3TXQA

Crystal structure of phage 44rr small terminase gp16
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
VYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHVEVFAQLMGQMTTTNKEMLKMHKEMKDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages.
pubmed doi rcsb
source organism Aeromonas phage 44rr2.8t
molecule tags Viral protein
molecule keywords Terminase DNA packaging enzyme small subunit
total genus 31
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2011-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3txqA01
4LWSA 2DE0X 2VRZA 3HR0A 3GWKC 2KG7A 3FAVA 4I0XA 1WA8A 3Q4HA 3TXQA 2AZ2A 2B9ZA 3TXSA 4LWSB 3GVMA 3OGIB 4ABMA 4GZRB 2KG7B 2AZ0A 3O9OA 3G80A 3ZBHA 3FAVB 1WA8B 4I0XB 3FD9A 3Q4HB 2VS0A
chains in the Genus database with same CATH superfamily
2UXCB 1WP7A 5J9PC 2BOCC 2Q7EA 1MZEA 3J81N 4FLYA 4K8XA 4MVSA 4BAYA 4MT8A 2GTSA 2JJ2G 3ZMVA 2YI9A 3ZRWA 2HHHO 4MVRA 4UV8A 4UCOA 5CMUA 4I55B 2Q6AA 4G27B 4U7OA 1N0JA 3RVYA 3K03A 4JAUA 1E1QG 3MHSC 4F6EA 4L8JA 1I5XA 2H3OA 3BCCH 4WFEA 4JI6O 3AK3A 1S5LZ 5L3EA 3SPCA 2F1MA 3CCLV 3G71V 1PNLA 2P90A 1HNWO 1G8MA 2QEXV 2EBOA 3DC5A 4R7CA 1JJOA 4U3JB 4DW0A 2EIMB 2XAJA 4P9OA 1QBZA 2UUCO 1L0LH 4J80A 1L0NH 5EYPB 3K5LA 2RJZA 5KAFZ 2MW2B 4LH6A 5JQGB 4JTAB 4NKGB 4FM0A 5GONA 5LP6C 3ZMUA 1RSOB 1CPYA 1P84F 2VWJA 2Y48A 5B3SB 4U3FH 2JJ1G 2EX3A 3ETDA 3VQXA 1ROPA 1PKXA 2DOSA 5TISZ 1KP3A 2P06A 4R8CA 2NNUA 2QTOA 2YICA 1K5SA 1JX9A 3AG4C 2XAHA 4WF9V 4P9PA 5E1AC 4DV4O 4GKJO 2AHZA 1SQXH 4DR7O 5ITZB 3F7VC 2X6CA 4UB8Z 3R65A 1K9MW 3ZMSA 3T4ZA 1IBLB 1YTFD 4J7KA 4GZRB 1XNRO 2QKCA 4I4TA 3TGUH 3FB8C 3OMIB 3K9SA 2ITCC 4O4JA 1XBLA 3ABLB 1SZXA 1XI1A 4DK0A 3BABA 1M93A 5LBQA 2F43G 2GDSA 1NZ6A 1Z2GA 2V1DA 3ASNC 3JARA 5IJ0A 2Q67A 4ZIBA 2DWDC 3D3QA 2ZNJA 1VQ5V 1AP5A 3JASA 4O4HB 4ZOLB 1OCOC 3RYHA 1WN7A 2JEXA 3UM7A 4JI4B 3BEHA 4JI5B 4LNUA 2HFEC 4FFBA 2JK5C 1EFRG 1AR4A 3FD9A 4KUMA 2ZM6O 1K34A 3MHHC 3L71H 3K59A 5LXTA 1PP9H 1FXVA 2VQFB 2VQEO 2Q68A 4TV8B 2IU0A 5JJJB 3SPIA 4BR6A 4GKKB 2H94A 1QVFU 2DQ3A 4FK5C 3OGCC 5KHJA 3X2QC 5HFLA 4PI2A 2GUZB 1H38A 1CEZA 1YVWA 4YIOA 4NXMO 1FAFA 1COWG 1IDSA 4WFAV 1RPOA 2EJ7A 1W59A 1N36O 5JWPA 4B08A 1JMKC 1DF5A 1S5HC 2QA4V 2Z5UA 4NXNB 4U7NA 1SQBH 1GRJA 1SC5B 4GYCB 4DO2A 2A79B 1WPBA 1F7YA 1ZTEA 3RYCA 4JI2O 5B5EZ 1Y76B 1XQ8A 3N2KA 1SKVA 3B77A 2WPDG 4I55A 3ABTA 4O2BA 1S5JA 1YXBA 2YS8A 3W7SA 2N74A 1TUEB 4CH5A 5B1BB 1XMOO 5GTIZ 2P22C 4PHZA 2PZSA 1UJWB 3ZHQA 3GB7C 1PNKA 4NR1A 4FIPC 1R6NA 2ZE7A 3CCUV 3SDLA 3RT3C 1RPRA 2HHHB 4DRXB 3GWKC 4IIJB 1GM7A 1GAXA 1BCCH 2C2AA 4JYAO 1MNGA 2WLLB 3KKYA 2YXLA 1CP9A 4YIPA 2QWQB 4LF6B 3WU2Z 2ATKC 2ZQMA 4Z2WA 1H8HG 3BAAA 3ABMC 1M56B 5LL6Y 1JJ2U 4J9YB 2M7WA 3RFRA 5LYJB 5AG2A 3ABKB 4EEQA 1Q82W 3IGAC 4X62B 4DUYO 2Y69B 4PA3A 3MAQA 4XDJA 5IJ9A 1Q5OA 1YHQV 4FFKA 5H5NA 2LFRA 4AQYO 3OUSA 4X1YB 4JZ2A 2QJ1A 2XT9A 1OCZC 2DYSC 3SJAC 3QG5A 4NXMB 1K8AW 5J2TB 4I4TB 1IBKO 4YY3O 3SGIA 2PTMA 1OHHG 1VF7A 2P4VA 2ZIMA 2IBZH 3I55V 5EZYB 2DYRB 5FNVA 4IYHA 2Y69C 1AJPA 1GO3F 4A5UB 1BGYH 5KHKA 3F5WC 4LFAO 3HKCA 1N0NA 1RFYA 2F93B 2XTAA 3RYFB 2YEVA 3CC2V 1SRYA 4X1KB 1WPXA 3K0DA 4JAAA 5JCOA 4QE9A 4O4IB 5DECA 2QGNA 3APQA 2DW4A 1RP3B 4DV7O 5IDJA 3GVMA 4KP4A 4ABMA 5H2FZ 4DV6O 3JAWB 3RYHB 4B3TB 4PA7A 2QKSA 4MTXA 3BRCA 3BA8A 3K5OA 4W4KA 1QHTA 4LF8O 3CMEV 1KKDA 3H1HH 2YIAA 1P7GA 5KUKA 2DWEC 4UFZA 4JI0O 2HP8A 5GTHZ 4FZ1A 5B66Z 1H8EG 4PJ0Z 3NXSA 4F6RB 4FLWA 3NR7A 2PI4A 3SPHA 1XUQA 4NXNO 4ICGA 2WAMA 4JI4O 1P7BA 3OT7A 1VEWA 2WA4A 3FX7A 5LOVB 1Q90D 2K1EA 3UQ8A 3SJQC 2IJIA 2GUZA 5L3CA 5CN0A 3CCSV 1QLEC 4YJ2B 4Q20A 1RM1B 3SYOA 1OJHA 3HPLC 3A0BZ 3AK2A 4JI1B 4DR2B 4N21A 4X62O 2LW7A 4D7SA 3S3WA 5K1XA 2EINC 3K79A 4X65B 4OXSA 2BTQB 2DQ0A 1XNQO 1N33B 1GH6A 2AZ0A 5EK0A 4B3MB 2PY5A 3E35A 4B3MO 2ZE5A 4DV0O 1TGOA 1AI7A 4UUJC 1QLNA 1SERA 1IBLO 1T5EA 3RYIB 1X59A 5EIBC 1B3QA 2UUCB 2QM4A 1CXZB 1MZFA 2MK3A 1HNWB 2Y4UA 1V54B 3CJHB 2W6IG 3K5NA 1KP2A 2LO1A 2WLLA 3OR7C 3TETA 1PL0A 2CK3G 3ICXA 1LUVA 3JAMN 1EM1A 1SQFA 3FB7C 3K57A 3ASNB 1H2MA 4MW3A 3CCEV 5LMNB 1YJWV 5IYDO 1IBMO 3ZN0A 2IH1C 3D36C 5CA0A 4KL1A 3L73H 4HBNA 3ZHUA 2IJHA 1B6QA 4LC1A 3SJCC 1VMGA 2IJJA 3SYPA 1LNQA 4X66B 2W0XA 3IAYA 1FYJA 3CC7V 1OCRC 2AGAA 2X7RB 4B7KA 2EIMC 2UUBB 3THOA 4J7ZA 1Q6IA 1DLBA 4JI0B 2AHYA 2KKWA 3CPWU 1YI2V 1E1RG 4FLXA 2WA3A 2EINB 4ZOLA 1OV9A 1HNZO 3ZHRA 1DGSA 2Q0OC 3C90A 3CRCA 4IT5A 3BPZA 3AG4B 4DV7B 1IX9A 3Q4HA 3E86A 1SESA 1QLEB 5EIBD 1MOFA 4IYIA 2AXTZ 1YZBA 3JD4A 2FB5A 1O9GA 1X4TA 2R9IA 5JJNB 4TV8A 5KMGB 4EKWA 4B7EA 3PJSK 2DMXA 4MW8A 1N32O 2WWWA 1H2KA 3EHBB 4JTCB 5FL7G 3JAWA 1WNSA 3CHXA 1R3LC 4B3SB 2ILMA 3LSQA 1BHAA 4UCSA 5L3GA 2CGOA 5LMNO 2EIKC 1M4UA 5LHGA 1BQ0A 3EFFK 4WFHA 3SYQA 1GK9A 3IC9A 4BIOA 1VF6C 1F4MA 1NBMG 1FXKA 1R3JC 2ODMA 4NTXA 4NYKA 5JVDB 2Z0AA 3AK1A 4GX2A 5KAIZ 1S0VA 5HFMA 2FMLA 4X20A 4RQFA 5CA1A 5D5PA 3RYCB 2P4KA 2JEUA 2Q5ZA 2RMKB 1DK1A 4GLXA 1M56C 4CC6A 1MA1A 4I0XB 4EB6B 5IYZA 5LP6A 1H2LA 5BZBA 2ZR2A 4LF9B 5H6QA 3ABLC 3L9DA 4PDVA 3O65A 3L75H 3OGIB 5EC1C 4L87A 4DR6O 2LW1A 1GM8A 1QR9A 4HNAB 3CB2A 2RCVA 2UU9B 3B2EE 3CRMA 5C8YA 1ZX3A 1AROP 3QO5A 3CSXA 3JD0A 4J9ZB 3OMAB 2ARHA 3W7WA 3QVNA 1FFTB 2CE4A 1JR9A 4QNHB 2YXHA 2FL4A 1FFXA 3T1HO 4YJ3B 1KU9A 2CGNA 4YXWG 3H1LH 4MTGA 3JALA 5EBMC 4LFCO 2W0FC 2CTQA 2DE0X 1K97A 3CYOA 1G4YB 4ZHQA 3KCXA 4JV5O 1GN4A 2Q4PA 2CH7B 1K73W 1XILA 5CB4B 2EILB 1NKDA 3FAVB 2Q73A 2V7QG 5BR8B 3CD6V 1Y74B 1EN5A 3JSLA 3CXCU 3LDCA 2A7WA 4DR5O 1GKFA 1P49A 4GUNA 4MVMA 1G6UA 4K3AA 5KHIA 1SF9A 4HYOA 5IY5B 4O4IA 4O2AA 2QTSA 3FYIB 3E8BA 1XREA 1J5EO 1KECA 1R1BA 3W7TA 4DV3O 1IXMA 3SJBC 3MD0A 4MS2A 2IJKA 1BS3A 1W0JG 4PA9A 3DC6A 4YY3B 4ZI7B 2F95B 1GN6A 2PUSA 3G67A 1XHXA 3A0RA 3FYEB 1KBHA 2EILC 2CTPA 3I56V 3AG1B 3P3NA 4F6RA 2H8PC 3CRRA 1Q6UA 3LSUA 4LFBO 4MVOA 4IHJA 2Y4TA 2E76B 4I7ZB 4LR3A 2B1GA 2OWOA 3OE7G 3JAKB 1BMFG 2RDCA 3WB0A 1AJNA 3DGEA 3H9VA 2E75B 1D5NA 5JCOC 1GN3A 4WBNB 3H01A 1SETA 1SQPH 3QTCA 3VOUA 2GSMB 3WG7B 1KKCA 3JARB 4UB6Z 3ZHSA 1H2GA 4FM1A 3JCUZ 1HR0B 1Z5WA 4O4LA 2HR3A 4XBFA 3HKBA 4R6ZA 3UT5A 3UO2A 1V55B 5DEDA 3JD1A 5JH7A 1Q86W 2OCCB 2YI8A 2GBOA 4MTOA 1Q8IA 2WLJA 3ABMB 3K9AA 4LNUB 1QU7A 1L1FA 1V9PA 2RN9A 2UXXA 2KG7A 4I0XA 5B3SC 3K58A 3JATA 5KX5A 1NR7A 4CS3A 1AI5A 2R70A 5LP6B 1MG1A 4NTYA 3CCRV 3E83A 3HKEB 1OCCB 3DXRA 3S3XA 1YF2A 4JYCA 1V55C 3UCSC 1AP6A 2DN9A 4J10A 2HVKC 4JI8B 3ETEA 1KQSU 4JI3O 4JAVA 1JPXA 2XUMA 1FS0G 3CCMV 4JI6B 4CH4A 4LF4B 2YIBD 1SA0A 5CA0B 1AILA 5C93A 3ZMTA 2EIJB 5IWAO 5LHIA 2PYJA 3RWRD 2ZXWC 5B1AC 3SR2C 2ADQB 3I5DA 1F4NA 2Q7HA 1I94O 1YTFB 1Q3EA 3F7YC 1TUBB 1VQ8V 4PDMA 5IT9N 2UXCO 3JALB 2WLMA 3K3WA 2YUAA 1A32A 4QIWF 1SZTA 4OPAA 3ZRXA 1BZKA 1VQKV 3AG1C 1VQ4V 5D5QA 2L35A 4JI5O 3K04A 3X2QB 5CB4A 1MSDA 4X64O 1FJGO 1PM9A 2XAGA 4KHPO 4DR4O 2ETNA 4X65O 2O57A 5B1AB 2ZE8A 3TXSA 4DR3B 3QF7A 2UUAO 1I94B 2PYLA 4RO2A 3CE2A 4DUZO 1YSCA 4QPJA 2WLHA 4TT3G 3T1YB 5A9GA 5KMGA 4O2AB 3N2GB 2KQXA 2UUAB 1VARA 1ZSPA 4DR3O 1S76D 4TSFG 5H6RA 1M1KW 3QNEA 2EZPA 4JI3B 2GHYA 4E2LA 3B09A 4J42A 4X1IA 3BVOA 4KHPB 4MVQA 1YITV 1AI6A 3ZJZA 1R6KA 2ADPA 1MABG 2BE3A 4OX9B 2KB1A 5CBGA 5IJ9B 4LWSA 3ZS8C 1M9NA 2EJRA 2A3QA 3RBZA 1UPGA 3T2MA 2QWRB 1ZL8A 4K8ZA 1WAZA 1IXBA 4DV4B 4O4HA 2DJVA 3LNNA 1LUWA 1IURA 4DV5B 3O9OA 2A9HA 4UCTA 5B1OA 4TWKA 5EZYA 4TUYA 4MVZA 3JAKA 5CA3A 4B3TO 4DV5O 4I50A 1MMMA 3L70H 3U11A 3C3SA 3RYFA 5L3BA 4DK1A 4AILC 1M5IA 4LF7O 4GX0A 4UVAA 2X0LA 1ZUQA 4PI0A 1D2DA 3ETQA 1HNXO 3P3PA 1VQ9V 4LFCB 4LH7A 1NH2B 1MSWD 2ZNIA 4DXWA 2P6JA 4PELA 4JPRA 3JD2A 3HKBB 1XMQB 5KUMA 1ENVA 4G28B 2JGUA 4RUEA 4FLZA 1NTMH 1KUQA 3HKDB 2LQTA 3JCZA 1N4CA 5GONB 1K5QA 2YIBA 3APOA 3ZBHA 1TVKB 4K0KO 1RSOA 3K08A 3M8AA 3SYCA 3QO8A 1W2BU 3M99B 1YDXA 1R3IC 3HKEA 1BQZA 5DN6G 4YJ3A 3IFXA 4LF5O 1V54C 3UKMA 2PF4E 1NI8A 2F66C 1HR0O 3RGBA 3A0HZ 2UXBO 1F51A 3FKSG 4N23A 2JVDA 1WB7A 1HP8A 4H13B 4GX1A 1VQMV 1R73A 3ZIAG 1IZ3A 5CBHA 2HG5C 4YJ2A 1PNMA 5IYCO 1UFIA 2KSDA 3B8NA 3ZN1A 3ZHVA 4BWAA 3J7AU 3VQYA 2ZDIC 1AB3A 5DM6V 2WLIA 4DR1B 1J95A 3B8MA 3OTOO 2NR5A 2A06H 1N34B 2OTJV 4O4JB 3D8CA 3IC7A 2ZCEA 2BTOA 4CBCA 5IWAB 2BTQA 2FTKA 5KHHA 2E5LB 3C3TA 4K0KB 3W7UA 4FLVA 4NVPA 3E8HA 2P5OA 4PV1B 1NH2D 1Q6HA 2QM7A 3JASB 3P30A 4JV5B 2WSSG 4LP8A 1Z5VA 1DF4A 1ZWIC 2LP7A 2QKAA 1BHBA 1VF5B 2VS0A 1M57B 2EULA 2CUGA 2JS5A 4ZI7A 4JI2B 1EN6A 3CJHA 3OEEG 2VRZA 4ZBMA 2YXYA 1L8DA 2UXDB 1YCIA 3VQVA 2NLJC 5IY5C 4Q6GA 4XDKA 1H2NA 2GV9A 3STZC 1F23A 3ABUA 2JS3A 3WB2A 2YSUB 1VF6A 5EC2C 3R66A 1OCRB 2P7TC 2R9RB 2RQ6A 2Q9LA 3UO3A 4AHCA 4IHJB 4X89A 3STLC 4JI7B 2UXNA 3FB5C 5A2QN 2B1IA 5K1PA 4PA4A 3MDSA 2V4DA 1XEQA 4B3RO 4C7UA 3G4SV 3H1IH 3OTFA 3G80A 1S72V 3CCVV 3KG2A 2ZD9A 5L3DA 2UXBB 2ZM6B 1K92A 1NTKH 4PDLA 4WFBV 4E4EA 4X9QA 4LFAB 1E79G 2M6YA 4BW5A 2W6JG 2HJDA 1I7FA 4QPKA 1XDCA 2OCHA 4KFMA 4LF5B 3CXHF 1K3EA 2L6LA 3N2KB 3SPGA 3QO7A 5LGTA 1KYOF 1XOUA 1AI4A 4DYLA 4H0LB 3PN1A 1NVPB 2R72A 5B1BC 1AVMA 4RQEA 4JYYA 5JJEB 1VQ6V 4JI8O 4H44B 1U96A 4DR6B 3OTOB 1KB9F 1TAEA 4HZ3A 3OW2U 1M57C 4DR4B 4QJFB 1B06A 1EZVH 4DRXA 5ITZA 1KD1W 1SQQH 1BL8A 2BSKA 1QNMA 2CTWA 1PPJH 1K4DC 2Y0PA 3HKDA 2OTLV 4B3RB 3AG3B 1SA0B 1M90W 4OPHA 3CP1A 2AZ2A 4GT1A 1XNRB 2Q0AA 4JI7O 2WLKA 2LGQA 3K5MA 2ZINA 1PD3A 3AG2C 5LYJA 2Q69A 3H1KH 1ORQC 4DR7B 3L72H 1N34O 2IU3A 1TUBA 3ETGA 3LUTB 4CH6A 5LGUA 1HDJA 5FLXN 4CZZA 4PA6A 2QDOA 2E74B 4UCVA 5B1NA 5IJ0B 3KCYA 2HLDG 5J2TA 3WB1A 2JDIG 4AI8A 4KXRA 4TOIA 3E22B 3L74H 3WFVA 1SQVH 1XMQO 3LNMB 4P30A 2R9AA 2UUBO 5FNVB 4QGPA 3AG2B 1URFA 1QVGU 1VQ7V 1JFFA 1H2SB 1FD9A 1DTOA 2YEVB 2B9ZA 1FKAO 2PI5A 2D3OW 3K0GA 4FJCC 3BY6A 3RN4A 4R50A 1NTZH 2HEPA 2LFSA 4UVCA 3SPJA 1NT2B 5J2UB 1B04A 4CH3A 4H37A 4GX5A 3ZCCA 4YHHO 3EXAA 5EBWC 2QE7G 4BW9A 2XOKG 2XNDG 2Y0IA 3LDEA 4I9WA 2EIJC 4UCRA 1OCZB 3D3IA 1HNXB 3P32A 4JGSA 4I9QA 4X8AA 1K33A 4DV0B 1R3KC 4DW1A 2GTAA 3EVKA 4YHHB 1FPOA 4Z1MG 1Y76A 3ABKC 3DTUB 3OM3B 4H33A 4NB5A 1EBOA 2Q7GA 2IW5A 4D6TH 4I50B 5LOVA 5FPOA 4O2BB 1IBKB 5LGNA 1OCCC 3W7XA 4DUZB 2JGDB 1SQGA 4AQYB 5LA6B 2QWPB 4CS4A 4WFGA 1O9HA 4JF3A 1FXKC 1VP7A 4GCZA 4ASUG 4FMTA 4DUYB 3CEIA 2XAQA 2ZDIA 5LMUO 4G2KA 3T1HB 4X64B 2LGWA 4X66O 3SYAA 1Q7YW 2A0LA 4LF7B 5EBLC 5LHHA 1JVMA 4DV2O 2F23A 1ZLZA 1TVKA 4LF6O 2EZOA 1IBMB 4DV1O 2NN4A 3WG7C 5JVDA 3HB3B 4IL6Z 3J80N 2FYUH 2XASA 4X20B 3CCJV 5CA1B 3ZX6A 1GM9A 3OAAG 4DR2O 1Q43A 1IVSA 3ZRWB 5BR8O 3ML0A 2G38A 1RM1C 2JRIA 1LR1A 1WA8A 3RW0A 4LF4O 4I5SA 4X1YA 3F5TA 1XMOB 1R6TA 4FLTA 2QSAA 4LCUC 1N8RW 4W4LA 1W0KG 2N05A 5F2VO 3KZIZ 1VQPV 3UT5B 3A2FA 4U3JA 2DYRC 4HNAA 1G1XB 4BIUA 1VIBA 4JTDB 2ZXWB 5BMVB 4X1KA 2KG7B 2DYSB 4UXNA 5KA6A 2XHBA 3DSQA 3D36A 1WLEA 1Y6XA 4J7JA 1NS1A 1EN4A 2UU9O 1S3JA 5IYBO 1GN2A 1QCEA 1JCHA 1PV0A 4K35A 2CAZC 3TJTA 2OIGA 1NU1H 3CRAA 4LF9O 4GKKO 2QM8A 1OCOB 3OD4A 1K4CC 3M7MX 1JFFB 3CS5A 2VQFO 4LBEC 2CH7A 4FM2A 3N27A 3GWOA 3ZEDA 3FAVA 1Y74A 2YC0A 3FFQA 3ZRVA 5J2UA 3H1JH 1Y66A 2AW9A 3CRQA 5GW7A 4JASA 2FKXA 4JYBA 5CBFA 1KMIZ 3AG7A 1JA8A 1YJNV 1NR1A 1VQNV 3JD3A 2ZKOA 4UVBA 1NQTA 4DV6B 5KA5A 4WCEV 1QQCA 3VBBA 3BHPA 4HAMA 2UXDO 1THZA 3IJ4A 1K7DA 4X88A 4OX9O 3FB6C 1D5AA 2HVJC 4TV9A 1I0HA 3BFRA 4PDRA 2B5UA 1J5EB 4FFBB 3CCQV 4F4LA 4JZGA 4WFFA 3TK1A 3G6EV 2OIEA 4EB6A 2E5LO 3T1YO 5LXTB 4JYAB 5LA6A 3N2GA 2QWNB 3RYIA 5KHGA 1Y67A 4LF8B 1I5YA 4UCUA 3T1CA 4FLUA 2ITDC 4DR1O 4X1IB 3LSSA 4CS2A 2RNBA 2BSKB 4FPPA 4PD4F 3OFNG 2HKOA 4DV3B 1FJGB 3ZMZA 1EZJA 3CMAV 4LWSB 5C8YB 1WB8A 4TQFA 1ZL8B 2F4VB 1XNQB 4Z1VA 2OYQA 1WP8A 1FFXB 1AR5A 4LFBB 2EIKB 2JIZG 5EYPA 4TUYB 1YJ9V 3B4SA 3RVZA 2X6AA 2LJ2A 1BE3H 5JQGA 3TCUA 4UV9A 1GMGA 1WA8B 3AG3C 3OUFA 4ZHQB 3OEHG 2IH3C 1S77D 3G6BA 2ZT9B 4BIZA 3E22A 1QR8A 1KC8W 1Q81W 3DXRB 4XDLA 3A8TA 1SS3A 5BY1A 2K9PA 1TA8A 4MTFA 4RUFA 3ZHTA 4EFEA 4IIJA 2D2CB 3U10A 1OZ0A 2VQEB 4MSWC 4MVUA 3Q4HB 3ASOC 2ZIOA 1YEWA 5BMVA 2X6BA 2F4VO 3JYCA 1HWYA 3HR0A 1U97A 5BXZA 3OR6C 1BSMA 1WJZA 3ZRSA 2IM9A 1YIJV 1N33O 2ZR3A 4DR5B 2ZE6A 3CX5F 5L3FA 1NJIW 1BT8A 1VQOV 4IGGA 1HW7A 1FXHA 1JOYA 4P2ZA 5IE9A 4GKJB 2YDEA 3BA9A 4JI1O 1HNZB 4EFBA 3VQWA 2VWKA 4ZKIA 2CDYA 4FZ0A 1AR1B 1NVPD 3K06A 4NTWA 1FXKB 5H9CA 2WLNA 1US6A 4OGQB 4DV1B 2OT5A 2Q8VA 4B3SO 2PGGA 4DV2B 3T4DA 2WLIB 1PL4A 2OCCC 1P4RA 3E8GA 1AJQA 3LDDA 1XL4A 5LMUB 4J41A 4J11A 3HKCB 5E79Z 5KLVH 2CTRA 1VQLV 4FVMA 4CC5A 1GTOA 5IYZB 2XAFA 2JGDA 4WBNA 2Z3YA 1N36B 4TQDA 2QR4A 3ASOB 3JSNA 2P67A 2BOBC 1XL6A 1I08A 2E3CA 3OMNB 5FPRA 3E8FA 4O4LB 4RAIA 3E89A 3B40A 2YIDA 2HJFC 2N04A 1XHZA 5JH7B 3TXQA 1ZAUA 4TV9B 1JQ0A 4RWUA 3E2EA 2BCCH 4QE7A 1N32B 1Y4MA 3CWBH 4D7TA 2QWOB 3AEIA 3U0ZA 3JATB 5KX5B 3CC4V
chains in the Genus database with same CATH topology
4LWSA 2DE0X 2VRZA 3HR0A 3GWKC 2KG7A 3FAVA 4I0XA 1WA8A 3Q4HA 3TXQA 2AZ2A 2B9ZA 3TXSA 4LWSB 3GVMA 3OGIB 4ABMA 4GZRB 2KG7B 2AZ0A 3O9OA 3G80A 3ZBHA 3FAVB 1WA8B 4I0XB 3FD9A 3Q4HB 2VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWS A;  2DE0 X;  2VRZ A;  3HR0 A;  3GWK C;  2KG7 A;  3FAV A;  4I0X A;  1WA8 A;  3Q4H A;  3TXQ A;  2AZ2 A;  2B9Z A;  3TXS A;  4LWS B;  3GVM A;  3OGI B;  4ABM A;  4GZR B;  2KG7 B;  2AZ0 A;  3O9O A;  3G80 A;  3ZBH A;  3FAV B;  1WA8 B;  4I0X B;  3FD9 A;  3Q4H B;  2VS0 A; 
#chains in the Genus database with same CATH topology
 2UXC B;  1WP7 A;  5J9P C;  2BOC C;  2Q7E A;  1MZE A;  3J81 N;  4FLY A;  4K8X A;  4MVS A;  4BAY A;  4MT8 A;  2GTS A;  2JJ2 G;  3ZMV A;  2YI9 A;  3ZRW A;  2HHH O;  4MVR A;  4UV8 A;  4UCO A;  5CMU A;  4I55 B;  2Q6A A;  4G27 B;  4U7O A;  1N0J A;  3RVY A;  3K03 A;  4JAU A;  1E1Q G;  3MHS C;  4F6E A;  4L8J A;  1I5X A;  2H3O A;  3BCC H;  4WFE A;  4JI6 O;  3AK3 A;  1S5L Z;  5L3E A;  3SPC A;  2F1M A;  3CCL V;  3G71 V;  1PNL A;  2P90 A;  1HNW O;  1G8M A;  2QEX V;  2EBO A;  3DC5 A;  4R7C A;  1JJO A;  4U3J B;  4DW0 A;  2EIM B;  2XAJ A;  4P9O A;  1QBZ A;  2UUC O;  1L0L H;  4J80 A;  1L0N H;  5EYP B;  3K5L A;  2RJZ A;  5KAF Z;  2MW2 B;  4LH6 A;  5JQG B;  4JTA B;  4NKG B;  4FM0 A;  5GON A;  5LP6 C;  3ZMU A;  1RSO B;  1CPY A;  1P84 F;  2VWJ A;  2Y48 A;  5B3S B;  4U3F H;  2JJ1 G;  2EX3 A;  3ETD A;  3VQX A;  1ROP A;  1PKX A;  2DOS A;  5TIS Z;  1KP3 A;  2P06 A;  4R8C A;  2NNU A;  2QTO A;  2YIC A;  1K5S A;  1JX9 A;  3AG4 C;  2XAH A;  4WF9 V;  4P9P A;  5E1A C;  4DV4 O;  4GKJ O;  2AHZ A;  1SQX H;  4DR7 O;  5ITZ B;  3F7V C;  2X6C A;  4UB8 Z;  3R65 A;  1K9M W;  3ZMS A;  3T4Z A;  1IBL B;  1YTF D;  4J7K A;  4GZR B;  1XNR O;  2QKC A;  4I4T A;  3TGU H;  3FB8 C;  3OMI B;  3K9S A;  2ITC C;  4O4J A;  1XBL A;  3ABL B;  1SZX A;  1XI1 A;  4DK0 A;  3BAB A;  1M93 A;  5LBQ A;  2F43 G;  2GDS A;  1NZ6 A;  1Z2G A;  2V1D A;  3ASN C;  3JAR A;  5IJ0 A;  2Q67 A;  4ZIB A;  2DWD C;  3D3Q A;  2ZNJ A;  1VQ5 V;  1AP5 A;  3JAS A;  4O4H B;  4ZOL B;  1OCO C;  3RYH A;  1WN7 A;  2JEX A;  3UM7 A;  4JI4 B;  3BEH A;  4JI5 B;  4LNU A;  2HFE C;  4FFB A;  2JK5 C;  1EFR G;  1AR4 A;  3FD9 A;  4KUM A;  2ZM6 O;  1K34 A;  3MHH C;  3L71 H;  3K59 A;  5LXT A;  1PP9 H;  1FXV A;  2VQF B;  2VQE O;  2Q68 A;  4TV8 B;  2IU0 A;  5JJJ B;  3SPI A;  4BR6 A;  4GKK B;  2H94 A;  1QVF U;  2DQ3 A;  4FK5 C;  3OGC C;  5KHJ A;  3X2Q C;  5HFL A;  4PI2 A;  2GUZ B;  1H38 A;  1CEZ A;  1YVW A;  4YIO A;  4NXM O;  1FAF A;  1COW G;  1IDS A;  4WFA V;  1RPO A;  2EJ7 A;  1W59 A;  1N36 O;  5JWP A;  4B08 A;  1JMK C;  1DF5 A;  1S5H C;  2QA4 V;  2Z5U A;  4NXN B;  4U7N A;  1SQB H;  1GRJ A;  1SC5 B;  4GYC B;  4DO2 A;  2A79 B;  1WPB A;  1F7Y A;  1ZTE A;  3RYC A;  4JI2 O;  5B5E Z;  1Y76 B;  1XQ8 A;  3N2K A;  1SKV A;  3B77 A;  2WPD G;  4I55 A;  3ABT A;  4O2B A;  1S5J A;  1YXB A;  2YS8 A;  3W7S A;  2N74 A;  1TUE B;  4CH5 A;  5B1B B;  1XMO O;  5GTI Z;  2P22 C;  4PHZ A;  2PZS A;  1UJW B;  3ZHQ A;  3GB7 C;  1PNK A;  4NR1 A;  4FIP C;  1R6N A;  2ZE7 A;  3CCU V;  3SDL A;  3RT3 C;  1RPR A;  2HHH B;  4DRX B;  3GWK C;  4IIJ B;  1GM7 A;  1GAX A;  1BCC H;  2C2A A;  4JYA O;  1MNG A;  2WLL B;  3KKY A;  2YXL A;  1CP9 A;  4YIP A;  2QWQ B;  4LF6 B;  3WU2 Z;  2ATK C;  2ZQM A;  4Z2W A;  1H8H G;  3BAA A;  3ABM C;  1M56 B;  5LL6 Y;  1JJ2 U;  4J9Y B;  2M7W A;  3RFR A;  5LYJ B;  5AG2 A;  3ABK B;  4EEQ A;  1Q82 W;  3IGA C;  4X62 B;  4DUY O;  2Y69 B;  4PA3 A;  3MAQ A;  4XDJ A;  5IJ9 A;  1Q5O A;  1YHQ V;  4FFK A;  5H5N A;  2LFR A;  4AQY O;  3OUS A;  4X1Y B;  4JZ2 A;  2QJ1 A;  2XT9 A;  1OCZ C;  2DYS C;  3SJA C;  3QG5 A;  4NXM B;  1K8A W;  5J2T B;  4I4T B;  1IBK O;  4YY3 O;  3SGI A;  2PTM A;  1OHH G;  1VF7 A;  2P4V A;  2ZIM A;  2IBZ H;  3I55 V;  5EZY B;  2DYR B;  5FNV A;  4IYH A;  2Y69 C;  1AJP A;  1GO3 F;  4A5U B;  1BGY H;  5KHK A;  3F5W C;  4LFA O;  3HKC A;  1N0N A;  1RFY A;  2F93 B;  2XTA A;  3RYF B;  2YEV A;  3CC2 V;  1SRY A;  4X1K B;  1WPX A;  3K0D A;  4JAA A;  5JCO A;  4QE9 A;  4O4I B;  5DEC A;  2QGN A;  3APQ A;  2DW4 A;  1RP3 B;  4DV7 O;  5IDJ A;  3GVM A;  4KP4 A;  4ABM A;  5H2F Z;  4DV6 O;  3JAW B;  3RYH B;  4B3T B;  4PA7 A;  2QKS A;  4MTX A;  3BRC A;  3BA8 A;  3K5O A;  4W4K A;  1QHT A;  4LF8 O;  3CME V;  1KKD A;  3H1H H;  2YIA A;  1P7G A;  5KUK A;  2DWE C;  4UFZ A;  4JI0 O;  2HP8 A;  5GTH Z;  4FZ1 A;  5B66 Z;  1H8E G;  4PJ0 Z;  3NXS A;  4F6R B;  4FLW A;  3NR7 A;  2PI4 A;  3SPH A;  1XUQ A;  4NXN O;  4ICG A;  2WAM A;  4JI4 O;  1P7B A;  3OT7 A;  1VEW A;  2WA4 A;  3FX7 A;  5LOV B;  1Q90 D;  2K1E A;  3UQ8 A;  3SJQ C;  2IJI A;  2GUZ A;  5L3C A;  5CN0 A;  3CCS V;  1QLE C;  4YJ2 B;  4Q20 A;  1RM1 B;  3SYO A;  1OJH A;  3HPL C;  3A0B Z;  3AK2 A;  4JI1 B;  4DR2 B;  4N21 A;  4X62 O;  2LW7 A;  4D7S A;  3S3W A;  5K1X A;  2EIN C;  3K79 A;  4X65 B;  4OXS A;  2BTQ B;  2DQ0 A;  1XNQ O;  1N33 B;  1GH6 A;  2AZ0 A;  5EK0 A;  4B3M B;  2PY5 A;  3E35 A;  4B3M O;  2ZE5 A;  4DV0 O;  1TGO A;  1AI7 A;  4UUJ C;  1QLN A;  1SER A;  1IBL O;  1T5E A;  3RYI B;  1X59 A;  5EIB C;  1B3Q A;  2UUC B;  2QM4 A;  1CXZ B;  1MZF A;  2MK3 A;  1HNW B;  2Y4U A;  1V54 B;  3CJH B;  2W6I G;  3K5N A;  1KP2 A;  2LO1 A;  2WLL A;  3OR7 C;  3TET A;  1PL0 A;  2CK3 G;  3ICX A;  1LUV A;  3JAM N;  1EM1 A;  1SQF A;  3FB7 C;  3K57 A;  3ASN B;  1H2M A;  4MW3 A;  3CCE V;  5LMN B;  1YJW V;  5IYD O;  1IBM O;  3ZN0 A;  2IH1 C;  3D36 C;  5CA0 A;  4KL1 A;  3L73 H;  4HBN A;  3ZHU A;  2IJH A;  1B6Q A;  4LC1 A;  3SJC C;  1VMG A;  2IJJ A;  3SYP A;  1LNQ A;  4X66 B;  2W0X A;  3IAY A;  1FYJ A;  3CC7 V;  1OCR C;  2AGA A;  2X7R B;  4B7K A;  2EIM C;  2UUB B;  3THO A;  4J7Z A;  1Q6I A;  1DLB A;  4JI0 B;  2AHY A;  2KKW A;  3CPW U;  1YI2 V;  1E1R G;  4FLX A;  2WA3 A;  2EIN B;  4ZOL A;  1OV9 A;  1HNZ O;  3ZHR A;  1DGS A;  2Q0O C;  3C90 A;  3CRC A;  4IT5 A;  3BPZ A;  3AG4 B;  4DV7 B;  1IX9 A;  3Q4H A;  3E86 A;  1SES A;  1QLE B;  5EIB D;  1MOF A;  4IYI A;  2AXT Z;  1YZB A;  3JD4 A;  2FB5 A;  1O9G A;  1X4T A;  2R9I A;  5JJN B;  4TV8 A;  5KMG B;  4EKW A;  4B7E A;  3PJS K;  2DMX A;  4MW8 A;  1N32 O;  2WWW A;  1H2K A;  3EHB B;  4JTC B;  5FL7 G;  3JAW A;  1WNS A;  3CHX A;  1R3L C;  4B3S B;  2ILM A;  3LSQ A;  1BHA A;  4UCS A;  5L3G A;  2CGO A;  5LMN O;  2EIK C;  1M4U A;  5LHG A;  1BQ0 A;  3EFF K;  4WFH A;  3SYQ A;  1GK9 A;  3IC9 A;  4BIO A;  1VF6 C;  1F4M A;  1NBM G;  1FXK A;  1R3J C;  2ODM A;  4NTX A;  4NYK A;  5JVD B;  2Z0A A;  3AK1 A;  4GX2 A;  5KAI Z;  1S0V A;  5HFM A;  2FML A;  4X20 A;  4RQF A;  5CA1 A;  5D5P A;  3RYC B;  2P4K A;  2JEU A;  2Q5Z A;  2RMK B;  1DK1 A;  4GLX A;  1M56 C;  4CC6 A;  1MA1 A;  4I0X B;  4EB6 B;  5IYZ A;  5LP6 A;  1H2L A;  5BZB A;  2ZR2 A;  4LF9 B;  5H6Q A;  3ABL C;  3L9D A;  4PDV A;  3O65 A;  3L75 H;  3OGI B;  5EC1 C;  4L87 A;  4DR6 O;  2LW1 A;  1GM8 A;  1QR9 A;  4HNA B;  3CB2 A;  2RCV A;  2UU9 B;  3B2E E;  3CRM A;  5C8Y A;  1ZX3 A;  1ARO P;  3QO5 A;  3CSX A;  3JD0 A;  4J9Z B;  3OMA B;  2ARH A;  3W7W A;  3QVN A;  1FFT B;  2CE4 A;  1JR9 A;  4QNH B;  2YXH A;  2FL4 A;  1FFX A;  3T1H O;  4YJ3 B;  1KU9 A;  2CGN A;  4YXW G;  3H1L H;  4MTG A;  3JAL A;  5EBM C;  4LFC O;  2W0F C;  2CTQ A;  2DE0 X;  1K97 A;  3CYO A;  1G4Y B;  4ZHQ A;  3KCX A;  4JV5 O;  1GN4 A;  2Q4P A;  2CH7 B;  1K73 W;  1XIL A;  5CB4 B;  2EIL B;  1NKD A;  3FAV B;  2Q73 A;  2V7Q G;  5BR8 B;  3CD6 V;  1Y74 B;  1EN5 A;  3JSL A;  3CXC U;  3LDC A;  2A7W A;  4DR5 O;  1GKF A;  1P49 A;  4GUN A;  4MVM A;  1G6U A;  4K3A A;  5KHI A;  1SF9 A;  4HYO A;  5IY5 B;  4O4I A;  4O2A A;  2QTS A;  3FYI B;  3E8B A;  1XRE A;  1J5E O;  1KEC A;  1R1B A;  3W7T A;  4DV3 O;  1IXM A;  3SJB C;  3MD0 A;  4MS2 A;  2IJK A;  1BS3 A;  1W0J G;  4PA9 A;  3DC6 A;  4YY3 B;  4ZI7 B;  2F95 B;  1GN6 A;  2PUS A;  3G67 A;  1XHX A;  3A0R A;  3FYE B;  1KBH A;  2EIL C;  2CTP A;  3I56 V;  3AG1 B;  3P3N A;  4F6R A;  2H8P C;  3CRR A;  1Q6U A;  3LSU A;  4LFB O;  4MVO A;  4IHJ A;  2Y4T A;  2E76 B;  4I7Z B;  4LR3 A;  2B1G A;  2OWO A;  3OE7 G;  3JAK B;  1BMF G;  2RDC A;  3WB0 A;  1AJN A;  3DGE A;  3H9V A;  2E75 B;  1D5N A;  5JCO C;  1GN3 A;  4WBN B;  3H01 A;  1SET A;  1SQP H;  3QTC A;  3VOU A;  2GSM B;  3WG7 B;  1KKC A;  3JAR B;  4UB6 Z;  3ZHS A;  1H2G A;  4FM1 A;  3JCU Z;  1HR0 B;  1Z5W A;  4O4L A;  2HR3 A;  4XBF A;  3HKB A;  4R6Z A;  3UT5 A;  3UO2 A;  1V55 B;  5DED A;  3JD1 A;  5JH7 A;  1Q86 W;  2OCC B;  2YI8 A;  2GBO A;  4MTO A;  1Q8I A;  2WLJ A;  3ABM B;  3K9A A;  4LNU B;  1QU7 A;  1L1F A;  1V9P A;  2RN9 A;  2UXX A;  2KG7 A;  4I0X A;  5B3S C;  3K58 A;  3JAT A;  5KX5 A;  1NR7 A;  4CS3 A;  1AI5 A;  2R70 A;  5LP6 B;  1MG1 A;  4NTY A;  3CCR V;  3E83 A;  3HKE B;  1OCC B;  3DXR A;  3S3X A;  1YF2 A;  4JYC A;  1V55 C;  3UCS C;  1AP6 A;  2DN9 A;  4J10 A;  2HVK C;  4JI8 B;  3ETE A;  1KQS U;  4JI3 O;  4JAV A;  1JPX A;  2XUM A;  1FS0 G;  3CCM V;  4JI6 B;  4CH4 A;  4LF4 B;  2YIB D;  1SA0 A;  5CA0 B;  1AIL A;  5C93 A;  3ZMT A;  2EIJ B;  5IWA O;  5LHI A;  2PYJ A;  3RWR D;  2ZXW C;  5B1A C;  3SR2 C;  2ADQ B;  3I5D A;  1F4N A;  2Q7H A;  1I94 O;  1YTF B;  1Q3E A;  3F7Y C;  1TUB B;  1VQ8 V;  4PDM A;  5IT9 N;  2UXC O;  3JAL B;  2WLM A;  3K3W A;  2YUA A;  1A32 A;  4QIW F;  1SZT A;  4OPA A;  3ZRX A;  1BZK A;  1VQK V;  3AG1 C;  1VQ4 V;  5D5Q A;  2L35 A;  4JI5 O;  3K04 A;  3X2Q B;  5CB4 A;  1MSD A;  4X64 O;  1FJG O;  1PM9 A;  2XAG A;  4KHP O;  4DR4 O;  2ETN A;  4X65 O;  2O57 A;  5B1A B;  2ZE8 A;  3TXS A;  4DR3 B;  3QF7 A;  2UUA O;  1I94 B;  2PYL A;  4RO2 A;  3CE2 A;  4DUZ O;  1YSC A;  4QPJ A;  2WLH A;  4TT3 G;  3T1Y B;  5A9G A;  5KMG A;  4O2A B;  3N2G B;  2KQX A;  2UUA B;  1VAR A;  1ZSP A;  4DR3 O;  1S76 D;  4TSF G;  5H6R A;  1M1K W;  3QNE A;  2EZP A;  4JI3 B;  2GHY A;  4E2L A;  3B09 A;  4J42 A;  4X1I A;  3BVO A;  4KHP B;  4MVQ A;  1YIT V;  1AI6 A;  3ZJZ A;  1R6K A;  2ADP A;  1MAB G;  2BE3 A;  4OX9 B;  2KB1 A;  5CBG A;  5IJ9 B;  4LWS A;  3ZS8 C;  1M9N A;  2EJR A;  2A3Q A;  3RBZ A;  1UPG A;  3T2M A;  2QWR B;  1ZL8 A;  4K8Z A;  1WAZ A;  1IXB A;  4DV4 B;  4O4H A;  2DJV A;  3LNN A;  1LUW A;  1IUR A;  4DV5 B;  3O9O A;  2A9H A;  4UCT A;  5B1O A;  4TWK A;  5EZY A;  4TUY A;  4MVZ A;  3JAK A;  5CA3 A;  4B3T O;  4DV5 O;  4I50 A;  1MMM A;  3L70 H;  3U11 A;  3C3S A;  3RYF A;  5L3B A;  4DK1 A;  4AIL C;  1M5I A;  4LF7 O;  4GX0 A;  4UVA A;  2X0L A;  1ZUQ A;  4PI0 A;  1D2D A;  3ETQ A;  1HNX O;  3P3P A;  1VQ9 V;  4LFC B;  4LH7 A;  1NH2 B;  1MSW D;  2ZNI A;  4DXW A;  2P6J A;  4PEL A;  4JPR A;  3JD2 A;  3HKB B;  1XMQ B;  5KUM A;  1ENV A;  4G28 B;  2JGU A;  4RUE A;  4FLZ A;  1NTM H;  1KUQ A;  3HKD B;  2LQT A;  3JCZ A;  1N4C A;  5GON B;  1K5Q A;  2YIB A;  3APO A;  3ZBH A;  1TVK B;  4K0K O;  1RSO A;  3K08 A;  3M8A A;  3SYC A;  3QO8 A;  1W2B U;  3M99 B;  1YDX A;  1R3I C;  3HKE A;  1BQZ A;  5DN6 G;  4YJ3 A;  3IFX A;  4LF5 O;  1V54 C;  3UKM A;  2PF4 E;  1NI8 A;  2F66 C;  1HR0 O;  3RGB A;  3A0H Z;  2UXB O;  1F51 A;  3FKS G;  4N23 A;  2JVD A;  1WB7 A;  1HP8 A;  4H13 B;  4GX1 A;  1VQM V;  1R73 A;  3ZIA G;  1IZ3 A;  5CBH A;  2HG5 C;  4YJ2 A;  1PNM A;  5IYC O;  1UFI A;  2KSD A;  3B8N A;  3ZN1 A;  3ZHV A;  4BWA A;  3J7A U;  3VQY A;  2ZDI C;  1AB3 A;  5DM6 V;  2WLI A;  4DR1 B;  1J95 A;  3B8M A;  3OTO O;  2NR5 A;  2A06 H;  1N34 B;  2OTJ V;  4O4J B;  3D8C A;  3IC7 A;  2ZCE A;  2BTO A;  4CBC A;  5IWA B;  2BTQ A;  2FTK A;  5KHH A;  2E5L B;  3C3T A;  4K0K B;  3W7U A;  4FLV A;  4NVP A;  3E8H A;  2P5O A;  4PV1 B;  1NH2 D;  1Q6H A;  2QM7 A;  3JAS B;  3P30 A;  4JV5 B;  2WSS G;  4LP8 A;  1Z5V A;  1DF4 A;  1ZWI C;  2LP7 A;  2QKA A;  1BHB A;  1VF5 B;  2VS0 A;  1M57 B;  2EUL A;  2CUG A;  2JS5 A;  4ZI7 A;  4JI2 B;  1EN6 A;  3CJH A;  3OEE G;  2VRZ A;  4ZBM A;  2YXY A;  1L8D A;  2UXD B;  1YCI A;  3VQV A;  2NLJ C;  5IY5 C;  4Q6G A;  4XDK A;  1H2N A;  2GV9 A;  3STZ C;  1F23 A;  3ABU A;  2JS3 A;  3WB2 A;  2YSU B;  1VF6 A;  5EC2 C;  3R66 A;  1OCR B;  2P7T C;  2R9R B;  2RQ6 A;  2Q9L A;  3UO3 A;  4AHC A;  4IHJ B;  4X89 A;  3STL C;  4JI7 B;  2UXN A;  3FB5 C;  5A2Q N;  2B1I A;  5K1P A;  4PA4 A;  3MDS A;  2V4D A;  1XEQ A;  4B3R O;  4C7U A;  3G4S V;  3H1I H;  3OTF A;  3G80 A;  1S72 V;  3CCV V;  3KG2 A;  2ZD9 A;  5L3D A;  2UXB B;  2ZM6 B;  1K92 A;  1NTK H;  4PDL A;  4WFB V;  4E4E A;  4X9Q A;  4LFA B;  1E79 G;  2M6Y A;  4BW5 A;  2W6J G;  2HJD A;  1I7F A;  4QPK A;  1XDC A;  2OCH A;  4KFM A;  4LF5 B;  3CXH F;  1K3E A;  2L6L A;  3N2K B;  3SPG A;  3QO7 A;  5LGT A;  1KYO F;  1XOU A;  1AI4 A;  4DYL A;  4H0L B;  3PN1 A;  1NVP B;  2R72 A;  5B1B C;  1AVM A;  4RQE A;  4JYY A;  5JJE B;  1VQ6 V;  4JI8 O;  4H44 B;  1U96 A;  4DR6 B;  3OTO B;  1KB9 F;  1TAE A;  4HZ3 A;  3OW2 U;  1M57 C;  4DR4 B;  4QJF B;  1B06 A;  1EZV H;  4DRX A;  5ITZ A;  1KD1 W;  1SQQ H;  1BL8 A;  2BSK A;  1QNM A;  2CTW A;  1PPJ H;  1K4D C;  2Y0P A;  3HKD A;  2OTL V;  4B3R B;  3AG3 B;  1SA0 B;  1M90 W;  4OPH A;  3CP1 A;  2AZ2 A;  4GT1 A;  1XNR B;  2Q0A A;  4JI7 O;  2WLK A;  2LGQ A;  3K5M A;  2ZIN A;  1PD3 A;  3AG2 C;  5LYJ A;  2Q69 A;  3H1K H;  1ORQ C;  4DR7 B;  3L72 H;  1N34 O;  2IU3 A;  1TUB A;  3ETG A;  3LUT B;  4CH6 A;  5LGU A;  1HDJ A;  5FLX N;  4CZZ A;  4PA6 A;  2QDO A;  2E74 B;  4UCV A;  5B1N A;  5IJ0 B;  3KCY A;  2HLD G;  5J2T A;  3WB1 A;  2JDI G;  4AI8 A;  4KXR A;  4TOI A;  3E22 B;  3L74 H;  3WFV A;  1SQV H;  1XMQ O;  3LNM B;  4P30 A;  2R9A A;  2UUB O;  5FNV B;  4QGP A;  3AG2 B;  1URF A;  1QVG U;  1VQ7 V;  1JFF A;  1H2S B;  1FD9 A;  1DTO A;  2YEV B;  2B9Z A;  1FKA O;  2PI5 A;  2D3O W;  3K0G A;  4FJC C;  3BY6 A;  3RN4 A;  4R50 A;  1NTZ H;  2HEP A;  2LFS A;  4UVC A;  3SPJ A;  1NT2 B;  5J2U B;  1B04 A;  4CH3 A;  4H37 A;  4GX5 A;  3ZCC A;  4YHH O;  3EXA A;  5EBW C;  2QE7 G;  4BW9 A;  2XOK G;  2XND G;  2Y0I A;  3LDE A;  4I9W A;  2EIJ C;  4UCR A;  1OCZ B;  3D3I A;  1HNX B;  3P32 A;  4JGS A;  4I9Q A;  4X8A A;  1K33 A;  4DV0 B;  1R3K C;  4DW1 A;  2GTA A;  3EVK A;  4YHH B;  1FPO A;  4Z1M G;  1Y76 A;  3ABK C;  3DTU B;  3OM3 B;  4H33 A;  4NB5 A;  1EBO A;  2Q7G A;  2IW5 A;  4D6T H;  4I50 B;  5LOV A;  5FPO A;  4O2B B;  1IBK B;  5LGN A;  1OCC C;  3W7X A;  4DUZ B;  2JGD B;  1SQG A;  4AQY B;  5LA6 B;  2QWP B;  4CS4 A;  4WFG A;  1O9H A;  4JF3 A;  1FXK C;  1VP7 A;  4GCZ A;  4ASU G;  4FMT A;  4DUY B;  3CEI A;  2XAQ A;  2ZDI A;  5LMU O;  4G2K A;  3T1H B;  4X64 B;  2LGW A;  4X66 O;  3SYA A;  1Q7Y W;  2A0L A;  4LF7 B;  5EBL C;  5LHH A;  1JVM A;  4DV2 O;  2F23 A;  1ZLZ A;  1TVK A;  4LF6 O;  2EZO A;  1IBM B;  4DV1 O;  2NN4 A;  3WG7 C;  5JVD A;  3HB3 B;  4IL6 Z;  3J80 N;  2FYU H;  2XAS A;  4X20 B;  3CCJ V;  5CA1 B;  3ZX6 A;  1GM9 A;  3OAA G;  4DR2 O;  1Q43 A;  1IVS A;  3ZRW B;  5BR8 O;  3ML0 A;  2G38 A;  1RM1 C;  2JRI A;  1LR1 A;  1WA8 A;  3RW0 A;  4LF4 O;  4I5S A;  4X1Y A;  3F5T A;  1XMO B;  1R6T A;  4FLT A;  2QSA A;  4LCU C;  1N8R W;  4W4L A;  1W0K G;  2N05 A;  5F2V O;  3KZI Z;  1VQP V;  3UT5 B;  3A2F A;  4U3J A;  2DYR C;  4HNA A;  1G1X B;  4BIU A;  1VIB A;  4JTD B;  2ZXW B;  5BMV B;  4X1K A;  2KG7 B;  2DYS B;  4UXN A;  5KA6 A;  2XHB A;  3DSQ A;  3D36 A;  1WLE A;  1Y6X A;  4J7J A;  1NS1 A;  1EN4 A;  2UU9 O;  1S3J A;  5IYB O;  1GN2 A;  1QCE A;  1JCH A;  1PV0 A;  4K35 A;  2CAZ C;  3TJT A;  2OIG A;  1NU1 H;  3CRA A;  4LF9 O;  4GKK O;  2QM8 A;  1OCO B;  3OD4 A;  1K4C C;  3M7M X;  1JFF B;  3CS5 A;  2VQF O;  4LBE C;  2CH7 A;  4FM2 A;  3N27 A;  3GWO A;  3ZED A;  3FAV A;  1Y74 A;  2YC0 A;  3FFQ A;  3ZRV A;  5J2U A;  3H1J H;  1Y66 A;  2AW9 A;  3CRQ A;  5GW7 A;  4JAS A;  2FKX A;  4JYB A;  5CBF A;  1KMI Z;  3AG7 A;  1JA8 A;  1YJN V;  1NR1 A;  1VQN V;  3JD3 A;  2ZKO A;  4UVB A;  1NQT A;  4DV6 B;  5KA5 A;  4WCE V;  1QQC A;  3VBB A;  3BHP A;  4HAM A;  2UXD O;  1THZ A;  3IJ4 A;  1K7D A;  4X88 A;  4OX9 O;  3FB6 C;  1D5A A;  2HVJ C;  4TV9 A;  1I0H A;  3BFR A;  4PDR A;  2B5U A;  1J5E B;  4FFB B;  3CCQ V;  4F4L A;  4JZG A;  4WFF A;  3TK1 A;  3G6E V;  2OIE A;  4EB6 A;  2E5L O;  3T1Y O;  5LXT B;  4JYA B;  5LA6 A;  3N2G A;  2QWN B;  3RYI A;  5KHG A;  1Y67 A;  4LF8 B;  1I5Y A;  4UCU A;  3T1C A;  4FLU A;  2ITD C;  4DR1 O;  4X1I B;  3LSS A;  4CS2 A;  2RNB A;  2BSK B;  4FPP A;  4PD4 F;  3OFN G;  2HKO A;  4DV3 B;  1FJG B;  3ZMZ A;  1EZJ A;  3CMA V;  4LWS B;  5C8Y B;  1WB8 A;  4TQF A;  1ZL8 B;  2F4V B;  1XNQ B;  4Z1V A;  2OYQ A;  1WP8 A;  1FFX B;  1AR5 A;  4LFB B;  2EIK B;  2JIZ G;  5EYP A;  4TUY B;  1YJ9 V;  3B4S A;  3RVZ A;  2X6A A;  2LJ2 A;  1BE3 H;  5JQG A;  3TCU A;  4UV9 A;  1GMG A;  1WA8 B;  3AG3 C;  3OUF A;  4ZHQ B;  3OEH G;  2IH3 C;  1S77 D;  3G6B A;  2ZT9 B;  4BIZ A;  3E22 A;  1QR8 A;  1KC8 W;  1Q81 W;  3DXR B;  4XDL A;  3A8T A;  1SS3 A;  5BY1 A;  2K9P A;  1TA8 A;  4MTF A;  4RUF A;  3ZHT A;  4EFE A;  4IIJ A;  2D2C B;  3U10 A;  1OZ0 A;  2VQE B;  4MSW C;  4MVU A;  3Q4H B;  3ASO C;  2ZIO A;  1YEW A;  5BMV A;  2X6B A;  2F4V O;  3JYC A;  1HWY A;  3HR0 A;  1U97 A;  5BXZ A;  3OR6 C;  1BSM A;  1WJZ A;  3ZRS A;  2IM9 A;  1YIJ V;  1N33 O;  2ZR3 A;  4DR5 B;  2ZE6 A;  3CX5 F;  5L3F A;  1NJI W;  1BT8 A;  1VQO V;  4IGG A;  1HW7 A;  1FXH A;  1JOY A;  4P2Z A;  5IE9 A;  4GKJ B;  2YDE A;  3BA9 A;  4JI1 O;  1HNZ B;  4EFB A;  3VQW A;  2VWK A;  4ZKI A;  2CDY A;  4FZ0 A;  1AR1 B;  1NVP D;  3K06 A;  4NTW A;  1FXK B;  5H9C A;  2WLN A;  1US6 A;  4OGQ B;  4DV1 B;  2OT5 A;  2Q8V A;  4B3S O;  2PGG A;  4DV2 B;  3T4D A;  2WLI B;  1PL4 A;  2OCC C;  1P4R A;  3E8G A;  1AJQ A;  3LDD A;  1XL4 A;  5LMU B;  4J41 A;  4J11 A;  3HKC B;  5E79 Z;  5KLV H;  2CTR A;  1VQL V;  4FVM A;  4CC5 A;  1GTO A;  5IYZ B;  2XAF A;  2JGD A;  4WBN A;  2Z3Y A;  1N36 B;  4TQD A;  2QR4 A;  3ASO B;  3JSN A;  2P67 A;  2BOB C;  1XL6 A;  1I08 A;  2E3C A;  3OMN B;  5FPR A;  3E8F A;  4O4L B;  4RAI A;  3E89 A;  3B40 A;  2YID A;  2HJF C;  2N04 A;  1XHZ A;  5JH7 B;  3TXQ A;  1ZAU A;  4TV9 B;  1JQ0 A;  4RWU A;  3E2E A;  2BCC H;  4QE7 A;  1N32 B;  1Y4M A;  3CWB H;  4D7T A;  2QWO B;  3AEI A;  3U0Z A;  3JAT B;  5KX5 B;  3CC4 V; 
#chains in the Genus database with same CATH homology
 4LWS A;  2DE0 X;  2VRZ A;  3HR0 A;  3GWK C;  2KG7 A;  3FAV A;  4I0X A;  1WA8 A;  3Q4H A;  3TXQ A;  2AZ2 A;  2B9Z A;  3TXS A;  4LWS B;  3GVM A;  3OGI B;  4ABM A;  4GZR B;  2KG7 B;  2AZ0 A;  3O9O A;  3G80 A;  3ZBH A;  3FAV B;  1WA8 B;  4I0X B;  3FD9 A;  3Q4H B;  2VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...