3UPFA 4HEA9 3CMAS 3VAHA 1PC4A 1REVB 3TI0A 1YJUA 3DKDA 1IIDA 2E5IA 4Q38A 1S57A 1OSCA 2IM1A 1SJ4P 4DSLA 1RYRA 2W2QP 1XMOF 1DE4C 3F41A 4GO5X 2AYBA 3PKMA 4IF5A 2CWKA 2C6PA 2W7OA 3C3LA 5A76A 4NEYA 1G6BA 2UUTA 2V77A 1JMTA 2ZBPA 2N4CA 4A32A 3T1HJ 1T95A 1ZAVA 1BD6A 2Y1JA 4ZYQA 4DSIA 3MM6A 4H6ZA 1XR6A 3AJDA 4KRWA 4R0JA 4P7VA 4U9YA 4ZOSA 5LSOA 4MFBA 3ETOA 3D3SA 1JNZB 4A46A 3UW1A 4WFZA 2WW8A 3NE7A 1VQ8S 1WTFA 2W2MP 1NK8A 2HNYA 2YNDA 2HRTA 3BI0A 2QL7B 1FFSB 2LVWA 3T90A 1TL4A 5G1ZA 5KFXA 3LP1A 4P4JA 2G2YA 4CTAA 2Q0YA 5F9NA 3IFEA 4LR9A 3SI2A 1NBEB 1ZH5A 2QN6B 2XEXA 2D7SA 4QZVB 3W2VB 2MZTA 3LA0A 2FVPA 2COLA 2DNLA 1KFSA 3R1HA 3D67A 5J1EA 1GAOA 1S4EA 5J1EB 2DIUA 1LV5A 4DR1F 4F3OA 3DXSX 4ZDNA 2ROEA 2J9CA 3LALA 4KOXA 4HL9A 3BSCA 2V2VA 2GVDB 1NSLA 2GHVC 2CIMA 1TIQA 1WI6A 3D7FA 4G3IA 5IT9Y 4CAXA 2HVDA 3W9HA 4XPCA 4OZ0A 2Y0MA 1HPZA 1F0XA 3CCQS 3H5ZA 1VK8A 1NZ8A 2CZVC 1OZPA 1FKPA 2GAGC 3MEDB 4MY3A 1SJRA 4IOCQ 2QT7A 2MQOA 1RT2B 4LSNA 5HROA 2WUUA 4M5DB 4DUYJ 3BKUA 3QIPB 1JLAB 4BBYA 3OTOJ 3OTDA 3PX0A 1RTJB 1R8AA 4RZRA 2BJ9A 1DBDA 1YJVA 3CCTA 1S1TB 1TKTA 1J5OA 5D8HB 5KFKA 3QRRA 3AQPA 3MPVA 2HFVA 2EKNA 4PUOA 2Q7BA 2XEIA 3HSGA 2ZXVA 1FJEB 4NGSA 3UI3A 1WC6A 5L39A 4UEFA 2EFNA 4FNIA 1IKXA 2MLXA 2KJVA 4DV1F 4AE5A 4KGKA 5B0BA 4OYZA 1YG0A 4ED4A 3GQCA 1NJWA 4XNHC 2NUHA 1UTAA 3QT8A 3DLGB 4FXWA 2ZZNA 1X8DA 5J8FA 2Z57B 1RHUB 3VAKA 1F2GA 2Z3NA 4UZCA 2LA4A 3NS7B 2IRUA 4I67A 5DG9A 4ES1A 3B54A 4A37A 3GPAA 1IUJA 1HI0P 1U2RA 2QLJB 3E01A 3WZ0A 4YB5A 4DZ6A 4TU9A 1H2UX 3IO1A 1BQMA 3OR1B 1HNZJ 1H7WA 4ZCLA 4K4YA 3W6XA 1ZS6A 2QO3A 4ECYA 3CO9A 5F8JA 3RYOA 3K8VA 2C2KB 5E3CA 3FRZA 2Z10A 3F8KA 2CPIA 5IM0B 4UOCA 3RU0A 3U1NA 1HBNA 1PYSB 3MFIA 2ALZA 1JJHA 2YQ1A 1RTZA 3FF3A 1WF2A 4K2JA 3T9YA 3FZ2A 2DHSA 4B10A 1B70B 3T1YJ 1IWAA 3MEGB 2R8GA 2AFWA 4HHHA 4Y28C 5GAHI 2VC0A 3DI6A 5BR8J 1L3VA 1I1GA 1TL3B 3QO9A 2AEJA 3MR3A 2W4DA 4S0MA 4GRSA 4DU7A 4L8AA 2IMWP 3I0SB 2ABZA 2BL1A 2W24A 2WONB 4ID5B 1VJQA 2AYEA 4NGQA 2DK2A 3SYZA 2IM0A 3DGPB 3FJ2A 4OX8A 5G20A 1SC4B 3LWMA 4FPRA 3VVUA 5DGBA 3DLKB 1P9QC 1FFGB 4U9RA 2HQGA 4WP9A 4LSNB 2WAQD 5A8KB 3CJQA 5KG0A 3V6DA 2PJAA 3G8WA 3AD8C 2ZPAA 1UWBB 1E6YA 1M5VC 5H9FJ 2EK6A 3T1YF 1DLOB 4A8KA 1AZSB 3RUBL 3HX9A 1R6YA 2FB0A 1RHRB 2B3UA 1Q8KA 3Q0AA 4AQYJ 1VBKA 1D09B 3DRPB 3FBBA 1Q8IA 2AE6A 3D9BA 5K5MA 2QYCA 2OFHX 3QAEA 3IAM9 4ECSA 1U8SA 3MR2A 2J6SA 3KG0A 4LF9J 1FRXA 3PIPQ 3SSSA 2XGPA 5LYIA 5LMNJ 2HVHA 1NMTA 4WBFA 2C2OB 4N5SA 2ZW4A 1QD1A 2CPZA 3TUPA 3R5GA 1JXVA 4FF4A 2PFFB 2LXFA 4DMZA 1S0VA 2ZEJA 1N36F 2AFUA 4Z65A 4ELTA 1UL3A 1IR1A 3G6XA 3ENVA 3UN2A 3AQOA 2UXCJ 3X1LB 1PYTB 3ET6B 1ZM3A 2YBVA 2B43A 5ETNA 1FRIA 3T5LA 2DO0A 2K5TA 3CIMA 2DGQA 1RT5B 3ZNUA 2Y1RI 3B3WA 1N6QA 1TKXB 1MU2B 4ZP6A 4YHHJ 3OW2R 4DR1J 4DV6F 4MRIA 2DNNA 1GXUA 4AB7A 1CJVB 4Y34A 2B3VA 2IBKA 3L3CA 4WCEQ 3IWGA 4IR9A 2D69A 3FCVA 1EQMA 2O01C 5HN0A 2EWBA 2OP5A 3ISNC 1IJEB 1H3DA 1SIWB 2QA4S 1YRTA 4DR4F 2NS1B 1FJ7A 1AW0A 1TKHA 3KK2B 3ISND 4A8SA 4NYZA 2FD2A 2DXFA 1B7YB 2IRXA 2O53A 1ARMA 3M6XA 2L9DA 2RAQA 2CJYB 2V4JB 3SV4A 2RU3A 1EJ7L 3GCXP 4NLXA 2J8MA 4OP4A 4IQMA 2G13A 4H4MB 3D6MB 1KFDA 1LOUA 4HT7A 2V8GA 3I55S 2CNLB 4HTJA 5GAEI 2R7VA 1RTJA 1TKZA 4MFZA 3BPSP 3JS9A 4YY3J 1GFWB 4O3PA 1AA1B 1V9OA 3B3CA 4O44B 2X1FA 2FHOB 4XPEA 2GC8A 1YX0A 1ARLA 3MTJA 3PEJA 2RJZA 1FJGJ 2AQ4A 2BE7D 4Q43A 2R4FA 3CTRA 1CS4B 4LF8F 5LJ5Y 4N56A 1U6BA 4AT1B 5AXMA 2GVDA 2O4HA 1IKXB 4KHRA 4P7TA 3NMAA 1RCXB 2CA9A 2CDRB 4NX9A 1TKZB 2GHPA 1QSTA 3DOLA 3MUTP 5KFAA 4Y2CA 4QPXA 4F2RA 2IY5B 4ZVOB 4ZVPB 3CD0A 1FRJA 2R7WA 4LIRA 2JLGA 5F8GA 1B99A 4EUVA 2J8RA 5HQLA 3CCLS 1RU2A 3LGNA 1SJFA 2DPTA 3B3VA 3N7ZA 1B0VA 5HVGA 5E7OB 1X5TA 8ATCB 3NWGA 4LVOP 1Y0YA 4P2MA 3M2RA 1S1XA 4JYAF 1YJ7A 3DLGA 3DRSA 1MSWD 4OJ1A 2IRYA 2B5GB 3B8GA 3GIRA 4WF9Q 3FEXB 2V2ZA 2DPJA 1KWMA 3P49B 3DHXA 4USVA 4R5PB 4FS1A 2YNFB 3HULA 2GMHA 4QIGA 2W9AA 2MQMA 2FVSA 4M5GA 2YTCA 2OHDA 2V4JA 2K8GA 2CQIA 4CP5A 3NY0A 3TVKA 2WSEC 4ED3A 1LRZA 4DL2A 1RCOB 4NRUA 1UFWA 3JAMU 3D7GA 1RLDA 4IFVB 2PSZA 1S59A 2V68A 3VGVA 2HB6A 3MPWA 2XO7A 3NCRA 4X64J 2XMJA 2ASJA 3SDEA 3RNZA 2RH3A 3FEDA 1FXDA 2UXBF 1U6MA 4I7FB 5I3PA 4ZLJA 5A27A 2MY7A 1X4BA 1Y9OA 1YRUA 4XTTA 3GR0A 2WSFC 3DHWC 1RT4B 5E33A 2A6MA 1YJNS 1P8GA 3GE9A 4K4TA 3MGDA 5ISVA 2HVIA 4I2QA 3RAMA 1X4CA 1FEEA 3DLLQ 1OWXA 3R6GB 1NMEB 1MROA 2LEBA 4FZVA 2HQFA 4PYDA 1BQXA 1VQSA 2UVRA 4OZ2A 2DT9A 4ZY2A 2UXDF 3LWLA 3VH9A 3C15A 3D5MA 3GZ7A 1NNDA 3IWWA 4WZMA 1JLQB 1GYTA 2QX0A 3HVTB 1LXJA 1ZLHA 2ZH7A 4P2XA 2A3JA 2WYRA 4D3GA 2WZ1A 1OSDA 4C8NA 1BUXA 1M90T 3THPA 2R2TA 4FBEA 4YQWA 2I0XA 2QFIA 3NKYA 2ZHOA 2XMVA 3DM2A 3S6GA 4RWWA 4HHUA 1WD6A 3L95X 1SJQA 2QLWA 1IYLA 2OD4A 4JI5F 4V1Ak 4DR3J 2P9CA 2HQ3A 5IWAF 3MTKA 1OMSA 4UBRA 2DNOA 3D3CJ 3QWPA 2RS8A 3T1HF 3BH7B 2HHQA 1XEZA 3NOCA 4A38A 2KFZA 1X4HA 4F4XA 5ETTA 2DH9A 2RQMA 1WHYA 4HH0A 5I0CA 3BYRA 2X1AA 1FVSA 2QG9B 1TMJA 1HWJA 1VLYA 2DGXA 3ZO7A 1N5QA 2L9WA 4MH8A 3OUYA 4RUHA 1FX4A 1EP4B 4DDFA 1TK8A 3I82A 1DLOA 1KTQA 2C2NA 1N32J 4YUDA 3T5JA 2CADA 4B9VA 1EAYC 4F0HA 2QLBB 4QUSA 3ZZZA 2QJ3A 3GSDA 3TW0A 4EMDA 3BZQA 4LSLB 2ZKUA 2ZENA 3MECB 2CJXB 1J27A 4DJBA 4DG1B 4QJVA 5LMUJ 2D1CA 3PZPA 4JI0F 4QIWD 1VQOS 2VV5A 1BLUA 2BXJA 1HA1A 2H4YB 4LIWA 2A2DA 5KFYA 2CVIA 3V6JA 2OOTA 3PEHA 1WSRA 4N8NA 1MROB 4KVXA 1XNRJ 2BJEA 4PKDB 4NLDA 4ZVRB 1WF0A 3M8YA 4J91A 5BXIA 2MKSA 3KLGB 3QGPA 2Z2LA 1YLEA 4NLRA 4KHMA 5F0WA 9ATCB 4NYOA 1E6VA 4FVCA 3Q22A 3V4IA 3GJTB 4CAVA 1C1CB 3GV8B 2CG4A 2KHCA 3DSBA 4DR6F 3J7ZT 1YJ9S 3CJ8A 3W66A 4Q8FA 5KFBA 1Y7RA 2PJ3A 4RU2A 1WNEA 1EB0A 4YN3B 3L7OA 1YITS 4MFJA 1VQ4S 2DCLA 3FVLA 1VHFA 1UCNA 5ETSA 5M2PA 1T8EA 4JV5J 4GVBB 2VJUA 3GCWP 2DR7A 4RBVA 3W2WB 1QUPA 3X3UA 4EGLA 1YQHA 2F9JA 1TUWA 2IIHA 3V6KA 8AT1B 1HFEL 1NPPA 3VAMA 4LT6A 3BV8A 4TXSA 1SUQA 2DD8S 2XG8A 1R8PA 4CDIA 2BO9A 3EC4A 1SQGA 4YP3A 3T1AA 2MSTA 1VISA 3HO1A 2B9EA 1W2BR 3IG1A 1HMVB 3H40A 1RBOB 3PJWA 3SI1A 2XNQA 5M2UA 1XTZA 2RSQA 3EYZA 2ZWPA 2O3DA 1ZO0A 1UVMA 5IC4B 2VI7A 5EUHA 2NLWA 1SQHA 2IYGA 3FJUA 2VA3A 5JQ4A 1U7LA 1HYSB 3CPAA 2DBBA 1YJWS 3NH4A 5I42B 2AD9A 3PYDA 3JTNA 1S0MA 2R7TA 5EMIA 4F8ZA 3KMSA 4C7HA 3W65A 1IR2A 2D4PA 1B6BA 2R8JA 2PE3A 1RTDB 5A0YB 1RYSA 1RAHB 4KOUA 4C2MA 3SSRA 2HQYA 4KPYA 4EFDA 3W9JA 2JL9A 1FDAA 3UE2A 1JJ4A 3D68A 3BYPA 3NG8A 3PY8A 4UCNA 2C1EB 1PBUA 5E5NA 2PSWA 4WFBQ 1LAMA 1VBYA 2OZGA 2Q1LA 2O66A 4YR0A 3QIDA 4ZVEA 1UAWA 4IUSA 3CJ4A 3AXKA 4TYAA 3D28A 3EGWB 1XOVA 4IH7A 4AL6A 4KOYA 5EHHA 2RRNA 2YH0A 2V8PA 1D3WA 1YJTA 3B3TA 1H98A 2BZ2A 5IQQA 1IYKA 1CM0A 3HD1A 1IB1E 2RHQB 1RAGB 3U1LA 2JX2A 4O44A 2LQ8A 3BXMA 4KO0A 5IB9A 3DN9A 1J4JA 1QAJA 3MM5A 4F3MA 2CJ9A 3A8EA 4HACB 2PJ0A 3B4MA 5IZHA 3Q8RB 2PC6A 6CPAA 5IX3A 1HBOB 2M8HA 3CE8A 3FUYA 4DWIA 2ZBCA 2N7YA 4NCZA 3MPUB 2DEIA 1U6FA 2HC9A 2OD6A 2XI2A 4PWUA 4ZPBA 2GU2A 2VQEJ 3FBCA 4FYXB 2R98A 4MCQA 4C8LA 1UVJA 1JLGA 5FD1A 1FKOB 5HROB 2FJWA 2EFGA 3CNQP 4PAAA 3VAGA 1GH8A 1GX6A 1M1KT 5EX3A 1CS4A 4CTAB 2VBYA 3EVMA 5E96A 1WOSA 1OY8A 3I9V9 4F36A 4GMKA 4IHMA 1N5YB 3I9ZA 4ZX8A 3NFZA 3SBMA 4NXMF 4KC5A 3J7YI 3RW6A 4A8OA 2H9ZA 5JGFA 2PIZA 2PCUA 3OTEA 4NGTA 5IWAJ 1GMUA 3EXNA 4ZPDA 2KDOA 3TC8A 4ED6A 1YW4A 4MFKA 2MKHA 3I5CA 3AODA 1RWVB 2HVEA 3OL9A 3D66A 5EGYA 3M8QB 4H4KA 3Q8QB 1QSNA 4LR8A 3BF4A 2YPZA 5JH9A 3OFGA 1VIOA 1I51B 2CXAA 3BJYA 4H4OA 2FIUA 5LYFA 4NXNF 5F0UA 3T5KA 4LQ3A 2J8SA 3HSZA 3JYTA 4LF5F 3VAJA 5CCLA 1EQ0A 3FBFA 2DNKA 2OKQA 1NPKA 2IMOA 2HPUA 5A8KA 4JI4J 2VA2A 3CDBA 3HFZB 2RQ4A 1FK9A 3DRYA 2B4DB 2M0GB 1WEYA 3MFHA 4LREA 4OIWA 1LNQA 3IAS9 2CNMA 4U96A 1SH0A 2VG6B 5T7LB 3AOBA 3TQEA 4HKFA 4DSEA 4OADA 1CJKA 2RDJA 1RZMA 1HBUB 2NSBA 4H54A 2DNHA 3K57A 4UWIA 2RKIB 3M05A 5LSLA 1C0TB 2NPFA 2AJ2A 3R95A 4DFJA 2OLWA 2YNIA 5ETOA 1QAIA 1Y5NB 1X9MA 2HW3A 3WX4A 2C6GA 2B3TB 5DDQC 4OV1A 4CQ1A 4ECVA 1PUAA 1BC6A 4BDPA 1F1BB 1P9YA 3CJKB 2IA0A 2KXNB 5MAOA 2KM8C 2G0BA 1IOIA 3OBIA 2LDYA 3FQLA 1L3SA 1WHWA 4ETXA 3RBUA 1KHWA 3KJFB 1FO1A 4MY0A 2G0JA 4CO5A 3ET6A 3IC1A 5HQMA 4K5SA 2R7SA 4NA3A 5HO4A 3TOBA 4QU6A 2GO8A 5F8HA 4X4TA 2DITA 2W2PP 4R6TA 2M9KA 3O2IA 5D8NA 2Q3PA 3O3LA 2PVVA 5A2QY 4X4SA 3I31A 4CH7A 2J0XA 2UZAA 3CJ3A 1KOHA 2HAIA 2ROGA 4RN7A 1X0FA 2WW4A 4A48A 2CQ0A 2V8HA 1U4BA 3AJ1A 5CZXA 3LACA 5KOWA 1VBZA 4H4MA 2UVUA 1FTCA 1DARA 3JB9k 1TK0A 3BB5A 2DCUB 4DL4A 2GQCA 1HHQA 2GJFA 4OZ3A 2V4QA 3TANA 3MI7X 1ZZNA 4RWXA 2XSJA 3FIXA 4DV3F 3FGVA 5LL6d 1LANA 3IS9B 1G2EA 1JKHB 4RL1A 1TMMA 2GIVA 2VFRA 5B0GA 4LQ9A 2MKYA 4HKQA 3HVTA 4MKVA 2OPSB 3BGRA 4F02A 1CBKA 1RHQB 4R5PA 5DWNA 3J7YU 1FNXH 4WKYA 4C2YA 1TKXA 1BPMA 5KFQA 1MK4A 2AYMA 3NEKA 1BE4A 2AFXA 2MDAA 2MLZA 4P44A 5MLCV 3SJFA 1FXLA 2ROPA 3RJMB 2ANPA 2NYIA 3IS9A 5J1NA 2ZEFA 3OVBA 3DC2A 4ED0A 1FKPB 1S97A 4RBTA 2ZJQQ 5KFRA 1LWEA 3K8WA 5B0EA 2EEYA 2VODA 1ZA2B 4ZA1A 2FY8A 3RB6A 3ILIA 2VKRA 4XK8C 3FFIA 3DLHA 3TX0A 2QL9B 2IA6A 2M7SA 2DR5A 2YY3A 1V3ZA 4YFJA 4BWMA 4QYZK 5D4LA 1IBKF 3CW2C 4YDDB 3TZYA 5K14B 1VQ9S 2OSQA 3W8PA 1RHMB 2FHJA 5ETKA 1NUEA 3SIPB 3ONQA 1NK0A 1F9FA 1IY7A 1XIXA 5KT7A 4IDKB 4NOHA 1RA6A 2AFZA 1F3FA 4LX9A 3G8SA 4J9VA 3TNVA 1LCPA 1FNOA 2W2NP 2XEGA 3DNSA 4PG6A 3GMGA 3TCVA 2D4OA 1I21A 2QMLA 3CJRA 1V5VA 1MMNA 2CTCA 5F9LA 3CXQA 1IM4A 5F8LA 1OO0B 4B6ZA 2CQBA 3V6DB 3PDNA 3I4PA 1WI8A 4NLSA 1RT4A 2EVZA 2IC3B 1N34F 2QEXS 4DUKA 4LFAF 3PX4A 5J2QB 3DDNA 3NGDA 3V7ZA 2PEBA 1ZG9A 3LUYA 4PABA 1NE9A 1DTTB 1LW0B 2Z3KA 2RNEA 3NGRA 2JEIA 1GK8A 4TU7A 2BA9A 4JI1F 1SVDA 4JI7J 2IVYA 3B8HA 4CT9A 3J81Y 4JI3J 2BKOA 3C6TB 4DPTA 3MMJA 4QIFA 4NGMA 1Y0HA 4OHYA 3CCVS 4GVBA 1XK8A 2K06A 3GONA 1U1KA 2XYPB 3AT1B 2BQ3A 3HP6A 1QTNB 3MAHA 4QR0A 1Q7YT 2KU7A 3NXZA 4DUYF 2Z56B 2A1BA 2AX1A 4K5RA 4WPAA 4MK8A 3KHHA 3PW2A 1ZPWX 3A1YG 2E7VA 2M2BA 5IV0A 1NSPA 5IFMA 2CIJA 3GSIA 3BN4A 2WPXA 1SKRA 2JSXA 4CH1A 1F60B 4OJHA 4F67A 1W2IA 2FUG9 4P6YA 5I4MA 3RB4A 5H86A 5KT4A 3S6HA 3Q8PB 1D9DA 4JB8B 3H5XA 1IKWA 4C8MA 2E5HA 4EO6A 2VFVA 3OXGA 5KG7A 3V2UC 1C4CA 2DB1A 3J80Y 3NGSA 1XFOA 1L5UA 3MF5A 5F3TA 4DUZF 3JSYA 2PDOA 4X4OA 2HGLA 3PP9A 2LECA 1Q86T 4EU0A 1OBRA 3ADAC 3TO6A 3CPWR 1LAPA 1I94F 2GE3A 2BRLA 3BDEA 1Y10A 2AJFE 3GIKA 3FEZA 1GXTA 1S1VA 3HJVA 4KKOA 4EYIB 1JLCB 4DF4A 1IBMJ 3HKZD 4OLPA 4P4DA 3ELHA 4PPDA 4UIAA 4PXCA 4R0EA 2GGPB 4O4GA 1H7XA 7CPAA 4CNZA 2I9SA 1UPMB 4Q36A 1XC9A 2E66A 2YQ0A 3NGKA 2C1CA 3M1VB 4OHVA 3PB8X 1CVJA 3SMZA 1S6PA 4UF4A 4ID8A 2ASYA 1FD2A 4DI6A 4DV7J 1S9GA 1NEEA 4USMA 3ILOA 2V34A 3G82B 1S48A 3FVYA 3QGIA 1CJKB 2BQRA 3MGJA 1CJVA 4DXLA 1TV6B 4DX6A 4CYQA 1CSJA 4X4QA 1RAOA 1S72S 1P0HA 2KFYA 4IAVA 2R8VA 3BR9A 4GS4A 4EEYA 1IBLJ 2BABA 4KV8B 4FF3A 4OL8A 2PN6A 3KLEB 3A8IA 2MJNA 3R2CJ 4CYUB 4KBIA 2RS2A 4YRHA 1Z1ZA 1ZA1B 2FIWA 5KFUA 3C16B 2DRBA 3ETMA 5KFTA 2A2CA 2O67A 2ZJPQ 2F1FA 2KB2A 1TZ0A 1ACMB 2E1PA 1UJ4A 3SZ2A 1VQPS 3ITHB 1KR4A 1N5TA 4HT5A 4ZGYB 5KT3A 2Y9HA 1LW0A 4J9RA 1JB0C 3I4HX 3T6JA 3U02A 5CA5A 1UWYA 4YFUA 4P74A 3VGTA 1Q8BA 5CYMB 4ENOA 3KUHA 2RIJA 5LXRA 2HQDA 2GA7A 2M70A 3QATA 5DZ7A 4W90B 4IG0A 4UFWA 3PM9A 2CYYA 5FIIA 2J9AA 2OUGA 3E3XA 1SV5A 4V19X 2Z11A 2ASDA 1FWLA 2B6AB 5HVFA 2L9NA 1RTDA 4WE1B 1V0CA 4B9LA 5C24A 3FYNA 2ZBRA 4M5MA 4C0BA 1CC7A 5DQHA 3K17A 4BC9A 2PA3A 2ABYA 4ERDA 2FC9A 2AKWB 4IYQA 3TE4A 2YPYA 1S7NA 2ZH2A 3IP0A 4DPYA 2KXHA 2BM1A 3FSIA 3DRXA 4MI4A 2KRRA 4HNYB 4YB7A 1MWQA 1V5IB 3N0VA 3W60A 4DSJA 3JRUA 2EFOA 3FEEA 5D0HA 3S6KA 3JQMA 4WYWA 4JI4F 4CLSA 4FF2A 2DH7A 4P45A 4JI5J 1D1UA 3E8OA 1X9WA 3S01A 3Q8VA 4B3TJ 2BCOA 2E7XA 2E5LJ 2ZJRQ 2OI2A 4DUZJ 2CJAA 2W2OP 1TKJA 5DM6Q 3CB4A 1T9WA 5GCNA 1BXNA 2OPSA 2YWGA 1UMJA 4C97A 6FDRA 3P2FA 3LANA 1GMVA 1Y11A 3ISZA 4KVME 2CDQA 3QWUA 1PJ7A 1C1CA 2ILYA 2JBKA 4M3SA 2G3TA 4JUZA 1A2ZA 2HQCA 2CUYA 3HHLA 3S9NA 3TOAA 4OJ3A 2YKMB 5ETRA 3UD4P 3DR8A 4CLYA 2XBPA 4MFQA 3V38A 4TQRA 1SKSA 1WKLA 3CDXA 1M4LA 2QRRA 4KOTA 2MZJA 1SXLA 2LU2A 3AD7C 2VKZG 3C26A 3MM8A 5DQGA 4J90A 1JLCA 3GJSB 1HIYA 2HFUA 4O3QA 4OI6A 4OYXA 3TRGA 1ELLP 1RSCA 9RUBA 1QSRA 3ULHA 5CCMA 2BUNA 2BMBA 1Q5YA 4OC3A 3GB0A 3OJUA 4CGNA 2NXEA 2ZH8A 4U67Q 1FX2A 5D77A 5C2GA 3KLVA 4CLKA 2MQPA 3DCAA 3M30A 3IGNA 3FSXA 5HANA 5KFZA 4LF6F 4PK2A 4DPXA 3D1QA 2HG4A 1CX8A 4L76A 2E1RA 3DNCA 1B87A 2DISA 4HTIA 3UVJB 2DPIA 3IA0A 3RW7A 4RW8A 2O1PA 4IG0B 4IH5A 3W2WA 1S9EA 3JSMA 4M1KA 3AA8A 1HI1A 1QAYA 4C0OC 3HHLD 2F4VF 3VF0B 3AOCA 1B64A 4FP9A 1YREA 3IR6B 2R7UA 1FWPA 4CPAA 1IBMF 2CNSA 5AG6A 5K8NA 4ZVHA 3LODA 2G1DA 4UUWA 3N6LA 1TL1A 2OEMA 3RB3A 1R8HA 1TF8A 4P4FA 1XMQJ 2VUGA 1NU4A 4BWJA 4FVMA 4C2ZA 5AG4A 2P6TA 3F44A 5ETVA 2PMZD 1TL5A 1VDHA 4XAKA 3K9UA 1RKIA 4Q7AA 3EMTA 4PQAA 1GEHA 3H8FA 5IOLA 2MKJA 1J5EF 1RHKB 3POTA 1NSKL 1UVLA 2ZEMA 1TL3A 4CRJA 3T19A 3TUIC 2U1AA 5DLFA 1RT1B 1MWZA 2G3AA 3S6FA 3HVAA 5HMYA 1R7IA 4BS2A 1UP1A 2YGWA 3PFOA 3G6ES 3HFKA 1CPXA 4Q0BA 4B3OB 1CPZA 1M1HA 1WWZA 3MEKA 2OTJS 1I1DA 4HACA 1SH2A 3OSNA 2YWWA 5CYQA 2FC8A 4CZCA 4FNHA 2CJKA 1S4FA 1QSYA 1LWCB 4JV0A 2OTLS 4DOZA 1QUVA 2JNJA 1BLLE 2CG8A 2R42A 1KEKA 1C1BB 1WKKA 4CAEA 2GGPA 3H0PA 2Q4YA 3RAQA 4NL5A 4N76A 7FD1A 4Q0BB 4OYBA 2W7PA 3TZXA 3KZWA 2ZH4A 2WB4A 5B0CA 1M1GA 3A8KA 1LFPA 2J9DE 4NLTA 2XY6A 5CYMA 4O4RA 5AG5A 3TO9A 4NA1A 4ATNA 5T41A 5DS0A 1MJBA 4IFYB 4CAWA 1C1BA 3TYTA 5A8RB 1APSA 3UCGA 1YVFA 4PQUB 8RUCA 2FS5A 3MM5B 4AFFA 1QMUA 4DN0A 3TUJC 3MEDA 1T9VA 3IRXA 2P2CB 3UN5A 7AT1B 2H4WB 3W5ZA 4DL3A 3Q2SC 2YNGA 4N7TA 4NLWA 4DV0J 5L1KA 1XQIA 5BYRA 3UCZP 4C4WA 1O8BA 2FJVA 2X7BA 2GX8A 2LKZA 4MYTA 3VGSA 1RT6A 3R8YA 3RYLA 3OJSA 2C28A 2BANB 4FWUA 4D3HA 3UD5A 3VAIA 3FC9A 2WSAA 3TVYA 1FDDA 5A6PA 1FA0A 3H20A 1U0SA 2NCKL 1C2PA 3M6VA 2JHEA 2Y8YA 3EY5A 2G2ZA 3H98A 5HMXA 5CABA 2E7WA 4KS9A 3KQXA 2FVGA 4Y6IA 1YQEA 2JEFA 3O6QA 2FIAA 5K8OA 1RTIA 2I00A 2OB0A 2PEHA 1MG7A 4O0IA 1JLEA 4DHVA 1FRKA 2E1CA 1H38A 3DRSB 2RF2B 1F2OA 1Y0RA 4C7QA 1ULRA 2BW7A 1XNQJ 2WBRA 1EIYB 1FRHA 3CF5Q 1YBTA 3R3TA 3PG9A 4PZVA 1KUYA 1KS2A 2FHKA 1X5OA 4B3TF 4ZVTB 2W7AA 2Z2ZA 2KFNA 1U02A 1U1RA 2UU9F 1XBUA 4Z7CA 2CNOB 5GMKa 4TLRA 3H2LA 3OLBA 3ILJA 3ISXA 3H5YA 5C24B 1U26A 2PJBA 1RT1A 1HWUA 3J7A1 4NCGB 4YY3F 1WDDA 5HLFB 4FBUA 2VC1A 4UOGA 2RD5C 3BGOP 3CO0P 1FDBA 5CD4H 2AZ3A 3CMES 1FF2A 1Q0NA 4K2XA 2ZITA 1XR5A 3CWJA 5CYQB 1W7WA 1WTBA 3LO3A 2Y1LB 4NEZA 2J6UA 5KG5A 3B2YA 1RK8A 3QSIA 4DR2F 4MJKA 4DUTA 1Q78A 1CULA 2EKYA 3MPYA 4EMEA 1VK3A 1M5KC 3R6LB 3E0KA 1SL0A 4LSLA 1ELOA 4QPTA 2QFJA 2RRAA 1U0HB 3PIOQ 4F2SA 3B3SA 2R9LA 1RWXB 4OI4A 2W9BB 3IIBA 3V4IB 4LFCF 5C25A 4Y2IA 4X2TA 1TL7A 1Q5VA 3KDOA 5CAAA 1UW4A 1OYEA 2CQ1A 4N41A 2MKIA 3S6EA 4LSZB 1IQTA 3CC2S 1ZM4A 1Q2YA 2EFQA 3PBBA 2WOMB 4ICLA 1S0OA 1JLBA 1HKAA 2M88A 1U09A 5G0RB 3G96A 2XWYA 1WOPA 2RVJA 2DGUA 5H9EJ 4B3RJ 2PJCA 3R5DA 1IBKJ 1ZG7A 3I9SA 1Y7EA 4WK3A 3QNWB 1EKSA 3CCZA 1MJ9A 3KHRA 4XPDC 4M5DA 3IBWA 3UR3C 2KI2A 4R3KA 1JKHA 4X4PA 2U2FA 3D6FB 2K3IA 5DGAA 4DL6A 1NHVA 1ON0A 1PKUA 1KTVA 1S6QA 1OYDA 2J8AA 4EWTA 1TFYA 1JX4A 2B4BA 4Y49B 1Z2ZA 2PI4A 1N48A 2AJ0A 4OZLA 1FFWB 1HW8A 1WG1A 4X4RA 1BWEA 1WACA 2UUCJ 1RWUA 1SC3B 4DLGA 3ZXWA 4F4KA 2QIRA 1GMWA 4F4YA 2CPEA 3MCOA 1JWWA 3ZZRA 2R8HA 2GVZB 3CXSA 2HHWA 2QA2A 5D15A 4B3OA 3A8JA 1VQ7S 1PAEX 5AGEA 3N9UC 2AMCB 4RW6B 4DX5A 1T9XA 2Q66A 2FVRA 2XNRA 3LP2A 3HLPA 3SJGA 4DL7A 1KQFB 4XIUA 4ZI6A 4ED1A 4NASA 1KDNA 2F63A 4QWBA 1B7FA 4XPLA 2CQCA 3UN3A 2DRAA 1NDLA 3GFHA 1K73T 3KR5A 2BR0A 4EBEA 2ZH3A 1LK7A 3OWCA 1UA0A 4M6HA 5KT2A 4E98A 3NBPB 2DKOB 3P8BB 4NLGA 3DRRA 2XM3A 2I5JB 3OLAA 3E01B 1IXKA 2FLPA 4DS4A 3EO4A 2QLFB 3VALA 4UOHA 5GMDA 4FDFA 5A8WB 4ZHRA 3GFYA 2FJAB 5T14A 2ZDPA 2LYVA 1RWNB 2G9DA 4HNXB 1HNIA 2B51A 3KLIA 2RQCA 3EM1A 1NLKL 5SUHA 3QJJA 3T3FA 3U27A 4CLPA 3IGVA 1RAJA 4EZ6A 2PJ6A 1YIJS 3L09A 3N28A 4F0MA 4ID5A 5F48A 1YTYA 1LXNA 2CPXA 4I56A 3OFFA 3I0SA 4WK1A 1S6PB 4I6WA 2DRDA 3CCMS 4LF6J 1Y3JA 5I3QA 2HMIA 2HHHF 3DXBA 5KFGA 3VTIA 3G8QA 3BS9A 4LRAA 5E3PA 2QA4G 2HHSA 3RGIA 4ITSA 2BKPA 4I2QB 2VXKA 5DQIA 2OPRB 2FT0A 2ZFHA 3TEGA 4J37A 1S1WB 5IS2A 4KLWA 1S1TA 3AOAA 2C3UA 5HL7Q 4R25A 3CJSA 1IGBA 1U25A 4KR0B 3KYLA 4WFXA 1M5SA 5HXDA 3JSBA 1A9NB 4JI1J 2FZGB 3BO4A 3L2NA 2VG7B 4OMEA 1ZM2A 5IV4A 5FVJA 1EX8A 4RNMA 4ELUA 4TWEA 1UKUA 2XZWA 1TKFA 4NZ0A 2PJ8A 2RU9A 1PGZA 3FKBA 2YX1A 1MNEA 3IWXA 3KLFB 2QL5B 2QYVA 3MM6B 1L3UA 2MGZB 3QMQA 3CVKA 1S77D 1WC5A 4NCBA 4FPIA 2YNFA 4CT8A 3PW4A 2QSFA 2EW9A 2JEGA 4OFZA 2HK3A 3UQSA 2PC1A 2HNYB 4M95A 4M63A 3DM2B 2DXDA 3JYTB 1RUSA 4BD9A 4OIDA 1U47A 2NXJA 1PILA 4AD6A 3JAMY 1OY9A 2YQ3A 4ZCIA 4WFNQ 3WABA 4LBHA 1Z8WA 2BV3A 3QAHA 1R0AA 3W9IA 4Y2AA 4Y3CA 4MCPA 2RT3A 3PYFA 1IR0A 3VATA 4EFAC 1BY9A 3MCMA 3O44A 1HDUA 1SJ1A 5DS7A 2QE5A 2NYQA 2MLYA 1F5CA 2XHCA 2ZELA 4NXMJ 2MTLA 4FXDA 4R8UB 1AUDA 2M8DB 3J7AN 4JD6A 1MLAA 3K0JA 4OI1A 1WG5A 5CZVA 4F8RA 3M9OB 3CCRS 1VKCA 2QGFB 5E41A 2HZAA 4OI2A 1O6XA 3FRYA 4ZJLA 4GXHA 3CSKA 1R89A 4ZPAA 3PX6A 2VEZA 2J76E 3LGHA 3NMRA 1DHMA 4NCGA 1IVZA 1GXLA 2EI5A 1F2PA 1U1NA 5J1QA 4R8UA 2B4OA 3ILLA 2BJ3A 4DFMA 1O5JA 1QY7A 4PSWA 2W25A 4DQQA 3CXPA 2WSCC 4AVAA 3VHQA 3A3NB 3FMWA 4RU9A 4DV5J 4DV5F 2ODFA 2DO4A 2GQQA 2CNKB 3PFEA 5DDOC 6FD1A 1VHOA 1K8AT 4YMEA 3NL0A 3QRPA 1KRPA 2ILZA 1RB0A 5ELYA 2K1RA 5AE2A 1C4AA 2X1BA 3R27A 5AXKA 3U1MA 1K4JA 2FE7A 2G1HA 5G22A 4USWA 2FJBB 3HZEA 4ECXA 3R1KA 5CH7B 4TY9A 3D2WA 5KFLA 2CZ9A 4KORA 3R9GA 5KG3A 3JTOA 3KL9A 5IXUA 4KV8A 2OFGX 3TTHA 2R7XA 4L89A 4P4IA 4YHHF 4USJC 3I5BA 3TO8A 1XIQA 1WDTA 5G0RA 3MOZA 4NEXA 5ETPA 2B9WA 1SBRA 2CJQA 1UW9A 1HMVA 1URNA 4B5PA 3TA1A 4ZPCA 2KL8A 1TP7A 4KUBA 4ZP7A 5L1IA 1Y3KA 1LW2A 5ETMA 2MKKA 3ZZUA 4X8IA 4OX9J 1LW2B 2ZE2B 4A4JA 2QZ8A 1N32F 5ETQA 5KFFA 2A4NA 3MMCB 2RDDA 4IDKA 2BE2A 4R9MA 5H9FK 1KQGB 1Z4EA 3DGVA 4MIWA 2DTJA 2V5HG 1UVIA 3D7HA 4ALZA 2XY7A 1RT5A 2BEFA 4F4WA 4G6VB 4ZHRB 2MXYA 4WWSA 1J5EJ 5AE1A 2XLKA 2YH1A 3EWGA 4OLOA 4QCLA 2XGQA 4FS2A 1R43A 2LQ5A 1S60A 1YBUA 2GNKA 1RT3B 2VJVA 1NJIT 2VICA 1I3OB 2Z3PA 4ZIVA 2DEJA 1TK5A 3NWRA 4J9LA 4OC5A 2AEMA 4LF1A 5EWEA 1FT8A 3CDEA 2CNTA 5JXSA 4CH0S 3G86A 1Y7PA 1CLFA 1F5BA 1NKCA 4I68A 4QB9A 1KLNA 2H51B 4MIBA 2GFQA 4P71A 3GLJA 2QLXA 3QBCA 2CVEA 4XDCA 4LMZA 3IBCB 4P2FA 3SQOP 1VYAA 2WOMA 5DETA 3CCSS 4ED5A 4MHNA 2VFSA 2Q6BA 4GC7A 4W98A 3R96A 1YVKA 4IFVA 4UEEA 1FJCA 4QR2A 4JYAJ 1CQMA 1G7CB 1BQNA 3QJLA 2NQPA 1XBWA 3CGIA 2ZDOA 1H74A 4ZPWR 1HBUA 1Q4RA 5C25B 2JOQA 4RNFA 4U8VA 4RUAA 2DNGA 4USTA 4LUAA 2BRKA 4PWDB 3EVWA 2KG1A 2ZC3A 4DQPA 3G6VA 1S7IA 1XNQF 2Q7SA 1KZFA 5AT1B 2JWNA 5LXYA 1SL2A 2WB1D 4CGPA 3DGPA 4JP8A 4WFAQ 4FYDA 3I1UA 4JLYA 3MM7B 4DF8A 5D29A 2NZ4A 3D1OA 2VB6A 5F41A 2F3JA 2HNDB 2ZOFA 2DPSA 1FRMA 1CEZA 3M7VA 5C82A 3BGLA 1YZ7A 2EC2A 1SV5B 3H4DA 1EETA 3R5CA 5HMZA 2J6TA 4BHQA 4M6IA 1EKRA 3PJXA 5HVHA 5DG8A 3MXHP 3SFUA 1RTHA 2GJIA 2HZCA 1JIHA 2KN4A 1HQUA 4IK2A 1R0CB 3CDWA 1RWWB 4JBCA 4E0AA 4JV2A 3T9ZA 4CLUA 4Q8EA 4N8OA 5IT9U 3FXTA 1NB7A 4CIOA 3SJXA 2ZNZA 2VG7A 4JI6J 4HLBA 5F49A 3HT3A 1JWQA 1BAVA 5DZ6A 4QU7A 4C48A 5L46A 1LKZA 2UVVA 3ZTQA 4KLVA 3UO0A 4PG8A 2DR8A 4H89A 5T7LA 2CQPA 2K3KA 1KSPA 3KJVA 4Y65A 4PUOB 1NK5A 1RKJA 1Y00A 3CUNA 1ZBTA 4R87A 1M5PC 4MMOA 2M52A 1VC6A 4RNHA 3K7RA 1FEHA 4QQBA 2XY5A 5GADI 1CULB 3BH6B 5DDRC 2OGUA 4DV4F 4HI2A 2N82B 4K4SA 3JQJA 1R3NA 1I94J 1XF8A 4EZ9A 4MAKA 4ZITA 3N5FA 2ADCA 3HSDA 1RLCL 3CD7A 4KGVB 5DO2A 4G1QA 4B11A 1RJJA 2F65A 2LFVA 1JQGA 1FKOA 4AXIA 1Z8XA 1DTTA 4OZ1A 5CXTA 1ZZFA 3KGQA 4KHPJ 4EYHB 4JYWA 5FDLA 4LF7J 4IKAA 5B0DA 4ZVFA 1IBCB 3R97A 2XS5A 4WU3A 1HNZF 1VS3A 3WC6A 4JI6F 1XNRF 5K8MA 2J7UA 1CJWA 5JM6A 3KTQA 5BYQA 1NXIA 2F40A 4NA2A 2XEFA 2MMYA 2UUBJ 3MCNA 3WC2A 3PJ9A 4A94A 3KLHB 1VRQC 2KRBA 3BSAA 4N47A 3KR4A 3B7IA 2J8NA 4URGA 1N5YA 2PGCA 4ONWA 2OIHA 2NREA 1KD1T 3THTA 3M9MB 1F6TA 2WVFA 1U8WA 2WVBA 3EXCX 1HQEB 5D3GA 5J2PB 1VC0A 3NE8A 3TT2A 1T05A 1T03B 1HD0A 4EK2A 4RW7A 2LQBA 3V81A 2UUAF 2RUSA 2ZUGA 3JXOA 2GV1A 4XDDA 1TVRB 3D6TB 2I8EA 3QJPA 1VJWA 1RWKB 1DTQB 1Q8LA 3PYEA 5KFSA 3KJVB 3OXLA 4M5KA 2AFSA 3KKWA 3N6MA 3NNHA 4XPDB 5JVGQ 1N52B 2MQQA 2DGWA 5CNPA 2MPUA 1FT7A 2E9RX 4URQU 2X1GA 5D4PA 3R2DJ 1EHWA 1BPNA 2WZNA 2ZM6J 1RDRA 2JLFA 4JJXA 4P72A 4KYZA 5LRJA 2CQGA 3FQKA 4ER8A 4LF8J 1RXTA 2CAJA 1B0PA 1UJ5A 1JLGB 1U2FA 2P9GA 2GCFA 2PRQA 4DCJB 2VBZA 3FB3A 3KHZA 5F8IA 2NYHA 1TUVA 2DHGA 2ZZMA 2HS0A 1QM9A 5FJ4A 1X5SA 1ZAWA 1N6QB 4C11B 3DDKA 2W9CA 4C2XA 1FRLA 4MJ8A 4BLGA 4MHPA 2WVDA 4UCMA 2J9DA 3IG1B 3OD2A 3TAMB 1VQLS 2KHDA 3MR6A 4X62F 1U24A 2YWKA 3W7BA 1F3VA 1SIZA 2IAJB 3JTKA 1PG5B 1VHIA 1N5SA 2YKAA 4GKJJ 3P3DA 5B09A 1RE1B 3UFCX 4ORFA 2W4PA 2AZ1A 3QB8A 3VQTA 1Z5RA 4UQGA 4J9MA 5DJBA 2XYHB 1PC5A 4H4OB 3KJQB 2Z4PA 1NK7A 3MAAA 3I5AA 4MKAA 1YDLA 1WF1A 1GT8A 5HBMA 1R57A 5KTQA 3C15B 4I6YA 3Q24A 2HHTA 2X3DA 1T7PA 1TAUA 1M4GA 2HWHA 4Y0FA 1UZDA 2YX7A 4DL0C 1UEKA 2DIVA 4R3LA 2BX6A 1AROP 2HFNA 2PE8A 4TY8A 5A6WA 2KVQE 2KTQA 1EETB 5J2PA 1XJOA 3AB4B 4Y49C 1U1MA 2ZZTA 1L3KA 1BQMB 3G9CA 5A0YA 1YI2S 1NJZA 2O28A 5LT5A 3E51A 2EFPA 4AL5A 3G3SA 2AT1B 4QW8A 5AJ3F 1D9AA 4CM2A 4NJQA 4JI0J 4R76A 4UW2A 3NAIA 4F04B 2EPIA 4I69A 4M5HA 5HP1A 1T3OA 3TOQA 4ES2A 5JVHQ 4G1IA 4U95A 1PJ6A 2VQFJ 1QJHA 3ZTPA 5IB0A 3ZZOA 3P2HA 1EARA 4PWWA 1IKWB 3K5MA 4OI3A 1RBLA 4OZ5A 2C22A 2YWEA 2D3UA 5J2MB 1YHQS 4FD4A 4ES3A 2K7KA 1CJUB 4ZN3A 2V8DA 2L3MA 2QYGA 3D6HB 3PVXA 1DQ8A 2DXQA 2VQYA 2PD1A 3M2UA 1K0VA 1V6HA 3NP5A 4M8LA 4ZN1A 1LQ9A 3FECA 4TKTA 1VFJA 1K47A 2KT5A 3R5AA 1ZTTA 1B3TA 1JLQA 1YGHA 4P75A 5CD4A 3DOMA 3M8ZA 3K58A 2B58A 3PB4X 3H25A 3H5UA 1SL1A 2BE2B 3DOKA 1F5AA 1TAQA 2YKQA 2NZCA 1PSDA 2DXEA 2HHPA 2WBMA 2ZD1A 2CRLA 4RPFA 1FI4A 2F4FA 3EPGA 4C3KA 2R7OA 5CBMA 5L1JA 3FZBA 2OELA 1QSMA 4F3QA 4OZJA 3H4BA 5F3ZA 2GO9A 1P4NA 3QFWA 2VG6A 2REFA 3K2YA 2HYIB 1IN0A 5LYDA 3K5LA 3D3BJ 4B9SA 2OAUA 4UOFA 4F0KA 2PJ7A 3W91A 4USHA 2FVQA 4F4ZA 2CQHA 4LFAJ 4NPOA 2L48A 5A2QU 3GUXA 3BQ2A 1ICEB 3TJ9A 2J0QD 2M4MA 5J1PA 1VQMS 1Z8LA 5GVQA 3BPDA 2Y0SD 3SQGB 1VQYA 3PRDA 4A47A 3I32A 3TAQA 2GANA 1DY3A 1QTMA 1L3TA 2Q4ZA 1FJGF 2PI5A 3OR1A 2P6EA 4YWYA 4FD6A 3AAWB 3P5TL 3LGMA 3BI1A 1JK9B 4KB7A 2REEA 3GYNA 5D0RA 1WEXA 4ECQA 5LJ3Y 2XTJP 4MTPA 4PG7A 4KSIA 4FF1A 2VFTA 1LFWA 4Q2MA 2MB0B 4NZ6A 2HV2A 3PZJA 3PNIA 5C42A 2CQ2A 4DQRA 5KFVA 2LEAA 3W6SA 1NJXA 3QPIA 5KTDA 1NKEA 2FZCB 3PYGA 5D0GA 2XO6A 4OHXA 3B82A 3M2UB 2BJ1A 4KO0B 3NCQA 1JLEB 4BBHA 2QECA 1W25A 4P9SA 1A7GE 3VAFA 2MQLA 2QIFA 1TL1B 3FCHA 4CO4A 4RBUA 4RJVA 1Z4UA 2VOOA 3WR7A 4K50A 4B5OA 3DYAA 3PHEA 1HNXF 3DMJB 3ZC4A 3W1YC 1KVIA 4USUA 2BJ8A 4QBJA 2W8LA 1R0BG 3WC7A 2HHUA 3OHAA 4V19J 1Q16B 3B35A 4J7CA 2R2SA 3QLHA 4GKKF 4KUAA 3O5TB 5B0AA 3SXNA 2HLUA 2DJWA 2H65B 4XO0A 3MN8A 5F46A 5EWGA 2JH3A 3KUGA 1X60A 2H5JB 3CDUA 1HPZB 3OXFA 2Z30B 3CC4S 1UFKA 2IAJA 4K0KF 4DCOB 1EE3P 2DY1A 3HI9A 4I4BA 4KFBA 4RI1A 5D4OA 2ZOMA 3OL6A 1HDQA 2BQUA 1RXOB 1Z4RA 3LP0B 3KHLA 2ADBA 2OJ3A 3PB6X 4ZLPA 3MHYA 3FFIB 3MAAB 4DR3F 4LF4F 3GG0A 3CJTA 4I7FA 4X66F 3EGNA 4TNUA 2RILA 3N79A 2BSWA 3CPXA 2HGNA 3QSYB 4UT4A 2GW8A 2KT3A 1W26A 2BOAA 4GC6A 1S9FA 2VOPA 4EBCA 4OX7A 1YVOA 4IOAQ 1YJRA 2E1MC 4OLLA 3EX7B 2PIYA 4OYOA 6AT1B 2EBJA 1U1PA 2JDDA 4OMFG 1Y5LB 2HK2A 4A8QA 3QLHB 1WOOA 3FCWA 4KH1B 4DFKA 3LAMA 4CAFA 1A0OB 2HURA 3PR5B 3W8GA 2VFUA 4ED2A 1DTQA 4X4NA 4NMXA 5A8WA 5KFDA 5F09A 3OTBA 5FDLB 2C27A 2KZMA 2I2YA 3VWDA 3PV8A 4ZK7M 3THVA 2R8KA 2YX4A 3DFEA 4ETZA 4NCAA 3GFXA 2E29A 4RNNA 1TR0A 1SCJB 5D3GB 4ZVUB 4K0KJ 2UXBJ 5AXNA 4Y00A 2XEJA 4NRTA 3HF5A 2MEWA 2OPPB 5KOXA 4A33A 2ZEPA 1REVA 3D2PA 1YLXA 4MK7A 2RFHA 4OYIA 3SI8A 2V69A 1WORA 2MZ1A 1FERA 4Y2KA 2R1IA 1Q82T 4Z2XA 3K5NA 3C6UA 3GY9A 4HYKA 4UFXA 3D7SB 3PGPA 4UY85 1FE4A 3DRPA 4X4UA 1U1OA 2MQNA 4X4VA 1Z8TA 1DFDA 2V9WA 1NZAA 1NK4A 3POTB 3BSNA 5F47A 2UV8G 1FE0A 2ATCB 2HEKA 4KE5A 2DNYA 3I0RA 4JV1A 2VG5A 2I38A 2K7JA 1JJ2R 2A18A 2VIHA 1M1DA 2IM2A 1WC4A 2Q44A 4O3NA 4AXVA 2PMHA 1S7FA 5L9NA 4F25A 1QE1A 1NPRA 3GJRB 1SI9A 3M2VB 1RWMB 3DU6A 3DOMB 2HWTA 3UWTA 2VF3A 5AXLA 1NM2A 2MZSA 3KMQA 1HNVA 3F0AA 2H5EA 4PXEA 2KM8B 4M6GA 4TYBA 5K8PA 4QOTA 5L38A 2MY8A 2P6GA 2XZDB 4WJBA 1Z2LA 1RACB 4OHZA 5HATA 4AG9A 2NXCA 5JJBA 3H5SA 1T9YA 1KQSR 1C0UA 2B5JA 5DG7A 5CHCB 3VR1A 4PSXA 4O23A 3MM7A 3CJ5A 3DOKB 3CCJS 3BGFA 4PYAA 2XMAA 1P6TA 2DGOA 1CBXA 2HBRB 3RRHA 2HSEB 3TUZC 4JI3F 5EWFA 3HVRA 1D8YA 2DNQA 2ZHAA 4C8OA 1N56A 2K1RB 2UXCF 3TARA 3H90A 4ECRA 3OTOF 3MCSA 4PXBA 1H72C 2CPDA 3Q23A 3OR2A 1AFIA 4WXOA 4DPOA 1H0HB 4F9UA 4CO2A 2V2QA 4TY8B 3LW5C 5HAOA 2GLJA 2F9DA 1U0HA 3BGUA 2DNPA 4B3MF 1VQNS 1ZG8A 3FDSA 2D9OA 2BJDA 3LP2B 3JQKA 3BBFA 4RUCA 4KJIA 3QFHA 1PYOB 2JFKA 2UP1A 1FESA 1Q53A 1FNMA 3BGRB 2CXEA 3M6WA 5HP1B 3GKRA 4A8XA 2FTRA 2OPPA 2CF4A 2QV6A 1I6JA 1S7LA 2Y1IA 4MIAA 1WK4A 1NDCA 4OYMA 4ZCMA 4C6AA 2YNIB 1SKUB 2LP4A 4L3KA 1WJ9A 2XSJB 4I49A 2RQKA 1QSLA 2A0FB 2P5VA 1KN6A 3MM9B 4KT0C 2Z8QA 2C3PA 5GAGU 1NSQA 1CJTA 4K7QA 3BBCA 3RRGA 4P4EA 3MURP 2ARHA 1IWGA 3EZ5A 3KNAA 2BANA 5J8CA 3OPKA 4LF2A 3QZ8A 3FRMA 3PW0A 3QQCD 3J81j 4MT1A 1HNWF 4LF7F 3ZNJ1 4DV1J 5HMNA 5EDWA 5M2RA 1DTDA 1VLOA 1N36J 1FKAF 3SCIE 2IJRA 2HBQB 1C0TA 4DV6J 1RISA 2B6AA 1GNKA 1K1SA 3D4JA 2JLMA 2AJQA 5L9XA 3ZZTA 1VQ5S 1YLOA 4MK9A 2PJ5A 3AJ2A 2A6OA 2DF5A 3SCJE 4B08A 1PBAA 2JC1A 3HPOA 1B4SA 3LP0A 2ZEHA 2CQDA 1FWKA 1VMBA 4KPCA 3SCKE 1RT6B 1WEZA 3KK3B 4B9NA 3RTVA 4E2AA 4TU8A 4FD5A 2PVWA 3LD2A 1T03A 1SC1B 4WYLA 3SJEA 4II9A 3BLNA 3K59A 1VRUB 1XE4A 3RAXA 4LBPA 1PCAA 1YKWA 3F0NA 2CFXA 3IR7B 2XQCA 5GADU 4P4BA 3LF0A 2ZW5A 4ZX9A 3F5BA 4AXJA 3UDVA 1TKDA 4NMLA 3ZJ0A 3M8PA 1S0NA 4KTQA 2V9KA 1IKVB 4DR6J 1Q2DA 3KHXA 2QVPA 3WC5A 2AGOA 3NGTA 4O3OA 5K14A 4DX8H 3I96A 4ZVGA 1RTQA 4ECWA 2XMWA 4YDXA 4I0WA 2W9CB 4FN5A 2L41A 3PR4A 3IWLA 4K4VA 1R8BA 2PMWA 4RW4A 2JVRA 2KT2A 2PFDA 2IPOB 4CGMA 1LOKA 4TN2A 5KFOA 1X4EA 4KSEB 4U8YA 4ED7A 2J7WA 4CYNA 1WSVA 3D7DA 3A4TA 4G1QB 2OH1A 2B5GA 4KOVA 4NI2B 2E5GA 3RB0A 1NDKA 3KK1B 1RTIB 3R7NB 2HLTA 4K8RA 3BKTA 4C3MA 2VHGA 4ECTA 2AJ1A 4MFBB 4IFYA 4B5PB 2IFXA 1ZYQA 1HNVB 2MQ8A 2E5JA 1S1VB 4MHDA 5C5JA 4DNCA 4UA3A 4N77A 5KFIA 3NNCA 1HBMB 3TEHB 3MM9A 1KLMB 2QSWA 2UUCF 5B0FA 3T6BA 2XS2A 2ASLA 2LLZA 2VL1A 2CPFA 2X3GA 2EFVA 3J80U 3M4XA 1HQEA 3S9MA 4ZVSB 3W5XA 3KXDA 4IO1A 2EG1A 2EG2A 1P27B 2XMKA 2GREA 2A10A 3HHKA 1X10A 1X4AA 5HLFA 2KG0A 2VQFF 1HQUB 4ZS6A 3CIZA 1MU2A 1RAIB 4UQTA 5LYLA 3HHDA 4DV2F 2EWHA 3GTYX 2NMTA 2GVZA 4Z37A 3KUEA 1SH3A 4ONUA 4BC7A 3QRQA 3D2MA 2XCAA 4Q5VA 1TTHB 2DNRA 3IM9A 4J9UE 3ENQA 1VGYA 4NXNJ 1KBRA 3S1TA 4NGPA 4U7UK 1ELMP 2G9OA 3MEEA 2ZWOA 2FVCA 3RR7A 4UWJA 2MZQA 4NLQA 3BKFA 2HMIB 2HIQA 3BQ0A 2JEWA 1X5PA 1SPBP 1TFWA 3HFVA 3W62A 7FDRA 5L8RC 3FNCA 3MOJB 4YGOA 4ANDA 4OV6A 1UWAA 2ZH6A 3NS6A 3PXGa 1KLMA 4F50A 5HJXA 3CCWA 2VONA 4AL7A 2IDEA 3R9LA 2LU1A 2KKHA 5CPAA 2OMOA 3PB7X 1MMLA 1X9SA 2ZNYA 4NSQA 3EVOA 4ZP9A 3D4UA 3KG4A 3L9ZA 5BWAB 3JSMB 5KG1A 1T3NA 1JLAA 1SUQB 1S99A 1T9UA 5E3RA 2HBYB 3A3OB 4A8YA 2XMMA 3KK1A 4F26A 2Q6CA 3MR7A 2HQIA 2IM3A 2DR9A 3IMQJ 3SFGA 4MKYA 5LMNF 3QZ7A 2B7CB 5HJYA 4HNWB 1UJ6A 1S79A 2GLFA 1N8RT 3EDQB 4GKKJ 4ZP8A 3VWEA 3SQGA 5A8RA 3S7RA 4CGOA 1GX5A 4IG3B 2FJXA 1HYSA 1ZM9A 4FBTA 3GP9A 1XR7A 3T9NA 2UUWA 4J9PA 3SXOA 2RDIA 1J2VA 1HR0J 2GAHC 5IV3A 3FH4A 3B4DA 2ZEOA 1VQKS 4KQZA 2CPYA 3TA0A 2L08A 4WE1A 4C0HA 1N71A 2VG5B 5IQ6A 1NHKL 1UPPA 4PCQA 5KG6A 4JXQA 1DQ9A 5K20B 3ZZIA 2KVIA 2XWXA 3LMSA 3OSPA 2VPYB 4KY3A 3CD5A 4Q44A 3DLEA 4DS5A 2OU2A 4MCSA 4NJRA 1M44A 2VZZA 5KFCA 5RUBA 5BR8F 1K1QA 4DPUA 4FYYB 1NB2A 2GS8A 3MAQA 3H4QA 2XLJA 1KVJA 5ADZA 4KOSA 5BYSA 4DL5A 1NAQA 4C3LA 2C2ZB 1HNIB 2ZC4A 3H59A 4CLWA 3AD9C 3DLEB 3W63A 2XMUA 4HHJA 1SC6A 3NLCA 3SDEB 5GMEA 2N4DA 1TELA 3M32A 5GAGI 4ZJOA 2ZEDA 3R1LA 3CDAA 1E6VB 1N54B 3NH8A 4CRYB 1AFJA 5F8NA 2I5JA 4OX9F 5I3UB 5H1SV 3AA9A 3OFHA 4J5OA 3FEYB 3F56A 3CMQA 3UNGC 4CYUA 4L73A 2XB2D 2ZBQA 3GV7B 2KH9A 3T41A 1IOFA 2YVSA 4M85A 4QC6A 2AW0A 2PR1A 2APOA 5KTAA 3KG1A 2FXFA 3KLIB 2SXLA 1Y9KA 3US5A 3UDEA 2AYGA 4FXVA 2YNCC 4X64F 4OC2A 3W5YA 2E44A 3TAPA 4DU8A 3LPYA 4QWCA 3ITHA 1HNXJ 1ITPA 4CGLA 2KZZA 4USIA 4X3RA 4OC4A 1S6UA 1KOOA 2FL4A 1V3RA 4DYOA 1RHJB 3NA6A 4CLFA 1RT7B 3K2KA 4PQUA 4FUUA 2NPIA 3C16A 5JMNA 5D0EA 1I12A 5ITHA 3TAMA 2VU5A 1S6QB 1N88A 4F7VA 4IUFA 4B12A 3JUWA 5J2MA 3Q8SB 4CI0B 3N4WA 3G87A 5L1LA 3C6UB 4QIEA 1RI7A 2PR8A 3B6BA 3JTPA 1AUGA 1TKTB 1J5OB 1Q2CA 1OIAA 2IDLA 5KTCA 2JZ5A 1A6LA 4RR5A 3IBFB 1GTEA 1NO8A 2K2PA 1DZ5A 2XLIA 1T05B 2AEFA 3WBZA 1T0TV 2Z0GA 3GYAA 2B9YA 2LCWA 3V6HA 5F8MA 3FX6A 4DV2J 1F2HA 2XI3A 3GR1A 2QA1A 4K4XA 3ZFVA 2EC0A 3BO2A 2YNCA 1KQKA 2NUUG 2IJFA 3R5JB 1BWVA 2DHAA 3A13A 2Z3OA 4PV6A 4KGZB 2V4RA 4DR7F 5CQGA 1IU8A 1MN7A 2M5YA 3HHNB 3PO5A 4A8FA 2Z2YB 2F8HA 3OL7A 4TLQA 3QGGA 1P1TA 2MZRA 1ZTWA 2XHWA 4OHWA 1RO5A 4WZQA 2Y3YA 4R7MA 2Q79A 4ED8A 1IKYA 1WWHA 1RWPB 1NHUA 3M2VA 4PG4A 4ZVQB 4KH0B 2Z0ZA 3VGUA 2B56A 3GG1A 3CZXA 2OEJA 3OVSA 4URSA 1N34J 3O8WA 2IHR1 2NR0A 2RE1A 2D41A 4J9OA 1KVKA 4GVLA 2DGVA 4YEAA 1RGVA 1XMTA 1CQNA 2QMUB 3EFAA 4MYUA 3SEOA 3L4BC 4O4GB 4RKUC 1DRZA 3RZAA 1VRTA 3NCPA 2AU0A 4BINA 3IU1A 2CQ3A 4C8KA 2W4CA 1TXRA 3GYXB 4PK3A 2CWXA 4WU2A 4JI8J 2ZH9A 4ILLA 1TVRA 1DURA 2LXIA 4DJLA 4MHZA 2OO4A 3W2VA