3TX9A

Oye1 complexed with 2-(hydroxymethyl)-cyclopent-2-enone
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title Studies of Enantioselectivity in OYE1
rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 156
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tx9A00
5F1VA 4TR9A 2YFNA 4CNOA 1YXCA 1ZALA 3N2MA 1HO4A 5L9FA 2WSQA 2WJZA 4FO4A 2DZPA 4FIQA 2NXGA 2Y7GA 1XUUA 1M7OA 2R8WA 2R91A 2BXVA 4DBEA 1DJNA 3N34A 4Q4KA 2Z6IA 3T78A 3LERA 1H5YA 2QR6A 1Q45A 3C52A 4RXFA 4NZJA 3UD6A 1CI1A 2Q8ZA 2X1SA 3TK7A 1G7VA 3M7WA 3WJWA 1EP3A 4UTMA 5I3HA 2WOQA 2X1TA 3LCIA 4JIPA 1XL9A 2NUXA 2WV8A 3NYZA 2BX7A 2A2IA 4X9SA 4HNVA 4XWUA 4PTNA 1VYPX 2W79A 2GJNA 1Z48A 3G0SA 2FDSA 3GNDA 3W9ZA 4LTSA 1PL9A 1L6SA 3I7SA 1LLZA 1VH7A 4EWND 5TBOA 2QJIA 2ZZ2A 2RKXA 2J27A 4NT0A 3MYPA 3RMJA 3TKFA 2QCDA 3QH2A 3LV5A 1TPWA 4BK9A 4NJKA 4JTUA 2OJPA 1KLZA 2ZRUA 1IXQA 2RDTA 5HR6A 1F6KA 1UB3A 3SGZA 3G1XA 3QW4B 1R30A 4JYEA 3E12A 3SR7A 1I2NA 2WSYA 1MEHA 2FIQA 4MZYA 4QM1A 1A50A 3BV4A 4L4MA 2QEZA 3ABSA 4CQAA 3W75A 4ZMGA 1FCQA 2RH9A 4M19A 1TQJA 3B8DA 1X7FA 2HS6A 4JTLA 1LOQA 3LLFA 1Q3NA 1WXJA 3C2VA 3NEVA 4ZL1A 4UTUA 1P0KA 3W87A 4WY0B 4ORIA 3VFLA 2YDAA 4O50A 4JGDA 5E93A 4Z0SA 1UUMA 3PBUA 3IIPA 2CLIA 3BGJA 5AB3A 3UXAA 2I1OA 1FY6A 3W2KA 5DN1A 4X3ZA 3G1DA 4MYXA 2ZA2A 3F4WA 3BG9A 2YXGA 3N19B 4Q33A 5D38A 3EWWA 4WQ6A 1JCYA 4KKXA 4OBTA 4KWVA 5AHMA 1OFRA 1W3IA 2WPBA 4N4PA 3VE7A 3QRHA 3BW2A 1H7NA 2QAFA 3KXQA 3O1NA 5D33A 3T55A 4UUIA 3UZ5A 2EGZA 1KA9F 1AG1O 3C2OA 2PRHA 3NAVA 1PVNA 1T99A 4R34A 3S5ZA 4R33A 1K02A 4DF2A 3EWXA 2G5WA 3LV6A 4UFHA 2J9YA 5HINA 1RQHA 5F2IA 3GXNA 4LNYA 5FF0A 3S6DA 3QM3A 4GUGA 1TJRA 1VZWA 3HMJG 5HNRA 1YTDA 2Y89A 1VR6A 3GIYA 3DKJA 2G97A 5A5WA 1G4TA 4O28A 2GQ8A 3CEUA 1R47A 3PR2A 1OX4B 3FFSA 3I7RA 3TROA 3W2MA 1XBYA 1ZAIA 4HKPA 3E9AA 3G0UA 1E51A 1G4PA 2H90A 2Y7FA 3QMTA 4LT9A 2V2DA 1B3OA 3NA8A 3QPYA 3T4CA 4NNAA 3L0GA 5FEWA 3KFTA 1WA3A 4Y90A 2DZWA 3NL3A 3L0NA 1RV8A 2A4AA 1VCFA 4WOQA 4HNTA 1L2UA 3LCWA 4K36A 2WO5A 1FCBA 2C6QA 2X1RA 4BR1A 1FDYA 1K8ZA 4ZQMA 3A5VA 2C18A 1X1OA 1X8FA 4MYAA 3PWAA 3LM7A 1NFBA 5BOOA 1S3HA 4ZQRA 2J24A 2A21A 3G0XA 5G2WA 3STCA 4UR8A 5AC6A 2F7FA 1VHNA 1G67A 2QCCA 1AL7A 1GG0A 3VCRA 2PCQA 1F05A 4JTJA 1FDJA 3WJSA 3VKJA 3S9YA 1G7UA 1O5XA 1KFKA 4O12A 1Z41A 1GVQA 4MFEA 1TTJA 4DO5A 2H3DA 3MUXA 1K7EA 1R2TA 3IEBA 3TXVA 5BRBA 3PS7A 1KM5A 3EXRA 4IX0A 5LGZA 4N2YA 2E77A 5AOUA 1JUBA 1P1XA 1A5SA 4O57A 4I7UA 1TV8A 4WX2A 2ATMA 3FOKA 1VHCA 3NG3A 3ZFHA 1R46A 1W8SA 4Z1DA 1EP2A 1DJQA 2JK2A 4PH6A 5KSWA 4Q32A 5D37A 3HPSA 3BPWA 4GRSA 1WOBA 4FX6M 1LTDA 4JY9A 2GPTA 3H54A 3G1FA 4WY0A 4MUZA 3HPZA 1HFBA 1SSDA 5I3KA 3GLCA 3FIGA 2EF9A 3ANYA 5AHIA 4K39A 3CEPA 2YW3A 3QFEA 3W1NA 5A8GA 4O16A 4NUWA 1GTHA 3KHJA 3CM4A 4YWIA 2VEKA 3GDKA 2C0AA 4A29A 3M1ZA 2YYUA 3LCXA 1OJXA 3G24A 1XBZA 5KZMA 4QSHA 1C29A 1GT8A 2HS8A 2P0OA 2FTPA 3THAA 4M7TA 1QMLA 2DJXA 1SR9A 2DP3A 3P8JA 2XN1A 4FNTA 3LLDA 4AMAA 3C2EA 3QMRA 3GDTA 3DZ1A 1OFQA 3QPZA 2CZDA 2VXNA 2A7RA 1BTMA 4UFLA 2Y88A 1FUYA 3UWQA 1QPOA 4O8RA 1TPH1 2AGKA 4N9DA 3GX9A 3EX6A 3W88A 3TDFA 4NZFA 2E5BA 3L21A 3P82A 1EPXA 2VFIA 3FYPA 1IXPA 1QPNA 4LVAA 4O11A 1H1YA 1QO2A 4R7JA 4S2BA 1I2QA 2YYTA 1H7XA 1FXQA 1IF2A 1OX4A 5LHEA 5AN7A 3OVRA 5F2MA 2JKPA 4HSNA 2I9EA 1XC4A 1TREA 4JX4A 3NXFA 4PODA 1KM4A 4DELA 1H63A 3QF0A 4U28A 1YDNA 3LB0A 5DY3A 1H7RA 2FB2A 3STGA 4TMBA 4LUIA 4QNEA 1W0MA 1W54A 4XTDA 1X6UA 3BLIA 1H62A 4XBSA 3GKFA 3V75A 1UBSA 3EWBX 2RDUA 1HL2A 2QUTA 5FI8A 3TC7A 4GUHA 3UZJA 2QCFA 2DZSA 3NR0A 1QDSA 3O15A 3UXDA 1Z42A 1VLWA 3TV8A 2CWNA 4D2JA 2NZLA 3DU0A 4P2VA 1F7BA 5L6UA 3STEA 1L9WA 3C61A 3G1YA 4A21A 2ZQ0A 3MP5A 2Y63A 5CZ0A 1YADA 3F1QA 3L5LA 4JTTA 1BWKA 3TFCA 1L6YA 2R14A 5IBXA 3CWNA 4IX2A 1DOSA 3QZEA 1O4UA 3DKLA 3ATZA 3EX2A 4JICA 4JTHA 4MLRA 4UTIA 1W1ZA 3QSRA 3QC3A 2ZZ6A 3MI3A 1TPDA 2PE4A 3O16A 3HB9A 3W1XA 1AW5A 4LV4A 1GPWA 3L65A 3W23A 2BZNA 3ZS4A 3LHVA 5IBXC 5KZEA 4M5PA 1O94A 1JULA 4L4LA 5C5YA 3O6CA 4MZ1A 4K38A 4NNCA 4IPIA 1KBIA 4N9CA 4LRTA 2A0NA 4A3UA 4LVFA 4M6QA 5CPMA 3DAQA 4TIMA 3MI6A 4DO6A 3I7QA 1VQTA 3IGSA 3LTPA 5G1TA 4G1KA 2Y62A 1XFBA 3T40A 4LOCA 3NQ7A 4AB4A 2OZ0A 4BFAA 1B57A 1J2WA 3CIWA 5EKYA 1S5WA 1XDMA 3W7NA 4N9EA 3PB2A 1RPXA 4H3DA 4QNWA 4CCDA 4YCOA 3R8RA 3CLMA 4FXRA 3W7JA 2V2CA 2BWGA 5CKSA 1FWRA 3EXTA 3TJXA 2Q8LA 3W1MA 5EA9A 4JTSA 4N4QA 2Y61A 3MYOA 3UY7A 3W7IA 1F5ZA 1RD5A 2QCLA 4LV9A 4O15A 1TV5A 2VEPA 3SY5A 1LP6A 3SECA 5CZTA 3E02A 1OF6A 1ME9A 3HQ1A 3DGRA 1ZENA 2YSWA 2DZVA 1XUZA 2Z6JA 1TPVA 1QR7A 3IIZA 3TAOA 1EUAA 5D2YA 4HNUA 2ABBA 2NUYA 3P60A 3C0JA 4GJ1A 4GWEA 1J5TA 3DXIA 4LRSA 2VC6A 2ZZ7A 5LNUA 2FPTA 1XKYA 2QKFA 3FJ6A 5TIMA 3W6YA 3UYCA 2V0TA 3IV3A 4HSOA 4I7WA 3DFPA 3BG3A 5BNKA 5AC8A 2GVGA 1KFJA 1NAL1 3WFAA 1GVFA 1ADOA 1G69A 1GVRA 5G2IA 2CW6A 1AW1A 5J5RA 4YXGA 1RVGA 4LVDA 2TPSA 5DCDA 1PIIA 3OHIA 4O1DA 3W7QA 5D2TA 3FKKA 1MXSA 4JTFA 3LHWA 2CU0A 4XUGA 2VFDA 5HJLA 3VI2A 3RLVA 3S8HA 2W0UA 4KFPA 2JGYA 3O63A 2V82A 1TRIA 3C4UA 2VOMA 1GVSA 1NSJA 4QISA 1VCVA 3KRUA 1ZNNA 3U2OA 1BWLA 1H51A 3MI2A 3TA6A 3TMQA 1YDOA 2JBMA 4QAIA 2WNQA 4NU7A 3YPIA 3FYOA 1OFEA 3EX4A 3SIZA 1SZNA 1WBHA 2V8ZA 1NEYA 1DBTA 5I3JA 1ME8A 4NVTA 1DQWA 4DEFA 3G8RA 3R12A 5F4XA 4FB7A 4MPQA 3S1VA 3LX9A 3LHTA 3HG5A 4Z0JA 2VENA 3LRMA 1KM0A 3DH7A 5CSSA 3VNDA 4H4IA 3NQ6A 1FWTA 3DFOA 2FQIA 2J6XA 3LTSA 3G3DA 1OFOA 3MBFA 4MZ8A 1SO4A 4MLJA 2DJLA 1YPIA 2H3BA 3JRKA 2H8ZA 2ISSA 5EY5A 3L67A 4PFMA 4KWWA 3W74A 1H61A 2ZTKA 1RZMA 1JRBA 1YDVA 2V5BA 1ML1A 3RFAA 4ZZ9A 1TTIA 3L2IA 5EMUA 1KFEA 2BTMA 3A9IA 3PM6A 1OK6A 4DBDA 2X16A 1WYIA 2KZHA 2VKZG 1OG0A 4O14A 1QOQA 4FIRA 2YGYA 1I45A 4BI5A 1FXPA 3C8FA 2GUUA 3Q94A 2EKCA 1TSIA 4NX5A 4MJMA 3W2NA 4CQ9A 2PC4A 3CTLA 3P8IA 4ZQOA 4RKAA 3SGUA 5C55A 3L66A 3HG2A 2ZZ1A 4A2SA 4B5NA 1A5AA 3A22A 2NUWA 5T26A 1WV2A 3USBA 2QUUA 2OT1A 2QJHA 2TYSA 2ZRYA 1WX0A 3M5XA 3HGSA 3N3MA 3BARA 4JTKA 2C15A 3HF3A 1OFPA 4DQWA 4K7YA 3P67A 3G1VA 2A7PA 2ALDA 3W2UA 3Q58A 3NPVA 1VCGA 3MMTA 5K9DA 1WBJA 3THQA 3P61A 1HG3A 1EUNA 3HBLA 3W2JA 3P74A 1T0OA 4ZQNA 4ADSA 5G2HA 2NLIA 1H50A 4NQ1A 1P0NA 4JTEA 2DZXA 4JN6A 4NNBA 4JXCA 2C13A 2H6RA 1FWWA 3KAOA 1JQVA 2XN0A 4UC5A 1TPC1 2EHHA 4PCFA 2E6FA 3GNNA 3LHYA 3B03A 2CZFA 4M7SA 2ZA3A 3TIMA 3PUDA 3B04A 4ZQCA 3PAJA 3TQKA 5F1UA 2HMCA 3UQNA 4TX9A 4AH7A 1EIXA 5F2GA 4E2DA 2QCNA 3GDRA 5SWUA 4IMFA 5K2ZA 2ZYFA 1DVJA 3PULA 5D30A 2B0MA 4FNPA 4WXYA 5HWMA 1M7PA 3W3OA 1EP1A 2A1YA 5DBTA 4CLMA 3A23A 3QYQA 2VFGA 5CGQA 4UCGA 2C1HA 1IGSA 1QPQA 3ZR4A 2A5HA 2E6AA 3W07A 3R5EA 1MO0A 4QITA 1F76A 4Y96A 3N14A 5DCEA 1SUXA 3WK0A 3WJYA 4UFMA 2ABAA 5AHLA 3PBVA 3AJXA 3DFSA 4DO4A 5I3GA 4HPJA 3EWZA 3PSVA 4LUJA 1CW2A 4IUOA 4WD0A 3NQCA 2CLOA 3BK0A 1Y0EA 3LI0A 3NO5A 4OV4A 5AHFA 4TMCA 4W9TA 5FEXA 1LDCA 2V9DA 1I2OA 2NX1A 4LS1A 2DZUA 3TQVA 1SW3A 3RLUA 1RR2A 5LZLA 3ABQA 4LVBA 2D73A 3M5VA 1PE1A 7TIMA 1HTIA 2O7QA 4NX0A 2NX3A 3B0VC 3PB0A 2ZZ4A 4Y9AA 1BEUA 2GVLA 3RNDA 4TO8A 3S1XA 1VS1A 3B0UX 1T96A 3TMLA 1YTKA 1D9EA 4E38A 3NGJA 2J9ZA 5LHFA 5D2VA 2J88A 3MP3A 4FNRA 2ZRXA 1SW0A 1N55A 1VLIA 3MJYA 4CCCA 4C1KA 1LM1A 3C2RA 1TV7A 3W84A 4M6PA 3H53A 4UMAA 3PG9A 1W5PA 5AHEA 4H6KA 4UNKA 4IMGA 3H55A 3P5ZA 4ORMA 4UFIA 5D05A 2X30A 3W7CA 3UWUA 1JCLA 2CLMA 1TO3A 3FEMA 3NL5A 3HGRA 3TR2A 1SPQA 1IIGA 4ONVA 4IWWA 3LXAA 2NWRA 2QJGA 4YL2A 3FLUA 2C19A 2R94A 5FF7A 3DFNA 2F84A 3HG4A 3W70A 3NQMA 3P62A 5C2XA 3IIXA 4NXSA 1DL3A 2GJLA 3T7VA 2BSLA 1JUEA 2B7OA 2RHGA 1LLWA 1UUOA 4AHOA 4BI6A 3BG5A 4HN4A 1M6JA 4XKYB 4PL1A 4KFOA 4EF8A 3OA3A 3BGGA 2HTMA 1OYBA 5G4EA 1PHQA 3W2LA 3FA5A 4R53A 3DI1A 5U7SA 3KVJA 3W1QA 4WUIA 4CQ8A 4HIBA 4ML9A 3NQVA 3CB8A 4K37A 3BW4A 1FWNA 4Z1BA 3LBCA 4OU1A 4N9BA 4UTTC 3P7YA 4LW7A 3S42A 1LOLA 3NDOA 4CNPA 5DBUA 1W5QA 3QQ1A 4FX8A 1MZHA 3B4UA 1IXNA 3G1SA 2YX0A 4RLIA 4RZ6A 3GYEA 2ISWA 4UTKA 2NV1A 4JYDA 3QEZA 1L6WA 1FX6A 1F74A 3LCLA 4MIMA 4LC6A 5AYXA 4PEKA 3FS2A 4FEZA 2GOUA 3GKAA 4OQVA 3U8GA 5HR7A 3L5AA 4IPJA 2GQAA 2WQPA 5LNSA 5HWNA 3NOEA 1VJIA 3N9RA 2VEIA 4RZ4A 3LGEA 3W7RA 1J4EA 1SFLA 3W7LA 5H2ZA 2A6LA 1KTNA 2TMDA 4JD4A 3U6WA 4BF9A 4MFDA 6ALDA 4EF9A 3LCFA 1Q6OA 5ABTA 3G22A 2CLHA 1THFD 1JCNA 4IOTA 4O53A 3NVTA 4QIUA 1LRNA 4MVAA 3DBPA 3W72A 4EVZA 1QWGA 4Z1AA 3CPRA 4NXKA 4OE7A 2Z2UA 1TYGA 1LROA 5F2LA 3QQ0A 2WKJA 5F4WA 3W86A 3E96A 3NZ1A 4UIOA 5MHBA 3TAKA 4AWSA 3NQDA 3P5YA 2RFGA 3P81A 4XTIA 4J9JA 1TIMA 3VE9A 4ICNA 3QJAA 2PURA 2A7NA 2QCHA 2TRSA 3MHUA 1QO5A 1VYSX 4Z1CA 5CPLA 4JDBA 3F03K 3C56A 3G3MA 1KM1A 2G96A 1ZCOA 3IIVA 5CPNA 3TXZA 2DZTA 1WQ5A 1GOXA 3HO8A 3EX3A 2ZDRA 4BWLA 2OT0A 1NF0A 4DPPA 3IVSA 2FLIA 3TW7A 1O60A 2GVJA 2QCDB 1TPB1 4GUJA 4O1BA 3WK3A 3NQGA 5IM51 3DHDA 3AO0A 3A5FA 5FEZA 1VRDA 1OHLA 1DHPA 4AF0B 3W7OA 3M43A 2OX1A 1XXXA 3CIXA 4CCEA 5G4WA 1F2JA 1TRDA 4DF0A 4XKYA 1K7XA 4BWLC 3EWUA 1SW7A 1YTEA 2VFHA 4Y8FA 3OEXA 5FEPA 2CLKA 1UCWA 3HPXA 2V5LA 3NPUA 3L9CA 5LNVA 2X1UA 3HIJA 3W7GA 1XBVA 1WOAA 3HG3A 1CX9A 1KTBA 1DKWA 4MOZA 1D3HA 4WY0F 1W56A 3SJ3A 1A5BA 4WOZA 2V2HA 1H7OA 2ZBTA 4XBKA 1RQBA 3LCGA 3KVKA 1GQNA 1QOPA 2ZZ3A 2DU2A 3C3NA 1U83A 2NV2A 3UWWA 2E68A 2QCEA 3WK1A 5I3FA 1TPFA 1KM6A 2B7NA 5FESA 3W1TA 1LRQA 3I65A 4Y6GA 1OVDA 2TSYA 5K4ZA 1H1ZA 1OFDA 1GEQA 3I68A 4RZ5A 5DELA 3BVJA 3KX6A 3FJLA 3TH6A 2RDWA 3HGJA 1I2PA 4AWTA 1PS9A 2C14A 2ZZ5A 4RJEA 5KINA 3GXTA 2P10A 1EA0A 4N6EA 2Q3RA 4OGZA 1TB3A 3OVPA 2QF7A 1FDZA 1RQEA 3CT7A 4S2CA 5CSRA 3B05A 5HMSA 1GTEA 3WK2A 4O18A 3SFKA 1SFJA 1X1ZA 4WJEA 4O0KA 1LCOA 2YPIA 1M5WA 2B4GA 1SO5A 1W3NA 1I2RA 1FQ0A 1SU5A 5C6MA 3JR2A 2ZRVA 3MO7A 1KTCA 3GDMA 4MY1A 3EEGA 3ATYA 3GR7A 5G5IA 4O13A 4FHAA 4AHPA 4N6FA 1NVMA 3TC6A 4GFSA 3UWVA 3EX1A 1QFEA 3IRDA 4ADTA 2I14A 3LCHA 1JUKA 3S5YA 2NXHA 1AW2A 4S1FA 2NX9A 4OHQA 5D2WA 3SI9A 2E1DA 1SZFA 1AK5A 3GZ3A 3Q2DA 4UXDA 5HULA 4U4MA 2QDHA 4HT3A 5EYWA 1C9DA 3ZWTA 1VC4A 2ATSA 3SSJA 4DF1A 3M47A 2HSAA 4EOUA 1H7WA 1P5BA 3CHVA 3M5ZA 3O6YX 3W1UA 5LSMA 3W7PA 1VGAA 3MHGA 4FNQA 5HUPA 1ZAJA 4DPQA 4FF7A 2H8XA 3GXPA 3RF9A 2V30A 4RK8A 6TIMA 2P1FA 1QAPA 3FKRA 3O8AA 5F4SA 1VPXA 1EEPA 3KRZA 4K7VA 1KW1A 3LRKA 3PUOA 1N8FA 3TCEA 3NPWA 5J5DA 4BI7A 4IMEA 1OX6A 3TW6A 1W3TA 2IQTA 3EXSA 2LLEA 1KLYA 3NM3A 1R2RA 2E6DA 2Y6ZA 2B7PA 1OABA 3R13A 4OV9A 4JS3A 2QAPA 5AYZA 3C6CA 4UFKA 3UPBA 1KFCA 3M9YA 1I8JA 2NXIA 2ZRZA 4AF0A 2YZRA 1TJPA 1OFAA 3PY2A 1BKSA 1OYAA 5LNWA 1ONRA 4IXHA 2ZCGA 4LS0A 1ZFJA 3S5OA 1GVOA 4GBUA 1YXDA 1IIHA 4HHPA 3O06A 2NWSA 3OBKA 4ADUA 3NQEA 4LWWA 5KMYA 1G6CA 1XCFA 3OVQA 5G1YA 1TCDA 4WXZA 2OCZA 3LI1A 1GYNA 2CFFA 3ABOA 3R2GA 5EBUA 1O5KA 3W1LA 1FCUA 3TQ0A 2FPYA 4GC4A 5D04C 3W7HA 2J9XA 4O1CA 4JNMA 4IQLA 1ZAHA 4UMCA 2FFCA 1EB3A 4NJGA 1G4SA 1I4NA 3M44A 4FNUA 3W7EA 1JJKA 1QCWA 2YW4A 3R89A 1LRTA 4I7VA 1GZGA 2EAWA 3LBMA 4KFNA 1OK4A 1W5OA 4PL2A 4YLWA 4O17A 4RXGA 1LORA 3M0ZA 1JVNA 4UTJA 1A5CA 3L0KA 8TIMA 3OIXA 1LYXA 5HWJA 1WAUA 3HOJA 5HQEA 1FCVA 3KVLA 1W37A 5LNRA 3IGXA 3LDVA 2C3ZA 1Q6LA 5LGXA 5FF2A 3M6YA 2VELA 1ME7A 5K9CA 4NJHA 2QCGA 1B4KA 2ZTJA 3LHZA 4POCA 1MEWA 1PHWA 1W31A 1EWEA 2AQWA 1V7YA 2E5DA 2CLFA 1SQ7A 1F73A 2FPVA 4FNSA 1XM3A 4ZVJA 4UTHA 1PCWA 5CZSA 3N73A 3RU6A 3MHFA 3TU9A 1KFLA 1OF8A 1GG1A 2XFWA 2Y85A 1YPFA 1XI3A 1K3UA 1GJPA 3O6DA 4RV8A 3B0PA 1C8VA 5KITA 3HGOA 3BO9A 1TMHA 1HUVA 2ZA1A 4GUFA 5TQLA 3LRLA 3I6RA 1TPUA 1PV8A 4I9AA 3W7KA 3M5YA 3UWZA 4JDYA 2W6RA 4MKNA 5AFDA 1OX5A 3W1PA 2ISVA 5D09A 4IXXA 1YYAA 5K4XA 1QNVA 3PC0A 4ALDA 3A24A 4JYFA 3TJLA 1O95A 5D03A 3WJZA 1H7PA 1KV5A 3E0IA 2A6NA 3NZRA 1LZOA 4JEQA 4GUIA 4K8EA 1UASA 3GAYA 3L68A 5KTLA 2VEMA 1U5JA 1KFBA 4CNNA 3W22A 3L5MA 2B7QA 4AHQA 2C16A 2JKAA 4A22A 1Q6RA 5HUOA 5K3VA 1UJPA 4O10A 4UTTA 1OYCA 3DHFA 1DQXA 1SZEA 1KV8A 1P4CA 5BMXA 5DY2A 1ZHAA 2FJKA 3P80A 3N2XA 2Y7EA 2CLEA 5AC7A 3LOTA 4ZQPA 1QPRA 3W85A 1DORA 3D0CA 3GK0A 3RK8A 3PUEA 5LKYA 5C54A 3ELFA 1GWJA 4MJZA 4JR5A 4P61A 3EKZA 1EWDA 4O52A 5EL1A 3Q37A 1LBLA 3LTYA 1JCXA 3PG8A 3G1AA 3MBDA 3EB2A 3PSWA 4UFJA 2YR1A 2V81A 3P84A 3UPWA 1K8XA 4O0ZA 2ZRWA 4RX0A 1B4EA 1MEIA 2QUVA 1JCJA 4JTIA 3W71A 4IMDA 5KZDA 2E5CA 4O19A 3WJXA 4HNNA 1SO6A 1Z44A 1LBFA 5E0KA 1N7KA 3QSTA 1K03A 1SZGA 2UV8G 3DFTA 4RR4A 4GE8A 2O7SA 4QJ1A 4TU1A 2VFEA 5D02A 3C2FA 4AXKA 1EX5A 3OG3A 2E09A 4E0CA 3G1HA 4E2BA 1Q6QA 3S1WA 3CC1A 3GVGA 2WNNA 1JCMP 2WNZA 1VYRA 3CQ0A 5K9XA 3IVTA 5BMWA 1K8YA 2YCEA 1NF7A 1S5VA 3DENA 2FB3A 5FF3A 4O1AA 3UY8A 4IJBA 3NNTA 5FF4A 1TTQA 4NJJA 3KRSA 4YCPA 2E6YA 1F6PA 3O07A 4LU0A 4OT7A 4Z08A 3TNOA 4LS2A 3IVUA 4PA8A 3BLEA 1K7FA 1B9BA 1TTPA 3A21A 1T8XA 2QDGA 3UWYA 4UMBA 3W7DA 1SSGA 3TE9A 4X2RA 4YMZA 5E1QA 1PCKA 3MW7A 4UTLA 3O05A 1ICSA 1TQXA 5CZJA 3W73A 3PBYA 4A2RA 4JY8A 4JX6A 4GXMA 1FBAA 4OWGA 1FWSA 3F4NA 3GAKA 5D2XA 3HJZA 2DORA 4GNJA 1LBMA 2A85A 3CWOX 4X22A 3W83A 2WSRA 2GQ9A 3IIOA 1YXYA 5I3IA 3BW3A 3PF3A 4AVFA 3LXCA 4O54A 4K6AA 3MWAA 5GVJA 3NQ8A 1AMKA 4N02A 1JR1A 1LOSA 3BLFA 2JKEA 3PBWA 3TSMA 5BW6A 5DCBA 3S0CA 1W5MA 2CZEA 4O4VA 4AWUA 3SW6A 4FXSA 4IMCA 5AHNA 3K30A 3GB6A 5U4NA 4WZHA 3CU2A 3PVFA 3DFQA 3JS3A 4JX5A 2QCMA 3TX9A 3SZ8A 3W7MA 5CPOA 3B06A 4UTWA 3NM1A 2PRMA 4XZ9A 3S1UA 5AYYA 4RCXA 2EPHA 1V5XA 4K8HA 4MY9A 2YFOA 3IGUA 1SO3A 1XBXA 1OFBA 2BLEA 3NPXA 2XN2A 3M41A 1MSSA 1S5TA 3S5NA 2PRLA 2ZFAA 3TUUA 3KVMA 1TPEA 5DLCA 4NJIA 4FX7A 4HPXA 3G8EA 4AEOA 1WDWA 3NL2A 3T44A 1R2SA 3E49A 1KM2A 3TFXA 2Z1BA 4O4WA 4DXVA 4LC8A 4UTWC 4MY8A 4QQ3A 1KBJA 1AL8A 4IGHA 1H60A 3NQAA 1XDLA 3TSDA 3ABRA 2X2GA 3DI0A 4C1LA 1IXOA 3W1RA 1D3GA 3NQFA 2CZ5A 3GDLA 3KOFA 3EWYA 1HO1A 4AAJA 5DXYA 3G18A 3N9SA 4UNLA 5DXXA 3GR8A 5EPDA 1YLVA 2Y70A 3STFA 3QW3A 1KM3A 3QMSA 2OMAA 1ALDA 3INPA 1A53A 2Z0IA 3W1AA 2CLLA 4PC8A 3MP4A 1ICQA 3LHUA 5H91A 2G95A 3EKLA 1JRCA 3UNDA 5CG7A 5D32A 3V1PA 3W76A 4XQ6A 2AAMA 1ICPA 1GYLA 1W5NA 4UR7A 3LXBA 3NQ2A 2Y7DA 1DV7A 1ZJIA 4M6VA 4LY8A 3M16A 4LVGA 1G4EA 3TSBA 3NL6A 4JTGA 3ZWSA 2Q3OA 2VFFA 4JIQA 5K7JA 4EIVA 2JGQA 1ZY9A 1JQXA
chains in the Genus database with same CATH superfamily
1CYGA 3S47A 1J6PA 3FNDA 1ZALA 1HO4A 3NO3A 3EA3A 1XLBA 3VNJA 2R1PA 1W1B1 1M7OA 3NURA 3TA9A 3TYBA 2XVKA 1V03A 4W87A 3N34A 4Q4KA 4MAVA 3SUVA 4DJED 2ZADA 1LWJA 2C1IA 4PSRA 2INFA 4GKLA 4UTMA 3T0DA 4IQJA 2XGIA 4EWJA 3VMOA 1SZRA 4JIPA 5EMMA 4L6HA 3S6TA 2R6OA 2WV8A 3NYZA 3MDWA 1JZ6A 1Z48A 4C6JA 1RVKA 3AHZA 3G0SA 1XH1A 2WMFA 3WQCA 3W9ZA 4LTSA 4I6KA 4QS6A 1LLZA 1TWDA 4C7DA 1VH7A 4IQEA 5TBOA 3AMGA 4NT0A 1A5KC 1IR2A 3TKFA 4Z2LA 1ZBWA 2OJPA 1Y8BA 1NOUA 1KLZA 2ZRUA 4QEEA 1IXQA 2RDTA 2VZOA 1WKDA 1UB3A 1UP3A 3QBUA 2KX9A 1Q6DA 2FIQA 4C60A 4S3JA 2OQYA 1KD0A 1VBJA 3NYDA 4CQAA 1UW9A 4M19A 2RH9A 1VFOA 2YBUA 3B8DA 1WDRA 1JPMA 1LOQA 5E6YA 5LA0A 3W87A 5LIWX 4ORIA 3VFLA 2H9AB 4GG9A 3W6LA 1R3QA 2HVOA 3IIPA 3UXAA 3ANVA 1KKRA 4X3ZA 4GVFA 3F4WA 4I3GA 2YDQA 2YXGA 4DJEA 3N19B 4KKXA 2NSOA 1OFRA 2WPBA 4G5DA 3VE7A 2VX5A 1H7NA 5D33A 1NARA 4J3XA 3E5PA 3UZ5A 3E2SA 2VUYA 1AG1O 2PRHA 4R33A 1K02A 4IL0A 3LV6A 2J9YA 1RQHA 5F2IA 3GXNA 3IJ8A 4RNIA 5FF0A 2NQHA 3QM3A 3W25A 4GUGA 1JEZA 3HMJG 3EKGA 4H04A 2Y89A 2G97A 1G4TA 3CEUA 2Z4GA 3CT2A 1BG9A 3BZJA 4C6CA 3E9AA 1GQIA 2FMOA 2H90A 2DUXA 2Y7FA 3LUTA 2QUNA 3PBGA 3NA8A 3QPYA 3T4CA 2BY1A 3P2VA 1WA3A 4Y90A 3L0NA 3MSDA 1EBGA 3OJGA 1JGIA 1VCFA 1EJUC 4K36A 2REQB 2WO5A 2C6QA 1CECA 3WEZA 1FDYA 1K8ZA 4ZQMA 3ITTA 1QPKA 1B5TA 1H1NA 1X1OA 1E0WA 1X8FA 2G3FA 5BZAA 2V5KA 1NFBA 1JI1A 1S3HA 4C1NA 2I56A 3UVIA 1W3HA 2A21A 3G0XA 3N2TA 3DBNA 4KGJA 4M51A 1AL7A 4ZO6A 5CBJA 1U1JA 2R1MA 2TODA 1G7UA 2DGAA 2FH8A 2QT3A 1EH9A 4M29A 3WCZA 2HRWA 4LB4A 1H0IA 4DO5A 3IEBA 2XINA 3TXVA 5BRBA 3EXRA 3CZKA 1J6OA 5FSDC 2AL1A 1C7SA 3H12A 3MZNA 4PFHA 4O57A 4UCFA 3VDAA 4DZ5A 3NCOA 4I7UA 1GOMA 3NG3A 1CB7B 5CQ1A 4HGXA 4PH6A 1KWKA 5KSWA 4KWUA 7TAAA 2PLJA 4GO9A 3HPSA 4GRSA 1RY8A 4JY9A 1OEPA 3WBWA 3ISIX 3DFHA 2FVLA 1CZ1A 5DX7A 5I3KA 4PR4A 2EF9A 2J7DA 1UIPA 5AHIA 5A8QA 2PLKA 1XPGA 3CUZA 3FA4A 3UPMA 4D6EA 4NUWA 2UBPC 3S1GA 2ZVRA 1R9ZA 1OADA 1Q66A 2BBFA 5KZMA 4YTQA 2P0OA 4AIOA 1GUVA 2BXYA 1XS2A 2J13A 4M7TA 1N82A 3FV9A 1SR9A 1ODUA 4FNTA 3C2EA 3QMRA 3GDTA 3CUIA 3QPZA 3ALFA 2UY3A 4GZJA 4B16A 3LPGA 1FVPA 2E9MA 2Y88A 5DFAA 3H2NA 3RN6A 3RRAA 3GX9A 5TAOA 1T40A 3ZR6A 4ENLA 3VOJA 3PZOA 3P82A 1V6WA 3N6HA 1VEPA 3EOSA 5CPSA 1QO2A 4MNMA 1V6UA 1V6TA 3ABXA 1XRTA 5JIWA 5LHEA 1EDQA 2HVMA 5AN7A 3UJSA 4GXPA 3OVRA 4ATWA 2JKPA 4HSNA 1XC4A 1TREA 4FZIA 4J3SA 4H00A 3VIKA 3WLJA 4U3CA 5JH2A 1KM4A 4UQAA 1YDNA 3LB0A 1U30A 4CNUA 4QNEA 4M0XA 1YMYA 2DW6A 3MDUA 1XISA 3BLIA 5KEZA 2YB1A 2F6UA 4WKHA 4XX6A 1OQFA 2QUTA 1TJ1A 5BOFA 3UZJA 3PZ9A 3OHMB 1EC8A 1RA5A 2BHYA 2W62A 3UXDA 4RW5A 1BSLA 1E70M 2NZLA 4P2VA 2XFRA 1O5RA 3MP5A 6REQB 3VD9A 1YADA 3VKBA 3L5LA 4JTTA 3SCOA 4R85A 3GH4A 3CWNA 1KQZA 4MLRA 3EX2A 4JTHA 3SY1A 3M4HA 3ARSA 1AUSL 1W1ZA 3QSRA 3PAOA 1PBGA 3DG6A 1BYAA 3M6DA 3MI3A 1NH6A 1TPDA 3SN0A 5A8PA 3CASA 2BHZA 1GPWA 3WH9A 3S9ZA 3ZS4A 3IK2A 5IBXC 5KZEA 4M5PA 4KW2A 4C6QA 1KBIA 4N9CA 2A0NA 4A3UA 1PKYA 4LBUA 1DJZA 3BICA 4J4KA 5BYWA 4DBSA 3TZFA 1OIMA 2V68A 3AJ7A 3CIWA 3NZQA 3L2MA 3AS0A 2CETA 1MUWA 3R8RA 3SCPA 1HKMA 4EAYA 4FXRA 1HJSA 1E43A 2WC3A 3TZNA 5BROA 3GBDA 3W1MA 4JTSA 2V5JA 3UY7A 5DF0A 1CBGA 5IFTA 4AXNA 4ZE5A 2QCLA 3LBOA 2W4XA 4O15A 5CPTA 1LP6A 1P0DA 5I6SA 2WAGA 1OF6A 2O55A 5AVNA 1UOKA 1M68A 2E8YA 5G1MA 2DZVA 1XUZA 1BVNP 2XVGA 1W3KA 2ABBA 3M0MA 2D23A 2NUYA 4GJ1A 3DXIA 1BXCA 3FGCB 2DIKA 2ZZ7A 1M7XA 3QGAC 1BRLB 4OBRA 2EEXA 2C71A 5LNUA 4AIEA 4AY8A 2QKFA 1YPXA 2D22A 4NSBA 1ZCCA 4KEMA 4B90A 3F7JA 4WSJA 4GHRA 3UYCA 1DWGM 3U2ZA 4I7WA 1NM9A 3T0CA 2GVGA 2OWXA 2VC9A 1GVFA 3ZVHB 1ADOA 4PN2A 5G2IA 3KOXA 2CW6A 4GFIA 4HA3A 5GJPA 4Z2KA 3VX0A 1RVGA 3OHIA 2ACQA 3VOFA 5BXTA 1MXSA 4XUGA 2VFDA 2V3DA 3AUJA 2NQ5A 2W0UA 1KKOA 4KFPA 4DNHA 3CGTA 4V15A 1TRIA 3C4UA 3SCQA 1CGVA 4ATDA 5DEZA 3EEZA 1V0LA 2PDXA 3BJFA 3C3UA 3TMQA 1YDOA 2JBMA 2ZVIA 4NU7A 1PIFA 1SZNA 2VWTA 4DIAA 1EF3A 5I3JA 4DEFA 5F4XA 4U2YA 4AEEA 1ZP4A 4AYSA 4Z0JA 3LRMA 3ORWA 4GYKA 5CSSA 1Z8AA 3NQ6A 1FWTA 1F07A 3RCMA 3LTSA 1ZL1A 3G3DA 4MZ8A 4IL2A 4DZHA 2VUNA 1SO4A 3CUHA 3KZPA 3JRKA 2H8ZA 4HCDA 2ISSA 2YDSA 3W00A 3AXMA 4TTUA 5AZ1A 4DBUA 4WSHA 2ZWYA 1R87A 1RZMA 4KS0A 3MC5A 1TTIA 5A2AA 2OG9A 1NOFA 4QJ5B 1TV4A 3PM6A 4DBDA 3LYEA 3W38A 1CGTA 4L1XA 2YGYA 1I45A 4BI5A 3C8FA 4AG0A 2IKJA 1NOWA 2QJNA 1FH8A 2J7EA 3CL7A 2W5FA 4HVXA 5C55A 1FHLA 5DMMA 4CQBA 3ES7A 1L8PA 3USBA 1PAMA 3KHDA 2OT1A 3KP1A 3L4YA 1PKMA 3TN4A 1WX0A 1CPUA 3HGSA 3N3MA 1E56A 3SEPA 3WUFA 2Y5JA 4ZFCA 1OFPA 4NY2A 4K7YA 3SSZA 2PDIA 3FXGA 3W2UA 2QGHA 4X61A 3NPVA 3DOPA 4US5D 3GTXA 4PMZA 4GA8A 4QFUA 4A8RA 1HG3A 4DB7A 5HQMA 4LYRA 1EUNA 3W2JA 3WDHA 4ZQNA 1NFPA 3EGJA 1V02A 2W66A 4JTEA 4KRZA 2WHLA 2QXWA 4JN6A 3SO7A 4YN5A 1WDPA 1VFSA 2PBGA 3MTWA 4QLJA 3LHYA 1B9ZA 3B03A 4WGXA 1FWIC 2V38A 4B2DD 1Z89A 4AH7A 2VDHA 2CC0A 3CHCA 5K2ZA 1BVZA 3PULA 4GPNA 1EZWA 2B0MA 4FNPA 3BSHA 1KRAC 5DBTA 4WDTA 3UZWA 3A23A 2YBTA 5JVLA 4U5IA 3MVTA 1RALA 2IW0A 2C1HA 1IGSA 1BD0A 4LPCA 1MO0A 1GKPA 1P6BA 4UFMA 1MW1A 4ZA0A 3PBVA 3AJXA 5CC7A 4DO4A 1CXIA 5I3GA 4QSFA 3PSVA 4C7GA 1B3YA 1C7TA 4IUOA 2CLOA 1V79A 3LI0A 2Z24A 4W9TA 2OKOA 1LDCA 1E72M 2CZVA 2GOKA 2DZUA 3O0KA 2YDRA 2BXZA 3QN3A 4A3QA 1XWYA 4IUGA 4PUKA 3M5VA 1PE1A 1UZ4A 4NX0A 3VMPA 4Y9AA 1H3GA 4PB4A 2QLYA 2X8RA 4G6CA 3RNDA 2WHJA 4K1GA 3KEHA 3F4VA 5F7UA 1UUQA 4US5A 1JFHA 3NGJA 2J9ZA 1S5MA 2VX7A 2XIQA 5CGTA 3MP3A 4S38A 2ZRXA 3TP4A 2HXUA 1VLIA 4DWSD 3C2RA 3W84A 3U2CA 3TWBA 4UNKA 4UZUA 2PB1A 2CEQA 4UFIA 4UNIA 3OA5A 3NZGA 3FEMA 4F2BA 3NL5A 4LBRA 3HGRA 4H2CA 3LXAA 1A47A 2NWRA 2QJGA 3CH0A 3DFNA 1XR2A 4Z2JA 3W70A 4Q8TA 5B7YA 3P62A 1DL3A 3T7VA 2H9AA 2BSLA 1XINA 1LLWA 3H2MA 3BG5A 4HN4A 1M6JA 2IXVA 4MB4A 5ABFB 3OA3A 1ZUAX 1ZJAA 1EJRC 4HU4A 1UMLA 3OLGA 1KO0A 5G4EA 3BLOA 3GFYA 5CJ5A 4CQ8A 4HIBA 1FWAC 3QPEA 3KBWA 3QV6A 3TEVA 2OX4A 1XIGA 3CB8A 1FWNA 4DM2A 2SFPA 3LBCA 2G8ZA 4LW7A 5DANA 1VFLA 1LOLA 1IZJA 2CLPA 3QQ1A 1MZHA 5CCZA 2BS9A 2YX0A 4RZ6A 1N8IA 3AHXA 2ISWA 4UTKA 3QV7A 4JYDA 4EP8C 4QE4A 1L6WA 4AIBA 4LC6A 3DC8A 2FMNA 2GOUA 4ML4A 3U8GA 1FHDA 1ZU8A 3L5AA 2X41A 2BY3A 2GSHA 5EFFA 2BOFX 2A3BA 1VJIA 4P8UA 4DWSA 2J66A 2QUMA 1TKKA 3W7LA 1JYXA 3PN8A 2A6LA 4BF9A 3U6WA 4MFDA 5A6TC 3WQFA 1R8LA 4EF9A 1E15A 1NDVA 1Q6OA 4U2ZA 3ABZA 2G37A 3KCJA 4EK7A 3G22A 3EDEA 3SCWA 1LRNA 4EVZA 4GI9A 1XG3A 3CPRA 3CWHA 4NXKA 4QCFA 2Z2UA 3KDOA 1LROA 4B4FA 4Q8MA 3R25A 4ILSA 3BAKA 3QQ0A 5A8OA 4I9JA 5REQB 4LCSA 4I90A 1ZLPA 2RFGA 1TIMA 3VE9A 2YL8A 1TVLA 4P8VA 3BAJA 3U5YA 2QQ6A 4F0LA 1QO5A 5CPLA 4JDBA 3G3MA 1KM1A 3MCNA 2G96A 4JQ3A 3I6EA 2E4TA 4FLQA 5HDRA 3QFWA 2DSZA 1GOXA 4F40A 4GZEA 3EX3A 3VU2A 2ZDRA 1QW9A 2CHRA 2FLIA 4JL2A 1U1HA 1MNZA 4Y9PA 1NDWA 4E2OA 3NQGA 1EYWA 5IM51 3PZTA 3SUUA 2I5GA 3K2GA 5FEZA 3W7OA 1E9IA 2C79A 2BDQA 3CIXA 3QTPA 1HQTA 4X2PA 4CCEA 3RX4A 3WY1A 4BWLC 3EWUA 1R85A 4GQQA 1Z6KA 4H83A 4PMXA 1AFSA 2CLKA 3K8LA 3NPUA 3L9CA 4PCTA 5LNVA 3HIJA 3LQGA 5FJTA 4I9MA 1XBVA 1QHOA 1CX9A 3HURA 1XX1A 1W56A 3WLHA 1R5YA 4ZSUA 3LCGA 2MANA 2ZZ3A 2DU2A 4KCTA 5BRQA 4MNJA 1TPFA 4DXXA 2DV0A 2B7NA 1LRQA 1YNPA 3I65A 4GGHA 2GVEA 3AU6A 5K4ZA 1OFDA 4RZ5A 5E0CA 1XICA 3HGJA 3UZZA 6XIAA 1M65A 3Q4DA 1XRSA 4PMQA 3WDIA 3AZRA 1EL3A 4MJ2A 1LUCB 2FZ8A 1JZ8A 2P10A 4CEXC 1TB3A 1RJQA 3CT7A 4S2CA 4V1YA 2F6XA 3AXIA 3VPLA 3MKCA 3N2BA 4J27A 1R3VA 4WK9A 2YPIA 1M5WA 1W3NA 1FQ0A 3JR2A 3PTKA 3E2VA 5DT7A 3LS9A 3CJPA 2WZHA 4OTKA 4AZHA 1B90A 4FHAA 4XD4A 1ZJBA 1J93A 3VTRA 3L2LA 5KZ6A 4I5XA 1YKWA 2DUAA 2I14A 4BY3A 1OZQA 3S5YA 4I8DA 3LNPA 4OHQA 3SI9A 2E1DA 1AK5A 3Q2DA 2YL5A 1C9DA 3NSMA 3M0IA 3WMBA 1MW2A 4DF1A 3M47A 2F2HA 3VCNA 4Q7NA 3ENLA 3H70A 2O9PA 4FNQA 4W8LA 1ZAJA 3I4EA 3VNLA 1Q4NX 2J25A 3GXPA 3RF9A 2CBUA 4UQ9A 6TIMA 4BEUA 3T08A 2PDHA 3FKRA 1T7LA 3O8AA 1X6LA 3ZT5A 1EEPA 1VENA 3IWPA 1XF0A 1N8FA 4M8UA 1GOOA 2EG7A 5J5DA 4BI7A 4IMEA 3WLPA 4OUEA 4QDWA 3EXSA 1KLYA 4MNLA 1TWWA 1MI3A 4JN7A 2Y6ZA 2FGZA 3M9YA 5CSYA 4TVCA 2YZRA 4XIAA 1OFAA 3PY2A 1OYAA 4E3TA 2BG5A 1TA3B 3M0HA 4BS0A 4LS0A 3UFYA 4GLEA 4GBUA 3IAPA 1YXDA 5DO8A 3WLQA 3ME3A 1CXEA 3FK4A 1IIHA 4HJWA 3RITA 4HHPA 3O06A 3OBKA 1E55A 1ZZMA 2HISA 2Y8VA 4ADUA 4PEEA 4P7LA 3L4UA 4TUFA 5CLTA 5KMYA 1XCFA 3MMUA 5AYIA 2G0WA 4AD1A 4WXZA 5FJJA 3M0JA 4KCWA 1GYNA 2X0SA 1K4GA 5EBUA 2E3ZA 4REQB 7ODCA 1S2UA 4KCVA 2WQDA 2Z28A 2WW5A 1HKJA 2J9XA 5ABEA 1IR1A 4O1CA 3P0WA 3TLQA 4IQLA 3KOZA 4WGHA 1UPMB 4DUWA 1I4NA 4FNUA 3W7EA 1JJKA 1QCWA 2YW4A 1LRTA 1X96A 2GK1B 1OCQA 2EAWA 3ITXA 3APTA 2JALA 1W5OA 4PL2A 4YLWA 3NZPA 3VIFA 3I3BA 1CIUA 2WBGA 3GUGA 3VIOA 1A5CA 3L0KA 8TIMA 4C6MA 1E73M 2PI6A 4HZ6A 2VC7A 1WAUA 3HOJA 5HQEA 3BE7A 3KVLA 2C3ZA 1JPHA 2IPWA 3H2EA 2HZGA 1B4KA 4DI8A 3WLTA 2VZVA 4INFA 3RCNA 1UR4A 4ZVJA 1REQB 4UTHA 3N73A 4U5KA 1FWJC 3MHFA 1V6VA 4D72A 2XFWA 2KAUC 5EMJA 1XI3A 1TR1A 3WUEA 1C90A 4Q22A 7REQB 1D2KA 2WANA 2J8TA 1GYMA 2DW7A 2QVNA 3O6DA 3GU1A 4YTTA 1HUVA 2ZA1A 3GXMA 3LRLA 1MXDA 1TPUA 1C91A 1PV8A 3W7KA 4JKMA 1XYAA 2PDPA 1BLIA 2WKGA 5AFDA 1AH0A 4ZODA 1IWAA 2JEPA 1DHKA 2VCAA 3A24A 1S5NA 4O0QA 1TZZA 4UOQA 2A6NA 4JEQA 3WLMA 4NI8A 1BQCA 1E4NA 1E4LA 3RM8A 4B91A 1UASA 1F3WA 3LNMA 5KTLA 3MKVA 5A8MA 1U5JA 3AI0A 3PTMA 2XIBA 5IOBA 3IJ9A 1NDZA 2C91A 3KCLA 2BASA 3WDRA 2RUSA 1UP0A 4LUSA 5K3VA 2YCLB 4L9ZA 1OYCA 1TZ7A 1DQXA 1QU4A 3VZXA 5BMXA 1SJDA 3RU8X 1YE4A 5DY2A 5FJOA 1ZHAA 2FJKA 3GQYA 1MDRA 2Y7EA 4HCHA 5AC7A 3LOTA 3OLDA 1QPRA 3WQ8A 1IGWA 1V3JA 5C54A 1J0YA 2QGYA 3FXYA 1GWJA 3O7UA 1IT7A 3WKZA 1EWDA 1XIDA 5EL1A 1RLDA 3RLHA 1F3XA 4Y9NA 3PG8A 3WX7A 2V81A 5C9WA 4PTXA 1DWIM 1A5OC 1SR0A 1K8XA 2FVMA 4TV6A 3F2DA 3ARZA 2VWSA 1G1YA 1LLOA 1X8CA 4EX4A 1J11A 4TV5A 3M0YA 5KZDA 1B54A 2E5CA 4HNNA 2OYLA 2CHNA 3OZPA 5E0KA 3TOYA 3W37A 5I77A 3UGRA 2UV8G 3VD4A 1V6YA 4GE8A 4NP7A 3C2FA 4AXKA 3RMEA 4F0MA 1A3WA 2XG9A 1PZ1A 1O68A 2HQAA 3WDJA 4LBSA 4WDXA 1NTHA 4XZBA 4ICCX 2YA2A 1VEOA 3CZGA 4IPNB 4DHGA 4QE1A 2ANUA 2J74A 1P0EA 4W89A 1ZBCA 3UNTA 3ARVA 4AVOA 4PGLA 3DENA 2V3EA 2JIEA 4KMQA 3T81A 1JYNA 4JTDA 4AX7A 4Q8PA 3C5QA 1E6PA 3O07A 1K9TA 4WCJA 4C6IA 2XYLA 5EMLA 4X9YA 1P1MA 1T8XA 1CDGA 3AQUA 4UMBA 2DY3A 1SSGA 3KWXA 3XINA 3IS4A 4X2RA 4GCXA 1WO2A 4E8GA 1Q63A 4UTLA 1W9DM 2FJUB 1EHAA 1TQXA 4PUUA 3AYSA 4UB9A 1AQHA 1QK2A 4B15A 4FLSA 4LXFA 1H49A 4FAMA 3VOHA 4W4QA 1WXYA 2IPFA 3S2NA 5D2XA 3LPPA 4HZ8A 4J3WA 1JCTA 3IIOA 4AVFA 4AD3A 4DWDA 1UJQA 3MWAA 3NQ8A 1JR1A 2PPGA 2Z7KA 3BLFA 3TSMA 1IQ8A 1QATA 5DCBA 4IICA 2QIWA 5E6ZA 1W5MA 1JGMA 2CZEA 3WD2A 5FD0A 1PZ3A 4IMCA 5AHNA 3GB6A 4JTCA 4WZHA 1K9EA 3DFYA 3DFQA 3JS3A 5ECUA 4GNVA 1P7TA 1PKNA 5MF5A 1J2BA 3CQJA 4Q6XA 2EPHA 1RBOB 1V5XA 3AYVA 1UWSA 2YFOA 4E5TA 2CERA 3NQBA 2PWFA 3NPXA 1MSSA 1TWZA 2OLAA 5DLCA 4DAFA 1W1PA 2J7FA 1R2SA 4PUJA 3E49A 1XPYA 2RDXA 4DXVA 4UTWC 2J8GA 4QQ3A 3NQAA 3POHA 3TSDA 3VOIA 2AKMA 1EYEA 1IXOA 3W1RA 3RXZA 2WSKA 2CZ5A 4AZCA 2UWFA 1NP0A 4AAJA 1JZ7A 4F48A 3G18A 3N9SA 4UNLA 1BF2A 3STFA 4AD2A 1KM3A 1OBAA 2YCIX 3W1AA 4QXIA 4AD0A 2D2GA 3LHUA 3PANA 5H91A 4DJDD 4B3ZA 4JHMA 3UNDA 2VTFA 3D5HA 4LFYA 3A6OA 3GVWA 1RXOB 1FA2A 3K4WA 3LXBA 1WZMA 3WUGA 1RPKA 5HNNA 1QT1A 1ISWA 4M6VA 3VGBA 3BLLA 3QGVA 4LVGA 4N42A 1G4EA 3NL6A 1F9CA 2Q3OA 2AAAA 1G01A 2HVNA 4QRNA 1S46A 1JQXA 4XVEA 5F1VA 1U2YA 4TR9A 4KESA 2YFNA 2VCBA 3OTRA 4CNOA 2VNCA 2PTZA 5L9FA 2WJZA 1E9YB 4MGGA 3A12A 1YNQA 4FIQA 2R8WA 1I9CB 1ONXA 1FFQA 4HU0A 1KB3A 5IHSA 4H6EA 1DJNA 2J4GA 2Z6IA 4H01A 1JDDA 3R7MA 2EPKX 4OECA 2O9RA 4NZJA 1CI1A 3TK7A 1G7VA 1I1WA 2NSXA 3WJWA 5I3HA 2WOQA 4AEFA 2V69A 3RX3A 4GY1A 1VBUA 5M17A 3LCIA 2NUXA 3CO4A 5D4YA 1E1EA 2BX7A 2QPSA 3OZMA 1E6XM 2GJNA 1VD6A 4IG2B 1K70A 3RR1A 3GNDA 1L6SA 3APGA 3I7SA 2V6AA 1ONEA 4H6RA 4EWND 1G5AA 5BXPA 2RKXA 2J27A 3AXKA 4FXFA 2VEGA 9XIMA 3QH2A 3EMCA 4RDZA 3KS6A 4NJKA 4M1RA 3A3WA 4DYJA 1F6KA 3B8UA 4LH8A 4DJDA 2R24A 1I2NA 5HNTA 1X39A 4GI8A 1Q6GA 2G3NA 4MZYA 4QM1A 1LJYA 3BV4A 3URBA 4ZMGA 1FCQA 4F9JA 2OZTA 3LLFA 1WXJA 3AMLA 4WJ8A 4UTUA 3AC0A 1P0KA 5DRCA 1QNPA 4XSLA 4WKAA 3H24A 2PWDA 4XO7A 3GHRA 1A4LA 2CLIA 4LQ1A 5AB3A 1JYWA 4XK2A 1FY6A 3W2KA 2ZKMX 3GVVA 3TN6A 3FVMA 2D69A 2D2OA 2XZ7A 3O9NA 5D38A 4WQ6A 2VC5A 3IUDA 5AHMA 2OQHA 3QRHA 1Q4WA 4Z1YA 3KXQA 2FFIA 5JMUA 2EJAA 3CUGA 4DJFC 3S5ZA 4R34A 4IFRA 3ZT6A 1W17A 5HINA 2GL5A 1LUCA 4LNYA 3S6DA 4H9YA 1IYXA 1S2WA 4LCQA 2ZX5A 4O8AA 2PMQA 1TX2A 1VZWA 3M7SA 3UCCA 1E5JA 1WKEA 5HNRA 1CGXA 1OG6A 5BCAA 3B8VA 1UQZA 3N6JA 5A3HA 4HK7A 3GIYA 3DKJA 4GXWA 5A5WA 1P0BA 1T8QA 3UG4A 4O28A 3PR2A 4GI4A 1OX4B 3FFSA 3UWEA 2I17A 2E8ZA 1E51A 5I3DA 3KOWA 1O12A 1PPIA 3NSXA 1B3OA 3QTGA 1V0NA 3HQNA 5FEWA 2WLYA 2EQDA 2HWGA 3DECA 3ZMRA 5C9RA 2QW5A 4HNTA 1L2UA 1SYTA 1PB0A 2XIOA 1DJHA 1FWGC 1J0IA 4J3UA 3AAMA 4HYRA 4G1NA 1V6XA 4MYAA 3PWAA 3R79A 1EO5A 4B5VA 1RJRA 4NKCA 3H2AA 5C71A 3STCA 4UR8A 2VCCA 2F7FA 3PZNA 1VHNA 3TN5A 1G67A 2QCCA 3VDGA 2GJRA 4UOJA 1SGJA 4B5SA 4JTJA 3ECQA 3IJ7A 3T2QA 2AL2B 3DHUA 1P48A 4O12A 1OT2A 1ZSXA 2NVCA 3EYPA 4IIGA 2XH0A 1K7EA 3DUGA 4PMJA 3PUGA 4L9XA 3WYZA 3NUKA 3WG6A 3LN3A 4H9VA 2FKPA 2E77A 1JUBA 3SFWA 3KDNA 1PZ0A 3VGHA 4O1FA 4XZHA 1KXVA 1TV8A 4WX2A 3FOKA 1VHCA 3UT0A 1UKQA 2VX4A 1YEYA 4Z1DA 1EP2A 2JK2A 4G7FA 3TNBA 2XH4A 4Q32A 2GUYA 4YU1A 3C0QA 2O56A 3BPWA 3GHTA 1C8XA 1WOBA 1BYDA 2CBIA 1LTDA 1W2PA 3H54A 4HMEA 3G1FA 4WY0A 4MUZA 1HFBA 1B3XA 3GLCA 3QY6A 3VNMA 4K39A 3BOFA 1O66A 1GVIA 4PUDA 1DYSA 2PWVA 1N8WA 4RUBA 3KHJA 3EBVA 3WDQA 1H11A 2VEKA 4A29A 3M1ZA 4JQAA 2YYUA 1XBZA 4JFTA 3A4XA 1GT8A 4AC7C 2RJHA 2FTPA 3THAA 3GM8A 3VKDA 2PGWA 4AMAA 3O2LA 4BHYA 1OFQA 3VYLA 4XBJA 3IAQA 2Z7GA 5I00A 1NFGA 4W8AA 3DYOA 1XLKA 3E2RA 4MTVA 1KXQA 3H7VA 1QPOA 1GVEA 1R9XA 4O8RA 3UWQA 1U5VA 4GBDA 5HPCA 1GEHA 2A3EA 1TPH1 4N9DA 5GPRA 4JHOA 1R86A 3W88A 4NZFA 2PGRA 1EPXA 2WMHA 4ERAA 4LVAA 2PA6A 1H1YA 2WHMA 4QG9A 1QI2A 3G2GA 4S2BA 3AWNA 2XHYA 3W81A 3BMWA 3PBMA 5DT5A 5CC3A 1EC7A 4FK9A 2NT1A 1RCXB 2BVYA 5A6SA 4GYPA 2WWDA 4IGNA 1CGWA 3NXFA 3E1F1 4IP5A 1X98A 3MANA 3WLOA 1H7RA 1UC4A 3STGA 4TMBA 1W0MA 2MUCA 4XTDA 1J0HA 2JF7A 1KBBA 1M53A 3WH8A 4U10A 3V75A 1HNYA 4L80A 4J3TA 3VNIA 1UBSA 1HL2A 5FI8A 4C6EA 2QCFA 4YTRA 4A8NA 2DZSA 3PJXA 3EDDA 1GK8A 1A0CA 1CXHA 4GX9A 4L6OA 4TOQA 4D2JA 3QR3A 1F3EA 1L9WA 3G1YA 2WLZA 4EPDC 2ZQ0A 2Y63A 5CZ0A 4YS1A 4US6A 5CBBA 3VZYA 1JYVA 4UQEA 4IX2A 1DOSA 1E1FA 4JICA 4CGTA 1UROA 4UTIA 3BAYA 3EOLA 1NJJA 2PE4A 1XHGA 3O16A 1DEDA 4IGSA 3APYA 4FSAA 5E9XA 3I6TA 3W1XA 1RH9A 3ITVA 3AOFA 1UP2A 2EPOA 3F2BA 5C5YA 4LNCA 4NNCA 4LRTA 3DAQA 4TIMA 3WQ4A 1VEMA 1E3XA 3N25A 3TVAA 2Y62A 3NVDA 4JIHA 3T40A 4LOCA 3NQ7A 2OZ0A 4BFAA 1HP4A 1HXJA 4OVXA 3EDKA 1EPVA 5EKYA 1HIZA 3W7NA 1JD7A 2IKIA 5EFDA 1JI2A 4H3DA 4HD5A 4ZOCA 1LQAA 1OCJA 4H2HA 5EMYA 3MSGA 3H8AA 2BWGA 2NV9A 1FWRA 3EXTA 3TJXA 4PMRA 2PTYA 3AXXA 1PYFA 5EA9A 3W7IA 3POCA 1T6MA 1EXBA 4Y9MA 4Q8UA 2EO7A 3HQOA 4YWSA 3E02A 1ME9A 3HQ1A 7ENLA 2W9MA 1ZENA 5EGRA 4XUYA 3TAOA 1EUAA 5D2YA 3P60A 2XFYA 1J5TA 3IJIA 1AZ2A 1MVYA 2GDUA 2OO6A 2X05A 2FPTA 1XKYA 8XIAA 5TD4A 5TIMA 3W6YA 3CZLA 4C5YA 2V0TA 3DFPA 3BG3A 4LUTA 1KFJA 2NLYA 1R3TA 3WMLA 4PUNA 4I9TA 2CBJA 2OGJA 2WCSA 4PE8A 1Y65A 4NILA 2PWGA 4YXGA 4ES4A 4LVDA 4QG6A 1R7OA 5DCDA 3ZSTA 3UZXA 4C6LA 2WMKA 5D2TA 4BQ4A 4QDMA 4IZGA 3R58A 3VI2A 4M56A 1A5NC 2C7FA 3N9KA 3O63A 2V82A 2YL6A 4AW7A 4MB3A 3AISA 3WSUA 1GVSA 3E2QA 1NQ6A 1VCVA 3O6AA 3S2JA 1WPCA 1PEZA 1QTWA 3TA6A 3K8KA 4QAIA 4YVPA 3YPIA 3SIZA 1WBHA 1ME8A 4NVTA 5J04A 5I0DA 3R12A 4FB7A 4TQTA 1FP9A 7A3HA 3H2OA 3IJDA 1C92A 3LHTA 3HG5A 1KM0A 3DH7A 3WQOA 2XH2A 4H4IA 3MO4A 1E40A 1GKQA 1KFWA 4EPKA 4PBEA 4QJ4B 3ANUA 1US0A 1OFOA 2QDEA 1V3MA 4GVGA 4BA0A 3TTEA 1WE5A 2QV4A 1J18A 3EMZA 1KRMA 4LF1A 1H61A 3VMNA 3URNA 4XAZA 4L4PA 4ZZ9A 2PFHA 3W26A 5I2UA 2WMIA 4LAUA 1KFEA 4CD4A 2KZHA 3RO6A 1RLCL 1BVWA 2VKZG 1AZ1A 4O14A 4FIRA 1OC5A 4A3RA 2EKCA 5FJRA 1DJYA 3W2NA 2BV9A 4CQ9A 3P8IA 1CGYA 4RKAA 1R9YA 5C2CA 3SGUA 1W9VA 3HG2A 2ZZ1A 2RAGA 3IPWA 4B5NA 4D8ZA 1A5AA 3A22A 5BOEA 2HXTA 4ACZA 4DJFA 4JFVA 2QJHA 2TYSA 4GH3A 2ZUNA 2C15A 3T6CA 4Z17A 3P67A 3E0WA 4X0NA 3Q58A 2FVKA 3THQA 3P61A 5J8LA 2BGNE 4WRHA 2GLKA 3BMVA 4J3ZA 1M7JA 3GFXA 3B0XA 2XSXA 4BQ5A 1F4HA 1YRRA 4KEZA 3URAA 1H50A 1B0IA 4NAFB 2DZXA 2HJPA 4NNBA 4RPPA 2C13A 4B5UA 1JQVA 2XN0A 4UC5A 4PCFA 2E6FA 3GNNA 4M7SA 2ZA3A 1CWYA 2NQLA 1VFFA 5C7HA 2IQ0A 1EJTC 2PDUA 4E2DA 5SWUA 3N11A 4Q8OA 3WD4A 4WXYA 3COTA 1JD9A 4GYJA 3W3OA 1EP1A 2A1YA 4CLMA 2VFGA 1UZHA 2PUZA 3WQWA 3VNZA 4PRTA 4HMNA 1UH3A 4Q4SA 4LUYA 3ZR4A 2XPKA 5BXRA 3SURA 1JNDA 1F76A 4FLOA 3QKZA 2GSEA 2HK0A 2MNRA 3DFSA 5FJIA 1DXFA 1R3RA 3B8WA 1CW2A 4WD0A 3NQCA 3SAZA 4D71A 1Y0EA 4OV4A 1PX4A 5FEXA 3AFBA 3L4WA 1UKOA 1QW7A 4UQDA 3RLUA 3ZZ1A 5C70A 1EC9A 2OSXA 1MQQA 1OZMA 3ABQA 4LVBA 3UETA 2D73A 1MFUA 4XSMA 3AIUA 1HTIA 2O7QA 3PB0A 2ZZ4A 1BEUA 3IARA 1IT0A 1E4IA 4HHHA 4S3GA 3KWSA 3TMLA 3KBVA 1D9EA 3RX2A 3VAVA 1HKKA 1KWGA 2R82A 5LHFA 1GZ1A 1XLGA 3F5LA 3TONA 4CCCA 1AQFA 3LENA 4C1KA 1LM1A 1G9HA 1TV7A 1WKFA 4M6PA 3H53A 1H5VA 3PG9A 1E6NA 5ABHA 3P5ZA 4ORMA 5D05A 2X30A 3W7CA 3UWUA 7XIMA 2RGLA 3FCPA 3B97A 1SPQA 4ONVA 1ECEA 3R11A 2WHKA 4ZB0A 4A3HA 4IP7A 2GGEA 3FLUA 3ITOA 3NQMA 3IIXA 3W02A 3SUTA 1JUEA 2B7OA 5EB8A 4CD8A 2OXNA 4XKYB 4MWAB 3L4ZA 3VDBA 1XH0A 1US2A 3DGBA 5M3WA 3L4TA 5IRPA 1V93A 1VBGA 3NQVA 4J2MA 1GQLA 3ZM8A 3BW4A 4HA1A 4S3BA 3VIGA 3P7YA 3S42A 3TC3A 4L4OA 2VQUA 3WL1A 5A2BA 1WZLA 4F4RA 1HJWA 3G1SA 1D8WA 4MKSA 3GYEA 2NV1A 2E67A 1OSEA 1FX6A 5AYXA 1KCLA 3H4GA 3FS2A 3GKAA 4OQVA 4EACA 4LX4A 1E0XA 5LNSA 4D6IA 2VEIA 9CGTA 3FSTA 4RZ4A 3LGEA 5CH9A 3UA3A 3OYZA 2GFTA 3GRIA 4JD4A 2TMDA 3RILA 1UC5A 4UR9A 3XISA 2Y1HA 3ARYA 2PEVA 2ISDA 3M0LA 1Q5MA 2BVDA 3VINA 2ZUWA 2CLHA 1THFD 4PMNA 4IOTA 4HQVA 4O53A 2Z1KA 4QIUA 2OSWA 1XFCA 2PDYA 3S46A 5I79A 4MVAA 3VIJA 2VVNA 4OE7A 4WLCA 4V33A 2AQVA 3WF1A 4FA3A 5F2LA 4KPLA 5DMLA 5E0FA 4GD0A 2WKJA 1N2VA 2E1WA 1ZGDA 3CAQA 4J3VA 3P81A 4XTIA 3OQEA 1KR0A 2C0HA 4ICNA 3GIQA 5DQPA 4KWOA 1GVYA 1PYMA 1OGGA 2QCHA 3MHUA 1J10A 2WM0A 4Z1CA 2V5CA 2A3LA 1WUFA 3F5KA 4UWMA 3OBAA 3A4JA 1ZCOA 3V4BA 2EPLX 2CYGA 3IIVA 5CPNA 3IJ6A 3CAVA 4QP0A 2DZTA 1I0BA 3IRSA 4PTVA 2Z25A 1WQ5A 3HO8A 3NEHA 2ADAA 1NF0A 3BJTA 1O60A 3OPSA 1AQMA 2QCDB 4Q8NA 4O1BA 4CVWA 4ZOEA 3DHDA 3WL0A 4HYVA 2AQOA 1ZQ5A 3DCPA 1OHLA 1DHPA 1XP3A 3ZQ9A 4AF0B 5CSUA 3SCSA 2OX1A 1XXXA 1GJWA 1PX8A 5G4WA 1TRDA 3P3BA 1SW7A 1RJPA 3CXOA 2WWCA 1YTEA 2O4QA 2VFHA 3EDFA 1XD1A 1UCWA 2QZRA 2V5LA 2ZOXA 4CCZA 1R6WA 2YOCA 2CKSA 3MZ2A 2ZE3A 3QHMA 4FOJA 3WNKA 3ALGA 2DSKA 3UGVA 4D6JA 1WOAA 2ZIDA 3G6LA 4MB5A 1DKWA 3PNUA 4MOZA 4WY0F 1POJA 3SCVA 4UBPC 3SJ3A 4WOZA 2OZ3A 4XBKA 1RQBA 3KVKA 1GQNA 3JZEA 4MWAC 2PP1A 1XYLA 3UWWA 2E68A 1YNYA 5FESA 2YCKX 4L1GA 3W1TA 3VGGA 2VJXA 2TSYA 4ZBCA 2V63A 2FTWA 3QHNA 3GH5A 3QGKC 1I2PA 4JCLA 1JDCA 4DYKA 4AWTA 1PS9A 5E9AA 5A6LA 3REQB 4MG4A 2HROA 3GXTA 1EA0A 1BWVA 1O7AA 3EMQA 2QF7A 2W67A 2PCEA 5HMSA 2XFFA 1VFHA 1LCOA 2ONEA 2B4GA 3ID7A 1AH4A 4QROA 4QTGA 4YYCA 3VNYA 3EEGA 3ATYA 5G5IA 5A95A 5E09A 3UG8A 2PDWA 5HQLA 1A80A 3FAXA 4ZOBA 2P8BA 3UWVA 2GJXB 1LWHA 2DZBA 4ADTA 2HDJA 3T05A 1JUKA 3K13A 2PWUA 3ZJ8A 2WCAA 2WZTA 5D2WA 3P93A 5HULA 4U4MA 2QDHA 3A9BA 4HT3A 5EYWA 1VC4A 2ATSA 2W92A 3SSJA 5HATA 4RDVA 3LMYA 1TVPA 2R1NA 3RPMA 3O6YX 3W1UA 3W7PA 3MHGA 4ZR8A 5HUPA 2H8XA 3K1GA 1UWRA 1MNSA 4JNYA 4RK8A 4ROQA 4KQNA 1RBLA 5I5RA 5F4SA 5RUBA 1VPXA 2AOSA 1MUCA 1UH2A 3PUOA 3U0HA 2HK1A 2JQXA 3FJNA 3TW6A 2XJ7A 5D8WA 2IQTA 2LLEA 1EJVC 3NM3A 1R2RA 1KR1A 2E6DA 1WZKA 1OABA 3R13A 4OV9A 2QAPA 3S3GA 3C6CA 1HJUA 4IISA 5D9NA 3LU2A 2ZRZA 1PDZA 2OGYA 3CZ8A 4B5WA 1ONRA 1SJBA 2ZCGA 4HNOA 2DH3A 1V3IA 3S5OA 1HN1A 4AZIA 3DYMA 1G6CA 5MKGB 2OSYA 4DVOA 2OQLA 2DH2A 3LI1A 1A0DA 4U33A 4OOZA 3GD6A 1Q7QA 4CD6A 4GVHA 2FPYA 4L1WA 3W7HA 3UZYA 4J7RA 1RAKA 4JNMA 1G0CA 5DRIA 2ACUA 1EB3A 4NJGA 1JZ5A 3TJ4A 3R89A 4P7QA 4W86A 4RZBA 2X09A 4I6VA 4AZ6A 3WF3A 4O17A 4K2SA 4GIAA 2PTWA 3PPCA 2RGMA 3SUWA 1QUMA 1RBAA 3PFRA 4NL1A 2WJEA 4AZBA 3OIXA 3B9NA 1XRFA 1FCVA 3QOMA 3IGXA 3LDVA 2WK2A 5LGXA 5FF2A 3M6YA 2VELA 4NJHA 4R9OA 4ASTA 1JDFA 2ZTJA 1LQ2A 4POCA 1MEWA 1PHWA 1EWEA 2PDNA 2XIJA 2VRKA 2VDIA 4J2PA 1GG1A 2Y85A 2PTXA 4L6DA 3FYYA 3LA4A 3B0PA 5KITA 4C6PA 4B9ZA 1JIBA 4Q8VA 5G4HC 3I6RA 3AU2A 3V16A 4B92A 4I9AA 4YVVA 1G94A 3VUSA 4W85A 4YPJA 2ISVA 3W53A 4IXXA 2WVVB 1DWAM 1BKHA 4ALDA 4JYFA 3WH5A 2X0HA 5D03A 3KM8A 1H7PA 3TTSA 2PDMA 1KV5A 5ENLA 3E0IA 3NZRA 1LZOA 1HL8A 4GUIA 1YW1A 4IJCA 4NZ5A 2FGLA 1KFBA 2P3ZA 4MHBA 4AHQA 2EG8A 4FS9A 2CBVA 2G3MA 2XWEA 2JKAA 3PPHA 4A22A 4DNMA 4DUXA 4HBKA 2BNJA 1MW0A 3N4EA 1P4CA 5CEWA 4EPEC 1YBQB 1BSIA 1CB2A 2DQXA 4GZ7A 3N2XA 4OBSA 3BAWA 5B80A 1FKWA 3PUEA 4MJZA 2J47A 4P61A 2F8QA 2X7WA 4O52A 4Q4QA 1ISZA 3LTYA 3G1AA 2Q02A 3MBDA 3EB2A 3PSWA 4JIRA 4UFJA 3J7HA 3B8TA 1PWMA 3UPWA 4Q8QA 4O0ZA 4IFKB 3EOEA 1B4EA 3H26A 2ZX7A 1FFRA 2QUVA 4LALA 1TV3A 3CMFA 4M80A 4UZSA 2DZAA 1LBFA 1OT1A 4X63A 1KCKA 2VD8A 3A4WA 2OZ8A 2O7SA 2VFEA 3B8SA 3OVGA 4TXEA 3OG3A 3D3AA 3G1HA 2G50A 2D3LA 3S1WA 4NYYA 1OB0A 3CC1A 5FJUA 4E4UA 2Y24A 3KTCA 2WNNA 4GACA 2OPJA 1VIZA 4WSKA 2WNZA 2BVWA 2CPUA 2YCEA 2E9LA 1OC6A 4P8XA 3I3EA 2FB3A 2XDFA 4O1AA 4IJBA 1TTQA 3WLNA 4A05A 2E6YA 1F6PA 3T8LA 4LU0A 4Z08A 4IFOA 5D8ZA 3BLEA 1SMDA 3D46A 5LA2A 3ZXWA 1TTPA 3JVAA 3QY8A 1TWSA 4HPGA 1GW1A 4HTBA 3GC4A 1A3XA 1NWTA 4YMZA 3DX5A 3O05A 2OU4A 4A2RA 2J7GA 3EA1A 1FBAA 1VBHA 1DTUA 3JW7A 3GAKA 4YJ5A 4AWEA 4AX6A 2DORA 4QX4A 4S3AA 2A85A 4K8GA 4GC3A 4X22A 4WHBA 4BQ3A 2WSRA 4FP1A 1YXYA 1RP8A 3GU9A 3SIMA 2WJFA 3BW3A 3PF3A 2F2KA 4K6AA 1XYFA 4N02A 3ITCA 1LOSA 3VD5A 2DVXA 4JOMA 1UKSA 1EOMA 4O4VA 1F8MA 4DO7A 3U4AA 3K30A 3LG3A 5ECVA 4OZOA 1A5UA 2PF0A 1UR2A 2QCMA 3TX9A 3SZ8A 1XSJA 3W7MA 5CPOA 5KETA 1O1HA 1V0KA 5HJXA 1PIGA 4CNSA 3QR1A 1AQ0A 2OO0A 2WVTA 1XCWA 2XN2A 2NW0A 2ZFAA 3KVMA 1TPEA 3QYSA 3G8EA 4AEOA 1WDWA 4XAGA 1W6TA 3NL2A 3T44A 1A4MA 3V5OA 2Z1BA 4O4WA 3QV9A 4MY8A 5CXPA 4H9TA 1XDLA 3WLRA 3W28A 3B3DA 1EBHA 3ABRA 3N04A 3MUIA 5CGMA 1D3GA 3NQFA 5TNVA 3GDLA 3NWRA 3KOFA 1HO1A 4GQ0A 3C8NA 3MSYA 1QI3A 1YLVA 4NF7A 5GQBA 1YHTA 3HPAA 2CLLA 4PC8A 5FCZA 4FMVA 2PDFA 4MPKA 3TN3A 4CU8A 2W63A 2G95A 3EKLA 1JRCA 1UWAA 2G4FA 3V1PA 3W76A 4ZOAA 2AAMA 4PUWA 5CC6A 1W5NA 4RNFA 4JCMA 4UR7A 1AODA 4XAYA 1DV7A 4YYFA 1ZJIA 4W7VA 4X0VA 1XIIA 3S6OA 3ZWSA 1BG4A 4XISA 4JIQA 5K7JA 1SMAA 3K46A 3DERA 4BZYA 1YXCA 2JFEX 5HBFA 4FO4A 4E6MA 2INEA 2DZPA 2IPGA 2FHFA 5JBEA 1EJSC 3VDHA 1XUUA 4GQBA 1L2QA 3AWOA 5IDIA 4G2DA 3T78A 1J96A 1Z3NA 1U1UA 3GS6A 3VGEA 1Q45A 1EGZA 3UD6A 2X1SA 1EP3A 1M01A 3OIHA 5AECA 4ZFMA 1EA9C 3CYJA 3KBJA 2Z29A 3MUAA 4IIFA 4C1NB 1XL9A 2XSAA 3V0SA 4J1OA 4X9SA 2A2IA 4XWUA 4PTNA 1VYPX 2W79A 6PTDA 2IKHA 1DTNA 4IPLA 3N15A 2FDSA 5A6AA 1XIJA 1PL9A 4EAMA 4D9PA 2JE8A 5C0QA 2QJIA 2CXGA 4LEQA 1AD4A 1C8YA 2QCDA 3AMKA 3AIEA 4BK9A 1ZTVA 4MMWA 2E25A 3WEMA 3G1XA 1BGGA 3F4DA 3QW4B 4JYEA 3E12A 2F6KA 2WSYA 3NSNA 1A50A 3CNYA 3FHAA 3SN1A 4GOAA 2Z2BA 4ZGYA 2VMFA 4JTLA 1RK5A 4ZL1A 3NEVA 4Y2WA 3WH7A 3OZYA 2YDAA 4JGDA 3CZJA 4Z0SA 3HTWA 1X7IA 1SFTA 1TZ9A 3BGJA 1I75A 3GZAA 5DN1A 4G7EA 3G1DA 3T0BA 2ZA2A 5A8NA 3RAOA 2GZXA 3BG9A 2FZBA 1KXHA 4Q33A 3P14A 4OBTA 4QAWA 4KWVA 2I9UA 4N4PA 2I5QA 3BW2A 2QAFA 3C86A 2AKZA 2ZUMA 3DHPA 3LGDA 4C6OA 3C2OA 1Z9AA 3T42A 1PVNA 1IZCA 4DF2A 3MUZ1 3IJQA 1CT5A 5T9BG 3GXIA 3CQIA 2POTA 3M64A 4DJEC 3NJ3A 2OVLA 1TWIA 1EJWC 4L64A 1D8CA 4M82A 1EEXA 1VR6A 5M2FX 1UR3M 4EXQA 4HZMA 4KIRA 1R47A 1LF1A 3I7RA 1XBYA 1ISVA 3G0UA 3ITLA 3RRXA 4C91A 1V02E 2VR2A 2V2DA 3KBMA 4NNAA 3L0GA 2VD9A 4QJ3B 2DZWA 2BB0A 4IP4A 1HVQA 2WC7A 4WOQA 2BVTA 1FCBA 4JPGA 2X1RA 5FIPA 5I03A 2BGSA 4HJFA 4BCEA 2C18A 2PS2A 1S2AA 3GTNA 1CXFA 2X1IA 4TVUA 5BOOA 2J24A 1OINA 4AVNA 1XYBA 3VCRA 3ICJA 1XYCA 3WJSA 3VKJA 1O5XA 1D7KA 3KUMA 4IPPA 4LANA 4JHZA 3V5FA 1TTJA 1BGAA 3MUXA 1JAKA 1AJZA 3R1ZA 4IX0A 1H4PA 5LGZA 5AOUA 3VZZA 2HCVA 1JXJA 3K8MA 3ZFHA 4JTAA 1R46A 3B9DA 1BYCA 4F2TA 4YHGA 5D37A 2ESCA 2OYMA 4FX6M 1ITUA 2GPTA 3UBPC 3AHVA 1DE5A 4QLKA 4ZSTA 3HPZA 5FSEC 1XDJA 3FIGA 3ANYA 4GVIA 3QVQA 3CEPA 3OLEA 3QFEA 3W1NA 4PMOA 4AD5A 4DZAA 3AIBA 3WQVA 2WYSA 4PSPA 3KL3A 3GDKA 3Q65A 2C0AA 3R43A 1KCZA 4AUBA 3UJRA 1OCBA 3LCXA 3G24A 4QSHA 2HS8A 2CIPA 2VI0A 1QMLA 2DJXA 2VP8A 3P8JA 2XN1A 3LLDA 3WBXA 3ES8A 3DZ1A 2CZDA 4XG1A 1B3VA 2VXNA 2A7RA 1BTMA 1H41A 2FZMA 2FHBA 2PDBA 4MKVA 1JFXA 1OIFA 2VVSA 3EX6A 5EBAA 4OKDA 3TDFA 1GW9A 2VFIA 3SM0A 1QPNA 2P8CA 3B9AA 3V3WA 1I2QA 1HKIA 3MCMA 1UPPA 2YYTA 1FXQA 2WKLA 3GHSA 2YLLA 1IF2A 4DLFA 3UF9A 3CMGA 3PWIA 3IACA 3MUCA 1NWRA 3NFUA 3G77A 1ZS2A 4JX4A 1NWSA 4PODA 4IIHA 4DELA 8CGTA 3VKCA 1H63A 4U28A 5DY3A 4NAEB 4LGXA 1X6UA 3GKFA 4KCUA 3EWBX 2RDUA 2REQA 3TC7A 4GUHA 3AHTA 3LPFA 2B81A 1KBLA 1QDSA 1Z42A 1AD1A 5A2CA 1VLWA 1J0ZA 4RL3A 1F7BA 3STEA 1K6AA 3HPFA 4GJJA 4A21A 3PTDA 1IEQA 3KS5A 1E0UA 3EB3A 2BGQA 1L6YA 1S2CA 2R14A 5IBXA 3SQLA 1D7FA 3QZEA 3DKLA 4AIUA 3ATZA 4DAIA 2D0FA 5HOSA 2BOGX 4JIEA 4GY0A 3QC3A 1TV2A 4PTMA 5BXSA 4OIFA 3ITYA 4W5UA 3STPA 2VX6A 4EANA 1GJUA 3HM7A 1AW5A 4PBGA 3L65A 3W23A 1FH9A 1VBRA 4NG3A 3BLKA 3T0TA 2PC8A 3O6CA 4MZ1A 3FSUA 4IPIA 3CPUA 4B3LA 1DPMA 5CPMA 3M0XA 3MI6A 3R94A 2XGZA 4RNHA 4G1KA 5G1TA 3I4KA 3RO8A 1XFBA 2G3JA 1GHRA 1B57A 3A64A 1J2WA 1B3ZA 3HV8A 1D3CA 1S5WA 1XDMA 3UVAA 4N9EA 1RPXA 1F3TA 3VIPA 2D20A 1ADDA 3T8QA 3PZMA 5JU6A 4XD6A 2V2CA 1JNEA 1DIOA 5CKSA 3HMCA 3BDKA 1F4AA 4XD5A 1HX0A 3MYOA 3T9PA 2OODA 3L12A 1RD5A 3PJUA 5HMDA 1TV5A 1UBPC 5A94A 5HXMA 3DGRA 2QHAA 1RSCA 3E3HA 5BU9A 1QR7A 3SDOA 4Q4RA 1TELA 4MSSA 4PCPA 4F0HA 3C0JA 1SJCA 3QZ6A 5AKQA 4W84A 4LRSA 4LYPA 3B8IA 2VC6A 3SRFA 4WR3A 1BHGA 2FH6A 3N17A 4GH1A 3H22A 1UD3A 3WD1A 2ZXQA 4GY7A 4GINA 4BF7A 3IV3A 3KRBA 4HSOA 2G41A 4ZO8A 1UQYA 3WFAA 2PDJA 1G69A 1GVRA 3P0XA 2XZ9A 2WZEA 1AW1A 1HF6A 3CUXA 2BP1A 2TPSA 4O1DA 3W7QA 2VR4A 4JTFA 3LHWA 1VRXA 3JUGA 1ZPTA 2VR5A 3ARWA 4RNJA 1Q6FA 5HJLA 1WKYA 4LY4A 3C0LA 1GZJA 3RLVA 1K1DA 4PRWA 1BXNA 2JGYA 3G5EA 4D6CA 1XIHA 2VOMA 2Y2WA 2VQTA 4QISA 4I5RA 1LL6A 2EKGA 3KRUA 1ZNNA 1H51A 3MI2A 3RIKA 3E74A 2WNQA 4I8YA 3FYOA 4G9PA 2ICSA 3GG8A 3GNOA 2V8ZA 1DBTA 1RHCA 1DQWA 3BAXA 2ZXBA 3VD3A 6REQA 1XLHA 4AMCA 3S1VA 2Z1WA 4KETA 3GXDA 3CL6A 2VENA 2QMKA 3FN9A 3RPDA 2FDMA 3VNDA 2PTDA 3OBEA 3OLIA 2FQIA 2J6XA 3QV8A 3N4FA 1O5QA 1XLIA 3H7RA 3B4YA 4MLJA 2DJLA 3ARTA 3WDPP 3LZ5A 5EY5A 4C6DA 4PFMA 3SCUA 4KWWA 1XD0A 2ZTKA 3OB8A 4MUPA 2V5BA 1YDVA 4K1WA 1ML1A 3RFAA 1VPYA 2DT3A 1ITCA 1IEIA 1P6WA 3A9IA 1OK6A 1SM9A 1WYIA 3VD7A 1EDGA 1TIWA 4GK8A 1OG0A 1QOQA 4JZ5A 5AC4A 4RDYA 1FXPA 3T0AA 3DYPA 4M24A 1MWOA 1TSIA 4NX5A 4MJMA 1HJXA 1GOKA 3L66A 2P5NA 4A2SA 2L5HA 2NUWA 5T26A 1WV2A 3T2PA 2GUBA 4JAWA 3GW3A 3BARA 3DDMA 4DXKA 3I10A 3HF3A 2I5IA 4DQWA 3G1VA 2ALDA 1UZ1A 4P8WA 3VOCA 1FTXA 2BY0A 1WBJA 3WFLA 4CNTA 3WQ6A 2VO5A 3P74A 3KL5A 1T0OA 4ADSA 2NLIA 4NQ1A 3S83A 4JNZA 1A0EA 2PP0A 3M0KA 3E5BA 5JXQA 4CD5A 5LYRA 1FWWA 3KAOA 3KZSA 1TPC1 2EHHA 3FGCA 2CZFA 1XGZA 3GTFA 1BRLA 2XWDA 2YIHA 3PUDA 4ZQCA 1CLXA 2ZICA 3PAJA 3TQKA 3GG7A 3UQNA 4PMUA 2DVUA 4TX9A 3QQWA 4HB7A 5F2GA 3CYVA 4MDOA 2QCNA 3GDRA 2OTDA 3GNXA 4WDWA 1DVJA 3PZVA 3ZVHA 5D9MA 5FKYA 3FAWA 3CIVA 4BF5A 1JPKA 5CGQA 3CUFA 3RM4A 4M3PA 4HA0A 3WD0A 4DWSB