3TX9A

Oye1 complexed with 2-(hydroxymethyl)-cyclopent-2-enone
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
molecule tags Oxidoreductase
source organism Saccharomyces pastorianus
publication title Studies of Enantioselectivity in OYE1
rcsb
total genus 156
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tx9A00
3QF0A 3PC0A 3SW6A 5FF4A 4UTIA 3EX4A 4MVAA 1GVRA 2CLFA 3W7OA 1GYLA 4GUHA 4XZ9A 3LTPA 2QDHA 1QPRA 4I7VA 4E0CA 3A24A 3GDMA 3MI3A 1W3TA 1ZY9A 1N55A 2XFWA 1I2RA 4NU7A 3PUDA 3VE9A 4E2BA 3QH2A 3W1TA 5K9CA 2NUXA 2WQPA 4I7UA 4Z08A 2ALDA 3O05A 3W1UA 2ZA3A 5HWMA 1XKYA 3KVMA 5DCDA 2J27A 3PY2A 1PIIA 2R8WA 1KV5A 3RF9A 4YCPA 3SI9A 4N9EA 2FIQA 1XCFA 2FLIA 3LERA 3N2MA 4DPQA 3UXDA 3BO9A 2FB3A 4RX0A 1ONRA 6TIMA 3DFPA 4UR7A 3LCIA 4QNWA 1THFD 5EPDA 5H2ZA 3I68A 4WJEA 4PL1A 1NF7A 4WUIA 1MZHA 2C1HA 5FEZA 4LNYA 4JIQA 1XL9A 3L21A 1EP1A 1AL7A 3W22A 3GYEA 1OVDA 3NQDA 1XM3A 1Q6LA 2DZTA 5DY2A 3L5AA 3T44A 2VFEA 2QUTA 2CU0A 4UFMA 2YGYA 5KMYA 3FEMA 3P84A 4O54A 2ATSA 3W88A 4AB4A 3SZ8A 4ZQCA 3W71A 4FNUA 1SO6A 2A4AA 1UB3A 2ZA1A 5D2VA 3MYOA 3SY5A 1FXQA 3O15A 3LBMA 1VGAA 3QZEA 1WAUA 3HBLA 3LHYA 4Y96A 3W2UA 1ZNNA 3WJXA 2HS8A 4HPXA 1K7XA 2NX1A 4UTJA 4AWSA 4S2CA 3W7PA 2VC6A 4MLRA 2E77A 3FJ6A 1FWWA 4UTLA 1TSIA 1KTBA 2VEIA 3OVQA 4I7WA 3DXIA 5KZMA 3DFOA 5FESA 4MFDA 3DHDA 3GX9A 5MHBA 5F4WA 5D2YA 5HQEA 1D3GA 3CWOX 3O6CA 4UXDA 4FNRA 3TAOA 3EWUA 2VEMA 3W2MA 4O13A 4W9TA 1RV8A 2J9YA 3NL3A 1V7YA 3G24A 5LNRA 1OX4A 2ZTKA 3SECA 3P5YA 4LVGA 3P82A 4DPPA 4L4LA 1LOLA 1R2TA 2I9EA 3THAA 5DELA 5HMSA 4FHAA 3B04A 4NJGA 3DGRA 3IVUA 4KFNA 4JS3A 1JQVA 3T4CA 1OFBA 4JDYA 5HNRA 2YR1A 4D2JA 2Y70A 4LW7A 4MY1A 4E38A 1H7WA 4O1BA 3B0UX 4N6FA 3BW2A 4XBSA 3WK2A 4ICNA 1TV8A 2C18A 4LS0A 4O52A 3TE9A 2DZUA 1R2SA 1TQJA 3LCWA 3UY8A 4DELA 4IMCA 4UTHA 1YADA 3ATZA 3L9CA 2ZZ1A 1TTJA 3TQKA 3O1NA 1DBTA 2EF9A 5D05A 1VRDA 4JTHA 4HIBA 4OT7A 4EIVA 3FFSA 1JUKA 1UBSA 3UPWA 4GUIA 3B05A 4H3DA 4NVTA 1GOXA 3A23A 2E5BA 3HIJA 4OBTA 3S42A 4UMBA 2VELA 3HF3A 2V2HA 1UCWA 4I9AA 2WNZA 3UWZA 2YYTA 3MJYA 4CLMA 1WXJA 3MP4A 1SU5A 3HG5A 1W0MA 1H62A 1FCUA 3GDKA 4JY9A 2EAWA 3W7JA 4XBKA 2Z2UA 4PODA 3P7YA 3NPVA 3HQ1A 3Q58A 1QCWA 1T8XA 3I7SA 1GTEA 3UZ5A 1JCXA 1M5WA 6ALDA 1FDJA 1K03A 2WKJA 1HG3A 1SW0A 4C1LA 2H3DA 1W56A 3NZ1A 4Z1CA 2VXNA 3VI2A 2X30A 4M7TA 2Q3OA 3I65A 2XN0A 1RQBA 1A5BA 5AFDA 1IXNA 1KM6A 2CZFA 1KFCA 2ZQ0A 4TMBA 3NQFA 2JKPA 4MFEA 3O8AA 4BI5A 5BW6A 1GT8A 3P81A 5EL1A 5AYXA 1KBJA 3U6WA 1CI1A 3G0UA 3GZ3A 1KFLA 3G1XA 3M5ZA 4OE7A 4IGHA 2YDAA 3PG9A 1VCGA 3M1ZA 3PAJA 3P61A 2ZRZA 4DF2A 3M47A 4JD4A 1XBVA 3S8HA 3KX6A 5C5YA 3SFKA 4DO6A 4HSNA 2EGZA 2GPTA 4ZQMA 3P62A 4MZYA 3WJZA 1EWEA 5IBXC 2A7PA 1T96A 4O14A 4A2RA 3P8JA 4FIQA 5FEPA 1RQHA 1OK4A 4LRTA 3W7NA 2LLEA 5IBXA 3IIVA 4LC6A 2W0UA 5L9FA 2J6XA 3B06A 5F4SA 2OCZA 4DO5A 2ZZ2A 2QUUA 2O7QA 1TPVA 3LLFA 3W6YA 3N19B 1JQXA 2NLIA 4DQWA 1F6KA 2YXGA 4AAJA 4E2DA 3S1VA 4O18A 4UCGA 3P5ZA 1TIMA 2Y7GA 3G22A 1WDWA 2HMCA 5I3JA 3CQ0A 1TMHA 1FDYA 4CQ9A 1SSGA 3RK8A 4JY8A 3F03K 1L2UA 1CW2A 1XFBA 3A5VA 1U5JA 1CX9A 1EWDA 2V5LA 4LV4A 3UWUA 1NEYA 2Y89A 2WOQA 2CZEA 4K6AA 2CLHA 3C56A 1H1ZA 3EKZA 5DCBA 3CLMA 1KM3A 3MMTA 4UTMA 3UYCA 1IXOA 2QJGA 4NNCA 2BSLA 3MI2A 1LYXA 2ATMA 3NQMA 3LXCA 5AC6A 3DU0A 4NJHA 1XBYA 4IXXA 1XBZA 1R47A 1QWGA 1FXPA 1H63A 5AC7A 1OFPA 1OFOA 4GUJA 3S1UA 2W6RA 5CSRA 2Y85A 3NL5A 3PB2A 3F4WA 1KTCA 1DKWA 1DOSA 1UASA 1H7RA 4XTDA 1R30A 3N9SA 3V1PA 2NV1A 4AEOA 4JTGA 3C4UA 1BKSA 2DZPA 3P74A 3LLDA 2VEKA 2ABBA 4LOCA 3W73A 4FNPA 5D2TA 2GVLA 3E49A 3PF3A 3USBA 2V5BA 4YCOA 4JTTA 5KZEA 2TPSA 2FPVA 1DL3A 3HOJA 3FKKA 3CIXA 3TMQA 4R53A 4CNPA 1TB3A 4JTEA 2WJZA 5C6MA 3TKFA 1J4EA 1YLVA 3P67A 1GVOA 1ME7A 3LTSA 2P1FA 3EWYA 5J5DA 1HFBA 4KFOA 4JTKA 5EY5A 1F05A 1O95A 3C2VA 2NXHA 1RD5A 4ONVA 3ATYA 2J24A 4UFIA 1K8YA 3W1PA 3QW3A 4DBEA 3VCRA 2QEZA 4TR9A 4AXKA 2OT1A 2YYUA 4FXRA 4A22A 3KVJA 4CCEA 4DEFA 3M6YA 1KLZA 5AYYA 4CQAA 1W8SA 3N34A 4DBDA 3BGJA 4JTSA 5H91A 2V2CA 5TIMA 4JTJA 3SJ3A 4OQVA 5AHLA 3TNOA 1F5ZA 1ZAJA 4FEZA 4K7YA 3EX1A 4LWWA 3BARA 3Q37A 2Q8ZA 3QSRA 4Z1AA 4NUWA 3THQA 1O5KA 4LS1A 1JCLA 3M43A 1GQNA 3W7DA 3MI6A 3TW6A 3ZR4A 1EP3A 2TMDA 2PRLA 4CNNA 2VFDA 2RDUA 3C0JA 1G4SA 2QDGA 3JS3A 4NJKA 2FTPA 1NF0A 4LUJA 4HKPA 2A2IA 1KW1A 5G2WA 4M19A 1AG1O 4NZJA 2ZZ5A 4TO8A 4RR4A 5L6UA 2NWSA 3W1NA 5EBUA 1C8VA 1W5OA 3MHFA 2C13A 2CLOA 3NQCA 4KFPA 2D73A 1G67A 4JTIA 8TIMA 3OVPA 3B4UA 1LRNA 1DV7A 1WBJA 4RLIA 3LI0A 2GVGA 3Q2DA 2YZRA 5DXYA 2GQ9A 3STEA 1OF8A 2ISWA 5DXXA 3UWWA 1W1ZA 3KFTA 1J5TA 3NVTA 3QPYA 4WD0A 3DFTA 5LKYA 3TROA 1XI3A 3TUUA 3W1LA 3DHFA 4PL2A 3TK7A 2ZRVA 4MY8A 4QJ1A 3MWAA 2YX0A 4K38A 4WXZA 3KVLA 5HR6A 3WJYA 1H1YA 2WSRA 3C8FA 1I45A 3W7HA 1QNVA 1H61A 1L6WA 3UNDA 1SO5A 4LVAA 4U28A 2OZ0A 3L68A 1FBAA 5CPOA 4K8EA 3UXAA 4XKYB 4POCA 3LHVA 1VYRA 4QITA 4JYEA 4TX9A 4JNMA 4EVZA 1N8FA 4UFJA 3EX6A 2CLLA 4HSOA 3LDVA 3O6DA 4NJJA 4AH7A 5LNUA 2E09A 3WK1A 4UTUA 4UC5A 1H51A 1F2JA 1RZMA 5CZ0A 3HG4A 3Q94A 2QKFA 4O4WA 2VFGA 2P10A 5CG7A 5D32A 3F4NA 4LY8A 2E6YA 2NXGA 3W2JA 4FXSA 4KWVA 3U2OA 1MO0A 4GUGA 2Y7FA 4M5PA 3GLCA 4K39A 1FWTA 2V82A 4H4IA 5BRBA 3KRUA 3QQ1A 3W70A 4BK9A 5HINA 2EKCA 1S5TA 5F2LA 1GTHA 3W72A 1IGSA 3TX9A 5F4XA 3H54A 1W5NA 3G1YA 4A29A 2HS6A 3GNDA 2BX7A 3NPUA 2C0AA 1KFEA 2KZHA 4O1CA 4BI6A 2EPHA 2YW3A 4FX6M 3IEBA 1PL9A 3NQVA 5I3GA 1LROA 3NL2A 3QMSA 3R2GA 1L6SA 4OU1A 1EPXA 5T26A 3F1QA 1P0NA 5A5WA 4DF1A 4N9BA 1LP6A 1I2OA 4U4MA 3I7RA 4N2YA 5D30A 2ZFAA 4ZQNA 3M5VA 4PFMA 1X1OA 3LI1A 2VFHA 2VKZG 4M6PA 5C2XA 1BWLA 4O50A 3T7VA 3G1AA 3T78A 1PS9A 4IPJA 1IXPA 3W87A 3S1XA 2A1YA 1H5YA 3PBWA 4S2BA 5TBOA 5ABTA 4O19A 3N3MA 3I7QA 4FNTA 4MZ1A 5GVJA 1OYAA 3CC1A 2FQIA 1AMKA 3TAKA 3TC6A 3DFSA 4JX6A 3HMJG 4RKAA 2P0OA 3SSJA 1TPEA 4FX8A 4LT9A 4RZ4A 2ZCGA 4XQ6A 3DI1A 1ZJIA 5AHFA 4WY0B 3ABSA 4WXYA 3DI0A 1T99A 2BZNA 2BLEA 1H7NA 2Z0IA 3OHIA 1G4EA 2DP3A 3NG3A 4GE8A 2ZRXA 3WK3A 5FF0A 3C6CA 3VNDA 2V2DA 1B4EA 2GOUA 2NX3A 1OABA 1F76A 1QOPA 3NZRA 2NUYA 3S5ZA 1ZCOA 4O0ZA 2DJLA 3TXZA 1ALDA 1LCOA 1X6UA 3W7IA 1OYCA 1H50A 1DHPA 2AQWA 4O1AA 1C9DA 5DY3A 3TCEA 3PBUA 3EWWA 3HJZA 3D0CA 2JBMA 3W7KA 4HN4A 2TSYA 3GIYA 2A21A 3LHTA 1P1XA 4IUOA 2JKAA 3NPXA 3STFA 2WSQA 2YCEA 3KOFA 1W3NA 4KWWA 4ZMGA 4UNLA 1M7PA 2RFGA 2X1RA 3NYZA 2CLIA 5KITA 3PB0A 2QAFA 4M6QA 1VCVA 1XBXA 3BLFA 1ZAHA 4GRSA 1QOQA 1I2NA 3EKLA 1KM5A 2Y61A 4UMCA 2G5WA 4CCCA 3LHUA 2VFFA 3CU2A 1X8FA 1AL8A 3BW3A 3LCGA 1KM0A 2YFOA 4JIPA 3FJLA 5DCEA 1HO1A 1VS1A 2FPTA 1YTDA 3FLUA 4UTTC 1TJRA 1VHNA 1TQXA 2A6NA 3W84A 2J88A 3W75A 3QW4B 4RK8A 1ZFJA 4XWUA 4MJZA 3DFNA 3C2FA 2YSWA 4HHPA 1JULA 1KLYA 3W7CA 4P2VA 2NWRA 3HGOA 4EWND 5FEWA 1PVNA 3A9IA 4NX5A 4PCFA 1J2WA 1W5QA 3MW7A 4JN6A 4CCDA 2X1SA 4QISA 1ME8A 4G1KA 2DU2A 3CIWA 1FWSA 4IPIA 1FUYA 3N2XA 4K36A 2B7NA 3CWNA 4WOZA 1TREA 3H55A 4C1KA 3ZWSA 3R12A 1TPDA 3VKJA 3GKFA 4WX2A 3B0VC 2Z6IA 3K30A 4ALDA 1GZGA 5FI8A 4HNVA 4UFLA 4IOTA 4ZQPA 2OT0A 3NL6A 5HJLA 1TTPA 4K8HA 3G1FA 4GJ1A 4UFHA 1RVGA 1TRIA 5FF7A 4HPJA 4Z0SA 4IMEA 5I3IA 2OX1A 1W31A 2QJHA 3HB9A 1LORA 3BG3A 3JRKA 2QR6A 1TRDA 3NR0A 1YXCA 2DJXA 2PE4A 4FO4A 4NT0A 5K7JA 1KFKA 4GNJA 3NOEA 2WV8A 4BI7A 4LC8A 1L9WA 3L5LA 1JUBA 1LLZA 3VFLA 2ISSA 2RDWA 3E02A 1GYNA 1Z44A 2BTMA 3LOTA 5HUPA 5F1UA 1HUVA 5KZDA 1OJXA 2UV8G 1RPXA 2F84A 1OX6A 3GNNA 3EXSA 1OFQA 3LX9A 2ZBTA 3GR7A 2I1OA 4JDBA 1O60A 1PE1A 1XXXA 4IXHA 1JRCA 1QFEA 2FB2A 1VPXA 4A21A 1UJPA 3QSTA 1ICPA 1GG0A 3PM6A 4NX0A 1BWKA 3WFAA 3C3NA 2ZTJA 4JYFA 5AOUA 5BMWA 3E12A 3LV6A 2A85A 3I6RA 4GWEA 4H6KA 2PC4A 4ADUA 3HGJA 4IMFA 1PV8A 1YDOA 3UQNA 3INPA 4EOUA 3U8GA 1WOBA 4ADTA 5K9DA 1OX4B 3LBCA 1SZNA 4QAIA 4WZHA 4MY9A 4Y8FA 2R14A 2OMAA 5I3HA 3R8RA 2QCDA 4LS2A 4Y9AA 3OBKA 4ZL1A 4NNBA 5LGXA 3N73A 4N4PA 2AAMA 3LHWA 3R5EA 4LVDA 2ZZ7A 3MBFA 1I8JA 1WX0A 4A2SA 2C16A 3G1HA 4IWWA 1MEIA 1SZFA 3GDRA 4IJBA 3NQ7A 1H7OA 3LXAA 4WQ6A 1YPFA 3NNTA 4BFAA 3DENA 2GVJA 1ICSA 4O8RA 3NPWA 3EB2A 4YWIA 5CPMA 1H7XA 2PRMA 1QMLA 2QCFA 4O4VA 5CPLA 3LM7A 3S0CA 4R34A 1IIGA 1EUAA 2CLKA 4B5NA 4PH6A 3B03A 3ZS4A 4HNNA 5LZLA 5HR7A 2A0NA 1QDSA 2CZ5A 2FDSA 4EF9A 1TPFA 3A5FA 3EXRA 1TV5A 3NQ6A 4O28A 1LTDA 3OIXA 3EX2A 1F73A 2Y63A 4L4MA 1U83A 2J9XA 2R91A 5G5IA 2QUVA 2YPIA 5K4XA 1KFBA 3NAVA 4TMCA 4QQ3A 3UWYA 3M9YA 5AC8A 3MHUA 3W1QA 3OG3A 3IIPA 1A5CA 1TPUA 1K7EA 3G8RA 3NA8A 2X16A 3HGSA 3C52A 3LCFA 3M5YA 4O57A 4UFKA 5CGQA 5C55A 5D37A 3PBVA 1DQXA 3HO8A 1TYGA 1EEPA 1RR2A 3E0IA 3TJXA 2ZZ6A 4IMGA 1YYAA 3B8DA 2DZSA 2NV2A 2E5CA 4PC8A 2QJIA 1HO4A 4NZFA 3QMRA 4JEQA 3TFCA 1DJNA 3G3DA 2ZZ4A 3TR2A 3KHJA 3W3OA 4X2RA 4NXKA 3TSDA 3CB8A 4R7JA 1JCMP 3GDTA 4WY0A 3GK0A 1Z48A 4OHQA 1G6CA 1YXDA 4RZ6A 1TTQA 3UWQA 4YLWA 5DLCA 1FY6A 4OV4A 3MO7A 2JGQA 4GC4A 1LRTA 1VZWA 3L0NA 4AHOA 3S6DA 1W5MA 4Z0JA 1KBIA 4UMAA 3TU9A 1G69A 5E93A 1JRBA 3CHVA 1Y0EA 3TFXA 3RFAA 4Y6GA 4LVFA 3GAKA 1MSSA 4MJMA 3FYPA 4AF0A 1SUXA 1LDCA 1G4TA 2ZRYA 2O7SA 2HSAA 3BG5A 3HPXA 5SWUA 1JR1A 2Y7EA 1XUUA 2WNQA 1GVSA 1EA0A 3P80A 3NQGA 2C3ZA 3BK0A 5G1YA 1GWJA 5F2GA 1BTMA 4HNUA 3GKAA 1VYSX 4YL2A 2OJPA 3IGXA 3KAOA 1ZAIA 1B57A 3W2NA 1TTIA 1JCYA 2FFCA 3FKRA 1P5BA 5D2XA 5HUOA 1LBLA 4J9JA 1R2RA 2A5HA 5LNWA 3TQVA 3W1RA 1OF6A 1VH7A 5D04C 5BOOA 5HULA 1OFAA 4UTTA 2FJKA 2ISVA 3PR2A 4OV9A 1L6YA 1Q6OA 2DORA 2GJLA 5BNKA 3L66A 4LUIA 3FS2A 3A21A 1SFLA 2Q8LA 2QAPA 5AHNA 3QM3A 2ZDRA 5AHMA 4MOZA 3NO5A 2GUUA 1G4PA 3OA3A 3HPZA 5FF3A 3AJXA 3QQ0A 4QM1A 1P0KA 3QFEA 5A8GA 4PEKA 3W7QA 3QRHA 3LCLA 4KKXA 1QPOA 3DZ1A 3S9YA 2ZYFA 1UUOA 3S5NA 2E1DA 3W1XA 2NX9A 2TRSA 3CEPA 4UNKA 3W7MA 1FWNA 1IIHA 3C2RA 1F6PA 2C15A 3NM3A 4MYAA 3L5MA 2QCNA 1SW7A 1XC4A 1KTNA 4MIMA 3RU6A 5AHIA 1QO5A 4XKYA 3W83A 4XUGA 1VR6A 1LLWA 1O5XA 4O0KA 4DO4A 1SO4A 1JCNA 3G18A 3KRZA 4JICA 3T55A 3ZWTA 4R33A 1EB3A 3EXTA 2B4GA 2E6DA 1NFBA 2B7QA 3TC7A 5LHFA 5K4ZA 5D33A 4K37A 1RQEA 5CZSA 5LGZA 3TW7A 4AF0B 3MBDA 3P8IA 3GXTA 4X3ZA 1QO2A 5K9XA 1HTIA 2FPYA 2V8ZA 3VE7A 3CEUA 2TYSA 1LBMA 1R46A 1SFJA 3O16A 3WK0A 4BWLC 4UTWC 3W85A 1YDVA 3TSMA 1GVFA 2Y6ZA 1FWRA 4IMDA 4GXMA 4MUZA 1A5AA 5E0KA 4RZ5A 4HNTA 1QPQA 5LHEA 2DZXA 2DZWA 5DBUA 4RCXA 4QNEA 1DJQA 2E6FA 5EA9A 3WJSA 2E6AA 3NM1A 4ORIA 1OFEA 2RDTA 3O06A 3OVRA 3W2KA 1WYIA 1TJPA 4UIOA 4O10A 1LRQA 1K8XA 1A5SA 3FA5A 4A3UA 4LV9A 5C54A 2X1TA 3MP5A 4TIMA 4NNAA 1IXQA 3DKLA 3CPRA 2PCQA 3KVKA 4EF8A 3MHGA 4M7SA 4CQ8A 4PTNA 4LU0A 3E9AA 2G96A 2C19A 3NGJA 1XUZA 2X2GA 4NXSA 3A22A 3W76A 2V0TA 5CKSA 1ICQA 4BR1A 4O17A 5J5RA 4Q4KA 1JJKA 1YDNA 1Z41A 2B0MA 1BEUA 3TXVA 4FNSA 5F1VA 3CTLA 3KRSA 3W86A 1OK6A 3ZFHA 3DBPA 2GJNA 3W1AA 3TJLA 1EIXA 3B0PA 5G4WA 2DZVA 1PHWA 1FCQA 1W54A 2I14A 3TDFA 3PUOA 2CFFA 1GEQA 5D09A 3UY7A 3LTYA 2WPBA 1OX5A 3PS7A 4MLJA 4UR8A 3LV5A 2ABAA 4AWTA 1B3OA 3PVFA 1VC4A 4QSHA 2CZDA 3ABRA 4N9DA 3R89A 1OFDA 3QMTA 2ZRWA 3IVSA 5CPNA 4ZQOA 3RNDA 4BF9A 4O53A 3QYQA 4XTIA 1TPWA 3G1DA 3KXQA 1ZENA 1S3HA 3DAQA 4WOQA 3IGSA 4P61A 1VHCA 1AK5A 1W3IA 1FX6A 3EWBX 4ZVJA 5G2IA 1JVNA 4JR5A 3C2EA 1MEWA 3BLEA 4LTSA 1TCDA 3AO0A 3M16A 1WOAA 2QCDB 3GXPA 4DF0A 3M44A 3RLVA 3GXNA 4ORMA 2VENA 2Z6JA 3FYOA 2CW6A 2Y62A 1FCVA 4JTUA 2B7OA 1QPNA 5TQLA 1MXSA 1S5WA 3QJAA 5BMXA 1F7BA 4OGZA 4RXFA 4JTFA 3IRDA 5K2ZA 1VLWA 1TPB1 3PBYA 4RV8A 2WO5A 2WSYA 5CZTA 4N02A 2E68A 5LSMA 1F74A 5FF2A 3M7WA 4JYDA 3HGRA 3LXBA 4ADSA 1I4NA 1EUNA 1FDZA 5G4EA 4X22A 1SW3A 4JGDA 1AW1A 4N6EA 3W74A 1O94A 1SR9A 1PCWA 3QC3A 1DQWA 1SO3A 4Y90A 3MYPA 1FQ0A 2JKEA 1X1ZA 3L67A 4GBUA 4FF7A 2B7PA 4ZZ9A 1JCJA 3TSBA 3O63A 1KFJA 4JXCA 1K7FA 2YW4A 2GQAA 4O1DA 3W7EA 1Q3NA 1P4CA 4IX2A 3SGZA 3G8EA 5CZJA 1KV8A 3TA6A 2Y88A 1SPQA 3GVGA 2HTMA 3H53A 3WJWA 3SR7A 3NQAA 2V30A 1G7VA 3NQ2A 4GUFA 4MKNA 1TPH1 1D3HA 3BLIA 1WV2A 3JR2A 2RKXA 5DBTA 1H7PA 1YPIA 1ME9A 2ZA2A 3STGA 2XN2A 3L0GA 1N7KA 1LOSA 4GFSA 1K02A 1QR7A 2Q3RA 1QAPA 2NZLA 3TQ0A 1S5VA 4MYXA 1A53A 3BW4A 1V5XA 4S1FA 1PCKA 3ANYA 3SIZA 4NJIA 3OEXA 4AHPA 4MZ8A 2JK2A 3BG9A 2F7FA 3PG8A 5EMUA 1MEHA 1Q6RA 4TU1A 3C2OA 1W37A 1PHQA 1EX5A 1D9EA 3EX3A 3LRKA 1GVQA 2ZZ3A 5F2IA 4RJEA 5LNVA 4UUIA 1KM1A 4AWUA 1NAL1 3EWZA 4X9SA 4JX4A 3RMJA 3W9ZA 4NQ1A 5D2WA 5D38A 1OG0A 1VLIA 3MP3A 4BWLA 1G7UA 3L65A 3FOKA 3MUXA 1TO3A 2JGYA 4Q32A 4O15A 1Q45A 1H60A 2J9ZA 1ADOA 3UD6A 3T40A 5G2HA 4AHQA 1ZHAA 2X1UA 2CLMA 3TMLA 3EWXA 1LM1A 3IIXA 3LRMA 3LCXA 3UZJA 2XN1A 3NEVA 3W07A 4YMZA 5E1QA 5KTLA 4Q33A 3G0XA 1HL2A 3HPSA 2VOMA 3IGUA 2H6RA 4JX5A 1SZGA 2NXIA 4O16A 1GPWA 5EYWA 3RLUA 4K7VA 5LNSA 3CM4A 3TH6A 3ABQA 2A6LA 1T0OA 2Y7DA 3CT7A 3LB0A 1SQ7A 4PA8A 1DORA 3DKJA 4OWGA 3GDLA 1AW5A 3IVTA 5AN7A 1SZEA 2VFIA 4JTLA 1E51A 3O07A 5U7SA 1VCFA 5KSWA 1B9BA 2C14A 2BWGA 4Z1BA 2W79A 1GJPA 1NVMA 2EHHA 4AMAA 5KINA 3ELFA 1WQ5A 5U4NA 1KM4A 4O12A 3DH7A 4HT3A 5D02A 3HG3A 1SSDA 1LBFA 2PURA 5K3VA 3L2IA 5I3KA 3SGUA 1Q6QA 1A50A 3LGEA 1W5PA 3BPWA 3LRLA 3S5OA 1XDMA 2QCHA 4IX0A 4ZQRA 2G97A 5EKYA 3FIGA 3R13A 3ABOA 3S1WA 2BXVA 1EP2A 3W23A 3P60A 1VJIA 4IQLA 3V75A 2H8XA 2H8ZA 4AVFA 3NQ8A 2QCGA 4FIRA 3NQEA 4O11A 4CNOA 3PWAA 1LOQA 2H90A 2QCEA 1K3UA 4DXVA 1I2QA 5G1TA 3W2LA 3PULA 3GB6A 3STCA 1K8ZA 2A7RA 3EEGA 3W7LA 3W7RA 3M0ZA 1FCBA 2GQ8A 3TIMA 1VQTA 2QCLA 3LHZA 2NUWA 2R94A 3IV3A 5HWNA 3E96A 1M7OA 1AW2A 2QF7A 3LCHA 1WBHA 3UPBA 3NDOA 5DN1A 4FX7A 3UWVA 3S5YA 2RH9A 4YXGA 1TPC1 7TIMA 2IQTA 2QCCA 3BV4A 1UUMA 3YPIA 1OFRA 4ML9A 2G95A 2CWNA 3G1VA 4MPQA 5AHEA 5FEXA 3N9RA 4UTWA 5CSSA 1KA9F 1O4UA 5AB3A 1YTEA 3BVJA 1YXYA 3IIZA 3NXFA 4FB7A 2YFNA 4FNQA 1TV7A 4M6VA 2WNNA 4LVBA 2Z1BA 3TV8A 2V81A 3M5XA 1LZOA 1WA3A 5I3FA 3PSVA 5D03A 1ML1A 3G1SA 3BGGA 3G3MA 3QPZA 2E5DA 1M6JA 4QIUA 1OYBA 3PSWA 4WY0F 1VYPX 3DFQA 1YTKA 1C29A 1NSJA 2RHGA 4RXGA 5AYZA 2A7NA 2AGKA 4N9CA 3PUEA 2V9DA 3GR8A 2CLEA 4Z1DA 1DVJA 1Z42A 1X7FA 2ZRUA 3HG2A 3QEZA 1ZALA 3W7GA 1I2PA 3W1MA 1IF2A 2PRHA 1OHLA 2QCMA 3G0SA 5IM51 4UTKA 4LRSA 5HWJA 3M41A 3O6YX 3N14A 2VEPA 2C6QA 3L0KA 1XDLA 1B4KA 1JUEA 3IIOA 5F2MA 1KM2A 3GAYA 3C61A 1GG1A 2H3BA 4N4QA
chains in the Genus database with same CATH superfamily
5REQA 3EX4A 2CLFA 4D6DA 1LWJA 4GUHA 3OPSA 4XZ9A 3RJXA 2UWFA 2PB1A 4RDVA 2WPGA 4I7VA 1UR0A 4E4UA 2V67A 4QJ3B 1KRCC 1HKWA 3KS6A 4OIFA 5JIWA 1H2JA 5FCZA 4Z08A 2ALDA 4Y9NA 4L65A 3V7PA 3QY8A 5DQPA 2D20A 1FHUA 4FK9A 3HQPA 2J27A 2WMIB 2WANA 2WMFA 4N9EA 3EPMA 4DPQA 2DZAA 1I60A 4RX0A 3CO8A 6TIMA 4OUIA 3DFPA 4UR7A 3WQPA 1HJSA 3I68A 2WVUA 2PDQA 3U2CA 1JNDA 4WRHA 5ABEA 3RR4A 3GYEA 4PULA 1OVDA 3NQDA 4RNIA 2WC7A 2DZTA 1X39A 3W37A 2AGTA 3L5AA 5LA1A 3T44A 1Q5MA 2WLZA 3EOOA 3L2LA 5MKGA 2CERA 4REQA 1POKA 4O54A 1GQKA 1OCJA 4AB4A 4ZQCA 2VZUA 2A3BA 3AOFA 2X40A 4CCZA 1PZ1A 4D6IA 5C71A 3S2LA 3MYOA 3LBMA 1VGAA 3LN3A 3W2UA 3DOPA 3G1RA 3CL7A 3W53A 3W7PA 1IR2A 4UTLA 1CNVA 1B3YA 3MANA 4RUBA 5KZMA 1OCBA 3QPEA 4MFDA 4FLOA 5F4WA 4IL0A 5HATA 4ZOAA 3RRAA 3KWXA 2VEMA 4FLSA 3AXIA 4Y2WA 4BQ3A 5LNRA 4HZ6A 3S46A 3P82A 4L4LA 4Y7EA 1L6GA 1LOLA 3T09A 2I9EA 1MQQA 1XV8A 4B3ZA 1WDSA 3HQNA 1J01A 1B5TA 3EOSA 3B9DA 3UETA 2WBGA 3OP2A 5HJYA 3DECA 2YR1A 1O68A 4MY1A 2QW5A 4PN2A 5LA0A 1ENUA 4E38A 4PRTA 1A3XA 4NG3A 3SCOA 4O1BA 3RILA 3WK2A 1UH2A 2BHZA 3TE9A 4S3DA 4AQLA 1TQJA 3BLOA 3P0WA 3UY8A 1JZ4A 4IMCA 1TTJA 3TQKA 1KR0A 3O1NA 1DBTA 4QDWA 3SY8A 2YZ5A 2EF9A 3PPFA 3V4BA 1W1A1 4EIVA 3V5FA 2XFFA 1UBSA 3IJDA 1E0UA 3B05A 3BICA 3LZ5A 1JEZA 1GOXA 2E5BA 1XD1A 1W3JA 4I9AA 3DFYA 4QG8A 5I2UA 1QI5A 4CLMA 1WXJA 1W0MA 5T91A 3VX0A 1FCUA 3ARQA 3VUSA 3W7JA 2Z2UA 3ARTA 4PODA 3P7YA 1FWDC 4GA8A 3HQ1A 4LSBA 1QCWA 4IG2A 3CZ8A 8A3HA 4ZGYA 6ALDA 1FDJA 1SW0A 1DPMA 1BVWA 2FH6A 4Z1CA 3WNMA 2Q3OA 2XN0A 3MSRA 4TOQA 3QGKC 2XZ7A 3N9KA 2CZFA 3D6NA 1J0IA 3FW6A 4PMNA 1KFCA 4TMBA 4HHMA 1DEDA 2JKPA 4YVXA 4MFEA 4DXXA 5BW6A 1GT8A 5EL1A 5AYXA 3G5EA 1KFLA 3M5ZA 5BXPA 4ZO8A 2RJHA 1GZ1A 3M1ZA 3NZQA 4CUCA 3M0JA 2ISDA 4PTDA 4U33A 3ARZA 1K8CA 5CAKA 2EGZA 2PODA 2WNWA 4GY0A 5GQBA 2A7PA 3M64A 3P8JA 9XIAA 2Z26A 1E71M 5JBEA 1R8LA 3V35A 3EA2A 3N12A 3LQGA 1Z9AA 2BVYA 3B8SA 1MRQA 4IM4A 4JHMA 4DO5A 2D1ZA 1AJ0A 1XYBA 3W6YA 2X0YA 4DQWA 1F6KA 1FP9A 4H8UA 2TAAA 6XIAA 1A3HA 2YKKA 4ASTA 4O18A 4UCGA 3UG5A 2PTDA 4H6RA 4PTVA 3ZT6A 3SCUA 2HMCA 3AMGA 5I3JA 3UXKA 3UJSA 3CQ0A 1SSGA 3ONBA 5DMLA 2YB1A 4JY8A 1X96A 3NVDA 2FZBA 5C0QA 1CX9A 1R7OA 1EWDA 3UR7A 4ZOCA 4GVHA 4WDUA 1OQFA 2CZEA 4K6AA 5EMKA 3EKZA 5CGMA 5DCBA 4UTMA 1SM9A 3UYCA 1HP4A 2QUNA 2BSLA 4MSSA 3MI2A 1W2VA 1UWAA 2ATMA 3LXCA 1TIWA 1O1ZA 4XZBA 4IXXA 3QN3A 2BVDA 3FJ4A 1XQLA 1VFSA 3TLLA 3AAMA 1BKHA 1XG4A 4RPPA 3TNBA 4DUXA 1OFPA 4YVPA 1JDAA 1QHZA 2W6RA 5CSRA 4UWMA 3H2MA 1OD8A 4DBUA 1HJUA 1JAKA 3PN8A 4AEOA 2QPXA 4ZE5A 3C4UA 3ISIX 5CGTA 1RJPA 3LK6A 4B9ZA 1MFUA 5J04A 3CHCA 2PUZA 1SGJA 4FNPA 5D2TA 3IUDA 4JTTA 4H2CA 1DL3A 4X2PA 4AZ6A 4HCDA 3BMVA 4HSHA 2XVGA 4CNPA 3TTSA 2HDJA 2W66A 1OC6A 2R24A 1QNSA 1DXFA 2PD9A 3U7BA 1JDEA 3SURA 3EWYA 1H1NA 5I78A 2QPSA 5E70A 5EY5A 3C2VA 1UKTA 2P5NA 4ONVA 3ATYA 1VFTA 3TTOA 3N2BA 4Q4PA 3WQ4A 4EXAA 3VCRA 5CC3A 1Q7QA 2OEJA 3KVJA 4D6FA 3NDYA 5AYYA 3B40A 4CQAA 2PDUA 2ZWYA 4H6QA 5FJRA 4LAUA 3L4WA 1DTNA 3I6EA 4E8DA 4GYKA 3QR1A 3BARA 5I5RA 1Q13A 2ZX9A 4NUWA 1TMQA 1F9CA 1O5KA 3T08A 5EMYA 3W7DA 4M1RA 4IUGA 3A3HA 3WO8A 5G4HC 1EGZA 2WXDM 2VFDA 2RDUA 2WM1A 1V4YA 3WBWA 1G4SA 4JKKA 4D6HA 1PKYA 2ACRA 3JS3A 1ITQA 1NF0A 4AD1A 5G2WA 4M19A 3AHZA 2H9AA 1PDYA 2ZZ5A 3RX2A 4XAZA 4IHCA 1C8VA 3SCRA 4MWAC 1YKWA 4Y8EA 1W5OA 1G9HA 2D73A 1G67A 3B4UA 4JL2A 3S47A 1UYQA 3GBDA 4QE5A 2VD9A 2DW6A 1AODA 3DYMA 2XHYA 3T81A 2GQ9A 4WVXA 3ITLA 4FLQA 4OBSA 3TUUA 1T5AA 4PL2A 3KBWA 3F4DA 4QJ1A 5CSYA 4RNFA 2R82A 3BAJA 2QJMA 3E1F1 3UJEA 4WXZA 4F66A 1FKWA 1DWJM 3PUGA 1H1YA 4F0SA 4AU0A 3AIUA 4J35A 3C8FA 3W7HA 2BGSA 1QNVA 3OLGA 5E0CA 2PAJA 4U28A 2ESCA 3L68A 5CPOA 4NF7A 4XKYB 5G1MA 3N1AA 4PMXA 1HX0A 5H8MA 2IPFA 1IT7A 3KDOA 1MW2A 3O6DA 2QQ6A 1Q6GA 3WK1A 1F2JA 5CZ0A 3HG4A 4H9ZA 2GJRA 2P10A 4RDWA 3C0LA 3CAWA 2EO7A 3CZEA 4K39A 1Q63A 5BRBA 3KRUA 5HINA 4IIFA 1VD6A 3QVQA 2CETA 3EMQA 1W1B1 2QIWA 2XIMA 1TCMA 3CQIA 2BFGA 3H54A 1W5NA 3SGGA 4A29A 2FMOA 2PDCA 5C9XA 3GNDA 2BX7A 5IDZA 4O1EA 3NPUA 3Q45A 4R27A 2O9RA 2KZHA 3S9ZA 1JL8A 1KXHA 1OCNA 3TC3A 3OZPA 3NL2A 1L6SA 1EPXA 3IAQA 5T26A 3F1QA 5A5WA 4DF1A 5A8NA 1LP6A 1I2OA 1WZMA 3CUIA 1V77A 4W5ZA 5D30A 4ZQNA 3QV9A 4PFMA 2BY1A 2W3ZA 3GC5A 1BWLA 3ITGA 3G1AA 4IPJA 4AVNA 4C6QA 1IXPA 4A8NA 3S1XA 5ABTA 4S2BA 1D2KA 2HQAA 4JTAA 3N3MA 5HNTA 1KWKA 1J0KA 1AMKA 1V08A 4GFIA 5BROA 3TAKA 3VINA 3TC6A 4JX6A 2ZC1A 4RKAA 3SSJA 1TPEA 4FX8A 1HL9A 4H2HA 4LT9A 2ZCGA 4XQ6A 4CQDA 1ZJIA 4GX8A 2EKGA 2YLAA 2BZNA 3LPOA 3GTFA 4HZ7A 2ZX8A 3N6HA 4DUWA 1RALA 2WMGA 3R0DA 2GOUA 1NDYA 1W8GA 2NX3A 2ZKMX 4DUVA 1QOPA 1XLEA 4O0ZA 4PUEA 3LZ3A 1LCOA 2OR2A 4Y9MA 1OYCA 4UNIA 1UKPA 3BUVA 2QS8A 4ZOBA 3WD1A 1Z32X 3WQ8A 3EWWA 2O9OA 4KIEA 3GIYA 4IUOA 4TXEA 3ZR6A 4NRSA 2PDPA 3STFA 4AMCA 4E8GA 1W3NA 3H2FA 4FOJA 4ZFMA 2RFGA 3NYZA 4PFHA 1NOWA 3BC9A 4F79A 1XBXA 3KRBA 4GRSA 4HK7A 4INFA 3EKLA 2G5WA 4L80A 3CK5A 3BW3A 2V5JA 4JIPA 2QMJA 3FA4A 1RLDA 1VS1A 3LMZA 4PBGA 1RVKA 1DQUA 4XD4A 3URNA 4GOAA 1XD0A 3PJWA 2CXEA 2EPOA 3QW4B 1ITCA 4RK8A 1BQGA 3AJ7A 2G3FA 4XBJA 4KEMA 1LWHA 2W91A 2NWRA 4G7EA 3VUPA 2ZX5A 2XIBA 3BLLA 3CPGA 1W5QA 2XU2A 2X0SA 3ITTA 1CTNA 4Z2JA 5E0FA 2XJ7A 1AZ2A 1NWTA 3CIWA 4IPIA 2WWDA 1HKIA 1Z69A 2B7NA 4ES4A 2INFA 4WOZA 3QXBA 3F2DA 3A6OA 1AH3A 3UCCA 3TYUA 1R3VA 4WX2A 3K30A 4M29A 5FI8A 1BWVA 1US0A 5I77A 4I6KA 3MKCA 2PS2A 4GJ1A 1FRBA 5FF7A 5IDIA 1MW3A 1XYMA 4IMEA 4Z0SA 1M01A 2GDUA 4LAMA 1W9DM 4PE8A 1GW9A 2DJXA 4FO4A 4AIEA 1HKVA 5K7JA 2XIIA 3HPFA 3ORWA 4C1NB 3TVAA 4LB4A 3NOEA 4XSMA 2J6VA 2WV8A 1LLZA 2Y2WA 4PRWA 3VFLA 2FTWA 1NDZA 1H0GA 3E2VA 3PFMA 4R85A 2AOSA 2WK2A 5KZDA 3QGAC 1OJXA 1VF8A 3GNNA 3LX9A 4TV5A 3R1ZA 4GMEA 1E3XA 1PE1A 4IXHA 4W89A 4E8CA 1QFEA 2OB3A 3VX1A 4A21A 3WQGA 1GG0A 4NX0A 1MXDA 1MNZA 5AOUA 4ZENA 3LV6A 2BVTA 1W1YA 2BS9A 3I6RA 4G7FA 4GWEA 2PC4A 1O5RA 1PV8A 2BXZA 1XQKA 4EOUA 1WOBA 1VIWA 1OX4B 4Y8FA 1BYCA 3FV9A 1TWIA 4W8AA 2R14A 2OMAA 1IV8A 3WD3A 4NNBA 3BAXA 1WKYA 4LVDA 4FSAA 2I16A 2ZZ7A 1IZKA 2GK1A 1UJQA 2C16A 3GDRA 3EDFA 3EBVA 3WQEA 3LXAA 1DTUA 4N7QA 3NNTA 4XO6A 3ZZ1A 3N3TA 3SSZA 2PU0A 4JIIX 1H7XA 1LWIA 2QCFA 4GNVA 4O4VA 4R34A 4QRNA 3UZXA 1J79A 1F3XA 3GIPA 3ABXA 2YDRA 1W9BM 2IW0A 3NQ6A 4O28A 3EX2A 4LB3A 4L4MA 1UR3M 3APTA 1E9ZB 5G5IA 5K4XA 1KFBA 3NAVA 3RU8X 4TMCA 1NWUA 1XR2A 3M9YA 7XIMA 3LNPA 3W02A 4GQRA 4KH2A 1POJA 4KCWA 1UH3A 3MCNA 3G8RA 2X16A 1BFNA 3WCZA 5CGQA 5C55A 1R3QA 5D37A 2Y5EA 1FWAC 2HE8A 3HO8A 1TZ9A 3E0IA 1ZJHA 3TJXA 2ZZ6A 1SJBA 5DT5A 1YYAA 3B8DA 3MUIA 1R9XA 4DWSA 1DYSA 2QJIA 2J13A 1HO4A 4LAZA 4JQ1A 4Q8OA 1E3ZA 2Y5SA 4XZMX 3TR2A 3N17A 4X2RA 4NXKA 3GNPA 1Z89A 3GDTA 4WY0A 2VQUA 3FNDA 3EB3A 3CYVA 3UNTA 3SCNA 1ZGDA 3A4JA 1FY6A 2VTFA 2W62A 1VB9A 2JGQA 1VZWA 3L0NA 1M65A 2QIIA 5LIKX 2DPEA 1XLMA 2IUZA 1JRBA 3B8UA 3CHVA 3GHTA 4PUJA 3TFXA 3RFAA 4Y6GA 4LY4A 5H6HA 1MSSA 2DT0A 3GG8A 2ZRYA 2HSAA 1TJ0A 1JR1A 5A6JA 2WNQA 3T0AA 2AL2B 2HVOA 2PLKA 1EA0A 2V5CA 1PYFA 2PTZA 1GWJA 5GJNA 3EPOA 3N29A 4DNMA 4HNUA 1TV4A 2P8BA 3BLPX 3OYZA 5T9CE 5HXMA 1ZAIA 3W2NA 3PPCA 2EQDA 2GL5A 1JCYA 4PMZA 5B7ZA 4J9JA 4D8ZA 4AYGA 3HTWA 3KDNA 2WZHA 3E0LA 4C6CA 4CEXC 1UOKA 5D04C 1FHLA 2BG5A 2E0PA 1XISA 2WHKA 3ARYA 5BU6A 1A0CA 1L6YA 4EP8C 2GYIA 2OSYA 2F2HA 3TN4A 3UVAA 1XIIA 3VIOA 3KZSA 5AHMA 3NO5A 1G4PA 3PTKA 4GZIA 5FF3A 3AJXA 3QFEA 3UGVA 4M24A 3CH0A 1KBLA 3S9YA 1UUOA 3SUSA 4XAFA 4E3VA 2TRSA 3CEPA 2EEXA 1FWNA 2NQ9A 4C6OA 3C2RA 3CTTA 2C15A 5LA2A 4US6A 3WEZA 1KTNA 1ZS2A 5AHIA 1QO5A 3CQKA 2J75A 1DE6A 4G5DA 3B0YA 1AFSA 1O5XA 4DO4A 4JFWA 4QDMA 3NYDA 3G18A 4QQUA 3WLKX 3KHDA 1E56A 2E6DA 1NFBA 4M8UA 4GLEA 2J7EA 4HHLA 5LHFA 4C6IA 1LL7A 2OOFA 2VP8A 3ZVHA 4W85A 3MBDA 4X3ZA 1QO2A 3GYCA 4S23A 2FPYA 2J7BA 2TYSA 3H2CA 1R46A 3WK0A 4BWLC 5ABHA 2GUBA 1GVFA 4FP1A 4MUZA 1A5AA 2QLYA 2XGBA 1KCKA 3N11A 4Q8TA 4MTVA 5DBUA 3WJSA 5EA9A 5TF0A 3NJ3A 3T42A 2E6AA 3NM1A 4Q4SA 2RDTA 1G0CA 1QNQA 1XLDA 1TJPA 1V02E 4U5KA 4DIAA 4A3UA 3MP5A 3DKLA 1S2WA 3KVKA 4HNCA 4M7SA 4LU0A 2DH2A 3K4WA 1EOMA 3A22A 5HDRA 3WLNA 4BR1A 3CO4A 3VCNA 1Q6EA 3UA4A 1UA3A 4NAFA 1K9FA 1Z41A 2QYGA 4Q8PA 2E67A 1F4AA 2CNCA 2DSWA 4JHZA 1RLCL 3W86A 4Z2IA 1OK6A 3ZFHA 4HA0A 4D1IA 2GJNA 4DHGA 2ZUSA 3KM8A 3TJLA 3CV7A 5G4WA 4JIHA 2OG9A 3ARWA 4JPGA 1GEQA 5HQLA 3PZQA 3QHOA 1ZBKA 4UR8A 4PTWA 3LV5A 4LH8A 3KCOA 3OG2A 4MJ4A 1XPYA 3RPMA 1KXTA 3ABRA 4J3XA 3APYA 3MWCA 3IVSA 4ZQOA 4O53A 5BWAA 3U2ZA 3QYQA 3RRXA 1TPWA 1OZMA 1S3HA 4WOQA 2PC8A 4TTGA 5HBFA 4A05A 3AZTA 1CGTA 2GK1B 2XFYA 4ZSUA 3FJNA 4W4QA 1MEWA 1RXOB 1E6XM 4DF0A 2PTXA 1BXNA 3KP0A 4GABA 1HJQA 3RLVA 3GXNA 2GWNA 1QHOA 2Z6JA 2VR4A 4B92A 2Y62A 2VOTA 5D8ZA 4JTUA 1QPNA 3KUMA 3QJAA 1VFUA 5DEZA 4OGZA 1OD0A 3CUFA 3LGDA 1CXHA 4LEFA 3N25A 4L4PA 2VVNA 4RV8A 4QS5A 1E9LA 2E68A 1XF0A 1EJUC 4UBPC 4IIEA 3WDHA 1R3RA 1UMYA 5G4EA 1QI2A 2PGFA 2FZMA 4KS0A 3VOGA 1QNRA 4X22A 5GNXA 4V1XA 2UZ9A 1HZYA 4B90A 1O94A 1T41A 4I90A 2KX9A 4Y90A 2WHJA 4I6VA 1YEYA 3ZSSA 4D8AA 5AY7A 4CVWA 1CGUA 4ZR8A 2B7PA 4FXFA 4MAVA 4XD3A 1SFTA 4PMYA 1KFJA 4C60A 4CD7A 4C6PA 5CZJA 1KV8A 3ZJKA 3WKZA 1FP8A 4L4OA 2DUXA 2YIHA 4GINA 2YDQA 3H53A 3TONA 4S3AA 4PCTA 4IQEA 4GUFA 3H2NA 4MKNA 4X63A 4HOZA 1TPH1 1D3HA 1LLOA 4P7NA 3BLIA 2A3CA 4TVUA 3N2CA 4KETA 3JR2A 2RKXA 1A0EA 1R3WA 2FJUB 1J5SA 1BRLA 1VIZA 2DT3A 3STGA 1E1EA 4DZHA 3TWAA 4MB3A 3WLSA 5A8OA 1QR7A 3TQ0A 1B3WA 1IEQA 3ZYZA 1V6XA 3E5PA 3DUGA 1VBHA 1WP6A 5EMUA 4HB7A 1MEHA 4EE9A 4C6EA 3URAA 4Q7BA 1K4GA 3AXMA 1DIEA 1KM1A 1ECQA 5D2WA 1NOUA 4GO9A 1NP0A 3LY0A 3B8IA 3V16A 5D38A 3L65A 4QAWA 3FOKA 1TO3A 5A8PA 3OGRA 4Q32A 1YNPA 4LBUA 2QDDA 2V69A 5ENLA 2Y8KA 1J2BA 4B15A 5G2HA 4AHQA 1ZHAA 2W63A 3EWXA 3UZJA 3LCXA 2XN1A 4YMZA 1MDLA 1XINA 1BG9A 3B8TA 3H70A 4O16A 5EYWA 3K2GA 3IJQA 2XVPA 3CM4A 3MZ2A 4KGLA 4QJ5B 3RR1A 1RHCA 4OWGA 4AY7A 3QV8A 1X6NA 4L9YA 4JTLA 3FXYA 1NWSA 4L9ZA 4BF5A 2WKLA 2POTA 2ASHA 1GJPA 1NVMA 2GLKA 3GNRA 4HHHA 5KINA 3ELFA 1DJGA 3T2OA 5U4NA 1KM4A 4HT3A 4DO7A 3JU2A 5D02A 3FDGA 5IXEA 1PIGA 1ZPTA 5IHRA 2PURA 5I3KA 1V3LA 1Q6QA 4GZEA 2FVLA 2G97A 5EKYA 3VIPA 3B9NA 3VZZA 1TFVA 3R13A 2XWEA 2ZUUA 4GJIA 2FGBA 3RCYA 1KGUA 3P60A 3AYVA 5BOEA 1VBGA 2H8ZA 4AVFA 1ELSA 4O11A 4MKSA 1LOQA 1XS2A 1I2QA 3WLRA 3H4WA 5G1TA 3W2LA 3STCA 3OHMB 3AHVA 2VHLA 2QDEA 2VX6A 3CYJA 4WLCA 2F6UA 3ANVA 1GQJA 1WZLA 2Q71A 3EDKA 3RO6A 3IV3A 4HA4A 4TVCA 1M7OA 3PBMA 1WBHA 1YRRA 2WMKA 4KF1A 3UPBA 3B97A 4FX7A 2WHLA 2L5HA 2QCCA 4IP7A 4W7WA 4ML9A 3VOHA 3N9RA 3HMCA 1KA9F 1O4UA 2DQXA 1Y7VA 3NXFA 4M6VA 2O9TA 3OLDA 2Z1BA 3CGTA 3L2MA 1WA3A 5I3FA 3PSVA 5D03A 1ML1A 4Z2LA 4YJ5A 3PSWA 3GU9A 1VYPX 3DYOA 3WFZA 1NSJA 2RHGA 1OC5A 4K1WA 4QE1A 2PI6A 2WMHA 3PUEA 4L6HA 4Z1DA 4XAGA 2ZRUA 1JPMA 3HG2A 3W7GA 1OHLA 2D3LA 3M0HA 3PJXA 3KZPA 2QCMA 1CENA 6ENLA 1XLHA 4JOMA 8XIMA 2R1KA 3O6YX 2YXXA 4F9JA 1B30A 1J9YA 3GUGA 2W92A 5M5DA 3IIOA 5F2MA 4G8TA 1OADA 3QLLA 3IWPA 3VNMA 3C61A 5U7SA 3BZGA 3QF0A 4JFTA 4AZCB 3NOYA 4J27A 2F8QA 1EIBA 4Z42C 1A47A 1UWSA 2ZUVA 4ACZA 4ACZB 2BP1A 2VDGA 9RUBA 1QPRA 3T0TA 4DWSC 3IK2A 4WF7A 1QI4A 3ZLFA 4ZA0A 4E2BA 3ZJ8A 2WQPA 2WW5A 4J3UA 4Q22A 4F0RA 5A6TC 2DY3A 4C5YA 2VWSA 3KVMA 5DCDA 1V3HA 1FKXA 2H9AB 3RF9A 3SI9A 3VOIA 3PJUA 2Z27A 1J11A 3BO9A 2PP3A 1ONRA 4JAWA 3LCIA 4QNWA 5EPDA 3TYZA 2PZNA 5LXXA 1GGOA 3AWOA 4WJEA 1A0DA 1GOWA 4WUIA 1MZHA 4A3HA 2A3AA 4LNYA 3A13A 1US2A 2VD8A 2BNJA 1AL7A 3C86A 5FOOA 3W22A 1Q6LA 4IPLA 4JNZA 2VFEA 1LG2A 2YGYA 4DI8A 4U2YA 4IJCA 4GCXA 3W88A 4DLFA 2PWEA 3TCSA 2J8TA 3NSNA 5ECUA 2ZWZA 2EPNA 1SO6A 2A4AA 1UB3A 4HTBA 4GVIA 1SVDA 1U1HA 3REQA 2IXUA 3H2AA 5D2VA 2XISA 3TQPA 3CHDA 3WJXA 2HS8A 4HPXA 2NX1A 5EFFA 4AWSA 2VRQA 3FVDA 1QOXA 5A2BA 2E77A 3FJ6A 5TNVA 1MNSA 1FWWA 2CPUA 4HU8A 4HYWA 3WL1A 4DBWA 4I7WA 4C6MA 3DHDA 2QV5A 3CWOX 3O6CA 2ADAA 4DJFA 3W2MA 4O13A 4W9TA 5TD4A 4G9PA 2PWGA 2NW0A 3Q4DA 2I5IA 3KL3A 1HW6A 2ZTKA 4LVGA 3RPTA 4P7LA 4V2XA 3THAA 1X6LA 3M0XA 4H7ZA 5C2GA 3DGRA 3GTXA 2Y1HA 1JQVA 1OFBA 2HK1A 2CHOA 2PWHA 1ZL1A 2W9MA 4JDYA 5LYRA 2PEVA 1R9YA 1KKRA 1H7WA 5DRIA 3VMOA 3BAWA 1KD0A 2NVAA 3BW2A 4AZ7A 3AWNA 3BE7A 2C18A 4LS0A 3BSMA 1R2SA 3ARPA 3AXHA 4UTHA 1R3TA 3UR2A 3BV7A 4S3EA 2VNCA 1VRDA 4OT7A 1JUKA 4UZSA 3GW3A 3UPWA 2X0HA 3RUBL 1ZRQA 3CLWA 1IYXA 4NVTA 4KWOA 4JIEA 3MZNA 3S42A 3R10A 4GYPA 3HF3A 3E2RA 2AL1A 3VMNA 1OWQA 4NSBA 3UWZA 4ERIA 2YYTA 3RHGA 1A4MA 4XD6A 3MP4A 3HG5A 4K8GA 4H9VA 5HNNA 1MRAA 1KXQA 1HJWA 3GDKA 3ERPA 1TVPA 4JTQA 3NPVA 3Q58A 2V3FA 2XVNA 1OGGA 3I7SA 1GTEA 4W86A 1M5WA 1K03A 2P3EA 3NURA 4ZTXA 1Z8AA 3I65A 3OJGA 2QNEA 3VABA 1RQBA 1A5BA 5AFDA 5I00A 1MUWA 1KM6A 2E8ZA 2VL4A 3Q65A 5JBFA 2PWUA 3NQFA 2OQYA 1RCXB 3O8AA 5LIUX 2CXGA 2IPJA 3AS3A 1KBJA 4F2BA 1CI1A 3N15A 3G0UA 5JVLA 1XLAA 3G1XA 4OE7A 3GXIA 2CBVA 2WZEA 1VCGA 5FJJA 1JFHA 3AU6A 1FHVA 2A3HA 2ZRZA 3P61A 4XG1A 4DF2A 3PFRA 3KX6A 3EEZA 3QFWA 4HSNA 3T4WA 1E43A 1MMFA 2GPTA 4ZQMA 3CUJA 3GD6A 3WBEA 2WB5A 1DJYA 4XAPA 1ZLPA 3MV01 1XSJA 1PO9A 4FIQA 4Y9OA 4PBFA 5FKYA 1OK4A 4LRTA 5LIWX 1CDGA 2J6XA 2VUNA 5F4SA 2OCZA 4XZWA 3MKVA 3FSUA 2HJPA 1TPVA 4MB1A 3LLFA 2NLIA 2VUYA 3GZAA 1TA3A 1C7TA 3S1VA 2WQDA 3P5ZA 5EMJA 1UG6A 2Y7GA 3AALA 3G22A 4HCHA 2JF7A 2Y24A 1FDYA 4CQ9A 3SCWA 4F3HA 1XFBA 1DWFM 3CNYA 1C8YA 3GH4A 2ZOXA 2CLHA 3ZIZA 3MU7A 1JPDX 1KM3A 1TZZA 1V6TA 3VA8A 2QJGA 3SCVA 1JPHA 3NQMA 3QR3A 1SR0A 2PDYA 4JTRA 4H7CA 5D9MA 2Y85A 4NZ5A 1KTCA 1DKWA 1UASA 4GZ7A 1H7RA 4XTDA 1AJZA 4GQBA 1BKSA 3LLDA 3ES8A 1GVIA 3W73A 3MSDA 1JZ8A 4KEUA 2V5BA 3GC4A 2RGLA 2V5DA 1UKSA 2TPSA 5H8UA 3HOJA 3FKKA 4HNLA 4R53A 3SM0A 1K9EA 3RYSA 5C6MA 2D24A 1YLVA 3EDJA 5E09A 3H12A 3LTSA 1EYEA 1HFBA 3CZGA 4XSLA 1U2YA 1F05A 1RD5A 3W1PA 3QW3A 3ZR5A 4DJFD 4HP5A 2J47A 4NKCA 4DEFA 1J0HA 4EX4A 4BA0A 3SN0A 1KLZA 4S3JA 3PAOA 3BGJA 3WLTA 4REQB 2AMXA 5H91A 3SJ3A 4BEUA 1UHVA 1ZAJA 5DT7A 3FA3A 1YX1A 2Q8ZA 3W27A 1UP0A 3THQA 1VFOA 2WKGA 3F4CA 2AAAA 1T8QA 4XVDA 4LF2A 3VC5A 3ZR4A 2PRLA 4F48A 2HISA 3OBEA 5BRPA 4C6NA 2FTPA 1RY0A 1WDQA 3PPHA 2A2IA 4W5UA 3W1NA 5EBUA 3TYCA 3K1GA 5BWFA 3MHFA 2C13A 1PAMA 3SIMA 4JTIA 8TIMA 3OVPA 1LRNA 4RLIA 3BCFA 2MNRA 5CJMA 4A8RA 2YB4A 3Q2DA 4C5ZA 2HXUA 1W1ZA 3DFTA 5LKYA 2ZRVA 4MY8A 4DM2A 3MWAA 4MKVA 2YX0A 4K38A 4YS1A 2VQTA 4GI8A 2HK0A 3WJYA 1SYTA 2WSRA 3LLXA 2FZDA 1L6WA 3UNDA 4LVAA 3UZZA 4HA1A 2DUAA 4POCA 7PTDA 3WEMA 4CVUA 4JKMA 4G56A 4QITA 1E0VA 1EGVA 1N8FA 1AQ0A 2OZ8A 4UFJA 1YE6A 3EX6A 2CLLA 2VDHA 3LDVA 3SN4A 1KNWA 4AH7A 1CGXA 5I6SA 3WH8A 1W9UA 5FJTA 1IZCA 1A3WA 1OIFA 1CECA 2D69A 5D32A 3F4NA 4LY8A 1Y5XA 4BQ4A 1MO0A 5JH1A 4A35A 2NVDA 3V1HA 1FWTA 2EKCA 1GTHA 3C2YA 4CKQA 5C9WA 2DEPA 2PDNA 3GVQA 1RJRA 4HJFA 3BLDA 4B91A 3G1YA 3NIYA 1V6VA 3HJEA 1KFEA 4YHGA 3LMYA 2J7CA 3CUHA 4O1CA 2YW3A 3RJYA 1JYNA 4DAFA 1PL9A 3GFXA 2E8YA 3QMSA 3L23A 4WKFA 1S2AA 3BQ6A 4PR4A 2FHCA 3WUEA 2JF6A 1P43A 2YCJA 3ZLGA 2ZFAA 2ZADA 1MUCA 1X1OA 5J8LA 2VKZG 3VKBA 4JFUA 4M6PA 5M17A 4J40A 4AC7C 1OM0A 4ROPA 5AZ0A 2DFAA 5EGRA 2VGGA 2ZICA 2A1YA 2YBVA 4Q8QA 1UD8A 4AIUA 1EQCA 5EU9A 3VD4A 4GIRA 2MUCA 2FH8A 4MZ1A 5GVJA 1OYAA 3CC1A 4XZNX 4LCQA 2E3ZA 3DFSA 3PPGA 1SFSA 3WLPA 1Q4WA 5B80A 4RZ4A 3VZYA 1RH9A 4HA3A 2OWWA 3S9IA 3WDIA 2FZ9A 4Q8NA 1PX3A 4OZOA 5HMFA 1G4EA 1EYWA 1ZB5A 2PDBA 3EB4A 3WK3A 1VJSA 3LPPA 4AC1X 1BF6A 2V2DA 3LUTA 1V0MA 1OABA 1BQCA 1F76A 1J10A 2ON3A 1IEIA 4N42A 4Q4MA 4PGLA 3S5ZA 2DJLA 4QE4A 4HQVA 4NI8A 4HPGA 4GI9A 3PBUA 1GCYA 4GI6A 1QK0A 1QVBA 3D0CA 4HN4A 4QROA 2A21A 1CXLA 4FMVA 5DO8A 2CCRA 2XZ9A 2WSQA 2CHRA 2G3JA 2X1RA 2CLIA 3SRHA 1WZAA 4M6QA 5XIMA 1EC7A 4OOUA 3WUBA 3E0VA 4C90A 1LT7A 4UMCA 4CCCA 4FPSA 3FJLA 3ITVA 2FPTA 1J8VA 3E0WA 1E6QM 3W84A 2O0TA 3W75A 4C7DA 2PLCA 1ZFJA 2F9RA 1L0PA 2JALA 1VAHA 1W9VA 3R6IA 2YSWA 3BAIA 1JULA 1TWDA 3W7CA 4P2VA 3H21A 3T1GA 1PYMA 1GOOA 4EWND 3L4TA 4NAEB 1BF2A 1J2WA 3MW7A 4JN6A 3F7JA 2J7HA 4JFVA 1ME8A 1E6ZA 1WZKA 4I3GA 3N2XA 3CWNA 1GPFA 3ZWSA 1TPDA 3VKJA 2Z6IA 4ALDA 2O56A 3AI0A 1W91A 4DJDC 4HNVA 1A80A 1W1IE 2REQB 4IOTA 3RAOA 2OT0A 3NL6A 1TTPA 4K8HA 2DQWA 4TX8A 2I7GA 1RVGA 3BDKA 1TRIA 4TQTA 2EPLX 4GH3A 3JRKA 3H8AA 3NR0A 5A95A 4P7OA 3GU2A 2ZXAA 2PZ0A 1EJSC 1KFKA 4GNJA 4JCMA 7ENLA 1AA1B 6REQA 6REQB 3HA1A 1L9WA 3L5LA 1JUBA 1P7TA 1GYNA 4PEEA 3FVMA 5EMMA 2BTMA 3ZLHA 2V3GA 4WR3A 5I02A 5FIPA 1RPXA 4OJYA 5C2CA 1XSIA 1I1WA 3EXSA 2PDXA 1OFQA 4PMVA 4M3PA 1CIUA 1I75A 1O60A 3E0FA 4JDBA 5JU6A 1UJPA 3QSTA 3D3AA 3PM6A 3U5UA 4NI3A 3S2CA 1CYGA 2V3DA 5BMWA 2DUZA 2A85A 4GXPA 4KEZA 4ADUA 3ALGA 3HGJA 1V79A 3UQNA 4ADTA 3WFLA 1IEXA 4GYPC 4WZHA 4MY9A 4NAEA 2QCDA 2WAGA 4LS2A 4Y9AA 4ZL1A 1ONEA 3SY1A 2AAMA 1AVAA 3H2EA 3LHWA 3R5EA 4DNHA 4A2SA 1P1MA 3RLGA 3AU2A 3G1HA 4IWWA 3NWRA 3VGFA 4ZFCA 2GGEA 4A8LA 1OSEA 2OELA 1H7OA 3COTA 2VYOA 5GJPA 2GVJA 1ICSA 3EB2A 1BTCA 4L6DA 1IIGA 1GJUA 4B5NA 2VX7A 3B03A 4HNNA 5LZLA 4FAMA 5DMYA 2YA1A 4EF9A 3VKCA 4V1YA 1TPFA 3EXRA 3U7VA 1I9CB 1LTDA 1UA7A 1F73A 3RG6A 2WWCA 3NO3A 2XSBA 3VOFA 1A5LC 3W1QA 3FHQA 2DIEA 3OG3A 4MADA 3IIPA 3IJ9A 1A5CA 5BCAA 4KMQA 3HGSA 1VFHA 3M5YA 3IJ7A 1UWIA 5IOBA 1TYGA 4ZOEA 4AEFA 5FL0A 3AZSA 2DZSA 4CU6A 2E5CA 3EOUA 3QMRA 2HPIA 3BOXA 4JEQA 1C90A 3TFCA 1S5MA 3KHJA 1JZ6A 1AQFA 2FMNA 2JFEX 3UVIA 4KRZA 4R7JA 4ZXLA 3KL0A 3GK0A 1Z48A 4OHQA 3WLJA 1TTQA 5DLCA 3MO4A 3QOMA 1HQTA 3EMCA 1WAWA 4MNJA 1HN1A 3TZFA 3N6JA 4Z0JA 1U33A 1XIDA 1KXVA 3GVVA 1O6IA 1NWRA 3DEQA 3H24A 3GAKA 5FJPA 4J3VA 2BODX 4MJMA 4AZCA 2UY3A 5DMMA 2FHFA 3RLHA 3AFBA 4CU7A 4YN5A 1GVSA 3W82A 3MUCA 1B3VA 1F07A 3BK0A 4R5EA 1J0JA 4D8LA 1YHTA 4I9JA 2ACQA 4KRUA 2XSAA 1VYSX 4YL2A 2OJPA 1S2CA 1B57A 2O55A 5AYIA 2FFCA 4PRRA 1NFPA 1SJCA 1LBLA 4F0MA 2VEGA 1R2RA 5T9BG 2A5HA 1V3IA 5LNWA 3TQVA 5F7UA 1OF6A 4EAYA 4IIBA 3TN5A 2FJKA 4OV9A 2DORA 3SQMA 3L66A 1RA5A 2YBUA 3FS2A 3LM3A 3A21A 4LUIA 1SFLA 1XYLA 2EJ1A 2ZDRA 1WB0A 3UCQA 4MOZA 4B5UA 3OA3A 3E2QA 1JF5A 1P0KA 3E5BA 4JFSA 3W7QA 3VNLA 4GACA 4KKXA 2VC5A 2W61A 4PB3A 2E1DA 3UG8A 1EX1A 2NX9A 4UNKA 2FFIA 1F6PA 3NM3A 1FWBC 1UR1A 1SW7A 3RU6A 5PTDA 4AG0A 3K8KA 4M6UA 2D2OA 4QG6A 1XWYA 1XLKA 2ZXQA 2F38A 1JCNA 3UU0A 5A94A 3ZWTA 1NOFA 4GG9A 4KGJA 4GD0A 3EXTA 3WX7A 1JZ5A 3TC7A 3C0SA 5K4ZA 3R0KA 3CUGA 5CAHA 4AF0B 3U3HA 1F3EA 1HTIA 4ZEPA 1SFJA 3O16A 4UTWC 5B7YA 1NP2A 3PZNA 2VJXA 4GXMA 3M0IA 4EK7A 1XIJA 4X0NA 4JQ4A 1R6WA 5I0DA 1HKMA 5LHEA 2DZXA 3GS6A 4RCXA 4QNEA 1DJQA 2E6FA 4ORIA 1XLLA 3W2KA 2J74A 5A8QA 4MG4A 3IJ6A 1QW8A 4UIOA 4KEVA 1YBQB 2DZBA 3L4UA 3R0UA 3RN6A 4LV9A 2X1TA 1Q65A 1XYAA 2FGZA 2C19A 3NGJA 2OTDA 3POCA 3W76A 5CKSA 5J5RA 3M4HA 1XHGA 1H41A 5FAGA 3UA3A 1BEUA 1SMDA 5F1VA 3QTGA 4FXJA 4GQGA 3ALFA 1K9DA 2QV4A 1EIXA 1GKRA 4RW3A 1W54A 4ML4A 4D9PA 3PUOA 4E2OA 4D71A 3CXOA 5D09A 3SADA 4ECLA 4AZ5A 2ABAA 3UPMA 1VC4A 2OZTA 3TA9A 1OFDA 3QMTA 3VDCA 2ZRWA 1R85A 2D0GA 4J2PA 3RNDA 2EG7A 1GOIA 1XIGA 3JVAA 3BMXA 3DG3A 3OTRA 3DAQA 5A8MA 3EPNA 4P61A 1PKNA 4KWSA 1UWRA 1E0XA 4ZVJA 5G2IA 4CGTA 2ZX7A 3AO0A 1WOAA 1TVLA 3G2GA 2ICSA 1GHSA 1U5VA 5I09A 3M7SA 2O9PA 1PX8A 3UJFA 3V5OA 2CW6A 5CBBA 1EJVC 3BLKA 4PB4A 4XIAA 5BMXA 1EO5A 4HBKA 2J7GA 1V6WA 3A4XA 1V3JA 2OWXA 3IJIA 4LAOA 1BXCA 1O12A 3H2OA 4AD3A 5LSMA 4ENLA 1XW8A 3I6TA 5FF2A 3M7WA 4WKAA 3WQ5A 3WQ6A 3R7MA 3OYXA 1SW3A 1CLXA 1AW1A 3VNJA 2KAUC 5CJNA 5HMEA 3BSGA 4P7RA 3QC3A 2GJXB 1SO3A 3TYDA 1FQ0A 1CLKA 8RUCA 3MSGA 1UR8A 5I79A 1DWAM 1X1ZA 3L67A 4GBUA 2WCGA 1E9IA 3WELA 1JCJA 1E0WA 2HRWA 3IUHA 3W7EA 2BXYA 3GH7A 1Q3NA 1P4CA 4JCLA 3OBAA 1SPQA 1Y8BA 3GVGA 4XUYA 2HTMA 1UD6A 1JXJA 1E0TA 3WJWA 3BOLA 3GTNA 3SR7A 3NQAA 5H1WA 3LPFA 3NQ2A 3PWGA 2GGHA 1WV2A 4HU3A 2ZXBA 3WF1A 3W00A 5DFAA 1XRSA 1CT5A 2XN2A 1LOSA 1K02A 1QAPA 3LNMA 3EZ4A 1S5VA 2PF0A 1A53A 1RBAA 2ZC8A 4S1FA 2XPKA 2CKSA 5EMLA 1VEOA 1PCKA 3U4FA 4AHPA 6PTDA 1YMYA 2JK2A 2VGFA 1EBHA 3PG8A 4MUPA 4PCNA 5CC7A 4IP4A 4TU1A 4WCJA 1PHQA 1D9EA 3EX3A 4J3ZA 2GDQA 3MS8A 4MHBA 5I23A 1EFZA 4X9SA 4JX4A 3RMJA 4HZ8A 3BAKA 2E9BA 3WNKA 4DJDA 2VX5A 4BWLA 3D3FA 1FA2A 3MUXA 1UKQA 2Z4GA 4WDXA 2JGYA 5XINA 4RNJA 4X9YA 2J9ZA 2J62A 3TYAA 5DRCA 3HZ3A 1ZP4A 4K2SA 1UWUA 1ZBCA 2X1UA 3TMLA 3IIXA 2WZMA 3UG4A 3LRMA 2E9LA 3CZKA 2OSWA 5E1QA 5KTLA 2VOMA 1SJAA 3IGUA 1FWHC 2NXIA 1GPWA 3RLUA 2QVHA 5LNSA 3TH6A 1PKMA 2A6LA 1T0OA 4NILA 3CT7A 1QT1A 2VZVA 1K4HA 2I56A 4AX6A 2OX4A 3POHA 3GDLA 1AW5A 2NQ5A 5AN7A 1SZEA 2VFIA 3O07A 1Z6KA 2BWGA 5JUVA 5KZ6A 2R1NA 3OGVA 4FZIA 4D72A 2W79A 2EHHA 4P8WA 4AMAA 1EXPA 2PGWA 1OY0A 1WQ5A 3IJ8A 4AZBA 3ECQA 1ITXA 2ZUWA 1SSDA 3L2IA 2OOGA 1PDZA 2WCSA 3BPWA 3ITOA 3LRLA 3S5OA 1WKEA 1W2PA 2NT1A 4XVEA 3V0TA 2CBJA 3ABOA 3S1WA 2BHUA 2BXVA 1EP2A 3W23A 1KRBC 1EF2A 4QXIA 1VJIA 2G37A 1BSLA 5EB8A 4GQQA 4FIRA 2XM1A 3NQEA 3W01A 1G94A 4CNOA 4GKTA 3ZVHB 1ZCCA 4DXVA 4XX6A 3KWSA 1PTDA 3PULA 1UWQA 4IQJA 3AXXA 1TR9A 3SO7A 3WD0A 4JQ3A 2Z1WA 3JUGA 3M0ZA 2Y4SA 1FCBA 1JXKA 1VQTA 6TAAA 1V51A 3LHZA 3UF9A 1AW2A 2PDWA 2IQTA 3BV4A 3YPIA 4IPNB 4MPQA 3G1VA 3AIEA 1HXJA 1PB0A 5FEXA 1JNEA 3UERA 4LBRA 2VI0A 5AB3A 3VD3A 5CLWA 1JFXA 2VWTA 1TV7A 4FNQA 1C8QA 2WNNA 9CGTA 4QS6A 1AZ1A 3QKZA 1NARA 2V81A 3V0UA 5A6AA 4QLKA 3BGGA 3G3MA 7REQB 2PPGA 1EL3A 2NV9A 3DFQA 4OKDA 4JHOA 2E28A 4RXGA 3VD5A 1JDCA 2A7NA 1AD4A 1XCWA 4IF2A 2XYLA 1Q6FA 3FEQA 2RAGA 1JPIA 3W1MA 1IF2A 1YBQA 3E3HA 3G0SA 1S2UA 5IM51 4UTKA 2J25A 1EJTC 4NZ3A 4ACYA 2XFRA 1FH7A 4NHVA 1D8CA 3L0KA 3GY1A 5A6KA 1B31A 1X97A 1QW7A 4RDZA 1VEPA 4LYRA 4YU1A 1GG1A 3T0CA 2H3BA 4N4QA 5HR7A 3WF0A 5DX7A 5FF4A 4UTIA 3QTPA 4MVAA 1GVRA 3THUA 3CWHA 4FA3A 1IQ8A 2YBTA 3LTPA 4E0CA 2I9UA 2W27A 3A24A 3WD2A 3MI3A 3QV6A 1N55A 1HVXA 1I2RA 1XCXA 4HD5A 4NU7A 1A5OC 3QH2A 2V6AA 3W1TA 5K9CA 3N4EA 4I7UA 4B16A 3LQLA 3O05A 5HWMA 3WD4A 1XKYA 1IR1A 4GGBA 2YL5A 2I17A 5ECVA 4YCPA 1GNXA 1UIPA 4M81A 2FIQA 3LERA 3N2MA 5FACA 3UXDA 3SDOA 2GDVA 1THFD 3ARVA 1LT8A 1QK2A 3FHAA 1MUMA 4PL1A 3WH9A 2Q02A 4X0VA 4O1FA 4C6DA 4H8VA 5FEZA 1GUVA 1XL9A 5EBAA 2V3EA 1TE1A 1L8PA 1IEVA 1ZJAA 3BJSA 1C91A 1PX4A 4DWDA 2DVTA 2QUTA 3D47A 3NFUA 2CU0A 4UFMA 4B5SA 3FEMA 3P84A 3SCPA 1RBOB 3SZ8A 2P53A 1AJ2A 2OZ3A 3W71A 1UZ4A 4FNUA 3B9EA 1K1DA 4DLMA 2P8CA 2ZA1A 2PWFA 3SY5A 3O15A 4OVXA 3QZEA 1WAUA 3HBLA 4Y96A 3UWEA 1ZNNA 4IZGA 5AVHA 3WF2A 4HMEA 3AXKA 1L8NA 2PWDA 1XYCA 1TSIA 2VEIA 3OVQA 3DXIA 4MMWA 1TX2A 5FESA 3EWDA 4LANA 1UQYA 1BYDA 1D3GA 5HQEA 3TAOA 4FNRA 3EWUA 1RV8A 4BCEA 1J0ZA 3NL3A 4I9MA 1H4PA 4ZXOA 3VO0A 1F6YA 4DPPA 1TKKA 1R2TA 4BJHA 5DELA 5HMSA 1YQ2A 4FHAA 1XGDA 4YTTA 3OGSA 1TG7A 4NJGA 1FVPA 4KFNA 4JS3A 3T4CA 5HNRA 2Y70A 1O1HA 1XRFA 4B2DD 3ITXA 3GG1A 2VX4A 4GQ0A 3B0UX 2O4QA 4N6FA 3EA3A 3OLIA 4XBSA 4F4RA 4ICNA 1TV8A 4O52A 1HJVA 2DZUA 4DELA 1YADA 3ATZA 1Q85A 3ITCA 4LUSB 1EBGA 3OU8A 4PSPA 3QZAA 5D05A 2XDFA 4KCUA 4JTHA 4HMDA 1ITUA 5CBIA 4GUIA 3C8NA 4A6GA 4H3DA 4IICA 1UWTA 3KE0A 4BZYA 3A23A 4OBTA 2VELA 2V2HA 1UCWA 4CQBA 1KWGA 4P7QA 3MJYA 1W3LA 1Q8AA 1SU5A 1EJXC 1TWSA 2RDXA 3RM4A 3OO2A 3KEHA 3ZJ6A 3PTMA 4JY9A 4W8BA 1WDDA 6A3HA 1T8XA 5A6MA 5C7VA 1DJWA 3IARA 2OQHA 1FWJC 2H3DA 4EPEC 2VT0A 3NZ1A 2X30A 4ZB0A 3UJ2A 1ISVA 3WMBA 4LEQA 4HNOA 3KBJA 1IXNA 2G8ZA 2ZQ0A 1ZJBA 5IRPA 1KQZA 4W87A 1E1FA 4F9DA 3U6WA 3BAYA 5A69A 4AIBA 2WVTA 2YDAA 3FAXA 3PG9A 4WKHA 3PAJA 4RV3A 4DJEA 2V63A 3KOWA 3S8HA 2VC9A 3AIVA 5C5YA 3SFKA 4AD5A 3MCOA 4DO6A 3WDJA 1MDRA 3DIPA 1XIHA 2AKMA 1GZJA 3P62A 4MZYA 2VZOA 1EWEA 2OKOA 1JDDA 2ONEA 5LXEA 1T96A 2PLMA 3PNZA 1V6YA 2XGIA 4JN8A 5FEPA 1RQHA 2Q09A 2LLEA 5FD0A 5IBXA 4YTSA 5KEZA 4LC6A 3WQWA 5HOSA 3WNLA 5L9FA 1IWAA 4M82A 3B06A 2ZUTA 3W38A 2X41A 4XD5A 2QUUA 1PSCA 2CWXA 5IFPA 1JQXA 1QPKA 2YXGA 1GOKA 4AAJA 4E2DA 4DI9A 4M1BA 4JL1A 3F5LA 4JQAA 4GYFA 3EDEA 1P7TB 2VCBA 1WDWA 1FWCC 3QGVA 2BVWA 1TMHA 1TE6A 3WMCA 1OT1A 3F03K 1M9HA 2GWGA 4LUSA 2V5LA 3CB3A 2HWGA 3LSCA 3ZT5A 5AC4A 5HK4A 2WOQA 4DJFC 1C93A 1H1ZA 1E5NA 4QLLA 1QU4A 4FALA 1XX1A 3PNUA 5A6SA 4RE4A 2WC3A 3SFWA 2ISFA 2REQA 4XIMA 3ARXA 5C7HA 1QWGA 1FXPA 2Z29A 4Z1YA 1H63A 1OFOA 4GUJA 3S1UA 3NL5A 2CITA 3F4WA 1DOSA 2DSKA 2OYKA 3U2EA 2DZPA 3VK5A 1RCQA 4H01A 4LOCA 3P2VA 4NP7A 2GVLA 3B4YA 2QJJA 1UPPA 4YCOA 1QI3A 1R87A 1OIMA 5KZEA 1BXBA 2OO6A 2FPVA 1ECEA 1UMLA 4GYJA 3CIXA 1M41A 3TMQA 1PTAA 2ZVIA 4UTFA 1TB3A 4JTEA 3UT0A 1GVOA 1ME7A 1VFLA 2P1FA 5J5DA 3CS2A 3CQHA 4JTKA 3PZMA 3UESA 3CAVA 4WSJA 2PMQA 5CQ1A 1XSKA 2J24A 2PCEA 1K8YA 1UPMB 3VGDA 2CBIA 3DCPA 1JGIA 4TR9A 3EMZA 4AXKA 4L1GA 2PSNA 3M6YA 4U3AA 4M51A 2XVKA 3N34A 4DBDA 5ABFA 2V2CA 5TIMA 4JTJA 1V6UA 5A1AA 4OQVA 3PHAA 2Y8UA 3R79A 3AS1A 1F5ZA 4LWWA 4K7YA 3Q37A 3NEHA 3QHNA 3QSRA 4Z1AA 2BMBA 2ZE3A 3FX4A 3M43A 4O8AA 1GQNA 4W8LA 4NASA 2PDJA 2Z2BA 4B5WA 4AD2A 3MI6A 3SRKA 4AFYA 1EP3A 2TMDA 4CNNA 5CXPA 2YL6A 3ZQ9A 3WG6A 2QVNA 4C6FA 4NJKA 4Z17A 4K1GA 1E4IA 3MJMA 4FI4A 4LUJA 1KCLA 1KW1A 1AG1O 2OYMA 5L6UA 4RR4A 1A4LA 2NWSA 1IT0A 4LX4A 4PMJA 2Q01A 2PDMA 2YDSA 4EPDC 3UEQA 1VJZA 3SCSA 1DV7A 2FKPA 2IKJA 1EQPA 5EFDA 3LA4A 4QSFA 2C79A 3STEA 4LPCA 5CCZA 2ISWA 1NQ6A 4LYKA 2C91A 3UWWA 4CN4A 3KFTA 3QPYA 4WD0A 3AUJA 3KTXA 1EC9A 3VGBA 3DHFA 3OOQA 4CNSA 3M0KA 1R3YA 1JAEA 3KBNA 5BYWA 1PTGA 4DB7A 3KVLA 1XLBA 4V27A 1ADSA 4ZBCA 5T8GA 4RPQA 1I45A 3GU1A 1SO5A 1UZDA 1D7KA 1FBAA 3MVIA 4K8EA 3WDPP 3ANUA 4J28A 2YL8A 3LHVA 1VYRA 1VEMA 1YNYA 3AYSA 4WEVX 4JYEA 4TX9A 3QYSA 4JNMA 1OCQA 2NSXA 1ZUAX 4NJJA 4UC5A 1H51A 1RZMA 1BYBA 4O4WA 2VFGA 1EJRC 1XLIA 4XB3A 3R8HA 3LENA 1Y5VA 3AHYA 2Z25A 2NXGA 4FXSA 1F3WA 1OC7A 4M5PA 1FWGC 4R9XA 2V82A 4H4IA 1TVNA 4QBXA 5M1TA 3W70A 4BK9A 2X7WA 4PYSA 4AEEA 4XV0A 3TX9A 3OLEA 3GVWA 3KOYA 3M07A 4GIAA 4B3LA 5HAOA 1B3XA 2DT2A 1GQIA 2WZIA 2HS6A 4TVDA 2C0AA 3TEVA 4QG9A 1G5AA 4GI4A 2IQDA 5I3GA 3RGTA 3R2GA 2BASA 4B3KA 2ZXDA 1UKOA 2HZGA 4IMAA 4HCLA 2JEPA 1X38A 2E9MA 3VKKA 4U4MA 3WBAA 3I7RA 1NY1A 4N2YA 2R1PA 3S2MA 3M0YA 4JNYA 3DESA 3OQ8A 1F61A 2G50A 2VFHA 3UW6A 3HV8A 5C2XA 4O50A 3O0KA 4DYKA 2DGAA 1T7LA 5JIPA 3W87A 4GC3A 5TBOA 1H5YA 3PBWA 4S3BA 2GQ3A 4FNTA 1ISYA 4CNUA 3OA5A 2FQIA 1R0MA 3I10A 3CHEA 1JF6A 3BANA 3HPAA 2DW7A 3DI1A 1D7FA 4WY0B 4WXYA 3DI0A 3RX3A 4A3RA 3SCTA 3UP8A 2Z0IA 2DP3A 4GE8A 2VO5A 1JG9A 2POZA 2ZRXA 1UD2A 5FF0A 2PFHA 3CUXA 3VNDA 4EACA 5E5CA 4AY1A 4DWSB 2Y0FA 4TV6A 4PTXA 1ZCOA 2HE5A 1ALDA 1X6UA 4WHBA 3QHMA 3WNPA 1KCXA 1C9DA 3TCEA 2EG8A 3VOCA 3VIFA 2VZTA 4ZO6A 1XPGA 4V15A 3HJZA 4U10A 4GH1A 3W7KA 3HURA 3VC6A 3LHTA 2JKAA 2OSXA 3NPXA 3KOFA 3T2PA 1HGWA 3W28A 4KWWA 4ZMGA 4UNLA 1M7PA 5KITA 1EDTA 3PB0A 5D9PA 2XG9A 1VCVA 1ZAHA 1QOQA 1I2NA 2XUCA 2D2JA 2G0WA 2Y61A 1WXYA 4S3CA 2VFFA 1AL8A 1ISWA 3LCGA 3TP4A 2VDIA 1E5JA 3Q67A 1L6FA 1CCWB 2DV0A 1QNPA 2PTWA 1YTDA 4GX9A 4UTTC 1UC5A 2WHMA 4AY8A 1TQXA 2C8NA 2J88A 4PCSA 4AZGA 1Q2RA 4XWUA 3CMFA 3WDQA 5I7GA 4H00A 3A3WA 4TX6A 3C2FA 1FTXA 2P0IA 3UZWA 1H09A 5FEWA 3TTYA 2I5QA 4QCEA 3SRFA 1B3ZA 4PCFA 1MZRA 4CCDA 3I3DA 2X1SA 2GFTA 5CG0A 1DHKA 1UW9A 1HGYA 2RJGA 2OPJA 3SN1A 1MXGA 1TREA 3H55A 1JYVA 1XICA 1TV2A 2PD5A 3AISA 3R12A 3GKFA 3B0VC 3AYRA 2OXNA 4I5UA 1WDPA 1XYZA 2Q6ZA 4UFLA 4ZQPA 2BOFX 4H7VA 1K77A 1IE7C 3G1FA 2CIPA 4UFHA 1PZ0A 3EDDA 1MYRA 4QR6A 5I3IA 1LORA 3BG3A 4DJDD 1TRDA 1YXCA 3SUTA 2PE4A 1XLJA 4NT0A 4DUOA 3CH9A 3M0LA 4ILSA 2D22A 4IJRA 3OIHA 2FZNA 4LC8A 1UD4A 1WXZA 1GJWA 2RDWA 3E02A 4J1OA 2YXOA 2BOGX 3LOTA 3LBOA 4MDPA 4L56A 1HUVA 3TJIA 2UV8G 1JD9A