3TX9A

Oye1 complexed with 2-(hydroxymethyl)-cyclopent-2-enone
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title Studies of Enantioselectivity in OYE1
rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 156
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tx9A00
1O5KA 2ZZ2A 1EP2A 2AAMA 3IIZA 4O4WA 1PV8A 4LY8A 1QMLA 3KVLA 1IXPA 1GVQA 3QZEA 3L9CA 1NSJA 4Y6GA 1SO6A 2VENA 1TIMA 4NX0A 4Q33A 3UWVA 5K4ZA 4QNEA 5DCDA 4JN6A 2E1DA 3MI3A 4UFIA 1W56A 3LRKA 4RKAA 5AB3A 2DZUA 5EY5A 1H7XA 4RXGA 5C55A 5AC6A 3W1TA 4K7YA 4DBDA 1DBTA 2R91A 1VRDA 5D33A 5C2XA 1FWRA 3S1VA 4DO5A 5DBUA 4MLJA 2R8WA 4HNVA 4UTWC 1KA9F 2I9EA 1YPIA 4GNJA 4ML9A 3NQFA 4IMDA 2A7PA 1LCOA 3EWXA 3G1FA 3UZJA 1WOAA 3T7VA 3TW7A 4YCPA 4JR5A 2Z6JA 5AYXA 1Y0EA 3C6CA 1OK4A 1VCVA 3PC0A 3EB2A 4IMFA 1TREA 1PCKA 4EVZA 1ONRA 1S5WA 3PB2A 3TROA 2YGYA 4I7WA 3T4CA 1LRQA 1F6PA 2WNZA 1KFCA 1XI3A 3W7NA 2WOQA 3BG5A 3TXVA 3DFPA 3NQGA 2C6QA 5H91A 1D9EA 5AHMA 1CX9A 4FNSA 4O1DA 2YR1A 3LB0A 3YPIA 2OT0A 3DI0A 3UXAA 2X1RA 3CWNA 3MYPA 1PHWA 1DQWA 1JCXA 1P5BA 1TPFA 2HSAA 3PVFA 3OA3A 1GVRA 3L0KA 3KHJA 1I2QA 4EF8A 2A21A 4JIQA 4UMCA 3TAOA 2ZA1A 1XFBA 3EXRA 4U4MA 1MSSA 2Y61A 3DFNA 3QMTA 5FI8A 5HUOA 3CB8A 2TYSA 4ZQNA 4L4MA 1O5XA 2VFIA 2H8XA 1KFJA 3M43A 3LHTA 1C9DA 3KX6A 4AWSA 4IX0A 4ZMGA 3C4UA 1S5TA 4GRSA 4PC8A 5AHFA 4UTJA 2Z2UA 2BZNA 2WKJA 1ZAHA 2VEMA 5HNRA 3I7QA 4N9CA 3TIMA 2YYTA 2QCDA 5KZMA 4FX6M 1F76A 4QAIA 3RF9A 4O28A 2EPHA 3EX6A 4CCCA 1EB3A 4NZJA 1B4KA 1FQ0A 3W7OA 1KV5A 3W2KA 1JUEA 1XBYA 1KM0A 1R2SA 3W1UA 2ZRYA 3TXZA 2BTMA 2BWGA 3LCWA 1HTIA 4JIPA 3O07A 4NNAA 4AHOA 3THQA 3P60A 4PTNA 3HQ1A 2YZRA 3FJ6A 4UR7A 4DF0A 2TRSA 3WJYA 4MVAA 4UCGA 3QH2A 3E49A 3I65A 4RZ5A 3WK1A 2JKEA 4BWLA 1W3TA 3L5LA 1LRNA 2ATSA 4JTUA 5K9CA 3NR0A 4JYFA 2FLIA 3CIWA 3TMQA 4W9TA 5U4NA 3FIGA 4MYAA 2C14A 3ABOA 2GJNA 2V5BA 2X2GA 4FNQA 2OX1A 3W22A 1M6JA 4HSNA 1GVSA 3PSVA 1QAPA 3MMTA 4ONVA 1GT8A 2GJLA 2EGZA 1AL8A 5FEWA 1IXQA 2ZRUA 3PB0A 2VXNA 5EA9A 4CQAA 3QFEA 3W86A 1O94A 4PODA 3TKFA 3FOKA 1VQTA 1KLYA 1W54A 5I3KA 3UPWA 4POCA 3TQKA 4A22A 4UTWA 3GNDA 4ZQPA 3GDTA 4QITA 4GFSA 5G4WA 1P0KA 3FEMA 4GWEA 3H54A 4O18A 2QAFA 5K4XA 3C8FA 4LC6A 2C3ZA 3O6YX 1XCFA 1A50A 3MBFA 2QCLA 4X9SA 4UTLA 3PUEA 5EMUA 4IJBA 1XXXA 3N73A 1JR1A 5CZSA 1UB3A 1RR2A 1SZNA 4LVAA 1OABA 1RQEA 1TSIA 4UC5A 1QPRA 2DZTA 2C16A 5CZJA 3N9SA 4FIRA 4O1AA 1KV8A 1LBFA 3M44A 2FQIA 3UWQA 3QF0A 4FO4A 3EXSA 4IPIA 2TPSA 2V30A 2ZA2A 4LS2A 5MHBA 2X16A 4L4LA 2ZFAA 1I45A 1ICQA 5KZDA 5AN7A 3OEXA 1JJKA 1VYSX 3DZ1A 2VFDA 2FB2A 4MZ1A 1SW0A 2OT1A 5G2IA 4OBTA 3QSRA 3T44A 1OX6A 2E68A 3NQ7A 1TPEA 4UTHA 5DXYA 2WNNA 2QCMA 5CPOA 4K8HA 8TIMA 2QCNA 1RZMA 3O8AA 3IIOA 4XQ6A 4Z1AA 3W7HA 2WPBA 3VFLA 2WSYA 4I9AA 2C18A 3L5MA 1KM6A 3CEPA 4HN4A 4DF2A 2QUUA 1H1YA 1VLIA 4MPQA 5L9FA 3ANYA 3GLCA 1I2NA 5DCEA 3MP3A 2CLFA 2ABBA 4MFDA 3QMRA 3UNDA 3OVQA 2Y7GA 2ZYFA 4LV4A 1KBJA 1B9BA 1VLWA 1W5OA 3P61A 4Y9AA 3DGRA 3LI1A 5DBTA 1TPUA 3UXDA 4HSOA 4WY0B 4HNNA 4OV4A 3T55A 1WA3A 1VCGA 5HMSA 4AEOA 5D05A 5LNRA 3C2VA 3MI2A 3KRSA 5BNKA 2ZA3A 3NQ8A 3TC6A 5DCBA 3G1YA 4M6PA 3FFSA 3W73A 5D09A 1L9WA 5EYWA 1QOQA 2EAWA 5BW6A 1JCJA 1KFEA 3W1NA 1KLZA 5K9XA 4AB4A 1VZWA 4N02A 1U5JA 2R14A 3S5NA 1DORA 3QYQA 3VI2A 1WAUA 3PBYA 1QNVA 5D38A 2B0MA 4AHPA 1KTNA 1P4CA 3TSBA 1EIXA 3IVUA 2F84A 3GNNA 5LSMA 3M1ZA 2CLOA 1DJNA 1YTDA 3THAA 1XDLA 1IIGA 1VC4A 4LVDA 3STFA 4GBUA 6ALDA 1J5TA 3DH7A 1W5MA 2Y85A 3DFOA 4CNNA 4Z0SA 2J88A 5IBXA 2A0NA 2W79A 3G3MA 1G4PA 3O15A 1ZNNA 2VELA 1PIIA 3MO7A 5G4EA 1V7YA 1P1XA 2YYUA 3C2OA 4DO6A 3IEBA 4JTFA 2YW3A 4M5PA 3EKLA 3E96A 3ZWTA 4O57A 2Q3RA 5AC7A 3G1HA 3OHIA 3L21A 3SY5A 3O6DA 4HPJA 4MJZA 2NUXA 2B7OA 1M7PA 2Y7FA 4IWWA 3RMJA 3W7PA 4HT3A 1SZGA 3ABSA 5G2WA 3HIJA 1I2RA 2A4AA 2JGYA 1O4UA 3A5VA 1MEHA 1QDSA 2ZZ5A 5FEXA 1MZHA 1OFBA 3QQ0A 2V82A 1NAL1 1XL9A 1W5PA 2HTMA 3MYOA 3CWOX 4K37A 1HO1A 3VNDA 3NQCA 3W7KA 2BSLA 2J27A 4K8EA 3EX2A 1H7NA 1SPQA 4NUWA 3O1NA 3HG4A 4FF7A 4I7UA 3EX3A 5A5WA 1QR7A 4AHQA 3R89A 1CI1A 2QCEA 3DBPA 1VPXA 3HPZA 4UNKA 4NJKA 3MI6A 4M6QA 3OVRA 2PRMA 4N4PA 3TR2A 1H5YA 5U7SA 3DU0A 3GAKA 3R5EA 2V81A 4JTJA 3LI0A 4Z08A 5KITA 2VFFA 3MW7A 3Q37A 1F05A 1OG0A 4DQWA 1T8XA 4HIBA 3SR7A 3W85A 2Z6IA 4KFNA 3C61A 3W6YA 4UFMA 4UMAA 3EWZA 3SGUA 3S5ZA 3UY7A 4O19A 5FF2A 1I4NA 4JDYA 3HBLA 1JVNA 1VHCA 1QPQA 2NV1A 4XKYA 1A5BA 1K8XA 1JQVA 2WNQA 1TTIA 1X7FA 2HMCA 4H3DA 4UIOA 4JDBA 3W1PA 3S1XA 1LBLA 1Z48A 5DELA 3IIVA 5I3GA 3GDKA 3LXBA 5TIMA 2J9XA 4CNPA 5K7JA 4JTEA 4RR4A 3BG9A 4JXCA 3W1QA 4A3UA 1H60A 1H61A 1Z44A 3M7WA 2E09A 1SSGA 1K8ZA 3OG3A 2P0OA 1XBVA 2CFFA 3EX1A 1RPXA 3N2XA 1H7OA 5D2YA 1TV8A 2ZZ1A 4JTIA 4NJGA 2FB3A 3MHUA 3W07A 3QC3A 3CPRA 4ZZ9A 4MJMA 1F2JA 2VEIA 3LCFA 3L65A 5D2XA 5IM51 1W3NA 3W1RA 2FPTA 3IGSA 1K7XA 3G1DA 1ZFJA 4XWUA 3FS2A 1TPC1 5A8GA 3NZRA 2DJLA 3EKZA 4IXHA 2KZHA 1BWLA 3PY2A 1KM4A 2VFEA 3JRKA 4Y90A 2A1YA 2TMDA 3LCIA 3M5VA 2DZXA 1XC4A 1T99A 2OJPA 4PEKA 4RZ4A 4O14A 4O11A 3C0JA 1S3HA 4JYDA 3HG5A 2AGKA 5FF4A 4O8RA 2CZDA 2Z1BA 3BK0A 1FUYA 3W7RA 4BI7A 1R47A 2QR6A 3DFSA 5F4XA 3O63A 4N4QA 3CEUA 4O12A 1H62A 3KVJA 4TMBA 5I3IA 3UYCA 4UFJA 1FDYA 2C0AA 3I68A 1JRBA 5SWUA 1OK6A 1AW2A 1R2TA 1W0MA 1T96A 3W7IA 3W3OA 4DPPA 1GVOA 1EEPA 5CZ0A 5DLCA 4NJHA 4MY1A 1UBSA 3NPUA 1C29A 2A5HA 3PBVA 3C2RA 1RQHA 3STGA 4TMCA 1UUMA 1Q45A 1ZCOA 3P62A 4CNOA 4UTTC 3G1VA 3W9ZA 2W6RA 4EWND 3W7CA 5BMWA 2NUWA 4UXDA 3SI9A 1DJQA 2DJXA 4O53A 3ATYA 3CT7A 5TQLA 4ZQRA 5LNVA 2Y62A 2WO5A 3TNOA 4CQ9A 1FXPA 4FNUA 2JGQA 4LC8A 3R2GA 4S2CA 1VH7A 3G24A 3EWWA 4O52A 3LHWA 1WXJA 4PL1A 2BLEA 5C6MA 4ZQOA 3QPYA 4JY8A 1OHLA 4QIUA 5LNUA 3GDMA 3MUXA 1ZHAA 3BVJA 1O95A 3IIXA 4R34A 2J9ZA 1SUXA 1ML1A 4OHQA 1PL9A 2O7SA 5EKYA 3NQEA 4WXYA 2YW4A 1W37A 3NQ2A 3E02A 5LNWA 5CPLA 2BX7A 2CWNA 2O7QA 5HQEA 2G96A 4UUIA 1YDOA 3BW4A 5J5RA 1IF2A 4IXXA 1TB3A 4JNMA 2E77A 1Q6OA 2FPYA 3LOTA 4WUIA 7TIMA 1XM3A 3W74A 4I7VA 1J2WA 4TO8A 1O60A 1KW1A 1L6WA 3ELFA 3CQ0A 1HFBA 3GB6A 4MYXA 5FF3A 5KINA 1I2OA 5F4SA 1GTEA 4O0KA 1G69A 1VJIA 1JUBA 3LTYA 3HPXA 3TE9A 4MY8A 1ZY9A 3TQVA 1KM1A 1FCBA 3TFCA 5C5YA 4IQLA 4OWGA 1OFQA 2RDUA 4N9DA 1GVFA 1FY6A 1LROA 2H3DA 2GVJA 2B7QA 4U28A 4BK9A 3JR2A 3EWYA 3DHDA 3W84A 3TU9A 1E51A 2NX1A 5D30A 2WJZA 1LM1A 3NZ1A 4HNUA 4JTSA 2Y88A 5E1QA 3GKAA 3B8DA 3GXTA 2ZDRA 1LOSA 3UQNA 4Z1DA 2ISWA 3TJXA 3DXIA 3TSMA 2ZZ6A 1EP1A 1B4EA 1GEQA 4NJJA 2NX3A 3W7LA 3D0CA 2ZRWA 2TSYA 2RH9A 1U83A 4H4IA 1QPNA 4KFOA 3NPXA 3I7SA 1JULA 2VFHA 3GZ3A 3B03A 1OFPA 2ZRZA 5F4WA 3V75A 2NWRA 4O10A 3TCEA 3NPWA 4Z1BA 3QW4B 5EBUA 3AO0A 2DZPA 1PHQA 2GPTA 5CPNA 3CIXA 3LLFA 5DY2A 3GVGA 4R53A 2E6DA 4UTTA 3S0CA 2A6LA 3PG9A 4K6AA 3G22A 1XUZA 1V5XA 3BARA 2J9YA 3Q2DA 4OT7A 3O16A 3DHFA 3O6CA 4ZL1A 3C52A 4RLIA 3PBUA 1SU5A 3S9YA 2ISVA 3PG8A 1SO3A 1BWKA 2F7FA 3TSDA 5FEPA 3NA8A 5CGQA 1EX5A 1IGSA 3GDRA 3HG3A 1W3IA 2P10A 1H51A 3WK3A 4DELA 4PA8A 1L6YA 4EOUA 4A2RA 3P8JA 3G0XA 1KBIA 1OJXA 1VYPX 1LYXA 4UMBA 4DO4A 1YXYA 3EXTA 3NDOA 1YTEA 4AF0B 1Z41A 2PRLA 4ICNA 4DEFA 2A7RA 2A85A 4QSHA 3G3DA 3NL2A 3M9YA 3HGOA 3KVKA 3LXAA 3B04A 3MP5A 1KM3A 2DORA 2I1OA 2GUUA 5HINA 4DXVA 4EF9A 2Y7DA 3L2IA 4ADSA 3IVTA 1OYBA 4BI5A 5D2WA 1QO5A 4JTKA 3O06A 5LGZA 2Y89A 1FCQA 1S5VA 1UCWA 4R33A 4XBKA 3QW3A 5GVJA 1Q6RA 4YWIA 3FA5A 4MZYA 4O1BA 1WQ5A 4FNPA 3C56A 5AYYA 1RQBA 1XKYA 2CZEA 2QCGA 4JTHA 4NT0A 4RZ6A 1WBHA 3M41A 1Q6QA 3VE9A 1NFBA 3LCGA 2NV2A 3GIYA 4HNTA 6TIMA 1F73A 1FWWA 1PVNA 3PBWA 1UUOA 3VKJA 2DP3A 1SO4A 3FKKA 3M5ZA 3VCRA 1OX4B 4DBEA 4ADTA 1L2UA 4RX0A 4A21A 4JX4A 4K7VA 4K36A 4LVBA 3W2NA 3STCA 5C54A 3LM7A 3BW3A 4WJEA 4FIQA 3CLMA 1JUKA 4H6KA 4XTDA 4UTIA 3SW6A 3B0PA 3HG2A 1FWTA 1MEIA 1FCVA 5AHNA 5E0KA 1GYNA 5KZEA 4R7JA 2CLHA 1TPDA 2YFNA 1B57A 1OX5A 2GQ8A 1X8FA 2QUTA 2H3BA 3W87A 3V1PA 4RXFA 1C8VA 3BLIA 1X1OA 1F7BA 1K8YA 2J6XA 3G8RA 3NQ6A 1LP6A 4UTKA 1TPVA 1THFD 1WOBA 5I3JA 2H6RA 4DF1A 2AQWA 1N55A 1QCWA 4NQ1A 3GXNA 4PFMA 3SZ8A 3MP4A 3VE7A 5KMYA 2DZWA 4NNBA 3LHUA 1OFRA 4WOZA 4LOCA 1GPWA 2H90A 5D2VA 1MO0A 2QJHA 4OE7A 5CG7A 5BRBA 4TR9A 3P80A 1LDCA 3W2MA 2NZLA 4ORIA 1G67A 4OV9A 4MKNA 2VFGA 3P74A 4E38A 1A5SA 2VOMA 3GR8A 2R94A 2XFWA 2G95A 2PRHA 5I3FA 3A9IA 4O0ZA 2UV8G 3KVMA 4HHPA 4P61A 3IVSA 3TFXA 1GQNA 3FKRA 3UWZA 3PR2A 1YPFA 5EL1A 3H53A 3LXCA 4GE8A 2C13A 3W1AA 2P1FA 1D3GA 1LOQA 3A23A 3UWUA 4LUIA 2ISSA 1DQXA 4FNTA 3W1XA 4RK8A 4WD0A 3LGEA 1YDNA 5F2MA 4IOTA 4KFPA 4JD4A 1TMHA 1W8SA 5BMXA 4TIMA 2FIQA 2IQTA 5G5IA 1JRCA 1I2PA 1TYGA 5F2LA 3AJXA 4IUOA 2G5WA 4LV9A 2FFCA 2C1HA 1DV7A 1VS1A 3DFTA 3UWWA 3M0ZA 1N8FA 2V2CA 5DY3A 3HMJG 1SW3A 3P67A 3GX9A 4AVFA 3E0IA 4RCXA 4AXKA 1KFBA 3BGJA 3IV3A 5G2HA 3IRDA 4GXMA 1M5WA 3NL3A 4ZQMA 5TBOA 2RDTA 4PL2A 3CU2A 3W70A 1H1ZA 3G0SA 3I6RA 3QJAA 3G1SA 2XN0A 1DKWA 3IGUA 1HG3A 5G1YA 4LT9A 4FEZA 3KAOA 2ATMA 1WX0A 4WQ6A 2FPVA 1ME7A 4XKYB 2CLIA 4UNLA 1SW7A 2QJIA 3N9RA 3TC7A 3JS3A 1TPH1 1H63A 4K38A 2C19A 3N19B 4JEQA 3TK7A 1NF0A 1TTJA 2YXGA 1F74A 3W7GA 1KTBA 3ZWSA 4AMAA 3S8HA 3M16A 1EA0A 1M7OA 1AMKA 2CLLA 2GVGA 1FDJA 4XZ9A 1NVMA 3DAQA 1W5NA 2Y7EA 1SFLA 5CKSA 1GG1A 4E2DA 3N34A 1FCUA 3ZS4A 4KWWA 3QEZA 1OFDA 3LTSA 3PS7A 5F1VA 2X1TA 3LDVA 3HGJA 3W7MA 3F1QA 4IGHA 2OZ0A 3U6WA 3QM3A 3S42A 2JKPA 3PUOA 1H7WA 3W2JA 1ZALA 4FX7A 4LW7A 3ABRA 2E5BA 5AHEA 2X1UA 2V5LA 3QSTA 3TH6A 3LCLA 2JK2A 3WK2A 3NQAA 5AHLA 3B0UX 2ZBTA 4N9EA 3W88A 1HUVA 1GWJA 2B4GA 4LS0A 3SSJA 4ZQCA 1SFJA 1TQXA 2DU2A 3NQDA 4UTUA 3SJ3A 1K7FA 2GVLA 2ZZ7A 4J9JA 4ORMA 3LHVA 5D02A 2ZRXA 4O13A 1L6SA 3OVPA 4NXKA 4C1KA 5CZTA 4N9BA 4LWWA 3FJLA 4BF9A 2FDSA 5CPMA 3O05A 4MOZA 3CM4A 2GQ9A 4IMCA 3Q58A 4AWTA 3GDLA 3LHZA 4UFHA 3A5FA 1LLWA 4JS3A 5AC8A 3MHFA 3NG3A 2NLIA 2EF9A 5K2ZA 1HO4A 2V0TA 2GQAA 4XUGA 1LZOA 1OFEA 4OGZA 3LCXA 1DOSA 2D73A 3NAVA 5KTLA 4LNYA 1UASA 3G0UA 4NX5A 4YMZA 3T78A 1GZGA 2YCEA 3U8GA 3GXPA 4S1FA 2E6YA 1F5ZA 3TV8A 2A2IA 4UFKA 4WX2A 1UJPA 1HL2A 1K03A 4HPXA 5HWJA 5E93A 2CLKA 2Z0IA 4CCDA 1ZAIA 3PAJA 4N6EA 1GG0A 3B05A 5AYZA 1FWSA 1TPWA 4S2BA 2Q8ZA 4FHAA 2NXIA 3NEVA 4CLMA 3UZ5A 2OCZA 3A22A 2QCCA 3W83A 2CW6A 3PULA 4JYEA 3INPA 3SGZA 1EWEA 3GAYA 3N14A 3HOJA 1LBMA 1DL3A 1G4EA 1KFKA 2LLEA 3Q94A 3NQVA 4HKPA 1OYAA 1J4EA 3K30A 1G4TA 2QCDB 2YDAA 1BEUA 1BTMA 4C1LA 1YADA 4XBSA 1EUNA 1GOXA 2FTPA 1MXSA 2ALDA 3S1UA 1SZEA 4NXSA 5D37A 3BPWA 3S5OA 4LVFA 1QFEA 3W7JA 3UWYA 4FX8A 2A6NA 3GYEA 3LV6A 3QPZA 3L68A 3WJSA 3GKFA 5FEZA 3W2LA 4JGDA 1MEWA 4MY9A 4A29A 5H2ZA 1A5CA 4MUZA 3NGJA 2YSWA 3NPVA 3KRUA 5K3VA 3B06A 4GUIA 1ICPA 2J24A 1Q3NA 1YLVA 5LZLA 4IPJA 1DHPA 3WJXA 3F03K 3HB9A 3TUUA 4QNWA 1H7RA 1RD5A 3W7DA 3N2MA 2QDGA 3PSWA 3G1XA 4MIMA 3KFTA 2RFGA 4O17A 2XN2A 4GUFA 1VHNA 3USBA 5AOUA 3ZFHA 1H7PA 1YDVA 3LV5A 3P5ZA 3TW6A 2Y70A 4XTIA 3HF3A 4NU7A 3IGXA 3M6YA 1XBXA 3R13A 3SIZA 3TAKA 2Y63A 3NL6A 1GTHA 1Z42A 1W5QA 3UD6A 2HS8A 3T40A 5EPDA 3WK0A 2QF7A 4UR8A 3H55A 4WXZA 3R12A 3RU6A 1F6KA 1TV5A 2ZTKA 4NNCA 5CSRA 3LBMA 3PWAA 4G1KA 1EPXA 3HPSA 5F1UA 3MBDA 3EEGA 1TTQA 4P2VA 1A53A 1G7VA 4JY9A 3G1AA 2JKAA 1TO3A 3HJZA 3NM1A 1X1ZA 5G1TA 3OBKA 3LX9A 4IMEA 2NXHA 2NUYA 2DZSA 2B7PA 1QWGA 4CQ8A 1OFAA 4AAJA 3BG3A 1LRTA 1YTKA 2FJKA 1K7EA 1P0NA 3UY8A 2V2HA 4LVGA 4M7TA 3QRHA 1FDZA 1N7KA 3M47A 4N2YA 5J5DA 2ZRVA 1LTDA 2PURA 5KSWA 2PCQA 5HR6A 2QKFA 1OFOA 4YCOA 2E6FA 3RLVA 3ZR4A 3E9AA 3ATZA 2JBMA 2CLMA 4ADUA 5IBXC 2QUVA 1Q6LA 5LNSA 3L0GA 2ZZ4A 3BO9A 3TMLA 3MJYA 4Y8FA 1QOPA 3KOFA 1H50A 3TJLA 2YFOA 4K39A 3RFAA 1QPOA 2YX0A 1G7UA 1W31A 1X6UA 1FWNA 3PUDA 1ADOA 1GYLA 4N6FA 1TCDA 1KTCA 1YXCA 1R2RA 4UFLA 5HUPA 4BR1A 3B4UA 4GJ1A 1VGAA 1XDMA 1JCNA 3S1WA 5K9DA 2QJGA 2ZQ0A 3TQ0A 3LBCA 3EWBX 4Q32A 4LRTA 3U2OA 4X3ZA 4JX5A 3BGGA 2Q8LA 1ME8A 2VEPA 3DI1A 3EX4A 2WSRA 4LRSA 1VR6A 3WFAA 3DFQA 2VKZG 4QQ3A 1TPB1 3R8RA 5F2GA 4GUJA 3W75A 4AF0A 3NYZA 3HO8A 3LTPA 1BKSA 1FBAA 3HGSA 1WDWA 4X2RA 3LERA 1PCWA 1YYAA 4JICA 4BFAA 2NXGA 2H8ZA 3P82A 5D2TA 3DKLA 5LHEA 2V2DA 1YXDA 1ZAJA 3EWUA 3LRLA 5AFDA 4OQVA 4WY0F 3WJWA 3L67A 3TX9A 3NOEA 2X1SA 5HULA 4UTMA 3CC1A 4Z0JA 1AL7A 2C15A 5L6UA 2CLEA 3E12A 4AWUA 3GR7A 5HR7A 4NZFA 4DPQA 4FXRA 5BOOA 3BW2A 3HGRA 4FXSA 3IIPA 2OMAA 2Q3OA 4MLRA 4MFEA 5HWMA 1SSDA 4LUJA 2BXVA 4AH7A 1OX4A 1XBZA 1JCLA 2EHHA 4WY0A 1TJRA 5D03A 1NEYA 4E0CA 3NNTA 4GUGA 1OVDA 1D3HA 1VYRA 4MZ8A 3W1MA 3P5YA 1JQXA 2NX9A 5LKYA 3NQMA 4IMGA 3F4WA 4M7SA 3W7EA 4O50A 2Y6ZA 2NWSA 3L0NA 1G6CA 4QISA 1AG1O 2QCHA 2X30A 4B5NA 2GOUA 1IIHA 1DVJA 1RVGA 2E5CA 2HS6A 1ICSA 4KKXA 2PC4A 2VEKA 1T0OA 4WOQA 3BV4A 4JTGA 3PM6A 4YXGA 1FX6A 1KM5A 4RV8A 3W71A 3W76A 3W2UA 2V9DA 1TRDA 2VC6A 4NVTA 3W23A 2ZTJA 2YPIA 4D2JA 4FB7A 1RV8A 1PS9A 1VCFA 2W0UA 5FF7A 3W1LA 1K02A 1WBJA 1TJPA 1WYIA 3A24A 1LLZA 4QJ1A 4E2BA 5DN1A 1SO5A 4CCEA 4TU1A 3M5YA 1TRIA 1OYCA 3C2EA 1WV2A 4YL2A 5FESA 1AW5A 4JTTA 3SECA 3NXFA 3RK8A 2A7NA 3G18A 1TQJA 1LOLA 1EP3A 5D04C 3DKJA 1I8JA 3L5AA 1IXOA 3W7QA 1ME9A 4JTLA 3CTLA 3KRZA 4O15A 3WJZA 1ZJIA 1ALDA 4Z1CA 1OF6A 3NVTA 1R30A 4IX2A 4GC4A 5I3HA 3RLUA 1XUUA 2I14A 2EKCA 4EIVA 2DZVA 3MWAA 3M5XA 3W72A 3PF3A 4KWVA 2QCFA 1KM2A 3FLUA 2CZFA 4A2SA 3TDFA 1W1ZA 4M6VA 2E5DA 5CSSA 3LLDA 3QQ1A 4Y96A 2G97A 3SFKA 5ABTA 2RHGA 3NO5A 3TA6A 1AW1A 2RDWA 3C2FA 2ZCGA 4Q4KA 5F2IA 4ZVJA 5DXXA 1JCYA 3NM3A 1FXQA 4RJEA 3BLEA 5HWNA 4FNRA 3S6DA 1K3UA 3S5YA 4BI6A 1EWDA 4TX9A 1IXNA 2ZZ3A 5HJLA 3C3NA 4LTSA 4QM1A 4JX6A 3UPBA 1PE1A 4LS1A 2QEZA 1TTPA 4O4VA 2QDHA 3FYOA 1A5AA 1KFLA 3FYPA 1GJPA 3OIXA 1B3OA 1R46A 3LRMA 5LHFA 1ZENA 2B7NA 3NL5A 1SR9A 2CU0A 3I7RA 1OF8A 5T26A 3BLFA 1G4SA 2XN1A 5AHIA 4O16A 1AK5A 1SZFA 3P7YA 3P84A 4GUHA 4WZHA 2WV8A 3P8IA 3F4NA 4ALDA 3LCHA 4M19A 1QO2A 2E6AA 4O1CA 1CW2A 2CZ5A 3MHGA 3L66A 1SQ7A 3RNDA 1TV7A 4YLWA 3ABQA 2WSQA 3STEA 4X22A 5D32A 4NJIA 3KXQA 4LU0A 3G8EA 1NF7A 3B0VC 3N3MA 2RKXA 4PH6A 4OU1A 2V8ZA 4O54A 1JCMP 1LORA 3LHYA 3GK0A 4PCFA 5LGXA 5FF0A 2QAPA 2WQPA 3P81A 3DENA 2ABAA 3A21A 3CHVA 2PE4A 4BWLC 1EUAA 3QMSA
chains in the Genus database with same CATH superfamily
3WLQA 4S3DA 1V3LA 1T40A 1SO6A 1TIMA 4JEJA 7REQA 2FTWA 3DFHA 5DCDA 2OU4A 4JN6A 1M68A 3HPAA 3PPHA 5C71A 3CL6A 4RKAA 5AB3A 4YWSA 1H7XA 3VD4A 4GCAA 1WZAA 2OQHA 1DEDA 3N6HA 4K7YA 3NSNA 4C6LA 1VEMA 2OXNA 1FWIC 1VRDA 3W0KA 3C8NA 1GQKA 2QPUA 1GGOA 3URAA 1F3XA 4DBSA 2R8WA 1ISZA 3HV8A 3OBAA 2A7PA 1LCOA 3VDBA 1MXDA 3T7VA 2VI0A 3TW7A 4YCPA 2JIEA 2Z6JA 2GJPA 5AYXA 2RGLA 3A3XA 4R9OA 4I6VA 1PCKA 3RLHA 4EVZA 1E0VA 1FVPA 1KFCA 3KTXA 3VD9A 2PZ0A 3N4AA 2C6QA 4GXPA 1CX9A 4LBUA 3V35A 3YPIA 2Z1KA 3UXAA 1M1BA 1R38A 5CJ5A 1XLJA 4KRTA 1P5BA 5BU9A 2UY5A 3WL0A 3L0KA 4AD2A 3KHJA 1I2QA 3MVIA 2Y8KA 3TAOA 4U4MA 1F61A 2VDGA 2Y61A 1ZB5A 4ZQNA 3AU6A 4E6MA 3LHTA 3AMDA 1C9DA 5XINA 3OP2A 3P14A 3C4UA 3EB4A 2Z2UA 4A8IA 1XCWA 2QCDA 4PRRA 4FX6M 2E67A 3KLKA 2EPHA 2ZXQA 3CWHA 3S83A 4ROQA 1HIZA 1EZWA 1FQ0A 4AX7A 4AYSA 1KM0A 2AKZA 3GW3A 1C3FA 2BWGA 1SJCA 4LYKA 3AIEA 1IHIA 2QV5A 1UUQA 2J66A 3HQ1A 3B0YA 1ADSA 4YTQA 3FJ6A 5CSUA 4UOQA 1HNYA 1UH4A 1BXCA 3C0SA 2JKEA 1LWJA 3GTIA 1LRNA 2ATSA 3MMUA 2IMRA 3WENA 4GIAA 5U4NA 5EGRA 4IIEA 1D8CA 2V5BA 4FNQA 3MSRA 4HSNA 2PDCA 3BSGA 2BVYA 4ONVA 5HQMA 2R9RA 5CJMA 4A3YA 2EGZA 5FEWA 1IXQA 1CBGA 3ZT6A 1IEXA 4GC3A 3O2LA 3VCNA 4PODA 3BQ5A 1H09A 1KLYA 1W54A 3UPWA 3FA4A 4POCA 2ZC8A 4ZQPA 4GFSA 2PU0A 4LB3A 5I3DA 1AD1A 4D8AA 4QP0A 3U7VA 1FWFC 3O6YX 3OLDA 4O1FA 5AC4A 2QCLA 1G94A 3REQB 3BOXA 4LVAA 3HQOA 4C6BA 3CZGA 1XLDA 1K4GA 3MJMA 3ES7A 4X2PA 4AX6A 1H4PA 4UR9A 3GSMA 3M44A 4W87A 3R8GA 4GQGA 4H41A 4IPIA 2IKGA 4LS2A 4RNJA 1BYDA 2CEQA 4ATDA 2V63A 1KRCC 4HJFA 2ANUA 4OBTA 1XLGA 3PP7A 1OX6A 3NQ7A 5C9UA 1SYTA 4QJ3B 3LYEA 2WNNA 4NP7A 4YYFA 2J8FA 1RZMA 3O8AA 5C7HA 1DIKA 3TLQA 2WPBA 3N04A 3OU8A 2WSYA 4I9AA 2IPFA 3D46A 3WQOA 4DF2A 2QUUA 1VLIA 3CS2A 2IXUA 1A0CA 4MFDA 3QMRA 3WY1A 3F4CA 1RP8A 3IUHA 3T8QA 4WLCA 4LH8A 4LV4A 1GW1A 1OM0A 3P61A 5HATA 3ARQA 3LI1A 1EC9A 1TPUA 3OZMA 4J4KA 2VCAA 1EXBA 3T55A 1DWHM 4KETA 3PZTA 3VVGA 1BG4A 4YVPA 1VFUA 3NQ8A 5DCBA 3G1YA 5EYWA 1QOQA 4JTQA 1J01A 1QBBA 1EA9C 3OZYA 3AYSA 3UBPC 1K4HA 5K9XA 1VZWA 1R86A 4W7WA 1VFMA 1GOOA 1DORA 5CAHA 4ZXLA 3QYQA 3AI0A 3VI2A 1WAUA 3BJSA 3GBDA 5A8PA 2ZIDA 1KTNA 5A8OA 3QLLA 3EPNA 3RU8X 3EKGA 4JZ5A 3D3FA 1GQIA 2J74A 3UJ2A 3QHMA 1XDLA 3GD6A 3IK4A 1W9BM 1W5MA 2WC7A 3TONA 3DFOA 4FSAA 4CNNA 1SR0A 1G4PA 1M9HA 3DG3A 1CNVA 2I7GA 2HVMA 4DLFA 4XD5A 3UEQA 4MB3A 1ZPTA 3WQ4A 1P1XA 4YTRA 2YYUA 4JTFA 4IIDA 5I02A 4H19A 3DDMA 4B5TA 5AC7A 3G1HA 4IT1A 4LGXA 1IE7C 3MUCA 1NH6A 2JF6A 3SY5A 1JZ7A 1YIXA 2NUXA 4MJZA 2B7OA 4IWWA 3RMJA 4Q7IA 4P7NA 1G1YA 4HT3A 2DT2A 2FTYA 2PMQA 3ABSA 1UYQA 4IIGA 1XLAA 2A4AA 5FJRA 5HMFA 1NQKA 1R6WA 1FWAC 3VDCA 2QHAA 2Z1VA 4NZ5A 2EG8A 4NAEB 4Z2IA 4DNMA 2XIJA 4BQ5A 3CWOX 1A5KC 4ZB5A 3MUZ1 1V6YA 2DGAA 4I9MA 2BSLA 2E1WA 5AZ1A 3OPSA 3HG4A 3EX3A 4IP5A 3LNPA 4AD5A 2UZ9A 1UWUA 1VFFA 1CI1A 3DBPA 4BQ3A 3MI6A 3VGEA 3WNNA 3LQGA 4N4PA 1OC5A 5KITA 1OG0A 1TMLA 4B15A 2QGHA 4DQWA 3T0TA 3AYTA 4UFMA 4UMAA 5GNXA 1EFZA 3S5ZA 4O19A 2V68A 1IEWA 1JVNA 3CJPA 1QPQA 1YKWA 2WNQA 3B8TA 1UA7A 2G4JA 4H3DA 4UIOA 4TVCA 1RHCA 3RILA 3S1XA 1Z48A 5DELA 2DEPA 3TTEA 1I6NA 3H23A 4HOWA 4C5YA 3SCQA 1SGJA 1XR2A 1EHNA 3W1QA 2D0HA 1BAGA 1H61A 5A69A 2E09A 4N7QA 4W8LA 1SSGA 3CT2A 1ITUA 1RVKA 4QG8A 5ABFA 4ZO8A 4GYPA 1TV8A 2ZZ1A 4Q8PA 2I17A 2ACSA 1V6WA 2HEJA 2VEIA 4KCUA 1OADA 3W1RA 3ZVHA 2FPTA 4Z2HA 1ZFJA 3FS2A 1LT7A 4PZVA 3CYVA 5A8GA 3ITCA 2DJLA 2J78A 1BWLA 4QCEA 1QNRA 2NVDA 1A3HA 1T99A 3T2PA 2OJPA 4BF7A 3R10A 7REQB 3WLRA 4A8RA 4KEZA 3HG5A 1BQCA 5FF4A 1L6GA 4DM2A 2OKOA 1OD0A 4BI7A 4TVUA 3U2EA 5D4YA 1XINA 2QR6A 3WYZA 5HMDA 3O63A 3CEUA 2ICSA 2UY3A 2QMJA 3TA9A 4US6A 2CBIA 5I6SA 3T42A 4F0MA 4H2HA 1JRBA 1AW2A 1R2TA 1UKSA 1T96A 3W7IA 1XLEA 4OIFA 4MY1A 1EPVA 3W29A 3NPUA 1C29A 2FGLA 3PN8A 1OIMA 1RQHA 1B0IA 3FV9A 1Q45A 1W91A 4W93A 4UTTC 4ZE5A 1BRLA 1BVNP 4BJHA 1TG7A 1A5MC 2DJXA 4CU6A 3TZNA 4R9XA 1SVDA 3CT7A 4HHHA 2F38A 2WW5A 3B9NA 4CQ9A 4DAIA 2JGQA 3VGHA 3R2GA 4DJDD 4S2CA 1VFTA 3U7BA 2PGEA 3EWWA 1UD3A 2HBXA 5E6YA 4AG0A 1WXJA 3BLOA 2QT3A 2PI6A 4GZIA 4HNCA 1O95A 4R34A 4UOZA 2DT0A 4PUWA 1KBKA 1SUXA 1P0DA 4WSHA 3ARPA 1YW1A 4DUVA 1BSIA 4KRUA 3E02A 3H7VA 4XV0A 5CPLA 3EOLA 5J5RA 2PC8A 4IXXA 1TB3A 4JNMA 3K8KA 3VYLA 4IPLA 4WUIA 1W3LA 3L2MA 3KL3A 2G3IA 3W74A 2D69A 2ALRA 4H9VA 1KW1A 1O6IA 1HFBA 3UG4A 1I2OA 4O0KA 2GK1B 1G69A 1E1FA 3LTYA 2PP0A 3HPXA 3N2TA 4OWGA 1OFQA 1FY6A 2H3DA 1QI5A 2B7QA 1HXJA 4BK9A 2E0PA 3SGGA 3DHDA 3W84A 4GOAA 1D7FA 1LM1A 4HNUA 2Y88A 4H7ZA 1WE5A 3GXTA 4S3AA 3UQNA 3SCNA 5FSEC 4Z1DA 3TJXA 3TSMA 5C70A 1MMFA 1GEQA 5HNUA 4XK2A 1FKWA 4V28A 2AL2A 3BLDA 3WBAA 1F07A 3GHRA 1M7XA 1JYNA 4KFOA 4GI6A 1JULA 2MANA 2VFHA 1ZL1A 4KQNA 5BCAA 4GQ0A 2PDLA 2BB0A 2OGJA 4C7DA 5A6SA 2BVTA 1JAEA 3V75A 2X40A 4O10A 3CHFA 1XIGA 3KCOA 1FOBA 1KQZA 5EBUA 1PHQA 4QLLA 1YHTA 1UZ1A 3U2CA 2E6DA 1UP3A 1NDWA 3G22A 1C90A 3MDUA 2O4QA 3UGRA 1EO5A 3Q2DA 4OT7A 3O16A 3DHFA 3O6CA 4REQA 1O68A 4YHGA 4QSFA 4IL0A 3S9YA 2QJNA 2EXOA 1EC8A 1SO3A 1BWKA 4GHRA 3RRAA 3TSDA 1EX5A 5CC5A 5AYBA 3WDJA 4IPNB 1W3IA 2P10A 4DELA 4PA8A 3VCCA 1GKRA 3A47A 1OJXA 3KBSA 1LYXA 5M1TA 3UA4A 4CKQA 4AF0B 1YTEA 1QNQA 1HGWA 4DEFA 4XBJA 5FJTA 1V02A 4QSHA 3NL2A 3M9YA 3IUIA 1MWOA 3KVKA 2V3DA 4C90A 2J7GA 5C2GA 1KM3A 2DORA 2GUUA 3QOMA 3TOPA 4DJEC 3G6LA 3NDYA 3O06A 4PCNA 4F3HA 1RY0A 4QLKA 1ZJHA 3W6LA 3FA5A 1IZJA 1GHSA 4QG9A 2QCGA 3L4TA 4RZ6A 4HSHA 3LCGA 3EDKA 1F73A 1PIGA 3VKJA 7ENLA 2V3GA 3M5ZA 4MF4A 4QJ5B 1OX4B 1L2UA 4RX0A 4W89A 3UFYA 4A21A 4K3ZA 3W2NA 4L65A 1CPUA 2RAGA 4XTDA 3A4WA 3SW6A 4IF2A 1FWTA 1MZRA 1IWPA 5AHNA 2IXVA 3ZJ8A 5KZEA 4R7JA 4R27A 4XD6A 1TPDA 2YFNA 2ZX8A 2VD9A 1E6NA 1MFUA 4IQDA 3W87A 4RXFA 1ITXA 3BLIA 2D20A 1X1OA 3TQPA 3PAOA 3SQLA 2XISA 1KKOA 3M0JA 4MG4A 1CXFA 1DJYA 1PZ0A 3VIMA 1P48A 2WLZA 1DWFM 5A2CA 5BRPA 2YIHA 1E4MM 3COTA 3GXNA 4O0QA 3MP4A 5KMYA 1UPPA 2O55A 2DSZA 2OR2A 5IXEA 1OFRA 4KEVA 1GPWA 5T91A 5FJJA 1H11A 1MO0A 2QJHA 5BRBA 4G1NA 1V3KA 3P80A 2NZLA 4ORIA 4OV9A 4LEQA 4B9ZA 3K4AA 3FX4A 2VOMA 2XFWA 1A5NC 2G95A 2PRHA 3OW1A 5I3FA 2UV8G 3FKRA 3UR7A 5EL1A 1Q7MA 1S2AA 4GE8A 3MCOA 5CGMA 2P1FA 2XUCA 3OB8A 4F0SA 1LOQA 1W1A1 3OO2A 1MI3A 1DQXA 3AXHA 1DJHA 3W1XA 1ZP3A 1YDNA 2PAJA 5F2MA 4GD0A 4DWSB 4J3VA 3GQYA 3OGSA 5BMXA 4TIMA 4C1NA 5G4HC 2IQTA 2IS7A 1TYGA 2ZXAA 1PEZA 3ME3A 1JI2A 1DV7A 4B9YA 1HVQA 1VB9A 1Y7VA 4LAKA 2J4GA 2HNEA 1JD9A 4RCXA 3RX4A 3ARTA 4H9ZA 4PSRA 4GXMA 2RDTA 4PL2A 4HA3A 3W70A 1XIDA 3G0SA 1F8IA 2CBVA 1KGXA 4BEUA 4I3GA 3BMXA 3KW3A 4Y9OA 4FEZA 3KAOA 5FAGA 1LUCB 2FPVA 1VEPA 1Z32X 4XG1A 2CLIA 3MSGA 3N9RA 5BRQA 1QW7A 2V67A 2GUYA 4GXWA 3N19B 2XHYA 3TK7A 2O92A 2HWGA 1NQ6A 5EMYA 3GU9A 4TXEA 4GVIA 4AEFA 3ZWSA 2J13A 2CLLA 4US5D 1E15A 4PCTA 1W5NA 1SFLA 1EBHA 4TVDA 1FCUA 4H9YA 3EPOA 3QEZA 2GWGA 3LTSA 5F1VA 2V69A 3S1GA 3DGBA 3WMSA 3W7MA 3F1QA 4PTMA 2OZ0A 3V5OA 4QQUA 3AOFA 3U6WA 3W6MA 5HNTA 3B9DA 3S42A 2PTXA 2JKPA 3OODA 4FX7A 5AHEA 1RUSA 3VD7A 4GGBA 1A4MA 1N8WA 3QSTA 3LCLA 3TH6A 2WHJA 2WCGA 1H49A 4N9EA 3FJ4A 1ODZA 1E71M 4ZQCA 4LB4A 1SFJA 1TQXA 3K46A 4E4UA 2DU2A 1SZRA 1S3TC 4ZO6A 3VKDA 4J9JA 2CHRA 5A6BD 1MUWA 2INFA 3KWSA 4O13A 1WDDA 2XGBA 2ZUVA 2WMKA 4NXKA 4TX6A 3KDNA 5CZTA 4FLSA 3ES8A 2PDPA 3FJLA 4GA8A 3VDAA 2CIPA 4LJ3A 2FDSA 4OBRA 3SB0A 3O05A 4MOZA 2IW0A 1GUVA 4AWTA 3GDLA 1Y5VA 4QRNA 3MHFA 3DC8A 2J79A 2YA0A 4Y8EA 3ITVA 2V0TA 2GQAA 4WCJA 1R85A 4XUGA 1LWHA 1R0MA 1Q66A 4AY7A 3AMLA 1B1YA 1XLKA 3KS6A 5GPRA 1XH2A 2WVVA 1E9ZB 5JBEA 5KTLA 4TTUA 1UASA 1X97A 2YOCA 4AD0A 2WCSA 2YCEA 3POCA 4EKJA 3GTNA 3E2RA 3OZOA 1UJPA 1HL2A 2DQWA 2Z0IA 1XLFA 1ZAIA 4G56A 3AZRA 5AYZA 1RBOB 1TPWA 3UNTA 1B2YA 1WDPA 2Q8ZA 3QV6A 2Z7KA 4LXFA 2OLHA 2QCCA 2QQ6A 5E09A 4JIEA 1BSLA 3PULA 2X0HA 2Y8UA 1X98A 3SGZA 3GAYA 3AXXA 3HOJA 3UJSA 4AZCA 3NQVA 4HKPA 1OYAA 2YL5A 4XKMA 2WLYA 4TV6A 3ZO9A 3A12A 3N1AA 4XBSA 4HPHA 4E8DA 2FTPA 4HU4A 2ALDA 4Q8TA 4A8LA 3BPWA 3S5OA 4AY1A 3HURA 2YCLB 3AHYA 3OLIA 3WJSA 3GKFA 4E4PA 2IPWA 2AMXA 1K9FA 4GNVA 3VKCA 1FWGC 1A3XA 5HQLA 3NPVA 2VWSA 4GUIA 1ICPA 1Q3NA 4ERGA 4QNWA 3N2MA 3PSWA 4MIMA 3KFTA 2RFGA 2Z28A 4S3KA 4URIA 3SN1A 2XN2A 1VHNA 3TNBA 5AOUA 4AC1X 3VKBA 2WMJA 4DWDA 2DPEA 3GO2A 3TW6A 1TVPA 5DX7A 2AL2B 3UXLA 4YN5A 1JZ2A 3UR2A 1YBQA 4J5NA 3ALFA 3M6YA 2DFAA 3TAKA 2BGNE 3GU2A 1GTHA 4XZNX 2Y24A 4GQBA 5EPDA 1UOKA 2AL1A 3MVTA 3RU6A 2OSXA 4J1OA 4NIRA 2VHLA 4IFKB 2JE8A 4WSKA 4ZBCA 4NNCA 1MRQA 1XV8A 2O9OA 3LENA 4G1KA 1XLCA 3A3WA 3VNMA 4JIHA 3EEGA 4GZEA 3QLDA 1NWTA 2HISA 3G1AA 4MUPA 2FZMA 3NM1A 1X1ZA 5JU6A 2IUZA 3CZKA 3WEOA 2NUYA 5HBFA 3CH9A 4J3UA 2QIWA 4AAJA 2MNRA 4PN2A 3R0DA 5IFPA 1P0NA 2XSBA 3UY8A 2V2HA 4IJCA 1H3GA 4H9XA 1EF2A 4PTVA 1IV8A 2OFJA 4P7OA 2YDQA 2ZRVA 5KSWA 9RUBA 1UZHA 1OFOA 2E6FA 3RLVA 1UWRA 2CLMA 1V6UA 2ISDA 3QGAC 1Q6LA 5LNSA 3NZGA 3VM5A 3CUIA 1E1EA 4HJWA 4Y7EA 2YFOA 4K39A 3RFAA 2XDFA 3CXOA 4LQ1A 1X6UA 3U9IA 1DIDA 2WK2A 1TCDA 1YXCA 1PWMA 1VGAA 5HK4A 3JW7A 3S1WA 3WN6A 2ZQ0A 4TUFA 1KXQA 4H8HA 3LBCA 3WNMA 1TZ9A 4JX5A 1V02E 3UPMA 4B5XA 4CGTA 4LRSA 3WFAA 2VKZG 4WGHA 3MTWA 4D8LA 4GUJA 3W75A 2Z29A 2CPUA 3LTPA 1BKSA 3HGSA 4K2SA 1WDWA 3H26A 4BKNA 4XO6A 4YYCA 2NXGA 4PBEA 3QKEA 3MZ2A 5D2TA 1V51A 4ZOCA 2P88A 3ZSSA 1E6RA 3PJUA 5AFDA 2BS9A 5HPCA 4TOQA 4H2CA 1E4NA 4UTMA 3D6NA 1QNPA 2EPKX 2EBNA 3CH0A 4JQAA 3THDA 4QTGA 2C15A 4IP4A 3MUY1 4ZGYA 2CLEA 3H2CA 1E9LA 5JBDA 4NZFA 2ZICA 5BOOA 1XX1A 1J11A 3VZZA 4FXSA 3E0FA 3SN4A 3VU2A 1ZSXA 1CGWA 4AQLA 4JHOA 3EDEA 4LUJA 3NIYA 2QIIA 4DJED 2IKHA 1UP2A 4GG9A 4GNKB 1J0IA 2H9AB 5TAOA 3P5YA 5LXXA 2CKRA 4ERIA 3NQMA 4IMGA 5A6AA 3LPPA 4RE0A 2D0FA 1EJWC 4JFSA 1G6CA 5A6KA 4QISA 2QCHA 4B5NA 1V77A 2V5DA 3WF4A 3RPTA 1IIHA 2F6KA 3PZMA 4AIEA 2PC4A 2VEKA 1T0OA 3GNOA 4DIAA 3ENLA 3WLJA 1FX6A 5A2BA 4ECLA 1L6FA 2E9MA 1XIEA 1TRDA 2J62A 2PWGA 4OECA 4NVTA 2YPIA 3IJDA 4ML4A 1CXHA 3M0KA 5FF7A 1E6PA 4DBUA 3IJ9A 1E9IA 3H6OA 4C1NB 1EX1A 3S6TA 1V8EA 3WQEA 4YL2A 1W3JA 2E25A 4V1YA 2WMIB 1TQJA 5J8LA 3L5AA 2WWDA 3TOYA 4HA4A 1ME9A 3VABA 3CTLA 4Z1CA 3TCSA 4UQAA 1R30A 2VZTA 4LX4A 4YPJA 3RLUA 3W81A 3AXKA 2DZVA 3BLPX 3UETA 4WR3A 3LLDA 3MSYA 3QQ1A 4QE1A 3SFKA 5ABTA 3TN5A 3N6QA 4PUMA 3WF2A 1R3TA 3NO3A 4ZVJA 2QLYA 3WQDA 1ZJAA 1GOKA 1JCYA 5C0QA 1GHRA 1K3UA 4TX9A 1VD6A 3M7SA 5LIKX 2ZZ3A 2R1NA 4LTSA 4U2ZA 1KCXA 4MDPA 2YCKX 2PBGA 3QZ6A 4MB1A 1CEOA 1ZUAX 3BAKA 2C1GA 5LHFA 3KOWA 1SR9A 4DJFA 3N4EA 4QG6A 4PYSA 1G4SA 3NCOA 3W53A 4PEEA 3F5LA 3R79A 1SZFA 4DRSA 3RX2A 3LCHA 3DHUA 1U2YA 4O1CA 3MHGA 4HHLA 6REQA 2VT0A 5I79A 3VIOA 2Y5EA 1E43A 3NEHA 1V08A 2WSPA 1FTXA 5D32A 1HW6A 3KXQA 1JDAA 3GHUA 1Q4WA 3SCVA 5C7VA 3N3MA 4LBRA 4G7EA 4OU1A 3PZQA 1UROA 2V8ZA 3KZPA 4KBXA 1ODUA 3DENA 4LAMA 2ABAA 3CHVA 2C71A 4I6KA 3TVAA 1EUAA 4FI4A 3E0LA 3L12A 3P3BA 1O5KA 2ZZ2A 1EP2A 3H8AA 1QU4A 3KVLA 1IXPA 1GVQA 1S1PA 4GYFA 1NSJA 4Y6GA 4Z2KA 3DYOA 3UWVA 2HRWA 5K4ZA 1UPMB 5I78A 4ZB2A 1Q8JA 4JL1A 1OCNA 2E1DA 2ZVIA 3MI3A 4F9DA 4PUDA 2PODA 3LRKA 4RXGA 5AC6A 3WCZA 1D7KA 1DBTA 3EMCA 3GYCA 2HNHA 4D6IA 5C2XA 1LL4A 1FWRA 3S1VA 2WC4A 3ZLGA 1UMLA 4AWEA 4DO5A 4GY7A 1O1ZA 1W1IE 1EEXA 4MLJA 3WD3A 1MW0A 1JD7A 1AFSA 1YPIA 2I9EA 4GNJA 5E5CA 3FGCB 3NQFA 3G1FA 3UZJA 3WEMA 4JR5A 5JIPA 4MSSA 4NZ3A 1NM9A 3C6CA 1VCVA 2V5KA 4HNLA 3EB2A 2DUXA 1TREA 1S5WA 3PB2A 3M46A 3T4CA 1LRQA 1F6PA 2WNZA 4IG2A 3RYSA 3BG5A 3TXVA 3DFPA 3TN3A 5CH9A 3UU0A 1A3WA 1LF1A 4AZCB 1Q13A 5AHMA 2PLJA 4FNSA 2UY4A 3LB0A 3PZOA 1C8YA 2CITA 3U5YA 3HMCA 1M7JA 3QQWA 2OLAA 5F7UA 3SUSA 2HSAA 1CXIA 3PVFA 1V7AA 3OA3A 4HD5A 2A21A 2ZUNA 4UMCA 4FF5A 3EXRA 5FI8A 3QMTA 5HUOA 3CB8A 1T7LA 3ZT7A 3CO4A 2H8XA 3M43A 8RUCA 4AWSA 4IGSA 1XQLA 2Y1HA 1S5TA 3SCOA 3U2ZA 5AHFA 4Y9PA 1QVBA 4PUEA 2YYTA 1EGVA 4AFYA 3VNJA 4O28A 1SMAA 1MUMA 3OA5A 1UZ4A 1R3YA 3W7OA 1A80A 4ZOAA 4RV3A 3TXZA 2BTMA 3LCWA 3WF3A 4NHVA 4WJXA 3THQA 1Q6CA 3PFMA 1P43A 4QJ4B 4CVWA 2Q8XA 4LEFA 2WMGA 2YZRA 1PZ1A 1O5QA 1F4HA 2TRSA 3VTRA 3WJYA 4MVAA 2X0YA 1RCXB 5A1AA 3GUGA 3E49A 3I65A 4RZ5A 1G01A 1J6PA 4NYYA 3BOLA 1V93A 5K9CA 4JYFA 2O4MA 4JN8A 3CIWA 3TMQA 4PBFA 2WZTA 2GDQA 2X2GA 1M6JA 1GVSA 3PSVA 1WNOA 3H2MA 1BF2A 4Q8VA 2J7EA 2E9BA 4H9UA 2ZRUA 3PB0A 3BV7A 3LUTA 4EPEC 2D3LA 2PF0A 4CQAA 2NQLA 1JIBA 3W86A 3GG8A 1O94A 3AIWA 2PP1A 1TWSA 4K1WA 4UTWA 3GNDA 4QITA 5G4WA 4KF1A 3ZR5A 2I57A 1GORA 3GC5A 4B3ZA 5JMUA 2OWWA 1XJBA 1I0BA 4LC6A 4ZR8A 2C3ZA 5DFAA 3MBFA 1ONXA 4K1GA 4UQDA 4U5KA 4X9SA 4UTLA 5CZSA 1RR2A 2VRJA 1SZNA 3I4KA 1J96A 1TSIA 4G6CA 1NP2A 1JNEA 4PMVA 3BTNA 3N9SA 4JTAA 4O1AA 2PWDA 2FQIA 5BXTA 1HN1A 3QF0A 4FO4A 5I2UA 5FJPA 2WYSA 2VUNA 4JNYA 4H6RA 1XQKA 1ICQA 5AN7A 2Y5JA 3DZ1A 2FB2A 2A3CA 4MZ1A 1SW0A 2Q6ZA 4EXAA 4LCQA 2YDSA 5M17A 1EYWA 2VTFA 2W62A 3VMPA 3T44A 4L7ZA 3ZQ9A 5CPOA 4K8HA 1VENA 3K8LA 2QCNA 2QS8A 1PXGA 2FKPA 2HVOA 2G3MA 1UBPC 3IIOA 2FZ9A 3AQUA 3UF9A 1MRAA 1DWJM 3W38A 2C18A 2WKGA 1B5TA 4CQCA 3E2SA 1KM6A 4ZO9A 2O0TA 3OIHA 3HQPA 5GJPA 5IDZA 2XGIA 1VIZA 2CLPA 3GLCA 3VFCA 1I2NA 4R7WA 3MP3A 2CLFA 5E6ZA 2ABBA 1IR1A 5ECUA 3UP8A 3I10A 3PZ9A 4PE8A 3CMJA 1B9BA 1VLWA 4YJ5A 3MB9A 4HSOA 3R0UA 3SUWA 4HNNA 4QBXA 4J3SA 4HVXA 1WXYA 5KZ6A 4GZJA 5I5RA 1VCGA 1OT1A 4WDWA 1AH0A 3KRSA 4HK6A 5AC5A 4NZ4A 3WX7A 3TC6A 3VUSA 3FFSA 2JQXA 3DIPA 3JZEA 5ABEA 3RM4A 3UG8A 3VNIA 1JCJA 3LBOA 2A3EA 3SRKA 2R14A 3KHDA 2DH2A 4KGJA 3MMDA 1Q6FA 3PBYA 1QNVA 4GYPC 3SN0A 3U3HA 3ABXA 2B0MA 1P4CA 3SY1A 3TSBA 2WZEA 4HYRA 3WFZA 2IKIA 3IVUA 1XYAA 3KRBA 3LPGA 1RALA 1YTDA 2GQ3A 4H01A 3THAA 4ZSUA 3WQCA 1Z69A 2YDRA 4B4HA 1J5TA 3DH7A 3PPFA 5IBXA 3G3MA 1XGDA 3O15A 3MO7A 2CKSA 4K68A 1AH3A 2Y8VA 3G2GA 3C2OA 3K1GA 4INFA 5M5DA 3E96A 3F7JA 1DIOA 1TWWA 1XGZA 3PZUA 2AQVA 3O6DA 3WNPA 4HPJA 1M7PA 3MV11 4PMZA 1YNPA 4Q6JA 3TYEA 3VZYA 2HQAA 2BG5A 3HIJA 4U5IA 2WWCA 2A3BA 3SAZA 3IJ6A 1I2RA 2G50A 1IZCA 2JGYA 1WKDA 1OD8A 4M82A 4YU1A 1MEHA 2WVSA 1VRXA 1BPLB 5FEXA 1MZHA 3M0YA 3B3DA 4NILA 1NAL1 4LCRA 4MJ2A 2HTMA 3MYOA 3IGHX 4K37A 1H5VA 5CC7A 1XLLA 3AMKA 1Q6EA 1R5YA 2WANA 2J27A 3EX2A 2FJUB 4NUWA 5D9NA 7XIMA 2XWEA 3PK7A 4H7VA 5A5WA 4C6PA 3KUMA 1KWKA 1E6XM 3HPZA 4UNKA 4NJKA 3BCJA 3OVRA 4RZBA 2PS2A 2PRMA 3LD5A 3TR2A 1FWEC 1H5YA 3R5EA 1BWVA 1F05A 4XZMX 3E38A 2XH2A 1E0XA 3W85A 2Z6IA 1WCGA 2CXGA 3C61A 3W6YA 2ZADA 2OB3A 4JDYA 3GS6A 3HBLA 3E3HA 2NV1A 4XKYA 4GI4A 1GK8A 3WMLA 2HMCA 1M3UA 4JDBA 1LQAA 1LBLA 1XIJA 5I3GA 4FOKA 3GDKA 2J9XA 2B31A 4RR4A 2INZA 3SCWA 2E3ZA 1SJBA 1Z44A 3M7WA 4YTSA 4GKTA 1XBVA 4AW7A 3FDGA 4RW3A 4D1JA 2PWFA 3F5JA 3EDDA 4NJGA 3MHUA 2WMFA 3W07A 4ATWA 3C86A 1JYWA 1F2JA 1UC5A 4G7EB 1W3NA 3E74A 3IGSA 2DV0A 4H83A 3G1DA 4XWUA 3BSHA 3P2VA 3PTMA 3NZRA 3WQPA 1L2QA 3N3TA 1VF8A 3TWAA 3JRKA 3LMZA 1NELA 3WBWA 4ZOEA 1NU5A 4D1IA 4RZ4A 4PEKA 1B90A 1S3HA 3AWOA 1FHVA 3WH5A 3ERPA 2OEMA 5I06A 5HAOA 3W7RA 1L0PA 4YS1A 2AGTA 5F4XA 1NOWA 4FR1A 3KVJA 3WDIA 1KD0A 3I68A 4JAWA 1OK6A 3IUDA 3SCTA 4MNLA 3IJ8A 4DUWA 2HE8A 3LZ5A 4L56A 3DECA 5CZ0A 5DLCA 2GWNA 3II1A 4DB7A 2PLCA 2WKLA 3CQKA 3GWQA 1XLBA 5LIYX 2A5HA 4JKMA 3PBVA 3STGA 4L9ZA 3VGGA 3P62A 1VPYA 3W9ZA 2W6RA 3SBFA 4LYPA 4UXDA 3SI9A 3UT0A 3GVWA 2FZ8A 2DSWA 4U33A 3TNOA 1XICA 1FXPA 4FNUA 1X6NA 4LC8A 3H4WA 4MWAB 1XSIA 4JY8A 2EKGA 1KNWA 4PB3A 4QIUA 3CQHA 3IIXA 1T6MA 2VNCA 2DT1A 3EMZA 3RAOA 2BHYA 4XB3A 1VJSA 2O7SA 3QR1A 5EKYA 1JGMA 4WXYA 2VL4A 2YW4A 1W37A 2ASHA 4GVGA 4XD3A 4RNFA 4UUIA 3BW4A 2I16A 4KPLA 1IF2A 3H4GA 4GQRA 1Q6OA 3LOTA 3GRIA 1W3KA 1XM3A 1DP0A 3A6OA 3VMOA 3ELFA 5FF3A 4ZFCA 4GH1A 3WUBA 5KINA 2E8ZA 1TELA 4FS9A 1VJIA 1H2JA 3R6IA 2CCRA 3TE9A 4MY8A 1KM1A 4WEVX 3DYPA 3WH6A 3CTTA 3O0KA 1NDYA 3PTQA 2Z1WA 1GVFA 1LROA 2F61A 1MDLA 4KS0A 3GVRA 3BAYA 1XIIA 2YBVA 1UH2A 2WC3A 4GYJA 2VGIA 2WQDA 3U57A 2CZVA 3GKAA 4A6GA 1QI2A 3B8DA 2ODOA 1TX0A 2ISWA 4J3TA 4IICA 2QULA 3LGGA 3WLMA 3UZWA 4HTBA 2BV9A 3AYVA 3BUVA 2A3LA 3NPXA 4DI9A 3I7SA 3ARYA 2R1KA 1MYRA 1ZBCA 3GZ3A 1PKYA 1GONA 3CGTA 5REQB 3TCEA 3NPWA 3K1DA 2HXTA 3SCUA 4H8NA 1TUFA 1H0GA 4MPKA 3LLFA 2E9LA 3S0CA 2PTDA 1O1HA 3KE0A 2A6LA 3PG9A 3V5FA 2BOGX 2J9YA 1EXPA 4U2YA 1UR0A 3MKVA 3PBUA 1R7AA 3B40A 2D2GA 2F7FA 3GDRA 2PP3A 4KCWA 1W9UA 3NVDA 3WG6A 2Q01A 1EIBA 1L6YA 3AISA 4EOUA 4UMBA 1YXYA 1PZ3A 3EXTA 3SUUA 2PRLA 1T8QA 3RCYA 3REQA 3CAWA 4QCFA 3S9ZA 4HMNA 5BYWA 2XM1A 3HGOA 3SCRA 1X7IA 2VVSA 3KL5A 2I1OA 3PWIA 4DXVA 4EF9A 1NOFA 4ADSA 1MQRA 1UW9A 1DXFA 5LGZA 3CPUA 1S5VA 4R33A 4XBKA 4LCSA 1UOZA 2VR2A 4FNPA 2EPMX 5AYYA 1XKYA 2DW6A 2CZEA 1JXKA 1WBHA 3URQA 3MA8A 4PFHA 1NFBA 1XISA 4C6CA 4HNTA 1YEYA 1Q7ZA 3PBWA 1PVNA 2DP3A 1SO4A 3FKKA 1P0EA 3H22A 3VCRA 4DBEA 3DERA 2FMNA 3GNXA 4JNZA 4ACYA 3KBNA 4E2OA 4EXQA 4WJEA 2Z26A 3MMWA 3O6AA 4WVXA 4A4AA 3FJNA 2EPNA 3ARZA 4GQQA 2GSHA 1W32A 1MEIA 2FMOA 3UCQA 1OX5A 4ZTYA 2H3BA 2OYLA 2XVKA 1A47A 5C9XA 1XD0A 1GYMA 4CEXC 1F7BA 3GBEA 4C6JA 4JQ4A 1LP6A 1WB0A 4LUTB 1PX8A 4UTKA 3VIGA 3KM8A 2ZUSA 1JNDA 1XSKA 2X8RA 2AQWA 1N55A 2XIOA 3VE7A 3N2BA 1U1JA 3V18A 3SM0A 4XAZA 1R8LA 4QDMA 1G0CA 4G7FA 4LOCA 1EKOA 2SFPA 1B3YA 1KCKA 2X05A 2I56A 4M0XA 4OE7A 3BWWA 5CG7A 1W17A 1G67A 2OEKA 3P74A 4PBGA 3UESA 3GR8A 2R94A 3GIPA 3QY8A 2NSXA 1KR1A 4ZXOA 1GQNA 4J27A 3ZIZA 3PR2A 3SURA 1X1NA 3LU2A 3W1AA 1YE6A 3H7UA 1UR8A 3A23A 4D8ZA 4LUIA 4L9YA 4FNTA 4RK8A 1OCJA 4S39A 4WD0A 3ZMRA 2PGFA 2Z1XA 4WGXA 1TMHA 2AQOA 1OC6A 1I2PA 1U1HA 3AJXA 2FFCA 1VS1A 3DFTA 1WZMA 3GX9A 4AVFA 1HJUA 4LAOA 3SRFA 3T0CA 3GUWA 1WKEA 1KFBA 2GUBA 5ENLA 3VX0A 5G2HA 3IRDA 4P5UA 2WCAA 4Q8OA 3EA1A 3CU2A 1P0BA 2F6XA 4FP1A 4WF7A 1B3ZA 1GVIA 3I6RA 3QJAA 4NAEA 4ILSA 1HG3A 3OLGA 1K70A 1XHGA 3I3BA 2VR4A 2ATMA 1WX0A 1Z8AA 3CASA 4XKYB 1CGXA 1SW7A 3TC7A 1UQZA 3JS3A 1TPH1 1J93A 1TTJA 4IH3A 2YXGA 3QV9A 4HCDA 3S8HA 3M16A 1M7OA 1AMKA 1NARA 2YL6A 4QS5A 4E2DA 3N34A 5LA1A 1GOMA 1OFDA 1UIOA 5T8GA 3S2JA 1NP0A 2DDXA 3LDVA 3HA1A 4DLMA 4Q6XA 4LW7A 3WDQA 3ARSA 2V5LA 1DJIA 4PMUA 2ZBTA 1PTAA 1YX1A 4LS0A 1E6SM 3EZ4A 3VNYA 1BYCA 4IP7A 5LIXX 4JKLA 3NQDA 1G9HA 4P8XA 4HB7A 2GVLA 3PTDA 2J6VA 3MPGA 3EPMA 1LL6A 1JEZA 1L6SA 2OEJA 3VKKA 1UWTA 3OVPA 4C1KA 4PB5A 1PB0A 3LK6A 4HZ8A 1H0IA 1QK0A 4WDXA 4ATLA 2R6OA 2GQ9A 2VYOA 3R11A 4UOJA 4F9JA 5AC8A 1SM9A 3NTYA 1VP5A 5EMMA 4A3RA 5K2ZA 1YNYA 4KWUA 1LZOA 4CEUC 4JIIX 2XFFA 5H8UA 4E5TA 3LCXA 1TA3A 2D73A 2XH4A 2CHNA 4LNYA 3MANA 2BGQA 3MC5A 3PANA 3U8GA 3AHXA 4F2UA 1UWSA 3WQWA 1CXLA 2GJRA 4UFKA 4WX2A 3VOGA 5IHRA 3AHVA 1W2PA 4N6EA 3EA2A 2PUZA 1C8XA 1OT2A 4NZ1A 5MF5A 1FWSA 1BG9A 4S2BA 4Z2JA 5BZAA 4FHAA 2J47A 2NV9A 3NEVA 3T08A 5AVNA 3UZ5A 4KEUA 1OEPA 2Z4GA 3QHOA 3H2EA 3A22A 3M0IA 3W83A 4RDYA 4C7GA 1NOUA 3V5CA 1EOKA 1G4EA 1KFKA 2LLEA 1Q85A 3Q94A 2F6UA 3PUGA 1DJGA 3K30A 4W8AA 1BEUA 1BTMA 1Q4NX 1CLVA 5CBJA 1GOXA 2EG6A 1NJJA 3MU7A 1ESWA 2VC9A 2OZ8A 4PMOA 5EFFA 2D2HA 4AVNA 3QPZA 3L68A 1QWKA 5FEZA 3W2LA 4KWOA 4FOJA 1MQQA 3PBMA 1U1UA 1MEWA 4A29A 5H2ZA 5D9PA 1C9WA 3QFWA 2YSWA 3S6OA 5K3VA 2J24A 1YLVA 5LZLA 4IPJA 3HFTA 1DHPA 3WJXA 3F03K 3TUUA 5E70A 1RD5A 3VKAA 3GH4A 2QDGA 3QN3A 3ECQA 2PB1A 2E8YA 4DO7A 3ITXA 1JPIA 5BU6A 2GK1A 2Y70A 4XTIA 2ZXBA 3SDOA 1UQYA 2Y63A 3ZXWA 1Z42A 4QEHA 4WJ8A 1W5QA 1US2A 2HS8A 5A8NA 3T8LA 3LNMA 4WXZA 3R12A 3CPGA 2VOTA 3WLNA 3ZJ6A 2ZTKA 3WZ0E 1AA1B 4PUNA 2OZTA 4C6EA 4P2VA 2FH6A 2R1LA 3VC5A 1NIUA 3OBKA 1XD1A 4IMEA 4DHGA 3IJQA 3T4WA 1QWGA 1GJUA 3BG3A 3M0HA 1LRTA 1YTKA 1GVEA 2HVNA 4M7TA 3DX5A 4PTXA 1FDZA 1N7KA 3M47A 4N2YA 2YL9A 4XZLX 1LTDA 4BY3A 2CXEA 4ADUA 3JVAA 2QUVA 1US0A 5TF0A 4HA1A 1CT5A 3WD2A 3CAVA 2YX0A 1Q8AA 1QUMA 2C1IA 2WZMA 2NQHA 3PUDA 3WH9A 1GYLA 3TYAA 4N6FA 3WF1A 4AUBA 1XDMA 1JCNA 1FP8A 2QJGA 2O9PA 5GJNA 3SIMA 5HDRA 3VDHA 1EGMA 2RJHA 3BGGA 1DXIA 1ME8A 2FHFA 2ON3A 3EX4A 4IJRA 1XYCA 4QQ3A 3THCA 1E6QM 1KKRA 3R8RA 5F2GA 4AF0A 4RUBA 3NYZA 3HO8A 1EL3A 1FBAA 4W4QA 3QKZA 2A3AA 3LERA 4JICA 4B5UA 4B5VA 4BFAA 4U10A 3HZ3A 1PYFA 3T6CA 3LRLA 1ZAJA 1LJYA 4J7RA 1PYMA 3E0VA 4OQVA 1V0NA 3L67A 1MW1A 2CWXA 2X1SA 5HULA 4BCEA 1OGSA 4R7OA 1S46A 3N4FA 4Z0JA 1PDYA 3BZGA 5HPOA 4BQ2A 3QTGA 3TYZA 1KBBA 2WM0A 1ZRQA 1WP6A 1XYZA 3E12A 4YVVA 3H2AA 4QE4A 1QOXA 4DPQA 3E2VA 4GYKA 2NW0A 2W67A 3PZNA 1I9CB 2XH0A 2G41A 3IIPA 4A3QA 2Q3OA 5HWMA 1VFSA 2XJ7A 4D9PA 5FIPA 4L4OA 4AH7A 1OX4A 3BXWA 4WY0A 1NEYA 1S39A 2D23A 1J0ZA 4DJFC 4ERAA 5FACA 1KCZA 1VYRA 3R94A 1J0HA 4L1XA 3M0XA 3WLTA 3THUA 2DZBA 5LKYA 3AS2A 6XIMA 3F4WA 3W01A 4O50A 3I3DA 3L0NA 4ZODA 4LUSB 3CUFA 5DT5A 3GXDA 1RLCL 1RVGA 2E5CA 1B3WA 4FA3A 2ACQA 3LN3A 1ONWA 4WOQA 8A3HA 3JUGA 2YCIX 1QATA 4RV8A 2CERA 2OPJA 2V9DA 2WHMA 4KESA 2FDMA 4D2JA 4Q4MA 2HZGA 1QNOA 1PS9A 3W37A 4OBSA 2W0UA 3VMNA 5HANA 3W1LA 5CSYA 2Y0FA 1IWAA 5CAKA 1WYIA 1GQJA 3A24A 1LLZA 3UA3A 4CCEA 1EJRC 5FCZA 1HJSA 5E9AA 1OYCA 3C2EA 1WUEA 3UXIA 5FESA 1FHLA 1NFGA 3NXFA 2ZWZA 3ARVA 3EOEA 4GVFA 1LOLA 1JPMA 4XZWA 3DKJA 1DPMA 3W7QA 2ZUTA 4WHBA 3WJZA 1ZJIA 3GNPA 1OF6A 4IX2A 5T9CE 1RSCA 2I14A 4M24A 1IR2A 3NFUA 3M5XA 4KWVA 4IIHA 1XRSA 4DWSA 3I6EA 2D22A 2E5DA 5CSSA 1HJVA 2QPXA 3CIVA 2JF7A 1W1PA 3QGKC 2RHGA 3CBWA 2RDWA 4KW2A 4IQJA 3CUJA 4Q4KA 5E0FA 1L8NA 1V3HA 3S2CA 2PZNA 3TR9A 2PDGA 4RJEA 3BLEA 5CLTA 2O9TA 5HWNA 4FNRA 4C6KA 3S6DA 4BI6A 4AZHA 1IXNA 2VGFA 3C3NA 4JX6A 1U33A 3STPA 3K13A 4HCHA 2P5NA 1KFLA 1OQFA 3N6JA 3LRMA 1LUCA 5CBIA 2BNJA 1UG6A 3ANVA 3NL5A 1IGWA 4PCSA 4UB9A 4EPDC 2I9UA 5T26A 1UA3A 3G77A 2W92A 3TYUA 4DN1A 2XWDA 2PPGA 2FGBA 2J7DA 3CMFA 3P84A 4WZHA 4OUIA 2WVTA 4M19A 3UG3A 1QO2A 3H2NA 3EOUA 1E3ZA 2Z00A 1CW2A 3VOIA 3L66A 4QAWA 4D6CA 4M6UA 3F5KA 2J8TA 3IV8A 4G5DA 4UNIA 3ABQA 4JBRA 1K9DA 1UH3A 3WF0A 4Q3MA 3STEA 1N2VA 4X22A 3QZAA 1JDDA 1MUCA 2OTDA 2C0HA 3V4BA 5FJOA 1IWBA 3G8EA 2QVHA 4DUXA 4RDWA 2PCEA 2RKXA 3M4HA 4O54A 4PCFA 3B0XA 1V6VA 3UGVA 2QAPA 2WQPA 1W9XA 4HZ7A 2BY2A 1QW8A 4F2BA 3A21A 2BVWA 4F48A 1TA3B 2AAMA 1V3IA 3IIZA 1PV8A 1UD2A 4HMCA 1QMLA 4B3LA 3L9CA 3FN9A 4Q33A 3ZT5A 4QNEA 3DG7A 5I00A 4UFIA 1W56A 2YZ5A 2FFIA 5C55A 3IAQA 4DBDA 3WD0A 4Q8WA 3GZAA 1IQ8A 3M6DA 4GY1A 4AD3A 4BS0A 4UTWC 4F4RA 3TTQA 1KA9F 5MKGB 4IMDA 5EU9A 4EWJA 2GZXA 1WOAA 2X1IA 4ENLA 1MW3A 1JCTA 2EQDA 4P7LA 1Y0EA 1OK4A 3URNA 4IMFA 4S3GA 1ONRA 2WJDA 4LF1A 3KZSA 3TROA 1SFSA 5B80A 2QUMA 3C0QA 5HNNA 3BURA 1IEVA 2YBUA 2NQ9A 3GHTA 5H91A 3AALA 1S5NA 4C6DA 1GQLA 3ITOA 1PTGA 1Q2RA 4O1DA 3KWXA 3V0TA 5D8ZA 3DI0A 4L80A 3MYPA 2ESCA 2OO6A 1PHWA 2BHZA 1DQWA 1UC4A 4QS6A 3WDPP 1JCXA 1TPFA 4N0RA 4CD4A 2NQZA 2FHCA 3UXKA 3VD5A 1J0JA 4EF8A 4JIQA 3WD4A 2TYSA 2BMBA 3OTRA 1O5XA 4IM4A 2XIMA 3CUGA 1KFJA 2PWUA 3AZTA 4IX0A 4ZMGA 3E0WA 5FA5A 3N12A 4GRSA 4PTWA 1DWGM 2BZNA 1ZAHA 2VEMA 1REQB 3ZYZA 3I7QA 3TIMA 2C8NA 4LANA 3H12A 5KZMA 2VP8A 1F76A 4QAIA 3RF9A 2VM8A 3EX6A 2OSWA 4CCCA 2OG9A 1KCLA 1E0UA 1ZJBA 2XFRA 1KV5A 3W2KA 1JUEA 3A4AA 3QHNA 1XBYA 1R2SA 2ZRYA 3BGAA 1V3MA 3SSZA 3LS9A 3W26A 4GIRA 1HTIA 4JIPA 3O07A 4NNAA 2YCLA 4AHOA 2BOFX 3P60A 2DW7A 2NSOA 2WMHA 4PTNA 5G1MA 5DRIA 4AMCA 4E8GA 4D71A 4BHYA 4XZBA 1CCWB 1B3XA 1BLIA 4UCGA 1W3TA 2VZSA 4RDVA 3SQMA 1K6AA 4JTUA 1W9VA 1YDYA 4FLRA 3NR0A 2DIEA 2FLIA 1M41A 3TTSA 3FIGA 4MYAA 2QF8A 2GJNA 3W22A 1E4LA 4CN6A 3MMTA 1EBGA 2GJLA 1AL8A 2BDQA 2VXNA 2C79A 3TN6A 4L1WA 1KQYA 1SFTA 2OYKA 3FOKA 2VWTA 1VQTA 4L6OA 4IFKA 3C0LA 1JYXA 5I3KA 1JDCA 3QOKA 2EG7A 1U22A 4JQ2A 3TQKA 1RH9A 1P0KA 3FEMA 3JU2A 4E4FA 5LIUX 3H54A 2QAFA 5K4XA 1XH0A 1VFLA 5DANA 4DNHA 1OBAA 1BGGA 1CYGA 3MDWA 4NY2A 1HL8A 4IJBA 1XXXA 3N73A 1JR1A 3O9NA 3VK5A 4XD4A 5T9BG 3T05A 2J7CA 3F4DA 3BC9A 4UC5A 2DZTA 4AZBA 1X38A 2C16A 5CZJA 3TEVA 3VO0A 1JG9A 2PDQA 4S3CA 3VINA 2V30A 5MHBA 3N25A 3FW6A 2VX6A 1I45A 1X96A 4MADA 5KZDA 3PHAA 3OEXA 1W1TA 1JJKA 1R7OA 4MMWA 2VFDA 3KL0A 1QK2A 3V3WA 1W2VA 1XPYA 4FXJA 1TPEA 3AIVA 2QCMA 8TIMA 4YIWA 4JQ1A 3CUZA 3C5QA 4XQ6A 4Z1AA 3SADA 2GGEA 3CEPA 1H1YA 3D47A 1ONEA 1DJWA 2ISFA 3CZLA 5JH2A 5DCEA 3WL1A 4J3ZA 3MCNA 3UNDA 3DN5A 2Y7GA 3E6EA 3S46A 1P7TA 2ZYFA 1KBJA 1W5OA 4Y9AA 3DGRA 4IUGA 2QJJA 1ZQ5A 3CO8A 3EBVA 5HMEA 2WBKA 4WY0B 4IGNA 2HBVA 1WA3A 5HMSA 4AEOA 5D05A 5LNRA 1UD8A 3B97A 2VQUA 3MI2A 2I5GA 2ZA3A 2IQDA 1EJUC 3W28A 3QV8A 4M6PA 3W73A 1L9WA 3F2DA 2WPGA 3W1NA 1AQFA 1ECEA 4RE3A 3LG3A 3N15A 5XIMA 2X09A 3AS3A 4N02A 3PWGA 3S5NA 4H8VA 1F3TA 4DX3A 4EACA 2Z1SA 2RUSA 4S3FA 1YE4A 2XZ9A 2P53A 3DOPA 2XVPA 1EIXA 3EOSA 4LY4A 2F84A 3GNNA 3RCMA 1FHDA 5LSMA 4C5ZA 2CLOA 2H9AA 5KETA 4TQTA 1CGTA 1TVNA 1W8GA 3OZPA 4JL2A 1CXKA 4M1BA 4LVDA 1IIGA 3STFA 6ALDA 4GBUA 3IPWA 3WLIA 3FEQA 2J88A 2VD8A 2A0NA 2W79A 3VOJA 3WD1A 4NZCA 1ZNNA 2VELA 1PIIA 5G4EA 2NQJA 4PMQA 2VRQA 1M04A 3OHMB 3IEBA 2YW3A 3ZWTA 3OGRA 4DJFD 4IGMA 4AISA 1WDQA 3K8MA 1I1WA 3GW0A 2HXUA 4XZIA 3W7PA 1SZGA 3VIJA 3U0HA 4HMEA 3ICJA 4IIFA 1B31A 1EQPA 4UQCA 2F9RA 2L5HA 3IJLA 1B30A 1QDSA 1O7AA 4GGHA 2V82A 4W85A 1XL9A 3CV7A 1W5PA 2X7VA 3L4ZA 4GI9A 4Z42C 3VNDA 3W7KA 2WMIA 1C93A 1V0MA 4FF7A 4I7UA 3RM9A 3CNYA 4HU8A 1QR7A 2JALA 3R89A 2FVMA 2QCEA 1CGVA 4JFTA 2W63A 3LPOA 1VPXA 4PRTA 1UWQA 5U7SA 3DU0A 3GAKA 4Z08A 3LI0A 4F0HA 4PMYA 1XW8A 1GOQA 1T8XA 4HIBA 4GINA 5RUBA 1KRMA 3SR7A 5AY7A 2PEVA 4KFNA 4H9TA 3EWZA 5IDIA 3UY7A 4XIAA 1I4NA 5FF2A 1R3SA 4TV5A 1J0KA 1VHCA 1A0DA 1K8XA 1JQVA 2CBUA 3FA3A 1TTIA 5ABGA 4PCPA 1QHOA 1X7FA 1HKJA 3I3EA 3ZJKA 4B3KA 4LSBA 5TIMA 4NF7A 4CNPA 4JTEA 3RHGA 3BG9A 1UP0A 4J28A 4A3UA 3F2CA 4XAPA 2P0OA 3K2GA 3CHCA 1FFQA 3N2XA 2Z25A 4AIOA 4ES4A 1H7OA 3UJEA 2GGGA 4JIRA 1C8QA 2FB3A 3BAJA 3QC3A 1HKKA 3CPRA 4OOZA 3RMEA 3ONCA 4MJMA 3EMQA 2BY1A 3P0WA 3N17A 3O3RA 1Q6GA 4RL3A 3AYRA 5EFDA 5ECVA 5FL1A 2FVKA 3EKZA 3AC0A 1TJ2A 4LYQA 3LCIA 2TMDA 3FXYA 2NLYA 1E70M 4HNOA 5FKYA 3USZA 3VIHA 6XIAA 1XC4A 3AIUA 4O14A 4O11A 1K9EA 1PAMA 2AGKA 3LPFA 4O8RA 3VC6A 2Z1BA 3BK0A 1S2CA 1R47A 3U4AA 1TR1A 4WSJA 5I77A 3DFSA 1R3QA 3CAQA 1EJXC 2WHLA 4N4QA 4E3VA 2XSAA 1R87A 3OGVA 4PUKA 4ACZB 1B3VA 2C0AA 2YA2A 3L4VA 1KB3A 4C7FA 2DIKA 1I1XA 3A4XA 3ZJ7A 3SUVA 1XRVA 1TCMA 3PZVA 3L7RA 3C2RA 2FZNA 3N9KA 4TMCA 1UUMA 4D6GA 3T81A 1Y65A 1ZCOA 4Q4RA 4CN4A 3G1VA 3N13A 1KXTA 3W7CA 2NUWA 3S5SA 4O53A 1J79A 1J8VA 4GJIA 1RJQA 5TQLA 4F0RA 5LNVA 2Y62A 2WO5A 4HK7A 2A3HA 1Z9AA 1VH7A 3G24A 3FGCA 4PL1A 2BLEA 3CV2A 5CJNA 1J6OA 2OSYA 3GDMA 2F2KA 3ISIX 3SRHA 4OJYA 1ML1A 1IT8A 5DMYA 4OHQA 1PL9A 3FHAA 1ECQA 3QV7A 3NQEA 2G3JA 2D3NA 3NQ2A 1HL9A 4XAGA 5JVLA 5TNVA 2BX7A 5HQEA 3H2FA 5IRPA 2BXZA 4B4FA 1VFOA 1EHAA 2E77A 1HVXA 3QR3A 2FPYA 1LG2A 4AIUA 3WH8A 2W4XA 4AEEA 3H24A 4HTYA 5IOBA 3NOYA 1L6WA 4MYXA 5F4SA 3VIKA 3UZXA 4I9JA 3BJTA 1JUBA 4HZ6A 3TQVA 1ZY9A 1FCBA 2ZUMA 3TFCA 4IQLA 1VJZA 3MUIA 4N9DA 2ACUA 2JEPA 3GTXA 5LYRA 4RDZA 1OINA 3AWNA 1J12A 3EWYA 1E51A 5D30A 2WJZA 1BGAA 4Z2GA 3R43A 7A3HA 4JHZA 3RRXA 3A4JA 4O1EA 1FWHC 2ZZ6A 3RM8A 1ADDA 2REQB 2PTWA 6CGTA 2J77A 2ZRWA 2TSYA 1Q63A 2CESA 1ISWA 1U83A 1QPNA 4G9PA 4MAVA 3ZM8A 3CZEA 2WSKA 3FVMA 3UZZA 2YKKA 1DE6A 4J3WA 3TYBA 1IYXA 1OFPA 2ZRZA 4NL1A 1AZ2A 4GH3A 5A6JA 3TJIA 4Z1BA 1L8PA 4V2XA 4M81A 2GPTA 3ORWA 1T5AA 5DY2A 2Y5SA 4R53A 1DHKA 3FCPA 3GVGA 5D8WA 4K6AA 1XUZA 3BARA 1NY1A 2BHUA 3LM3A 1WXZA 2G3NA 2VC7A 1C91A 1SU5A 1Y5WA 4UBPC 3NA8A 4X61A 5FEPA 2GJXB 3L4UA 3POHA 3H7RA 1FH9A 1RA0A 1QBAA 3V0UA 4A2RA 4F0KA 2BOEX 3P8JA 3G0XA 1KBIA 4FK9A 3GH5A 3NDOA 3DESA 4ICNA 3WNLA 3GG7A 1RCOB 4S3BA 3WUFA 3T9PA 3LXAA 1R3WA 1X39A 3B04A 2PWHA 2VMFA 1UZDA 4NI8A 1V03A