3TX8A

Crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
360
structure length
360
Chain Sequence
DLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNVLARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLATSTELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLRIKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGVANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQVTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVAAILKQYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate desuccinylase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 92
structure length 360
sequence length 360
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tx8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3tx8A01
2PJCA 3L2NA 3BXMA 3V7ZA 2CTBA 4PXEA 6CPAA 1HDQA 3D7DA 4DUKA 2CF4A 2O4HA 1XFOA 2PJBA 1FT7A 2ABZA 5K8MA 1ELLP 4FWUA 1ARLA 1XRYA 3H8GA 2XEFA 4UF4A 2ANPA 4F8ZA 1R3NA 5JGFA 4R76A 1TF9A 4NGNA 3S9NA 3HLPA 3FH4A 2V8GA 3KL9A 3FMCA 3D7FA 4NGMA 2QJ8A 1TXRA 3SI2A 3RBUA 1TKJA 4RUHA 1LOKA 2PRQA 4BD9A 2PJ4A 1AYEA 3B3TA 1CBXA 4Z65A 5HVHA 1PCAA 2JEWA 5HVGA 2PJ6A 4P44A 2ZOGA 1CPXA 4OC3A 4PXCA 3DLJA 1ZG7A 4PXBA 2C6PA 1XBUA 4MXUA 4NGTA 1YMEA 1Y0RA 2PJ8A 4ZI6A 1NSAA 2ZEMA 1CG2A 5IB9A 4OC4A 3IIBA 4TNUA 2AFXA 3PB9X 1TKFA 2QVPA 2ZENA 1LAMA 1QQ9A 3T8WA 2NYQA 2AFZA 2GLJA 2AFWA 2PJ1A 4ONWA 4MHZA 4UEEA 5LYDA 4NGQA 1CP6A 3CT9A 3B3WA 4FBEA 3VH9A 4NGRA 5JH9A 4F9UA 4A94A 4KSIA 3K9TA 2F7VA 3KHXA 3MN8A 3PFEA 3GLJA 3IEHA 2PVVA 4OC0A 3KZWA 1GYTA 1UWYA 2EK9A 3GUXA 3SI0A 4FUUA 3PB7X 4P10A 3WC5A 4DYOA 1AMPA 1ZLIA 4P4JA 3PB6X 3FVLA 5LYFA 4NGPA 5K8OA 3RAMA 4OIDA 4P45A 4DJLA 4Q7AA 4UIAA 2AFSA 3SJEA 2GLFA 4H2KA 1BPNA 3B7IA 3PB8X 5LYIA 4OKOA 3SJXA 3VATA 3NFZA 2ZEOA 1HDUA 3KHZA 3IWWA 3FEEA 3WC7A 4MCRA 2RFHA 5LYLA 2C1CA 2OR4A 2PCUA 1Y7EA 3PB4X 2ZEPA 2ZEHA 2EWBA 5HVFA 3QNVA 1IGBA 1BAVA 1FNOA 2IJZA 4ZX8A 1Z5RA 2CTCA 1ZG8A 7CPAA 2AFMA 3TC8A 3D68A 1XMBA 2Q43A 1VHOA 2BO9A 2PJ5A 2IQ6A 4PXDA 5D29A 1ZLHA 4JZ0A 2V8DA 3CPXA 4ZY2A 4UEZA 3V38A 3BHXA 1BLLE 3B35A 3WABA 2QYVA 2EK8A 2RB7A 2J9AA 4LQGA 5J1QA 3D4UA 1CP7A 2F8HA 1VHEA 4OC1A 3KQZA 1EE3P 1M4LA 5CPAA 4ZY0A 3D66A 3H8EA 3PRTA 4WJBA 3DGVA 1CPSA 1LCPA 1BPMA 1Q7LA 4P4BA 2WYRA 4MHPA 3NA6A 2HB6A 3SJGA 3HUVA 1ELMP 4X2TA 1LAPA 2WZNA 2GU2A 2ZEGA 5LRKA 3IFEA 4ZY1A 1VGYA 5K8PA 4O23A 2ZEFA 3WT4A 3PBBA 1QMUA 2AFOA 3PFOA 4X8IA 2PIZA 4MCSA 4OC2A 5HXDA 1CX8A 1Y0YA 4NJQA 4OMEA 4NFRA 2JBJA 4MCQA 1TKHA 2V8HA 3GB0A 3IO1A 3VARA 3B3SA 3K2KA 2PE3A 4P4FA 4F9VA 3CPAA 3KR5A 4MRIA 4MMOA 3TX8A 4CPAA 3BI1A 3S9LA 1R43A 4W9YA 3BI0A 1F2OA 1YW4A 2GREA 4UEFA 4P4DA 3KGQA 4OP4A 3IC1A 3LMSA 3FX6A 2POKA 3KR4A 2VL1A 2V8VA 1F57A 4JYWA 4UIBA 2C6CA 1TF8A 4EFDA 3N5FA 2O53A 4FAIA 4YU9A 4OC5A 2FVGA 3B3VA 3NH8A 3JRUA 3IJ3A 1DE4C 4NGSA 3B3CA 4B6ZA 3D7GA 4ZYQA 1ZG9A 2OOTA 4MHNA 5LRGA 2Q51A 3FEDA 3FF3A 1RTQA 2PJAA 2ZOFA 3WC6A 4G1PA 3SJFA 2ZELA 4AXVA 2C6GA 4MHYA 1LFWA 4EWTA 2XEIA 1HEEA 5D8NA 5ELYA 2I3CA 2G9DA 4IK2A 1OBRA 3NH4A 2PJ2A 4NJRA 4PPZA 1KWMA 2Q4ZA 1VIXA 2PVWA 1F2PA 4OIWA 4R8FA 5K8NA 4EMEA 2HC9A 2V77A 2PJ0A 1H8LA 5DS0A 4A39A 1YLOA 1LANA 3D67A 4TWEA 4K3NA 4P4IA 5LRJA 2ZEDA 3ISXA 2PIYA 2BCOA 2IMOA 1ARMA 3SI1A 2PJ3A 4A38A 5CBMA 1DTDA 1XJOA 4X3RA 1IY7A 1Z2LA 2NSMA 3CDXA 4ZX9A 2XEGA 3FJUA 3KQXA 4GM5A 4IHMA 3I1UA 4A37A 3KASA 2XEJA 2AFUA 3PBEA 2PJ7A 2BOAA 3B2YA 3MRUA 2PJ9A 5F09A 1PYTB 8CPAA 3FECA 2ZEEA 3ISZA 3H8FA 5JM6A 1Z8LA 4IAVA 3D7HA 4WWVA 3LWUA 5THWA 4R6TA 1JQGA 4PQAA 4P4EA 3NH5A 4YWYA 4P6YA 3S9MA 3RZAA 2DEAA 3PEIA 4MCPA 2CIJA 5I4MA 2JBKA 4R7MA 1YW6A 1YSJA 3KI9A
chains in the Genus database with same CATH superfamily
2WONB 4Y0FA 2HHVA 3DLEA 1RUSA 4ZPTR 3PYEA 4ZPCA 3CVKA 3LAKA 3WHIA 3HT3A 1UVNA 3RAXA 1YVOA 1FKAF 2HMIB 1TFWA 4ER8A 1EP4B 1H6KX 5F9LA 1Y5IB 5I3UA 4J9MA 1TAQA 3H4QA 4DN0A 1YK9A 1U1PA 2D1CA 2DNMA 4NGMA 2F5GA 4TQRA 2YWWA 5L1KA 2I2YA 1RLCL 3Q89A 2I5JB 2Z3KA 2PJ4A 5D6GA 5HROA 2IVFB 2QSFA 3T6JA 3I56S 4ES1A 1YREA 3OLAA 1JKHA 1YLXA 1IXKA 4IKAA 1SIWB 1JIHA 1HBUA 2JSXA 5LOQA 3P4UB 1EIYB 1LXJA 2BANB 4DR4J 3TANA 4DX7A 1N54B 1NSAA 3W7BA 2HNDB 3AA9A 4KTQA 4YB6A 1CJTA 4X4TA 3L3CA 5SUHA 3HF5A 2R8VA 2ZEJA 2YNFA 3LACA 4OYXA 1XERA 4O3OA 3QAYA 1WDTA 3UQSA 2ZE2A 3OL6A 1AT1B 4NLRA 3V81B 1Q8IA 3GV5B 4KSIA 1LKZA 3F56A 4J91A 2DNHA 1BC6A 2HS4A 3VAFA 1IBLF 5HJYA 2WSEC 4MYTA 3SIPB 4X4UA 5BYQA 1BUXA 2K3KA 5A8KA 5K9FA 2F9JA 2COLA 4GXHA 5LYFA 3D9BA 1T3OA 3GG1A 3GJSB 5K8OA 5J2NA 2HRTA 2ALYB 4E8OA 4MJ8A 1HWUA 4C8MA 4NLTA 4UWIA 2D9OA 1CJUA 1YGYA 4ZPDA 4TU7A 1JNZB 3I5CA 4TY8A 2E29A 2BE2B 1RBOB 1DQAA 2FJWA 2FY8A 3AJ2A 4P9SA 3CXSA 3BGLA 1Z4RA 4CNZA 2XMMA 3CCJS 1GMVA 1U6MA 1JLAB 3GFYA 3GJQB 5EWEA 3JXOA 2MZRA 2IHR1 4B9VA 4NXYA 2MKHA 4EFAC 4K59A 4JZ0A 2K2PA 2KM8C 2LEAA 5DZ7A 3JSYA 2F8HA 4KGXB 4RW6B 3BYRA 3GJTB 3OPKA 1AFIA 1MLAA 2CJYB 4YFUA 3CJ4A 2KN4A 4I0WA 2XS2A 1RCXB 2CQCA 2HRUA 4BBYA 4WJBA 3QGGA 3TFYA 4DPXA 4P4BA 4PZVA 2YPZA 3HD1A 4X2TA 4KJIA 3EMTA 4QIFA 5KFKA 2MKKA 4FPRA 2HGMA 4O23A 1JXVA 4I4BA 5GAGU 1R0BG 2F4VF 3HCXA 1SL0A 3N6LA 2BDPA 2CJKA 1HHQA 5EGYA 3VF0B 3TEHB 4I2QB 1NDCA 3UDCA 4GC7A 3B4MA 3GB0A 3U27A 1RTHB 3K2KA 4ZVSB 3TA1A 4CPAA 3BI1A 1WSRA 3KDNA 4FYVB 3V81A 3HP6A 2GHVC 1VRUB 3PKMA 2MTLA 2GREA 4P2SA 4CYUB 2ACYA 2B4PA 1CEZA 2N7YA 3FX6A 2KT5A 4ETXA 2DR6A 1EQMA 2OPRB 3UD4P 3K57A 3TP2A 4TYBA 3MM7B 3ENQA 4LRFA 2NXNA 1U0SA 2E44A 1XNRF 5EC4A 1RP5A 3NL0A 3MECA 3QIDA 1G2EA 4JOUA 2PC1A 3CO0P 2Y1JA 4ED6A 4HYKA 2REFA 5AXNA 3QO9B 4UTGA 2H54B 3H4BA 2JEFA 2V2KA 4IOBA 4K5SA 1F1BB 3N7ZA 1S97A 1U6BA 2G2OA 3GQCA 3CMQA 3SCJE 5F8LA 3P96A 3WX8A 3KLEB 3FSIA 2G9DA 4ECSA 1OBRA 3NH4A 3BN4A 2W2MP 3D1OA 3TAMA 3F8KA 3EE3A 4F50A 1F2HA 2FDNA 2RUGA 2R2SA 1DQ9A 2H3EB 1SJ3P 1IBCB 2YTCA 1RE1B 3TAPA 2LXIA 3FYNA 1ZTTA 3F5BA 2P8IA 2I79A 1ZAWA 4L6V3 1M1KT 4J9QA 3I0RA 2NZCA 3SI1A 2CNKB 4ZCMA 4YHHJ 4X3RA 2FJAB 2RHSB 1HI0P 4OZ2A 2Z3LA 4UT4A 4K2XA 2H4WB 2V9WA 4OX7A 3I3GA 3V2UC 3D6HB 3M9NB 4WYWA 3B6BA 4F25A 3FNNA 4NLPA 4DPWA 3MAAA 4B9TA 2GVZB 2WB1D 2W1BA 1RAFB 4ES3A 2NQPA 3W65A 4M5LA 4TQSA 4I2PA 2PR1A 1QAXA 4GVBA 2M88A 3BH6B 1QJHA 1I12A 1KUYA 1M90T 5KT2A 1LWFB 2OPQA 5DDRC 2LQBA 4C6AA 2ZKUA 5L39A 1RT7B 4F3MA 2HQCA 4KT0C 4PPDA 3OFGA 4E2FB 4AQYF 1S1WA 4R5PB 1GEHA 4YY3F 1N88A 4ZP9A 3R9LA 1N5YA 1VFJA 4J3GA 1XK8A 1UWAA 2R2TA 3HHKA 1S1VB 3O44A 5LSRA 1TUGB 4AD6A 2OLWA 1TXRA 2YBVA 3OVBA 2YX7A 2NYIA 4OI3A 2VZZA 3P8BB 4L3KA 3KJVB 1WG4A 2ZJQQ 3DLJA 2RKIA 4H4MA 2EFNA 3RBDA 1J5EJ 1KFSA 3IM8A 1L3KA 3MFHA 1OPZA 2KJVA 2ZEMA 2FQQB 2DNLA 1CG2A 2ZJRQ 1TKFA 2Q6BA 1WEZA 2GLJA 4HKQA 2PJ1A 1VRTB 1UJ6A 3MCOA 3PO5A 2YNEA 1RHUB 2HQDA 1N34J 4CIOA 5IC4B 3IBCB 3ZZYA 2XCAA 1R27B 4HH1A 3MN8A 5E3PA 2PFFB 2ZW7A 4CM2A 4DG1B 4JI0J 2EXUA 3UR0A 5I42B 1BQMB 1TP7A 1QSMA 2LVWA 3GILA 1U48A 3S8SA 1IQZA 3VTIA 3C6TB 3GKRA 3K8WA 2CQHA 3ZO7A 3OVSA 2Y3YA 4F7VA 2JVOA 2CXAA 2DGWA 2HQIA 2GVZA 4B3SF 3UWTA 4IFVA 1TKZA 1RTDA 5U47A 3SJEA 2AJFE 1F5BA 2WVBA 4QWCA 5B09A 5EBVA 3DYAA 1NSKL 2VONA 3ELHA 3UCUP 2ZEOA 2FJXA 2FC8A 2B51A 3VZIA 2MZJA 2UXDF 3D0IE 2P6GA 1BAVA 4M85A 4DV0J 2FIAA 2V2VA 1S9GA 2YKNA 4XNHB 2MQLA 2AZ1A 1KLMB 2ACMA 3T3FA 2CJBA 4WE1B 5L9NA 4K4UA 3D68A 4GO5X 2K1RA 3A12A 1SKWA 1H7XA 4J9OA 3V38A 4LVOP 2UXCJ 5D0HA 1U7LA 1OYDA 1RHQB 3H20A 3VAMA 1QUVA 4F4ZA 1ICEB 1URRA 4FVMA 5EUHA 1WC4A 1XEZA 5AE2A 2A10A 3HVTB 1AFJA 1YDLA 3PTWA 3M1VA 2CWKA 4IG0B 4M8LA 4PWUA 2G0BA 3TVKA 4U7CA 3M8PA 2FSRA 3M30A 3RRKA 3VVUA 4F4WA 2GIFA 2CIMA 3RBZA 2ABYA 5K8PA 5ETVA 2AFOA 1VQYA 2YH1A 1S1UB 3DGPB 1NDPA 4CLZA 4NJQA 1OO0B 2FHKA 2IRYA 2KT3A 2D4PA 4NLUA 2Z58B 2PE3A 1PBUA 3IGNA 1NSLA 3KR5A 4MRIA 2HMIA 1JLCB 5IT0A 2RIJA 3TE4A 3PXGa 4Q38A 4B3OB 3QRQA 4MFLA 5AG4A 3HHEA 3H90A 2F8EX 1JWWA 5A8WA 1R0AB 3IRXB 2XSFA 3S6KA 2UXBJ 2YNIA 4USMA 3CD7A 3KFWX 4WBFA 2IC3A 1S6QB 3QBCA 5CYMB 5F8JA 3QWPA 2ZNZA 3M8WA 1KC8T 2QMXA 1TKXA 4OYZA 1DTTB 3PCOB 2N3OA 4B14A 4DSFA 3CJKB 5DDPC 1UTAA 2K7JA 2NUHA 2OUGA 1FJ7A 1YWXA 3H2LA 2ZW5A 1SB6A 5C82A 2DR8A 2ZOFA 4BS2A 1E6VB 2VIHA 3W60A 4NCGB 3I96A 4OZ5A 2WK4A 1VQ6S 2Q4ZA 4AL6A 4OIWA 4DJBA 2NPFA 4RWWA 2B58A 2E7XA 4FVCA 4DV2J 1T9UA 3SI8A 4OHZA 1TIQA 3VWDA 4KE5A 5D78A 2FL4A 2DY9A 4TWEA 3ZC4A 2WZ1A 1I94F 5EX0A 5LL6d 1REVA 2AEJA 3AD7C 3AD8C 5F46A 4YB1P 2FZKB 4IRKA 1IUJA 1HBOB 3FBBA 3T90A 1FTRA 4U9YA 3W3SA 4HT5A 4DV7J 2CNSA 3I1UA 1CJUB 2HHSA 4LBHA 2AFUA 4ZVTB 2WPWA 3B2YA 4K5RA 1NPKA 2PJ9A 3QT5A 3H25A 1U6ZA 2D7SA 2YX4A 2JZ5A 1IBLJ 3M8SA 2ZHAA 3M2UA 4OZ0A 2BEIA 4IAVA 1MG7A 2YQ3A 4TKTA 3W2WB 3LWUA 1RU2A 4J9PA 2VB6A 1CJVA 1IIDA 3WR7A 4PQAA 1RWXB 4P6YA 4I7FA 3KJFB 2R7VA 1N5SA 3QZ7A 5C7PA 2R8HA 1QSYA 4TYAA 1ZM2A 3V7ZA 1KLNA 4CO3A 1YJNS 3W66A 2DF5A 2CQ4A 4K4TA 4J9LA 2YNIB 2LDYA 2OPPB 2QIRA 3BKFA 2IC3B 1UWBB 1N5TA 3FB3A 2XC9A 2ANPA 1X10A 3OR1A 3MR3A 2RS2A 3R27A 2ZKTA 1S1VA 4ZHRB 4ZCKA 2O3DA 2XGPA 1IBMJ 3MDFA 4PWDA 4H89A 2VG5B 1RT5A 5DG9A 5C24A 1K8AT 2W8KA 2Q3PA 2IJRA 3NKYA 4UOHA 3TA0A 4KOSA 5F8NA 1VBYA 1VC6A 3CXCR 4ERDA 2IRUA 2N7CA 1U1LA 4UY8T 4JI2F 4CYOA 1X9SA 2V67A 2JRSA 3R9FA 1TMMA 1KRPA 4X65F 5E5NA 4ZPAA 3AJDA 2WTFA 2Z3MA 2OSRA 5LM7E 3TO7A 3G9CA 2VC1A 2LA6A 2CWXA 4NGRA 3MF5A 5DWMA 2DGTA 2F65A 3FSYA 3JYTA 4DLEA 4LUBA 1J5EF 1S7FA 1NEEA 3M2RB 5KFAA 4M5JA 2Q4VA 3T1YJ 5D0GA 4LQ6A 3T1HF 3TQEA 4DQPA 5C42A 4D3GA 3MUTP 3NCQA 3K8VA 2BKOA 2GMLA 4G1QA 4P2MA 4W92B 1RT4A 5A6PA 1UVKA 1TKZB 4O4GB 2VU5A 4YMEA 2HW3A 3OTCA 3MMBA 5H1SV 4AXJA 1T8EA 3QSIA 3G4SS 1EZZB 3RB6A 2OHDA 1X5TA 4UOGA 3N0VA 4LF1A 4O4RA 2DH9A 3GWCA 4HKFA 3FGVA 1O0PA 5EWFA 4PG5A 3D6MB 4ANDA 1WJ9A 2VJVA 1X5SA 3T1HJ 2AW0A 4F26A 2C42A 5DM6Q 4LRDA 3C14B 1WOSA 2GZOA 3TUIC 2MKCA 1NK5A 3FBCA 2Z3OA 4YN3B 2PJ5A 5D29A 2HHPA 3CPXA 3FMBA 2MJUA 1Z9UA 1QD1A 3M8QB 1VHEA 4DV3J 5CPAA 4X4NA 3E01A 3NLCA 5IX3A 2HWTA 4FF4A 3NXZA 1NH7A 1CPSA 1YLEA 4PSWA 4DR5J 4K4VA 1OS5A 5F3ZA 5KFMA 4ELUA 4U5YA 3MHYA 1DTQB 3N01A 3MEKA 2YKOA 1FESA 2QMWA 5FD1A 5FJ4A 2MGZB 4NXMJ 1QMUA 3T9YA 4IYQA 2KT2A 1MWYA 4JI8F 2VBZA 4MIBA 1S6UA 2W8LA 5KTCA 2QFIA 2H51B 1Z4EA 5JPHA 3W8GA 1SPBP 5HANA 5BR8J 2XMAA 4HT7A 3TCVA 4P4FA 4QPTA 4X4PA 2H5IB 2ZH9A 2RF2B 2HFSA 4I49A 4F2RA 2B6AB 4RNMA 3JYTB 2VBQA 1TKTA 2FYXA 1BY9A 4Q8FA 1NJYA 2F40A 3KR4A 2OJ3A 4I6YA 2V8VA 1C0UB 5BYSA 4EFDA 4F4YA 4OMFG 5G20A 4RBUA 2KXNB 1TV6A 4W98A 2I8EA 3NH8A 5BR8F 1IU8A 3B3CA 2OI2A 5K14A 2C27A 3SXOA 2BXJA 3CJTA 4RWXA 2HFOA 3SDEA 1GK8A 3MR2A 4DZDA 5A8RB 4EWTA 4A32A 4IK2A 4PQUB 2YQ0A 2CG4A 4M95A 1VRUA 1V5IB 3ADAC 3MM6A 3KK3A 2V2QA 2W7PA 4IG3A 4XDDA 5DS0A 4NZ7A 5C5JA 5EHHA 5KTQA 3G87A 3I9ZA 3A3NB 2E1RA 4WPAA 1LW0B 3ZXWA 3MR7A 4A38A 3OJSA 3HVRA 1DTDA 5CBMA 1HW8A 5JMNA 2C28A 4A8YA 1WC3A 3KQXA 1SJFA 3QFWA 3K89A 2BA9A 4TU8A 1R89A 1TL7A 3PYGA 2B5JA 4OHVA 5KFYA 1RHRB 2DHXA 4WK3A 4DV2F 3AODA 4DMZA 1QY7A 4Y2MA 3KG0A 4Q0BB 4WWVA 3IU1A 5THWA 1Q4RA 4LUAA 2QA4S 4WE1A 3PIOQ 3ILIA 4RNFA 2LDIA 4M1KA 4EI2A 5GAEU 5HO4A 3MAAB 1GTEA 5KG2A 2LA4A 4LFAJ 2GV1A 3J80Y 1C0UA 1AB8A 4GVBB 2B56A 4LF8F 2OGUA 3IWLA 4UW2A 2EFVA 4DV1J 3TZYA 2CNMA 2VBXA 3FH4A 4OJ3A 5L8RC 4DL7A 4C8ZA 3A13A 2E5GA 3PGPA 4M5DA 1VK8A 4I1TA 3RBUA 2G4BA 4NWBA 2IVYA 4KSEB 4IH6A 2QX0A 4B12A 1CPXA 3LGMA 4ANEA 2HK3A 1TK8A 3PRBA 2RJZA 3GIIA 1TL1B 2OFGX 5KG5A 2ZNYA 2FY1A 4EZ6A 3JQKA 4X64F 3PB9X 3NEKA 3T8WA 2AFZA 3F73A 2G3TA 3PW2A 3UN2A 3V4IA 5CA5A 4DPOA 1L3VA 1NAQA 5A6WA 3BO4A 2GHPA 2J0QD 2KVQE 2BZ2A 1U26A 2B9XA 2R7WA 2L48A 2EI5A 2E7VA 1HNIA 3EZ5A 4NEZA 3KZWA 2DNRA 2X3DA 3DOMA 5H9EJ 4I6AA 1XBWA 1ZPVA 4JI6F 3NGRA 4YRHA 1RO5A 4EBEA 2CYYA 4J9KA 4KOYA 4NLDA 4QVTA 3FMWA 2YKAA 1HDUA 2XMVA 3KHZA 3IWXA 2OZGA 2HFUA 4CM0A 3LP0B 5LYLA 1GHEA 4AL7A 2P6FA 1EB0A 1NSPA 1FEHA 4RI1A 2MKJA 3LANA 4ZVOB 4KH0B 4ID5A 4M5NA 2XYGB 2IBOA 2B8QA 2XY6A 2HK2A 2XHWA 4KOVA 2Z56B 2DD8S 2RDJA 2KG1A 3KUGA 1MSWD 2JC0A 5KFHA 4JP8A 3MEGA 3J80U 1FJEB 1U1RA 4ATNA 1BO4A 4ECUA 4MTPA 4XPDB 2ZVSA 3LGHA 4GS4A 2NXEA 1N8RT 2IVMA 2I38A 1HYSA 1NDLA 3D2MA 3D8PA 2VEZA 4ZY1A 5LRKA 4ZPBA 2M2BA 1M1GA 2HRYA 2LFVA 3CD6S 1E6YB 2EK1A 4DV4F 1FRJA 3QGPA 3HVTA 3BBFA 3KLGA 4OI2A 4CLFA 1TKHA 1N33F 1Z8XA 4ZDNA 3LAMA 3SV3A 2PSZA 4DUYF 3I9SA 4F9VA 4JI0F 4QWDA 4YDDB 1C1CB 3GFHA 1QAIA 4QQBA 3KJQB 2V6AA 1LWEB 1YW4A 4RUCA 4UEFA 1R6VA 4OYBA 1VK3A 4CAXA 3LMSA 2EO8A 5J1EB 3NCPA 5D15A 2VL1A 1VQSA 1UFWA 4B5OA 1KHWA 2HQGA 1HNWF 3W61A 2IJNA 4DF8A 3MMAA 2NREA 2FVGA 1X4FA 3B3VA 2B4BA 3GYXB 1Y10A 4NGSA 4MYUA 2HKEA 4B6ZA 2CPHA 1X12A 5F9NA 4ZYQA 4E98A 3SXLA 3FEDA 1UKUA 2CQDA 2YY3A 1H3DA 5E41A 4YHHF 1SJ1A 4AG7A 4U67Q 4CLSA 5F8IA 2QRRA 1GX5A 1U2CA 4ED0A 5A8RA 1RTJB 2VG7B 2I3CA 4OI6A 3GIUA 2YQ1A 2XBPA 2DXEA 1VQOS 1UW9A 4LF4J 4RU2A 2V77A 4GMKA 2VICA 4DX6A 5A8WB 4WP3A 2AHOB 2GIQA 1S6OA 4K3NA 1U1NA 5LRJA 2FLNA 1I6JA 5DGBA 1LW2A 2VQFJ 2IMOA 3C14A 4A8MP 4KGZB 1T03B 1KOOA 4N76A 4GM5A 1RAEB 3ILLA 2HLTA 1HYSB 1IB1E 2ATRA 4ZLLA 3N5BA 3PW5A 1QSSA 2EG2A 1S57A 3A8IA 3NBPA 2RH3A 1TL5A 3FZ2A 1TL4A 2QL9B 4MAKA 4RR5A 3TT2A 3EX7B 1Z8LA 4OYOA 3BKTA 3QJJA 4L72B 1QVGR 4NZ6A 1EETA 4LSNB 4JI4F 4ZP6A 1TK5A 5IT9U 3KLIA 4Z7CA 2EVNA 1H72C 4LFCJ 3S9MA 4DCOB 1VQNS 4IOAQ 3VGSA 1N52B 4EYIB 5I4MA 5AG7A 4C2XA 5D3GA 3CD0A 1HW9A 4HR2A 2CJXB 2DIUA 4ZJOA 2PEHA 1N56A 4GKKJ 4FXDA 2ZM6J 1R6YA 2FVPA 4ECQA 1SV5A 3BSCA 1KBRA 3PR4A 4EBCA 3KLVA 2DPSA 2FE7A 2O5DA 3SYZA 3G6XA 5H9EK 3RR8A 1R3NA 4R76A 2R4FA 1UEKA 5IV4A 3H42A 2OTJS 2MGZA 3JUWA 1OSDA 4FXVA 4CS0B 5IXUA 2YNGA 1VHFA 2IJFA 1UMJA 2H5MA 3RU0A 1NKEA 3OR1B 1XBUA 2MKSA 2XZDB 1FNMA 1U49A 1O51A 4DR7J 2IFXA 3AQOA 3Q22A 3TRGA 4LF8J 4MFZA 1F3VA 1NJZA 3QLHA 4OC4A 4USTA 1VMBA 5D4PA 4WXWA 3H7HB 4CO2A 3S1TA 1FKPA 3MUVP 2KJWA 2LQJA 4KHMA 3CCWA 5B0CA 2AGOA 3WC0A 3QRPA 3ENWA 4IR9A 3PP9A 2PVVA 4PK3A 3UNYA 3UN5A 3J81j 3O1LA 3BZQA 1UWYA 3AOCA 4IOCQ 4ED7A 1FKOA 2XLJA 1HL6A 2KM8B 4CH7A 1RWPB 4NASA 3WC5A 1QVFR 1JXLA 3PB6X 1VR6A 5AXLA 1C1BA 2GFQA 1RSCA 3TVYA 3VAIA 5JVGQ 4OHXA 3GMGA 4LF2A 5AJ3J 2KRBA 4FNIA 2HQ3A 1QM9A 2UUWA 3NFZA 2YNDA 4KVXA 3DLGA 1Y7EA 4JXRA 4ZPWR 1MU2A 3MD1A 3NOCA 4O0NA 2J5AA 2DT9A 3BR8A 4MKBA 2DXQA 3QAHA 3G96A 1DJ0A 2BO9A 4RW8A 1B0TA 4UEZA 3AXMA 1BLLE 3R96A 5AJ3F 3PACA 5HJXA 1FT8A 3THVA 3B8GA 1RAOA 2J6SA 2LEPA 3D3BJ 5B7WA 1WEXA 4ECZA 3T19A 2KXHA 1NLKL 3H5UA 3DHWC 3MPUB 1NB2A 3EFAA 3NA6A 3SJGA 1OQ3A 3HUVA 1S4FA 2DGSA 1RB0A 3Q23A 2H1YA 1VGYA 4CGLA 3FCHA 4KKOB 2KG0A 4NMLA 3KYLA 2D3UA 4MKYA 4NFRA 2GIVA 2JBJA 4NYZA 4F0YA 3ETOA 5LJ3Y 2PSWA 2NSCA 5H86A 2PD1A 3W9IA 3UNGC 2AX1A 2IYGA 1HBMB 5E3RA 3TX8A 3JVNA 5IWAF 2JLFA 4ES2A 2H48B 4FYDA 4QYZJ 3M8QA 3FJ2A 2J76E 1RT6B 3C2PA 4N47A 3E01B 2VBYA 1KR4A 1P8GA 4JYWA 2XNRA 1NHKL 3HI9A 4JV5F 2JLEA 4ETZA 2OH2A 2A3JA 3UCGA 1EP4A 1N33J 1HNIB 2KYZA 1X4EA 3A9LA 3HM9A 4X4VA 2P5VA 2B6AA 1DTQA 2P6SA 3PO4A 5KFFA 4JI7J 1KQKA 2V63A 4LJMA 4ILMA 2WVFA 4X4SA 2RUSA 4ECRA 5LRGA 1RT5B 2Q51A 5HK4A 1WHYA 5G4DA 4QU7A 1KEKA 3A1YG 3QATA 2D3ZA 5E3AA 3OSPA 1KFDA 3PVXA 1HMVB 4YR2A 5F48A 4YDXA 2LXFA 2XSJB 1Q16B 1P0HA 5I3UB 2PJ0A 2KYXA 2CJAA 1OPIA 2O66A 2GMHA 4HNWB 1C0TB 4DR5F 3M6XA 4CTAA 4ID5B 1M1HA 4QIVA 3NGTA 2G0CA 4ZN1A 4ID8A 3CDXA 3FXTA 4Y2KA 4WKYA 1K73T 3BGFA 3IRWP 1NPRA 4J9VA 4URGA 4OYIA 4NLSA 2BANA 4A31A 3M9OB 4UZCA 5F09A 8CPAA 3ISZA 2AU0A 3CIMA 2L08A 5HAOA 4MFQA 3K59A 4MKVA 1B0VA 4DV6J 4C3LA 1O6XA 3W1YC 5CD4A 2C2NA 3GYNA 2IRXA 1HI8A 2UUTA 2EKYA 3JQJA 2WW4A 4K4XA 1FE4A 1H7WA 3QGHA 3HHDA 2JBKA 3WQPA 3CMES 3L2NA 2ZW6A 3GYGA 6FDRA 1HD1A 4M5MA 4Q0BA 3NGSA 3NGKA 4PG7A 1FY7A 2E5LJ 3IR6B 4DN9A 1YIJS 2CF4A 2DITA 4CYPA 2Y0BB 4DR2F 1ARLA 5D4LA 3MR5A 1S79A 2FHJD 3CJ8A 3R7BB 2XYPB 3IGVA 3FMCA 1MN9A 3UD3P 3BV8A 3N79A 5J1EA 2QLJB 4DUTA 2M9KA 1EX8A 1TKJA 2ZOMA 1WEYA 3CTRA 1KSPA 1JB0C 4TU9A 2ZOGA 3OFEA 5LMUF 4MXUA 3CIZA 4P72A 2B3VA 1K47A 5FDLA 3K5OA 5HH1A 2MJNA 2MB0B 3IIBA 1I3OB 1JJCB 2ZENA 3QLHB 1LAMA 1LWEA 2RSQA 1UJ5A 3LQVA 3DDDA 4I2QA 5DS7A 5M2UA 3V4MA 1KP6A 5LMNJ 5LYDA 1HBUB 1N5QA 4HVZA 1CP6A 3H2UB 2M70A 2HS3A 1UFKA 1CJTB 2FXFA 1M4IA 2OP5A 2ALZA 2X1FA 2R7QA 3T5KA 5GAGI 3IS9B 4NLYA 1S5KA 2WW8A 1BQMA 1F5CA 1R7IA 3NAHA 2FJVA 3KG4A 3LUYA 5DRKA 2CPEA 2YWKA 4LF5F 4WWSA 3LO3A 3WX4A 3IWGA 3MAHA 2B3UA 2CDRB 4C8OA 1Q2YA 4PUOB 3HDSA 1XMOJ 2GLFA 4Y28C 4LF7J 4R87A 4UQGA 3OL8A 3SCKE 3FEEA 4ZVQB 1BMQB 1NBEB 1BWVA 4OADA 4J90A 4ZMMA 4X2BA 3TOBA 2QG9B 2CNOB 3NMRA 3KLHB 2VBWA 4ZGYB 1VBZA 3W8PA 5T41A 3KK3B 1M5HA 1SVDA 2X1AA 2ZXVA 3K5MA 1S4EA 4ZCLA 3GV7B 3PY8A 3RRGA 3O8WA 4U7UK 3D66A 4ZBGA 1W26A 1Q5YA 3D0HE 1BPMA 3CDUA 3IR7B 4TVAB 1Y7PA 3FC9A 2V4JA 1U6FA 4NEXA 2CQ0A 3GY9A 3PM9A 4Y00A 1L3SA 2NXUA 4K0KJ 3H5SA 3QT6A 4ZVEA 1U0HA 3L4BC 2W9CA 2CPXA 2G1DA 2J7WA 4OMEA 2DB1A 4R0JA 4JXQA 4DZ6A 1CM0A 5FLXU 2IL4A 2R9LA 3S9LA 3FNCA 1RACB 4IRCA 4ZN3A 4X4OA 5KFDA 4AVBA 1EQ0A 4AB7A 5J2MA 2EBJA 4KSAA 4QZVB 4EU0A 3P6YC 3TARA 4AFFA 6FD1A 3EPGA 4KUBA 1FXLA 4USIA 1YJVA 3PHEA 2DR7A 3HXMA 5IQQA 3QRRA 4HI2A 5CNPA 3BGUA 2B43A 2L9NA 3C6UA 2KHCA 1Q81T 2PA8D 2NSBA 4Y49B 2NMTA 2CNNB 3RUBL 2OOTA 5C2GA 1QTMA 1RAAB 3VHQA 2MHEA 1V9OA 1UPPA 2HEKA 2PJAA 4MT1A 4DWIA 2AV5A 3RNZA 5AGEA 2XZWA 1SJRA 2UXBF 1VQMS 4CGOA 1HMVA 4FF2A 3Q8PB 2E66A 2BM0A 4HDHA 1M5OC 3MURP 1KWMA 3EGVA 1FTCA 2C3PA 4LRBA 2ATLA 3CJ0A 1F2PA 4KHPJ 4OX8A 1K44A 4A39A 4PWWA 1V3SA 4NLWA 3EDRB 4MH8A 2PT0A 2AJ4A 4RBTA 2OB0A 4PSXA 3OFHA 3FUYA 1XQIA 3H40A 1Z2LA 1WKLA 2OIHA 2CPFA 3GPAA 4F0XA 4NA2A 4A37A 2V4JB 4DG1A 1WC5A 1WC0A 4FNHA 4CT9A 4X62F 2XMJA 1LW2B 2E1PA 2Z10A 3BQ1A 3V6JA 2Y1LB 4DUYJ 2OD4A 3R8YA 1ZAXA 3BM7A 4RNNA 1WF2A 3CC2S 3MM9A 4QR1A 3PRVA 3A3PB 4Y34A 3DI6B 2U1AA 1SQEA 3NCRA 3NH5A 3MPWA 3QMQA 4I56A 4DL6A 2CIJA 3R5GA 1QUPA 1NHVA 3OHAA 2FHMA 5KFSA 3R5AA 2Z2LA 3K5LA 5D0RA 1DQ8A 1X4GA 1RWKB 2YKMA 1KTVA 3KLIB 3BDEA 3FBUA 1ELLP 1XC9A 3AB2B 4F8ZA 2J9CA 3EICA 3EUNA 4KFBA 1RHMB 4IFVB 3HSDA 4JYAF 4NLOA 4PEOA 4WFZA 2QT7A 1WG1A 4YR0A 1X4HA 4CLTA 4RNHA 2SXLA 5CABA 4UCPA 1S48A 2HAIA 2AGPA 1FO1A 2HUZA 1SV5B 2N4DA 3SV4A 4CZCA 3HFKA 3HZGA 1HQEB 3DOKA 3HD2A 1XE4A 4P44A 5C24B 3EXYA 3H5ZA 3J7A1 4AQYJ 5IM0A 2K3IA 2NR0A 3VGTA 1U47A 1WWHA 3R5JB 4AVAA 4LRAA 2QE5A 3POTA 2KO1A 2OMLA 2NYQA 4I67A 3PJXA 3CJQA 1RT6A 2VHGA 2RKIB 9RUBA 3CT9A 1U45A 2R7UA 2OEMA 3G3SA 2AMCB 2Y0SD 4A94A 1TFYA 3BPSP 7AT1B 2AX0A 1RK8A 1NRKA 3EM1A 3VAJA 5CAAA 1J2VA 4U6PA 2EK9A 1GXTA 3W64A 1I1DA 4RPFA 1KHVA 4L73A 2W2OP 2Y0MA 4NGPA 3DRYA 5DG8A 1Y4ZB 2B4OA 2VZ9A 3V8IA 2BMBA 1UAWA 2VUGA 5KFPA 2JDDA 4DV3F 4O3NA 2UU9F 2FLOA 3IWWA 2HIYA 3HLUA 4GRSA 2FS5A 1ZETA 2LECA 1FRKA 3G8TA 3IRXA 1HLWA 4RW4B 3RB0A 3CCES 1OY9A 3CF5Q 1Z5RA 5H9FK 3W2VA 3E51A 2AFMA 5AXMA 1D9FA 4C7QA 1XMBA 4ED1A 3TUJC 3KLHA 1RWMB 2UUCF 3KUHA 1ZLHA 2Z0GA 3ZZTA 2VQEF 4DQRA 1V3ZA 2YKQA 4L8AA 3D4UA 4JV2A 3JSMA 3LGNA 2UVRA 2B4VA 3OQ2A 5ETMA 1RWWB 1XF8A 2WAQD 4CLYA 2W2QP 2RD5C 5MLCV 4RW8B 3WIVA 1PG5B 2W2PP 1Q53A 2M0GB 1M5SA 5HQMA 2MLXA 3HFVA 2RQKA 1RAJA 4X66F 4FBTA 2DHGA 3PX6A 3DLGB 4U8VA 5HMNA 4C98A 3N4WA 4YEAA 3A8JA 4IG0A 4C8YA 1B3TA 4IR1A 4LREA 1JLFA 2V34A 3BGRA 3B3SA 3MWBA 4Q45A 2MSTA 5KFEA 2JEIA 2Z4PA 4PAAA 3H2VE 1GH8A 1X0PA 4OI0A 3AY0A 2V94A 2JLMA 3IWEA 5T7LB 5H84A 4CAWA 2HG4A 2LYVA 1RKIA 4USJC 4JI5F 1SC6A 1FWLA 4QBUA 2HSEB 5HBMA 1X5PA 2N4CA 3S6FA 2JVRA 4ICLB 4RU9A 4DHVA 4KH1B 4JI3F 5I3QA 2Q7BA 2VXKA 2XI3A 2PA3A 4DDFA 3LP1A 2Z11A 2C2KB 4FYXB 1WI6A 3ZNJ1 5KAKA 4TNOA 4UFWA 3GIJA 2Y8YA 5ISVA 4DF4A 3CMAS 2GC8A 4KORA 2Z0ZA 2J6TA 2V68A 1HI1A 3AD9C 3PW0A 3HKWA 2XULA 5JJBA 3W9HA 4XPCA 2P2CB 4EEYA 4CLKA 1REGX 1CJWA 3M4XA 2VFTA 4HHHA 1FJGF 2DXDA 2K5TA 5K8NA 2XNQA 4EMEA 3VGUA 4LIWA 4KRWA 3D0GE 2OPQB 3HPOA 2C2EA 4PG8A 1URNA 4ED3A 4MKAA 5M2PA 5DDOC 2ZEDA 3SEOA 4IDKA 4K8RA 4KV8B 4J9SA 4F67A 2GE3A 3SQGB 2PJ3A 4M63A 1IOIA 5A2QU 4K0KF 2J9DA 1PJ5A 2CVEA 1FRMA 4PUOA 1WTFA 4PYAA 4LX9A 2LKZA 1F6TA 3PBEA 2MQQA 3OD2A 1N5VA 2MQPA 2BL1A 4F0KA 3M6UA 1WKJA 1YX2A 3EY5A 4A47A 4E0DA 2HWIA 3BJ7A 3GG0A 4Y49C 3AT1B 2KVIA 2ZWPA 2FZCB 3PDNA 4FD6A 1MMNA 4WTYA 4R8UB 4F3OA 1BXNA 1P1TA 4YWYA 1TVRB 2B5GB 1HKAA 3T5LA 4EK2A 2W01A 3KNGA 1DY3A 3EVOA 1P6TA 1Q95G 1MU2B 1JLGA 4RJVA 2Z8QA 3TO9A 2OELA 1UL3A 1TU0B 2C3OA 4PRFA 2ZC3A 4LF9J 2FB0A 3D7DA 4ZP7A 2JLGA 4LFBJ 2J0WA 3GFXA 1FT7A 1S6PB 2CA9A 3EZUA 3J7YI 1LV5A 1U02A 1W2BR 3K5NA 1AUDA 3D7SB 4EYHB 1KTQA 2PDAA 3S9NA 4G1QB 1GFWB 1VIOA 2V8GA 3IBFB 3D5MA 2HNYB 4OHYA 3OV7A 3IAS9 2CPYA 2MLZA 4RL1A 4LVNP 2OPPA 3M2UB 1PYTA 3PV8A 3UFCX 4CI0B 4OC3A 1VI7A 2DJWA 2UUBJ 4ECWA 3TOAA 1SIZA 2I0XA 3LALA 4OV1A 1IJEB 4H54A 1N4LA 1BGXT 2AFXA 1HR0F 1K0TA 2QVPA 4OI1A 3MEEB 4JYAJ 1WKKA 4ONWA 2GGPB 4DQIA 2R7RA 1SL1A 1ZA1B 1T02A 2VDIA 2G2ZA 1J4JA 3TR5A 4ZIWA 1AA1B 3N9UC 3PFEA 3N6NA 3QWUA 1JJHA 1G6BA 3ILJA 3IG1A 3KWMA 2LLZA 1PBAA 4C2YA 1QTNB 1YJRA 3SI0A 4NRTA 4OZLA 1CS4A 1XR5A 2BKNA 5DJBA 1VBXA 3EO4A 2QZ8A 1AMPA 4B3TJ 2I5JA 1RKJA 2D3OR 2HHWA 2PRBA 3CDAA 4X65J 2DYAA 1TV6B 1VQPS 2QN6B 3J7AN 3UD5A 1B7YB 4JBCA 1H2UX 1ZH5A 1KNZA 2RF2A 2EC2A 3IBWA 1UEUA 2WHOA 2BOPA 2HNDA 3CWJA 2HVHA 2ZEPA 2XLKA 2XB2D 3QNVA 2CJ9A 1U4BA 1M5KC 1Q2DA 2P0WA 1OQ6A 3HVAA 2QMLA 4ZVPB 2HYIB 2VASA 2J6UA 2WB4A 7CPAA 4RUBA 4PQUA 1WORA 1RWVB 3JB9k 4DR1F 1RWOB 5CYJA 1AUGA 5A0YB 1P9QC 5B0FA 4J9RA 4IG3B 2RRNA 1WDDA 1A6LA 1CC8A 2BR0A 1MJAA 1EE3P 2W4PA 3VWEA 4C2MA 4PCQA 1S6QA 5LMUJ 4A33A 1LCPA 1Q7LA 3E0KA 1B99A 2Z30B 3FFIA 1Y0HA 4HI1A 1RA6A 2MXYA 4RUAA 2HB6A 1OY6A 4M5HA 2DCUB 3MM9B 3AXKA 2PC6A 2DNKA 2F8MA 3JSRA 3GFZA 3MMBB 2KCWA 2V50A 2ZH7A 1M5PC 2DY1A 3HK2A 2AJ1A 3GIMA 4OX6A 2QLXA 4CH0S 2IA6A 4K2JA 3G82B 3CB4A 3HSZA 3OXGA 4FF3A 5A76A 5DO2A 5IV3A 1SJ4P 2VDHA 2XY7A 3BQ0A 3QFHA 4KO0A 4EGLA 3PR5B 1B0PA 1XIXA 3FBFA 4CT8A 2KB2A 1RA7A 5HN0A 3FCWA 4DL3A 1Q8LA 2WVCA 2POKA 3Q83A 4KQZA 2O67A 1R8BA 1S7IA 2BQUA 5G0RA 2AWZA 1PGZA 5KFRA 2RU3A 5KTAA 1NM2A 3K5PA 2ROGA 3OHBA 4OC5A 4P74A 2C22A 3R6LB 2CQBA 4M6HA 1TUWA 1U1OA 3H59A 2DPJA 2G2YA 2E7WA 1HNVB 1KS2A 2OFHX 1P1LA 2PE8A 4BINA 3FF3A 3ZZ0A 3LTOA 2APOA 3H98A 3LPEA 4P52A 3MMCA 2P9EA 2RDDA 3PEHA 3WC6A 5RUBA 4ZIVA 2DISA 3GYAA 3M6WA 3W9JA 5HL7Q 2ZELA 2DCLA 2VFSA 2VFUA 2XEIA 1N36F 4HHUA 1YRXA 1MMLA 3EVMA 5HATA 5HQLA 2BEFA 1FWPA 1FVQA 2CAJA 4QIEA 1NHUA 4ZPVR 3B82A 3L7UA 4NL5A 4Y2CA 2ERRA 2WSCC 1WWZA 3HHLC 3T1AA 2CG8A 1QLNA 4UFXA 2CRLA 3W5ZA 2I00A 3BLNA 3G86A 3DNSA 3CCQS 1L3UA 2XEGA 4HDGA 1X4BA 2BJ1A 2C2OB 4ZHRA 4YB5A 2IM0A 3PRDA 4KPCA 2MY7A 3EWGA 3B78A 2PJ7A 4GKKF 2I9SA 2JC1A 3VGVA 4DPYA 1FJGJ 4HH0A 3TX0A 3FKBA 1P27B 1ZBTA 5KFLA 4NLVA 2ZHOA 4NXNJ 2Q79A 3LP2A 4DR2J 4MHDA 2ROPA 3TJ8A 2BABA 3PW7A 2CQIA 4ITSA 5A28A 4EBDA 3OL9A 1DZ5A 3HSJA 2FPHX 3G6VA 4P7VA 3LOUA 4JI5J 1AROP 2AKWB 3PEIA 4LR7A 3M32B 1IYKA 3I87A 2AIRB 3ENAA 1Q1KA 3BYPA 2RDIA 2ODFA 1IM4A 1ZTWA 5MAOA 3EVWA 1BQXA 2XY5A 2VKZG 4DEZA 2FT0A 4IO1A 1T9VA 3DI6A 4OYWA 2RU9A 2G13A 2C2RA 2O4HA 1MJBA 1QSNA 4DR4F 5GAHU 1XRYA 3M8YA 2MQNA 3T5JA 3BBBA 4I69A 3W6XA 4WYLA 2KDOA 1S1TB 3KHLA 1WELA 1VC0A 4RW6A 3OSNA 3M05A 1JLBA 1NJWA 2BW2A 3LP0A 1PC4A 1YJ9S 3RW7A 2KTQA 3FSXA 4DUZJ 2Z3NA 3V5RA 4KFBB 1MMDA 4O4GA 1QDUB 1YMEA 4PV6A 4NF1A 3R2DJ 3CCTA 3ZJ0A 3P5TL 2GO8A 5ETKA 2QFJA 2V9KA 2AFWA 2BBEA 5CQGA 4CO4A 2H9ZA 1IR2A 3A8KA 1M1DA 3ZZZA 1R8PA 1AUSL 1TL1A 3L09A 3J7Z5 1R31A 2AT1B 1TL3B 3D2WA 2PGCA 3UVJA 1S5ZA 2F7VA 2R8IA 1BQNB 4CLUA 1RAIB 3QNWB 3POTB 3TEGA 1YGHA 4ENOA 4DR3F 1GYTA 3LP1B 4KBIA 1FHTA 3V6DA 3NE8A 5KG6A 2RRBA 5L1IA 1G4CA 1Z8TA 3CC4S 1ZLIA 2FIUA 2V4QA 2VPXB 3R6GB 5L9XA 4C7IA 1GXLA 3ISND 1DBDA 3K58A 3RBEA 1EHWA 4H4MB 2I6WA 4H2KA 1BPNA 2ZC4A 1TK0A 3TYTA 3MECB 3D6FB 4XTTA 4BBHA 5IV0A 2ZPAA 4OJHA 3KJNB 3PB4X 1ZPWX 1HIYA 4CP5A 1FNOA 4LMZA 4I64A 4ZX8A 2XEXA 1TZ0A 2JL9A 3BO2A 4OLPA 2Q43A 2LXUA 1TVRA 3BSOA 1GAOA 3TAMB 1VLYA 3MEDB 1S12A 3B35A 5A0YA 4OX9J 3G6ES 4CYQA 4Z2XA 1UA0A 1TELA 3MM5B 2DNOA 1XN9A 2W7OA 3CUNA 4BHQA 4ZY0A 2R2RA 5B0BA 1FRLA 2ZWOA 4ED2A 3BR9A 4NCZA 1HD0A 2EFQA 5IZHA 2J7KA 4BCAA 4C11B 2VKRA 1X7VA 3W6SA 4II9A 5K14B 4LR8A 1Y3JA 3VAKA 2GMJA 2VG7A 1X4CA 3CCLS 1YHQS 3WT4A 4LQ3A 2QYCA 3TOQA 4Q8EA 5HLFA 4KS9A 1YQEA 2MQMA 1ZM4A 3R1KA 4DX5A 1Y7RA 1OYEA 3OR2B 1YTYA 1KVIA 1V5VA 3TTHA 4OLOA 1BOBA 1S9FA 2CY2A 2PI4A 1B7FA 3BJ8A 1S0VA 5DZ6A 2A18A 4H4KA 2XG8A 2NYHA 2L9WA 3KUEA 3NNCA 1UA1A 1T03A 4Y3CA 5DLFA 2X1BA 2ZUGA 3I55S 1RZMA 2BE2A 1TL3A 4ELVA 4UOCA 1PYSB 4B3TF 4G65A 1HBNB 5B08A 1LWFA 4IFYA 4WXOA 3RYLA 2KFYA 3PEJA 1OZPA 5DLGA 1F57A 1VISA 4DV4J 1MW7A 4UIBA 4YGOA 3N5FA 1Y3KA 2V4RA 5F0UA 4C0BA 1TR0A 2BM1A 3HULA 3M1VB 1YQHA 2O01C 2RQ4A 2FJEB 3QT7A 5J2QB 1X4AA 3AOBA 4JV1A 3MGJA 1KVJA 1VHSA 4TLQA 1S0MA 3SFGA 5D3GB 4XPKA 1YBTA 3KLGB 1GNKA 2HNZA 3DGPA 3KHGA 1SH2A 2GGPA 2BUEA 2QA4G 4AXIA 1J27A 4DR1J 3M7VA 3A8EA 2C6GA 4MHYA 1IKYB 1HEEA 4LBPA 4U8YA 5ELYA 4TXSA 3THTA 3CCSS 4FD4A 1UZDA 2QA1A 1VIXA 5T7LA 3TUPA 1JX4A 4RX6A 2W24A 3O3LA 1FVSA 3Q2TC 4EUVA 2DO4A 5GADU 1FKPB 5L1LA 5C2CA 1ARMA 2VPWB 4O3QA 2A6MA 3BH7B 4HACA 2HBRB 2BJDA 3C3LA 2XCPA 2HGNA 3OFFA 2VODA 1IQTA 2XEJA 3SSQA 2DRDA 1HHSA 4LF6J 1H2VZ 3RB3A 2Y1IA 3FK4A 2EUIA 5LXYA 4USVA 1T0TV 3I5AA 1BLUA 3D7HA 1XMQF 3LWMA 1YBAA 5GCNA 3TWZA 3NBPB 5GAHI 2JEGA 3R5CA 4O3RA 1IBMF 4DNCA 4Y2IA 2Q66A 3GONA 2BUNA 1RYRA 3DRSB 2EVZA 3CGIA 1NB7A 4CGPA 2ZE2B 2EWHA 4QR0A 2Z2YB 3EZOA 2B9WA 4MFKA 4KV8A 4R8UA 1REVB 4JI3J 3K9UA 1LOUA 3D54A 3MM7A 5KOWA 3D1QA 2B5GA 2XEFA 1AW0A 5JGFA 4RNOA 4CLPA 2VA2A 1CULB 1AXQA 3FRYA 1X0FA 4WU2A 2GHWA 2PO4A 3DYAB 2KI2A 5A8KB 2XTJP 2RNEA 1RWNB 3BQ2A 2UUAJ 4IRDA 4ZVHA 3C26A 3ZFVA 1PU9A 2E5IA 4DOZA 2R7SA 1HNZJ 1S9GB 2YKNB 4FN5A 1Y0RA 1FERA 4EO6A 4WF9Q 4FPIA 2E9RX 3ZNUA 3VQSA 2ZH2A 2ZVIA 1G3OA 3DRRB 2ASDA 4YQWA 1KQSR 1N71A 1HBMA 1HQ2A 5JH9A 3AA8A 2DR9A 2LQ8A 2RS8A 2WVEA 4NEYA 2HPUA 2YGWA 2XM3A 3M30B 1F9EB 3TA2A 4DS4A 5KFUA 5L1JA 1PAUB 4FXWA 4KKOA 3I4HX 2RMLA 2FVQA 2QL5B 3DM2B 1VQ7S 2VG5A 4IH5A 4O3PA 2UUCJ 3IXQA 3BSAA 3HZEA 5CZVA 4P45A 4USKA 3V6HA 1VJWA 2UXCF 3SHPA 1KN6A 1VDHA 1IKXB 4ZVUB 1NK4A 4A8SA 2OR4A 4KUAA 3M9MB 2UVWA 2FGCA 4QB9A 3DRSA 4NRUA 4D3HA 4HLBA 3Q8YA 2NPIA 2WBMA 1M4DA 2GQCA 3A3OB 1U1MA 4UFVA 4OYMA 3TZXA 5AE3A 2FIWA 3PYDA 2D74B 2Q44A 1D8YA 3BHXA 1CQNA 3WABA 3MEDA 2RB7A 2B7CB 2J9AA 5J1QA 1FKOB 1SKSA 2OAUA 1YRTA 1SUQA 3OUYB 1AZSA 2PEBA 4CTAB 4RZRA 1SC4B 1VQ9S 1YX0A 3DN9A 3G2XA 2UXDJ 1GXUA 2JX2A 5KFJA 5LSOA 1U8WA 3P49B 4MHPA 3ZZRA 2E9ZA 3I9V9 1RTIB 3ZTQA 4P2XA 4KOUA 3IFEA 1R0CB 2IBKA 3UW1A 2E5HA 3RB4A 1UVLA 5JUMA 3AOAA 3CXPA 4OC2A 3I0SA 1CJKA 5ETNA 3FEZA 1YG0A 2HZVA 3CJ3A 2B4DA 1RCOB 1NZAA 3K0JA 1UVJA 1HA1A 3NGDA 2V5HG 4EMDA 4ZJLA 4ECXA 2EFOA 5K20B 3BS9A 2QSWA 4N41A 3U1LA 3B4DA 3PNIA 4MFPA 2IPOB 1U8SA 2EW9A 4QBJA 3IC1A 1NK7A 2W4DA 1YR0A 4YS2A 1RBLA 4DL0C 4ZOSA 5KT4A 4DSKA 5KTDA 5D0EA 1Q7LB 2J0XA 2O53A 2D69A 3DM2A 4UY85 1LWXA 4CRZB 1BQNA 2MKIA 3BEGB 2F1FA 1SH3A 2IAJA 3D7GA 3H4DA 2WSFC 1Y5NB 2XO6A 5I3PA 2VF3A 2OPSA 3K17A 4G1PA 3HJFA 2L9DA 5KFOA 1LFWA 1B6BA 4KVME 5D8NA 5FIIA 2E1MC 4WFBQ 2DNGA 5HSPA 2J8AA 1YJ7A 2CPJA 5HMYA 2VJUA 3PIPQ 3ZTSA 1X5OA 4ZK7M 5C25A 1EKSA 4PABA 3UN3A 4P71A 4QIWD 2ZD1A 4R5PA 4RN7A 4PWDB 1C4CA 2BCOA 1K9MT 4K4SA 2XMWA 4DL5A 3FIXA 5ETPA 1WTBA 1OSCA 4C8LA 4IHMA 3IG1B 1HNVA 2VV5A 2H65B 5CH7B 3KASA 1RI7A 3AB4B 3I4PA 3GJRB 3QIPB 4QU6A 3TO8A 2KL8A 4ORFA 4K4ZA 3RR7A 1XR7A 2VPZB 3RW6A 2G0JA 2DHAA 4DSEA 1V3RA 1FFWB 5IWAJ 2W9BA 3UE2A 1F3FA 5LT5A 2CQ2A 1JJ4A 2YPYA 4UZBA 5KFQA 2XSJA 4DSIA 4MCPA 1D09B 4C3MA 2CZVC 3ET6B 1HWJA 1BE4A 3GZ7A 1B64A 1R8CA 3GE9A 2JFDA 2FHOB 1Y11A 2HHHJ 1S0NA 1K4JA 4FP9A 2J8MA 1FX2A 5K8MA 4FWUA 4C11A 4NA3A 4U7UD 1DTTA 3QZ8A 4CO5A 1HNXF 4J7CA 3MPDA 4LT6A 1LQ9A 3T9ZA 2IA0A 2QJ8A 3SCIE 4BLGA 1F9HA 4C3KA 5B0DA 1LWCA 1KUXA 2WRMA 1S0OA 4A8QA 2R7OA 1D3WA 5HVGA 4NCGA 3DOKB 1S9EB 4PXCA 2Z2MA 5IB0A 2OPSB 3F0NA 1N48A 4LF4F 2BRLA 3R97A 2G1HA 4Q5VA 2VZYA 3H5XA 4P75A 3UO0A 3DNCA 5J2QA 2DH8A 4KOTA 4YUDA 1JLBB 3UDLA 2JNJA 2R8GA 3H8YA 4R25A 2J9EA 1FF2A 2O28A 1QQ9A 5G1ZA 2WSAA 5AG5A 5LJ5Y 2EEYA 1WUUA 2OKQA 2B9EA 2BJ8A 4ECVA 3VAHA 2R3VA 4WIIA 2WBRA 1LNQA 1DLOB 1RT3A 2A6OA 1YBUA 3TI0A 2GNKA 3DRXA 1GMWA 3IEHA 2WPXA 1ZM3A 4X4RA 2BJ3A 1NH8A 5KG4A 2GAGC 4IH7A 4B9UA 4KY3A 3U1MA 5LXRA 4OFZA 2GIRA 4DU8A 3FZBA 3TAQA 2XWYA 2KRRA 4QR2A 3DKDA 4A8KA 2EBEA 4JUZA 2MQOA 2XWXA 3HHLA 4DJLA 3J7YU 3DRPB 3PJ9A 4IO9Q 1Y5LB 1RYSA 4C8NA 1YJTA 1Q82T 2J0SD 3N28A 1VQLS 1DHMA 2C1CA 2LQ5A 2EWBA 2BW7A 2YNFB 4L75A 4RW4A 5KT7A 4UBRA 2CTCA 1ZOTA 2GO9A 2IM3A 4CO1A 1ZG8A 3JSBA 1JLCA 2HQYA 5IT4A 4LF5J 2DGXA 1T9YA 1VHOA 4RW7A 3W5YA 1WHXA 4PXDA 5ETSA 2LU1A 4CO0A 4XK8C 2W7AA 5ITHA 3SCLE 3RAQA 1TMJA 3OUYA 4DBQA 2ZBCA 2ASJA 4QWAA 2X7BA 3G8SA 1NK9A 3CE8A 4BWMA 1TKXB 4DFPA 4L74A 2WYRA 1GX6A 3MI7X 2HVIA 1T9WA 4FKXA 4LBIA 4QWBA 1QSOA 1CULA 2DGVA 1XWLA 3QSYB 4OLLA 3LODA 4MI4A 2ARHA 4C97A 2B5JB 5C42B 5LMNF 5HXDA 5DM7Q 1CX8A 3AHPA 4FKYA 4LF6F 3J81U 4NLGA 2V8HA 4DQQA 5HQ8A 4WKRA 4WP8A 1FA0A 4DU7A 1RT4B 1VLOA 2AP6A 2Q1LA 3JTOA 4OAEA 1FRXA 2UVVA 5J2PA 2QTWA 2K8GA 2W25A 1T7PA 1R43A 4W9YA 1IJFB 4F3QA 4WFNQ 3OWCA 4OP4A 3FRZA 9ATCB 2DBBA 1I1GA 2P6EA 1KKHA 1NJIT 4TN2A 5HBMB 2MLYA 4OJ1A 5DQHA 4YU9A 1SL2A 2OU2A 1T95A 1NMEB 4A4JA 3JRUA 4NPOA 1HPZA 1YRUA 1NUEA 2LMIA 1TAUA 3CJ5A 4WIQA 4A8WA 1PJ6A 2IDLA 2WOMB 4M5DB 2RVJA 1MNEA 2M7SA 1RTQA 3HFZB 3OJUA 1J5OB 1XOVA 2FJBB 1CJVB 2CPZA 3UR3C 1RISA 4QJVA 3THPA 2YKMB 3H5YA 1RHKB 4PPZA 1RHJB 1H0HB 3QT8A 1HNZF 2Y8WA 4EO8A 2C3YA 1ON0A 4B11A 2ZFHA 4DR7F 1MROB 1FRHA 2F63A 1HBNA 2FVSA 4K30A 2DKOB 2WONA 3E2EA 1RU1A 2NLWA 4OL8A 4QPXA 3EJMA 2YH0A 1ULRA 2GANA 1S3ZA 2NSMA 4C48A 3MMAB 3FJUA 1BWEA 4MFBA 1OIAA 4DI6A 5IM0B 3V6DB 1MWQA 1TKTB 4MY0A 1FNXH 4N8NA 4ECTA 4IQXA 2BRKA 2K06A 3G8WA 3VAGA 3IP0A 2ZM6F 4K50A 4WP9A 4QCLA 3FECA 3FRMA 3GR0A 4CRYB 3PX0A 5KG3A 2UV8A 4HACB 1FEEA 1JKHB 1Z4UA 5CCLA 3R9GA 2YXLA 1RTIA 2KHDA 5DQIA 4HNYB 4F4XA 2OTLS 2QLFB 4C7HA 3VV2B 2DEAA 4B3SJ 2BYCA 3M2VA 1XMOF 3TW0A 5DDQC 4M6IA 2CZ4A 2XGQA 3BPDA 3OTBA 1CJKB 2MEWA 1JLGB 3BXMA 4MIAA 1FI4A 1NDKA 3ITHA 2JH3A 4XAKA 2REEA 5HROB 1X60A 3OVAA 4I6WA 4NMXA 2ABZA 2EC0A 4S0MA 2PIIA 2FJDB 2AEMA 1HR0J 2ZZTA 1IKVB 3RGIA 3HLPA 3MCSA 3T6BA 2GJ2A 3F44A 2YNCC 2QGFB 3MEGB 5FVJA 2B3TB 5KFVA 3C66A 2UVUA 2XLIA 5HVHA 1LW0A 1PCAA 2JEWA 1HWKA 1KQFB 5F49A 3S6EA 1F2GA 3QQCD 1ZG7A 2C6PA 4USWA 2AE6A 3X1LB 4J9NA 2OZUA 5GVQA 1QE1A 4L89A 4LFBF 4Q2MA 4FYWB 4LSNA 4ZI6A 4LQ9A 2CZ9A 1UPMB 5AE1A 3Q0AA 1BD6A 2BKPA 3JSMB 2BE7D 1RWUA 2DNPA 5E96A 4CWBA 2XQCA 3I31A 3VH9A 1FDDA 4AYBD 4K4YA 3W5XA 3MMJA 1YKWA 3KHHA 1VQ8S 5C25B 2GW8A 4B13A 1W7WA 5CHCB 3S6HA 5G21A 1FFGB 4WFYA 5L38A 4KGMA 4DFMA 2VFVA 2HIQA 3OXLA 3NS5A 3HHNB 3BJYA 1XEBA 3I5BA 2J7UA 2BQRA 1PO6A 3CDEA 1JLAA 1H74A 4MK7A 4OX9F 2YKPA 1RT2B 2MQ8A 2Q0YA 4CAVA 4EZ9A 2Q7SA 4Y65A 4NYPA 3NE7A 4O3SA 2A4NA 3R2CJ 3KK2A 4JI7F 1SCJB 3GSDA 1DFDA 5HVFA 4FYYB 2A2CA 5EMIA 1IGBA 4OIXA 2IJZA 4UQTA 4R9MA 3MD3A 3HKZD 4B5PA 4KOWA 4A48A 2H5EA 3ITHB 5KFNA 2Z57B 1S7LA 2VOPA 3ZZIA 4NYOA 3NNHA 4ZY2A 3CZXA 2QYVA 3OXFA 3BSNA 4N5SA 1IOFA 4OZ3A 5D4NA 5F8HA 4KHPF 4M6GA 3QIPA 4JD6A 2AYEA 4W90B 3C6TA 3CEDA 4XPDC 3CCRS 1Q78A 4ILRA 5SZTA 1IR1A 1IKXA 2WZNA 4NSQA 2CQ1A 4JI2J 3P3DA 2QO3A 2VD3A 4DCJB 1IBKJ 3NP5A 2MZSA 3BKUA 2ZH5A 3TQ1A 1WOOA 5L46A 1KZFA 4AT1B 1Y0YA 1A2ZA 4DLGA 3M6VA 2LCWA 1Q7YT 5HP1A 1S9EA 1XNRJ 3G82A 1F5AA 3IO1A 3QB8A 3DMJA 4IDKB 3I6PA 4X4QA 2KZMA 2OPRA 3LF0A 3FCVA 1M0SA 1SC3B 4KO0B 2K1RB 1GT8A 1N32J 4F04B 1I5OB 4DL2A 3JTNA 1F2OA 1Z2ZA 2W9AA 1AZSB 3EGWB 4B17A 1XNQF 3CCZA 1WSVA 1S76D 3BGRB 1LWCB 4B9LA 1F60B 1YZ7A 1OWXA 5J1NA 2V2ZA 2ZBQA 4BWJA 1S6PA 2QIFA 4I68A 2P9GA 3JAMY 1WF1A 4NX9A 1EETB 4YY3J 1APSA 4A8OA 1MWZA 2R7XA 1T9XA 1VQKS 4R3KA 3I0SB 3G71S 4L3NA 2J9DE 4KSFA 3CW2C 3IN5A 2IDEA 2CVIA 1M5VC 1SI9A 3MCMA 1S7KA 4IUFA 2HVEA 2HLUA 1HNWJ 3GSIA 1C4AA 2BX6A 1FD2A 2MKYA 5KG0A 4K4WA 4QYZK 3RO0A 4R8FA 3C16A 2GAHC 1S10A 4DSLA 3JQMA 4H4KC 8RUCA 5KT5A 5B0GA 3DLKA 1RT7A 2BE9B 4AG9A 3O5TB 2FD2A 2Q04A 4ICLA 4WTOB 5BJRA 2YVSA 1I51B 2CJQA 5F0WA 1WACA 3DLHA 4U9RA 1Q79A 3MFIA 4U96A 4XPLA 2BV3A 1S1XA 1S7HA 4LIRA 2LEBA 1N36J 4I2PB 4DPUA 2VQYA 2YWFA 3MEEA 5GAEI 2OD6A 3TVZA 3BO3A 2KZZA 4AL5A 1P9YA 3ULHA 1GMUA 3MOZA 3MM8A 4NOHA 2NXCA 5HP1B 4LSLA 2OZHA 1VHIA 3NG8A 4R6TA 1RADB 2Q4YA 2MYFA 4P4EA 4FS1A 4M5GA 4ANCA 2XS5A 4IUSA 4J9UE 4HL9A 5KFZA 5ADZA 2Q6CA 5KFGA 4LF7F 3KI9A 5E3CA 4RKUC 1ZZNA 2GFFA 2AZ3A 3DLEB 1U09A 1NPPA 4UOFA 4PXEA 1RJJA 4RS2A 2MPUA 1H73A 3PKYA 3W63A 4C9DA 3UY5A 4DUKA 3WIUA 2RRAA 4UWJA 5CXTA 4XIUA 2WVDA 2DH7A 1VS3A 3ICLA 3ET6A 1MJ9A 1SJQA 2QLBB 2V0NA 4LFCF 3SI2A 5KFXA 2AJQA 3O2IA 2QA2A 4RUHA 1LOKA 2CDQA 2RQCA 4BD9A 4QWEA 2ASYA 3QO9A 1ZYQA 1G7CB 3HX9A 3VVTA 5IOLA 1C2PA 5JVHQ 5C88A 1FXDA 3KLEA 5ETQA 3N6MA 2R1IA 1HPZB 3M8ZA 4H6ZA 4KLVA 4FBUA 3DSBA 3HHLD 3C16B 4ILLA 5I42A 1ACMB 1I21A 3SZ2A 4UEEA 2ZBPA 4O44B 4RW9B 1XTZA 3T5HA 2NXJA 4F9UA 3PW4A 2DNQA 5E33A 1EJ7L 4X84A 1X31C 3WZ0A 4F8RA 2AYBA 4CGNA 3CO9A 1NJXA 1RTDB 1VC5A 3GUXA 2QL7B 2QV6A 5KFIA 4IF5A 3ONQA 3HSGA 2CNLB 2HQFA 4E0AA 2ZZNA 3FBEA 3EYZA 1YK3A 4N77A 4Q7AA 1V6HA 3GIKA 3B7IA 2IM2A 2DIVA 1R8HA 4OKOA 1CS4B 1E6YA 2GS8A 4KAIA 4HTIA 1IYLA 1CC7A 1H98A 2R98A 2C2DA 2VC0A 4HTJA 1WHVA 2AJ2A 2VOOA 1JLFB 3CPWR 3RBXA 3TC8A 2EFGA 4MJKA 2J8NA 1N5YB 2V8PA 2IQ6A 3M2VB 1NZ8A 2EK8A 1Y9WA 1VRTA 3ZTRA 2GQQA 1CP7A 4FD7A 1ROFA 1JLQB 2O1PA 3KMQA 4OC1A 2C2MB 2HBYB 3PRTA 4F6AA 1WC1A 3MMCB 2GX8A 2DHSA 2ZZMA 5EX3A 4XDCA 2C3UA 1X9WA 2DPIA 3VALA 1FK9A 2YNHA 3NRBA 4X8IA 3OTDA 4L76A 3R9EA 4MCSA 3OTOF 5HLFB 1CQMA 2D3O1 2MDAA 1C1BB 4MCQA 2AJ0A 1PJ7A 1NNDA 1IN0A 2EPIA 3J7ZT 1FRIA 3QAEA 2ATCB 2CXEA 3MCNA 4DQSA 5BXIA 1MK4A 2E1AA 3M32A 3QAUA 2HVZA 4GKJF 2MY8A 5KFCA 3BBCA 5D4OA 4C0HA 2W4CA 3DOLB 4JI6J 4UCNA 1RAHB 3OTOJ 5CCMA 3LP2B 5J2PB 2H4YB 3T9NA 4V1Ak 1O8BA 2EBGA 2R7TA 4K7QA 3IJ3A 1DE4C 3VR1A 1OY8A 3EPIA 4USHA 3VCDA 4R3LA 1ZG9A 3QGIA 5IQ6A 4CDIA 3MXHP 4UA3A 4C2ZA 4YFJA 3DCAA 1NK6A 2DGUA 4P73A 1L5UA 4QC6A 4XO0A 3MTJA 4ED8A 3I82A 3W2WA 4UCMA 4JV5J 4NJRA 4F4AA 4JB8B 2QLWA 2ILYA 1D9DA 5AT1B 4PYDA 1NKCA 1H8LA 2CNTA 4X5KA 1DARA 3D67A 2RE1A 4TLRA 4OJGA 4F0HA 3I32A 2DXFA 4W4MA 2RT3A 1RT3B 3ILOA 5CYQA 3AAWB 1DAXA 4JI1F 4B3OA 4NXMF 1TKDA 1WC6A 1IBKF 2HGLA 3QPIA 5DG7A 1SBRA 1R0AA 2BOAA 1HWIA 4C68A 2CQGA 4Z7YA 1KD1T 4MBUA 5FLXY 2E5LF 2K7KA 2LP4A 4OZ1A 1RLDA 2X1GA 4G3IA 2IM1A 4V19J 2QMUB 1RQ0A 1UCNA 3UDVA 3IR5B 2L3MA 1EAYC 1D1UA 1JQGA 2HBQB 2ZBRA 4EVYA 3B8HA 3RZAA 1UWBA 3KHRA 2L41A 1NU4A 1YW6A 2HZAA 2DHHA 4WZQA 3BGOP 2AJ6A 2HURA 1IKWA 3FQLA 3DMJB 3DDKA 5H9FJ 4UUXA 4RW7B 4KZTA 3DR8A 1B4SA 4PK2A 2AYGA 1XFOA 2PJBA 1N6QA 4Q2LA 1QAJA 3JTPA 1UVMA 1TF9A 4NGNA 3S6GA 3KL9A 3SQOP 4B9SA 3CDBA 3M2RA 1TTHB 1UFLA 3LW5C 4KLWA 4N8OA 2PRQA 1TL7B 3DR6A 3RJMB 4KR0B 3B3TA 3HO1A 4JV0A 1CBXA 4Z65A 5CZXA 5G22A 2PN6A 3KJVA 2JDCA 2PJ6A 3RTVA 4LSZB 3TUZC 5F8GA 1YI2S 4O0IA 1YVKA 5E7OB 1B87A 3EDQB 1B70B 2OMOA 1NO8A 1IM6A 5T14A 2XO7A 3NWGA 3KLFA 2MMYA 2YX1A 3GR1A 2P6TA 4C8KA 3CULA 3IMQJ 1IWAA 4KPYA 1LFPA 3C8YA 4Q44A 1UJ4A 4ZCIA 5IC6B 3DC2A 4QOTA 3ENVA 2BVZA 1C0TA 1FWKA 3MM5A 1K1SA 1PUAA 3WBZA 2OEKA 5KFWA 3B3WA 1QE1B 4GVLA 4FBEA 2UUAF 1U1QA 1HBOA 5F3TA 2FLLA 3CJRA 3K9TA 3P5BP 4C4WA 1PYOB 1PKUA 1S1TA 1GQEA 2E9TA 4A8XA 4FF1A 3PB7X 4P10A 1Q8BA 1VRQC 2JFKA 3H0PA 4DYOA 4N56A 1FDNA 4JI4J 3PHTA 3ZZUA 2B8PA 4OIDA 3NOGA 3SSSA 1FX4A 1VYAA 4H4OA 2DO0A 2F5IA 1S1XB 1W25A 3R5DA 4DFKA 3PB8X 2WOMA 5LYIA 2J8RA 3GIRA 3VATA 1L3TA 2RFHA 3KXDA 2QECA 4B3MJ 2X3GA 2VA3A 1R57A 4DR3J 3RYOA 2R7HA 2HNZB 3EGNA 4IFYB 3NS6A 4RO0A 3DLKB 2HZCA 4QYRA 4DFJA 4AUKA 1RT2A 2G0IA 4G6VB 4GO7X 2ADBA 3TJAA 3IU2A 3ZTPA 3UVJB 4X66J 2D4OA 3DU6A 2E1CA 1MROA 1XIQA 3AH6A 1N6QB 3SMZA 1HQUA 4CQ1A 2KH9A 2PMZD 4LR9A 4E8UA 3QJLA 5KG7A 1UETA 1U2RA 1M4LA 1SKUB 4B5PB 3H8EA 4NLXA 2UUBF 4DV5F 3RRHA 1M44A 3TZZA 4B3MF 3DGVA 1S99A 4OYPA 4ZLPA 1TQLA 3JTKA 1T05A 1JMTA 3OBIA 4LSLB 2U2FA 4KVOE 2RAQA 4J37A 4DCPB 1KVKA 1H38A 2ZUAA 2DR5A 4M94A 4WFXA 3KK2B 2PIZA 4USUA 4F2SA 3ZZOA 2GJFA 4CAEA 3SSRA 3W91A 1LK5A 2MZQA 3G6YA 5IT9Y 3U02A 3DLBA 2OH1A 3DXBA 4N7TA 2KFNA 1Z8WA 4FS2A 2GVDA 7FD1A 5IFMA 2DNNA 2DK2A 2RC4A 4ECYA 4MK9A 1PIEA 1FE0A 4P4DA 3OR2A 2M4MA 3Q8UA 3Q8VA 3R7NB 2XZTB 3Q8QB 2N3LA 2ZH4A 2YWEA 4ZVRB 3JAMU 5F41A 5BYRA 4ED4A 2Y9HA 2R2UA 4DXLA 5CYMA 2B4UA 3MTKA 1DURA 4JJXA 3PJWA 1D0EA 2HVDA 4LF9F 2DVIA 3V6KA 2YWHA 1EKRA 4R57A 2HWHA 1CLFA 1G1XA 1FCAA 2YWGA 5ETTA 2GJIA 3D2PA 4MHNA 2VPYB 1QSTA 4ZLNA 3R1LA 2B0GA 1PILA 5ETRA 3MAQA 3C19A 3K7RA 3ZZPA 2ZH1A 3Q24A 1SKRA 3SJFA 4B08A 3Q8SB 4NA1A 3BN7A 2PFDA 1Q8KA 2VG6A 4P7TA 4PG6A 3CCMS 4F02A 4PR6A 2ZHBA 1IVZA 1KUVA 2CQ3A 1YJWS 1LK7A 4NZ0A 4KOXA 1YLOA 3L95X 2JWNA 3HT0A 4ZS6A 1NK8A 1LANA 3KK1B 4P4IA 1NE9A 2JOQA 3E3XA 3F41A 4QW9A 1HQEA 2RQMA 5J1PA 3X3UA 1XJOA 2FLPA 2VI7A 1Y9KA 5GMEA 5DETA 2CKWA 1T05B 5J2MB 3CJ2A 1JNRB 1GTHA 4LFAF 1O5JA 3MRUA 2ZEEA 3CCVS 4FZVA 1RBAA 1RT1A 1WNEA 4ZVGA 1RGVA 2W2NP 4DV1F 2QYGA 1N32F 2F4FA 2ZDPA 3C6UB 5ETOA 2AEFA 4CGMA 4ZVFA 2B9YA 3NGUA 4MIWA 4DV7F 1JJ2R 3WDOA 4NCBA 1FFSB 3GCXP 1X8DA 5DQGA 4P2FA 1JLQA 4RBVA 4ZLJA 5EDWA 3V4IB 1IKWB 3ETMA 1A0OB 3W2VB 4WCEQ 2X51A 4CCHA 3UPFA 3F0AA 2NZ4A 4Y2AA 3BREA 1JWQA 4UF4A 4AVCA 4DR6J 4DL4A 3IS9A 2CQPA 3RG6A 3HVWA 1S60A 1VCTA 3GTYX 2ADCA 1UZHA 2LQ9A 3M8RA 3D4JA 3CD5A 5D77A 1NKBA 1Y9OA 2MZ1A 2JEJA 4U9ZA 3IGRA 3DDNA 3QYYA 4NGTA 5HMZA 4UUWA 3LD2A 1PAEX 1WK4A 1VOMA 5M2RA 5IB9A 2VG6B 1ZM9A 3MM6B 4CRJA 1WG5A 4DR6F 4TNUA 4TY8B 2XMKA 2JDJA 2ROEA 2F4VJ 3DOLA 3QJPA 4GC6A 4HEA9 4NGQA 3Q2SC 4B3RJ 1RABB 1X9MA 5F8MA 3SFUA 1PSDA 5J2NB 3KHXA 3GLJA 2PI5A 1VKCA 1XR6A 4YR3A 2PQ8A 4OC0A 2HV2A 1LXNA 4B9NA 1T11A 2DRBA 4Z37A 4FUUA 1F9FA 3LA0A 4O44A 4RW9A 4B10A 3NS7B 3CSKA 3C15B 3DDIA 4P4JA 4QW8A 4GKJJ 3LH2S 3OL7A 3RAMA 1PC5A 2P9CA 4QIGA 3PX4A 1RT1B 3GCWP 4UIAA 2AFSA 1N34F 2JHEA 5AG6A 4H4OB 5HI7A 3L7PA 4NI2A 4BC9A 4BC7A 1WI8A 5GMDA 2W9CB 4F4KA 2PMHA 3WC7A 4MCRA 5KT3A 1X4DA 2PCUA 5D8HB 3D1HA 2FVCA 2DGQA 2M3DA 3P2HA 3OTEA 2KU7A 3DRRA 3R95A 2QEXS 1Y00A 2OSQA 4PG4A 4WFAQ 3DFEA 2PDOA 2R8JA 5CYQB 2X7IA 2V8DA 2ZDOA 1MN7A 1QAYA 3CNQP 4CH1A 4MY3A 4OZNA 1UW4A 4AE5A 5KOXA 4A8FA 6AT1B 4MFJA 2HFZA 1NMTA 4ED5A 2AF6A 4FD5A 3TNVA 1N0VC 2DTJA 4DV0F 2XS7A 2VQFF 3CXQA 1ELMP 3T41A 2HBZB 2GU2A 2ZEGA 5KG1A 2ZEFA 1SC1B 1Q2CA 2E5JA 2F9DA 3MR6A 2NS1B 3U1NA 3KDOA 3IWNC 2AYMA 3Q8RB 1YJUA 3VWSA 3MM8B 2YNCA 1GMWD 2HHQA 1IKYA 1T9TA 3VARA 2W9BB 2NUUG 2J8SA 2CPDA 3CPAA 3IM9A 4MMOA 1JLEB 2ZITA 1CPZA 2FC9A 1ZO0A 3BI0A 3G8QA 7FDRA 3EC4A 1IWGA 1IR0A 3FEXB 3MZIA 2A0FB 4CYNA 4CNYA 4JI8J 2QC3A 2C6CA 3W62A 1TF8A 1KQGB 3I0RB 1SQGA 4MK8A 1Z1ZA 3FFIB 1SQHA 1OJ4A 5K5MA 3D6TB 4KHRA 4YP3A 3BDPA 1NXIA 4Y6IA 3SDEB 2CUYA 2FGOA 1UVIA 5E2QA 2B4DB 3P2FA 4FDFA 1ZZFA 1XMTA 2BSWA 5EN1A 4DX8H 1KONA 4NCAA 1KLMA 4QUSA 2PJ2A 1W2IA 1NK0A 3VZHA 3P45B 2HC9A 3AQPA 4A30A 2BACA 2MHNA 5B0EA 4WU3A 2VH7A 5CD4H 1YITS 1CBKA 1HWLA 2XYHB 3ISXA 2PIYA 1U25A 2FHJA 1HARA 2FZGB 1C1CA 1A7GE 1S59A 3MPVA 4C0OC 2CFXA 3CDWA 3KG1A 2ZW4A 3KKFA 2FUG9 1S49A 4RLEA 2OEJA 2KKHA 4NE9C 3MUMP 2CADA 2AD9A 1TUVA 1LRZA 2YNGB 3J81Y 2AGQA 3H8FA 1IICA 5JM6A 1SQFA 4F36A 2EG1A 3SBMA 1NCLA 2BJEA 4F0MA 1JLEA 1VQ5S 4URSA 1HQUB 4R7MA 3OLBA 1YSJA 3S7RA 3JS9A 2PJCA 3ISNC 2LU2A 4DUZF 4OQJA 2CTBA 4DS5A 3R7SB 2ZD1B 4X62J 3PYFA 2JEVA 3OW2R 1ZAVA 4KGKA 2M8HA 3U7JA 6CPAA 2GVDB 2ZJPQ 3MGDA 3SXNA 1HDQA 1RTJA 1RTHA 3CCUS 3Q86A 3H8GA 3DU5A 3HHLB 4X64J 4G1IA 2DNZA 3DRPA 4OHWA 1QSRA 3TZWA 4ELTA 3D7FA 4ALZA 5ETLA 3CJKA 5EWGA 1AYEA 2IYIA 3SQGA 2C2ZB 2XMTA 3TO6A 4PXBA 5BWAB 2UV8G 2EFPA 4ZP8A 1A9NB 4A2ZA 4XPEA 4JLYA 1WF0A 1FK9B 1JK9B 2YNHB 2PJ8A 4YOEA 2EK6A 3US5A 1LEOA 2B7BB 1VBKA 3FEYB 1EARA 5KFTA 3FDSA 1R8AA 3WC2A 5B0AA 4KB7A 3R3TA 4MHZA 1WHWA 1Q86T 2HAFA 4JI1J 2A1BA 3O6QA 2UP1A 4PKDB 2M52A 3D28A 3CJSA 2MZTA 4JWPA 4XNHC 1ELOA 2I1RA 5GMKa 1RDRA 4WZMA 1WD6A 4OZJA 3EXNA 1FXRA 3AJ1A 1WOPA 8AT1B 1VJQA 1SUQB 3K2YA 3UCZP 4E2AA 3KK1A 3NMAA 1KOHA 3DOMB 2ZBIA 2F3JA 1XMQJ 1UP1A 3R5BA 3FVLA 3C15A 1H2TZ 5G0RB 1CVJA 3B54A 3EGZA 4R0EA 5JXSA 3D3CJ 1FDBA 4B3RF 1T3NA 4IQMA 3KLFB 3LPYA 3M8PB 2HHTA 5FDLB 2C1EB 3BB5A 4NI2B 3SJXA 3PZJA 1VQ4S 5J8FA 4HHJA 4URQU 2ZEHA 3R1HA 3LWLA 4DSJA 2FCKA 3KOAA 1HNXJ 2CPIA 1DLOA 2Z2ZA 2ILZA 3OT9A 2DNYA 4CLWA 4ZA1A 3IA0A 4M3SA 3E8OA 3AFGA 2HFNA 1ITPA 3MOJB 2IIHA 2XI2A 1KDNA 4LQGA 4A95A 2HNYA 5DWNA 2C3MA 1Q0NA 3GP9A 3KQZA 1K0VA 2UU9J 3DLLQ 1S72S 3DXSX 1RTZA 1S1UA 2D9PA 8ATCB 1Q5VA 1J5OA 2KFZA 1U1KA 1I94J 2HHUA 2IMWP 4ZJQA 2N82B 3IAM9 3NWRA 4BMHA 2IAJB 1LAPA 3D3SA 2DRAA 1N0UA 2M8DB 1XNQJ 3PBBA 2RILA 4KIAA 3KMSA 1SXLA 3PFOA 1NSQA 3L7OA 2VQEJ 4H6UA 5F47A 2PMWA 3CC7S 2M5YA 1DRZA 4M5KA 3NY0A 1E6VA 2R8KA 2DEIA 2WCXA 5LSLA 5J8CA 2WUUA 3KNAA 1S1WB 2BJ9A 2RHQB 1BHNA 5DGAA 2ZH6A 4DV6F 1FJCA 5A27A 1RAGB 4MFBB 4CYUA 1V0CA 3GU0A 3GV8B 5A2QY 2DEJA 5AXKA 3KGQA 3PG9A 4KC5A 1HFEL 3ZTOA 4BDPA 2EKNA 3S01A 1D9AA 3HMJG 5HMXA 2Y1RI 3FQKA 2HS0A 3KKWA 4FAIA 4ZKAA 3NNAA 2HHHF 3A4TA 4Q43A 2GA7A 1U2FA 1CSJA 3C46A 5E0OA 2HHXA 2UZAA 5JQ4A 4B02A 2KXFA 3UI3A 2QJ3A 4A46A 2BJ7A 1FDAA 5E3QA 4P6QA 3FVYA 1U0HB 4U95A 4HNXB 2MSSA 3DHXA 2D41A 2IY5B 2G3AA 4KYZA 4AXVA 2H5JB 4HPSA 2G9OA 1JXEA 1UEVA 3KTQA 1S7NA 3BF4A 1L0CA 2PVWA 2FTRA 5KFBA 2DPTA 4ONUA 1IKVA 2NCKL 4V19X 1YZ6A 1RXTA 4CLLA 4NXNF 4DV5J 3L9ZA 4OYAA 5HMWA 2JJ4D 1XJWB 2GCFA 2R42A 1K1QA 3HJVA 1S77D 1HHTP 2ASLA 1IY7A 3TJ9A 1YVFA 2A2DA 5KT6A 2GQ2A 4ZX9A 4LRCA 2FVRA 2OO4A 4WK1A 3UDEA 2VFRA 2AQ4A 4NLQA 4J5OA 4OI4A 2V69A 1P4NA 1QSLA 3NAIA 1ZA2B 4TY9A 1F0XA 3PZPA 3VQTA 5GADI 4OV6A 4I7FB 2ZH8A 1RXOB 2XMUA 1PYTB 1ZS6A 5IS2A 3T1YF 4M5IA 4B9MA 1FD8A 2PR8A 2XHCA 3EXCX 4KGVB