3TXQA

Crystal structure of phage 44rr small terminase gp16
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'VYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHVEVFAQLMGQMTTTNKEMLKMHKEMKDLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Terminase DNA packaging enzyme small subunit
publication title Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages.
pubmed doi rcsb
source organism Aeromonas phage 44rr2.8t
molecule tags Viral protein
total genus 31
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2011-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3txqA01
3ZBHA 3G80A 2KG7A 2KG7B 3HR0A 4GZRB 3GWKC 3FD9A 3FAVA 3FAVB 3OGIB 2AZ0A 2VS0A 3O9OA 2AZ2A 1WA8A 3TXQA 1WA8B 4I0XA 4I0XB 2VRZA 2B9ZA 3GVMA 4ABMA 3TXSA 4LWSA 4LWSB 3Q4HA 3Q4HB 2DE0X
chains in the Genus database with same CATH superfamily
1FFTB 2ADQB 4G2KA 2Q7GA 2EIJC 4DR5B 1F51A 2WLLB 3T4ZA 4R8CA 3P3PA 2AZ2A 4JI8O 2WLIB 3N2GB 2UUCB 4DR3O 3K5NA 1SZTA 4DV1B 5LOVA 2ITDC 5BXZA 2PF4E 4WBNB 4QNHB 1WB7A 4JI7B 4GX0A 2F93B 1JPXA 3VQVA 3SPIA 5BY1A 1RSOA 3IFXA 4DR2B 4YHHB 3T1HB 3UT5A 1JJ2U 1GH6A 2EJRA 2QEXV 2MK3A 1NH2B 1IBLB 1V55B 4OPAA 5LOVB 3H1KH 4N21A 1YI2V 2L35A 4OXSA 3CCSV 1FS0G 2HP8A 3CJHA 4RO2A 3E35A 3M99B 2B1IA 2P06A 2HR3A 2UXCO 2EX3A 2Y4TA 1K8AW 1RSOB 4TWKA 5LMNB 1MG1A 3UT5B 4J11A 4XBFA 3WU2Z 3SPJA 4DV2B 4DO2A 1BQ0A 2Y4UA 1NTZH 2A0LA 2Q73A 3CJHB 3DXRA 4NYKA 1WJZA 1UFIA 3QO5A 4BAYA 4E4EA 2ZE6A 3AG4C 1R6TA 3I5DA 3FB7C 3K59A 1TVKA 4DR1B 3FFQA 3K58A 5BZBA 4LFBB 4P9PA 4QPKA 3CP1A 1HWYA 4PI2A 1VF7A 1GRJA 1KUQA 5L3FA 3ZRSA 4MTOA 4LCUC 2DN9A 3ETDA 3IGAC 2RNBA 1Q7YW 1JJOA 3AK2A 5KUMA 3SDLA 1XMOO 3DXRB 4X89A 4FZ1A 1K7DA 1OJHA 5L3EA 3APQA 3DGEA 1CXZB 5CBFA 5HFMA 4CH5A 3FD9A 2UXDO 2UUAB 5IYZA 1BE3H 4QE9A 1TVKB 5KUKA 4JI6O 5CA0A 2HHHB 5LYJA 1IXBA 2IM9A 4FK5C 1SQFA 1FD9A 1PPJH 2AGAA 1E1RG 1E1QG 4UCOA 5IYZB 4JAVA 5CA0B 3OEEG 1L0NH 1M56C 5CBGA 1GTOA 4PI0A 2OYQA 3A0RA 1QBZA 2ARHA 4LWSA 3DC6A 4UUJC 2H8PC 4HZ3A 4JI2B 4DXWA 4NTWA 4DV7B 3BA8A 2B1GA 1AI4A 2QTOA 5IYDO 1TUEB 3BPZA 3QG5A 1I7FA 5H6RA 1S5JA 5LP6A 4QJFB 4JV5O 4DRXA 1FXVA 3JYCA 2QA4V 4O2BB 1ZTEA 2QKAA 2HVKC 4I4TA 3ABKB 1EZVH 2DYSC 4LWSB 2QGNA 4ASUG 1VF6C 1O9GA 3WB0A 1US6A 4K8XA 5IWAB 5B66Z 5KHHA 1VQKV 1SC5B 4K35A 1BS3A 4K0KB 2M7WA 3ABMC 1IBMB 4LF5B 5LP6B 3OGCC 3NXSA 1IBKB 1ZAUA 1B06A 4XDLA 3K04A 1BZKA 1MSDA 3EVKA 4X9QA 2EIKC 4I4TB 4MVMA 1SQVH 1XREA 3QNEA 1VQOV 2XAHA 4K8ZA 1K4DC 2ZQMA 2EILC 1BMFG 3VQXA 4JI8B 4DR3B 4GKJO 3H1JH 1K3EA 1I0HA 4IT5A 1F4MA 4TUYA 4OX9O 1YTFD 1SERA 3W7WA 3TGUH 3W7SA 2JDIG 2IH1C 2JGUA 2Q5ZA 3RT3C 1N0JA 2R72A 3CEIA 3SPCA 1N32O 3ZN1A 4O2AA 3B77A 3WB2A 2EIMB 2BOCC 4G28B 5B1NA 3H1IH 2IW5A 2ZNJA 3JD4A 3LSUA 4OPHA 3LSSA 3UKMA 1DK1A 5EIBD 3CB2A 1NTKH 2YXHA 4YIOA 4O2AB 4UV8A 2UXCB 4XDJA 3THOA 3H9VA 1NU1H 5DEDA 2IJJA 4JAUA 3VBBA 1RM1B 2P4KA 3M7MX 4NXNO 2ZKOA 5K1XA 5KHJA 3TK1A 1FFXB 1PNMA 4D7TA 2UXXA 2FTKA 4MTFA 1UJWB 4UV9A 1GMGA 5EIBC 4PJ0Z 3CYOA 2QWPB 5DECA 2EULA 4KP4A 3OR6C 1QVGU 3CRMA 3JARB 4JI3O 1YEWA 3UM7A 4ABMA 1XMOB 4DR6O 5CA1A 3L74H 2QKCA 2YIBA 2R70A 2GDSA 2ZNIA 5LL6Y 2UXDB 1AJPA 4JI6B 3KG2A 2X7RB 2WLJA 2QM7A 4DV6O 1P49A 3L75H 4MVQA 1NH2D 3OUSA 1Y4MA 3RVYA 4FM1A 2DMXA 3LUTB 3OTFA 2YI9A 3B2EE 5CA1B 1KQSU 5IDJA 2EINB 5J2UB 3AK1A 5LGNA 3G71V 5A9GA 4B3RO 4EKWA 2AXTZ 4YJ2A 2X0LA 3PJSK 4Q6GA 3JASA 3LNNA 2P6JA 2KB1A 2ZR2A 4GYCB 4PD4F 4B08A 3KCYA 1GM8A 3FYEB 5HFLA 1XHZA 1FYJA 1V55C 4UFZA 4WFHA 1OHHG 1Y6XA 3IAYA 1Y76A 4BR6A 1M1KW 3SYQA 4GX1A 2W6JG 3ZN0A 5AG2A 3R65A 3X2QC 4JV5B 3RWRD 3T2MA 3JD1A 2VQFO 1X59A 3JASB 4DV3O 4J9ZB 4JTCB 2CK3G 3E86A 1SESA 1NQTA 3GB7C 2GHYA 4HNAA 4J41A 4PA4A 1FXHA 2N05A 1LNQA 5FPRA 5B3SB 1OCOB 1Y76B 1VQ8V 3JATA 5KMGB 4AI8A 1Q6UA 2R9IA 4ZOLA 4Z1VA 3AK3A 4QIWF 4UCRA 4JI5O 2Q4PA 2G38A 3GWKC 4W4KA 2VS0A 3FB8C 3TXQA 3CSXA 2OCCB 4HNAB 3L9DA 1SZXA 4UVBA 3SPHA 5CB4A 4X88A 1F7YA 1P4RA 1HP8A 4UCSA 1YCIA 3QO8A 3AEIA 3JATB 1QR8A 3K5MA 2P5OA 1P7GA 4GKJB 4ZOLB 1VQ5V 4OX9B 5JCOA 4J7ZA 2OIEA 1S0VA 2NR5A 1XILA 2PTMA 4DV4O 1K92A 1Q5OA 2Z0AA 2ODMA 1N32B 1AR5A 2YUAA 1EN4A 4LFCO 1JX9A 4H33A 5LGTA 1KECA 5ITZA 2XHBA 1QR9A 3OFNG 5GTIZ 2Y48A 2AZ0A 4RUEA 3D8CA 5EK0A 3EFFK 5EBLC 1MSWD 3MDSA 3AG2B 3Q4HA 5H6QA 5KHGA 3UO3A 5L3BA 3FYIB 3RYCA 1DF4A 5ITZB 2CGOA 2DQ3A 4NXNB 1KP2A 4RUFA 5LBQA 2BOBC 3AG3B 3K08A 3OE7G 3ABKC 4UCTA 3CCUV 1GN3A 1VQ6V 1DTOA 3Q4HB 4J7KA 4O4IA 3ASNB 2HLDG 2ETNA 3J7AU 2Q69A 1Q82W 2VWKA 3RYCB 5LP6C 4JI3B 2GSMB 3HKBB 4DR6B 2OCHA 3VQWA 1TA8A 3JSNA 4J80A 1YDXA 3CD6V 2PY5A 1LR1A 4O4IB 1K97A 3C90A 4P30A 4DV6B 4DV5O 1V9PA 2QM8A 2Q0OC 2YS8A 4UVAA 5C8YB 4I9WA 2AHZA 3T1YO 1L8DA 3BY6A 5D5PA 1YJ9V 1W2BU 3K0GA 3MAQA 4B3RB 1G6UA 2QR4A 3RW0A 4UVCA 2NLJC 5FL7G 2WA4A 1WP7A 1EN5A 5K1PA 2EIMC 3P30A 5E79Z 4B7EA 2HEPA 1K5QA 3CC7V 1AR1B 2NN4A 3CXCU 3AG1B 2E74B 3FKSG 2OTJV 2OT5A 2A3QA 2MW2B 4GX2A 1S76D 2ITCC 2ZXWB 4JI4O 5FPOA 3E8FA 3BAAA 1FXKA 1M93A 2VQFB 4UCUA 4DV3B 3A2FA 2IU0A 1B04A 4X1KA 4GZRB 3OUFA 5A2QN 3P3NA 2RMKB 3FAVA 3ETGA 1RM1C 2PI4A 2CH7A 2K9PA 1NBMG 3JAWA 3RYHA 5IJ0A 3ZIAG 4BIOA 1R6KA 1SQXH 2JVDA 2BCCH 4TQFA 4JI5B 2H94A 3JD0A 4KXRA 2CE4A 4X1KB 1XNRO 3I56V 1H2SB 2N74A 3FAVB 2CH7B 3JAWB 1WAZA 1WA8A 4AQYO 3RYHB 3ZS8C 5IJ0B 1K9MW 2ZR3A 1MZEA 4FIPC 5EZYA 2F66C 5CA3A 4MTXA 3IC9A 3ZBHA 3CPWU 4P9OA 2DQ0A 3I55V 4J7JA 3ZEDA 2XAJA 1GKFA 4JASA 4DV4B 2CDYA 4LF9O 3EHBB 3WG7B 4CBCA 1AR4A 4LFCB 5EZYB 5KX5A 3ZMTA 2EINC 2GV9A 3CRCA 1JA8A 2P90A 4NTXA 5CN0A 1ZUQA 2WSSG 3LNMB 1ZL8A 4ZHQA 3HKDA 1Y66A 1V54B 4YY3O 1JOYA 4LF4O 3SPGA 2ZDIA 4X20A 2CTQA 1VEWA 4QPJA 3WFVA 5KX5B 1BQZA 4LC1A 4L8JA 3G67A 3ZRWA 1ZX3A 2K1EA 3UCSC 2W0XA 2HG5C 4DW1A 1XMQO 1ZL8B 4ZHQB 3HKDB 5GTHZ 3S3WA 5KAFZ 3JAMN 4BIZA 4WFFA 1Q8IA 3QF7A 4X20B 2PZSA 2QE7G 1OCCB 2XUMA 5B3SC 4GKKO 1OCOC 1PM9A 5LYJB 3APOA 3ZRWB 4YIPA 1OCZB 2EZOA 1QNMA 2X6BA 1AI5A 2P67A 2QWOB 3O65A 1XEQA 3JSLA 3CRRA 3SJQC 4D6TH 1GM7A 2QWRB 2ZCEA 1NZ6A 2L6LA 2OCCC 5IYCO 1G4YB 2ADPA 2B9ZA 2QWQB 2FMLA 4UCVA 4DV5B 4JZ2A 3QTCA 2HKOA 3M8AA 3U10A 3RN4A 1KC8W 4CS4A 3OEHG 1WPBA 1GN2A 3T1YB 1XOUA 1BL8A 4I55A 1CEZA 1KBHA 1AILA 4JI0O 1MOFA 3CCLV 3CWBH 2QM4A 4DRXB 2KSDA 3CCRV 5LXTA 1E79G 3IJ4A 3T4DA 4MS2A 4QE7A 1UPGA 3JCZA 3P32A 1MMMA 2XT9A 1N8RW 1G8MA 2CUGA 4G27B 1B3QA 1PD3A 3ML0A 5E1AC 3OMIB 5JCOC 2D2CB 1MZFA 4O4LA 1EBOA 2Q0AA 4I55B 3E22A 1M57B 4A5UB 4FLYA 4JF3A 3BFRA 5B1BB 3O9OA 1Q81W 4JI4B 4RAIA 1Q90D 1PL0A 1K33A 3AG2C 3D3QA 1OCRB 2Q9LA 4NVPA 4I7ZB 3CCQV 1T5EA 2E5LO 5H9CA 4GT1A 4O4LB 2VQEO 1SA0A 4IIJA 1H2MA 1G1XB 3AG3C 4IYIA 2QSAA 2E3CA 1IDSA 3SYOA 4U3JA 3B40A 4FLWA 1NVPB 5CBHA 4TUYB 4L87A 3FX7A 4J10A 4MW3A 4PV1B 3ETEA 1BT8A 3ASNC 1XNRB 1B6QA 2LJ2A 3CX5F 2FL4A 4HAMA 2QKSA 1RPOA 4UB8Z 2F23A 3J81N 4AQYB 2YXLA 3OMNB 2EIJB 1SA0B 4IIJB 2YSUB 4JI1O 1S5HC 1VARA 4H13B 3VQYA 3RFRA 2X6AA 2FYUH 2NNUA 1H2GA 3SGIA 5B5EZ 3SYPA 5JJNB 1YVWA 5LHIA 4GUNA 1TUBA 4LF9B 1ROPA 3SYCA 3L71H 5JJEB 1RFYA 1U97A 3R66A 1VQLV 1YIJV 1FPOA 4PHZA 5LA6A 3BCCH 4X64O 1HDJA 1Q6HA 1WLEA 2GTAA 1TUBB 4YY3B 3W7UA 4MVOA 2DOSA 1PNLA 3CCJV 4LF4B 4LF8O 4X1YA 3AG1C 4WF9V 1QLEB 1ORQC 1BHAA 1XDCA 4KHPO 2ZXWC 1D2DA 2BTQA 5LA6B 2BE3A 2P4VA 1NTMH 1Q86W 3CE2A 3SJAC 4LP8A 1XMQB 4CC5A 3H1HH 4TQDA 5J2TA 3ZCCA 3F5TA 4X1YB 2F95B 4GKKB 4U7NA 1M4UA 4JGSA 1P84F 4LNUA 2BTQB 5EYPA 3OM3B 5IY5B 3K06A 1THZA 2LGWA 4JAAA 4EFEA 3LDEA 3KKYA 4WFEA 3STZC 2RDCA 2A9HA 5J2TB 1VMGA 2R9RB 4NKGB 3SR2C 3UQ8A 2ILMA 4YJ2B 3K3WA 2PYJA 2ZIMA 5BMVA 1M5IA 2WPDG 3RBZA 4Q20A 3JAKA 3A0BZ 2WA3A 1VQPV 3HKEA 3K5LA 4I0XA 3ZHUA 4LNUB 1K34A 2IH3C 1Q3EA 5FNVA 1HR0O 5EYPB 2YIAA 1JCHA 1EM1A 5KA5A 2XAQA 3DC5A 5BR8O 4JI0B 3ZHSA 1PP9H 3JD2A 1KP3A 1N33O 5BMVB 1GN4A 3U11A 1H2LA 3WG7C 4DK0A 1KKDA 3JAKB 1AB3A 3ZMVA 1W0JG 2CAZC 2VRZA 4I0XB 5H2FZ 1R73A 4W4LA 3ABLB 4X8AA 5FNVB 1NJIW 2XOKG 4JTAB 5KA6A 4B3SO 2O57A 4IGGA 3ZHQA 3CC2V 1V54C 4GCZA 1IVSA 2LGQA 2JEUA 4B3TO 4XDKA 4JYCA 1SRYA 5CB4B 2CTRA 4FPPA 1X4TA 3N27A 2W0FC 2E5LB 2W6IG 5KHKA 1AVMA 4EFBA 4KL1A 2ZD9A 5L3GA 2VQEB 1YITV 4FJCC 3S3XA 1JVMA 1AJNA 4F6RA 4LR3A 1F4NA 2Q7EA 1CP9A 1OCCC 3OTOO 2V7QG 3CC4V 2WLNA 1JMKC 3LSQA 1N0NA 1WPXA 1Z5WA 1HNZO 5IE9A 4DUZO 4JI1B 4MTGA 1K5SA 4FLXA 3RVZA 3TETA 4MT8A 5B1AB 2V1DA 4C7UA 4F6RB 4FM2A 3D3IA 4F6EA 2OIGA 3ZHVA 1ZSPA 1AI7A 1R1BA 1S3JA 2DWEC 4RQFA 2QJ1A 4DR7O 1QU7A 1N4CA 1W59A 4FVMA 4D7SA 1F23A 3T1CA 2EBOA 1S5LZ 4LFAO 3B8MA 1XUQA 1KYOF 4X64B 2ZT9B 4B3MO 4AILC 2DYRB 1R3IC 4O4HA 4LF8B 2QWNB 4FLZA 3K03A 2X6CA 1NVPD 4JPRA 3ZMSA 4LF6O 1M57C 3CCMV 4PA6A 5B1BC 4KHPB 3HPLC 3D36A 1XNQO 5F2VO 3AG7A 1FKAO 1NR7A 3FB6C 2WLKA 1OCRC 4BW5A 1WP8A 4LF7O 1PNKA 4FLVA 4DYLA 4DUYO 1FAFA 1VP7A 3VOUA 4JYAO 3E2EA 3G80A 1L0LH 5IWAO 1YJWV 5EC1C 1HW7A 2A7WA 2AW9A 3F5WC 5KHIA 2WLIA 4MW8A 1R3LC 3G4SV 1PV0A 4ZBMA 3IC7A 1JR9A 4PA7A 1M9NA 1Z2GA 4R7CA 3CMEV 1XL4A 2AHYA 3TCUA 1J95A 4ZIBA 4HYOA 1NT2B 5EC2C 1HR0B 1KKCA 4PA9A 1HNXO 2FKXA 2WLHA 4B7KA 5BR8B 5JVDA 2DJVA 2XTAA 3JCUZ 1FXKB 3A8TA 1N33B 1CPYA 3L72H 2F43G 1SQGA 2GBOA 3OR7C 1M90W 2A06H 1GO3F 1FJGO 2PGGA 3B09A 3B8NA 3CRQA 2YIBD 5IYBO 3TXSA 1K73W 4B3SB 2UXBO 5JVDB 4QGPA 4X62O 4B3TB 1RP3B 1I5XA 4TSFG 1LUVA 2R9AA 3X2QB 4CH3A 5CMUA 4WFAV 4UXNA 3K9SA 3ABUA 4PDLA 5JH7A 3SJCC 1QLEC 3L70H 1WA8B 2V4DA 1AI6A 3EXAA 2EJ7A 3BABA 1RPRA 3GVMA 1J5EO 1D5AA 3HKCA 1WNSA 2P22C 1P7BA 3RGBA 2ZE5A 4ZI7A 4TOIA 1PKXA 3OTOB 5JH7B 1AROP 3ASOB 4FFKA 1OZ0A 3MHSC 1HNZB 4GLXA 2LP7A 3K57A 5IY5C 4DUZB 3E8BA 4MVUA 5IT9N 3HKCB 1I94O 5JWPA 1QLNA 3ZRVA 4WFBV 3NR7A 4ZI7B 1YHQV 1XQ8A 1R3JC 1VF5B 2Y0PA 3ABTA 1ZWIC 1VQ7V 2PUSA 4KUMA 5LMUO 2UXNA 1QVFU 3GWOA 2YI8A 2JK5C 4DR7B 1VIBA 1NS1A 2JIZG 3BRCA 2JS3A 2ZM6O 4JTDB 4NXMO 1VQ4V 1BCCH 4LFAB 1PL4A 2YC0A 3ZJZA 5KAIZ 5LHHA 2Z5UA 1YZBA 3A0HZ 2RJZA 4B3MB 4DR4O 4R6ZA 4WCEV 4O2BA 3ABLC 1N34O 3H1LH 3CXHF 4LF6B 4UB6Z 3H01A 4BIUA 2OTLV 2RQ6A 1ZLZA 5IJ9A 1XNQB 2IJIA 4H0LB 2QDOA 4FLUA 1AP6A 1KMIZ 4IYHA 4P2ZA 4F4LA 1N36O 2HJFC 1IXMA 4LF7B 3U0ZA 4I9QA 4FMTA 4DUYB 4TT3G 2Y69B 4JYAB 3E8GA 2BTOA 3JD3A 3UO2A 1HNWO 5IJ9B 4U7OA 3CCEV 2F4VO 1H8EG 4DV0O 3HB3B 4NTYA 4AHCA 1SQQH 3CMAV 3SJBC 3ZHRA 4PDVA 2E75B 5LXTB 5TISZ 1SS3A 1GAXA 4EEQA 4X66O 2GUZA 2BSKA 2P7TC 5J9PC 4TV9A 1GM9A 5B1AC 4Z2WA 1MABG 2YDEA 1HNXB 4H37A 1AJQA 3E22B 1NR1A 3OD4A 1Z5VA 3KZIZ 1QHTA 4ZKIA 1R3KC 2GUZB 2BSKB 5JQGA 1H8HG 1EZJA 2UU9O 4TV9B 2WLMA 1U96A 1FJGB 1TAEA 3DTUB 2OWOA 2B5UA 1VQNV 4IHJA 4R50A 2UUBO 4RQEA 1JQ0A 3BA9A 4NR1A 1MNGA 2JS5A 2FB5A 1YF2A 4U3JB 2UXBB 4NB5A 2YEVA 4ICGA 1FFXA 4PELA 1BGYH 3JALA 2C2AA 2DYRC 4X62B 4PA3A 5JQGB 2IJHA 2Q8VA 4LH7A 5L3DA 5D5QA 4J9YB 1URFA 1GN6A 1QCEA 2ZIOA 4YXWG 4IHJB 3OGIB 1WN7A 5DM6V 2Z3YA 1J5EB 2XNDG 3JARA 1SETA 1KB9F 2YEVB 1Y74A 1YSCA 4BWAA 3JALB 1DGSA 2QTSA 4X65O 1IZ3A 3LDDA 3OMAB 2ZINA 1OV9A 3BEHA 2JJ2G 2D3OW 4JYBA 2RN9A 1Q6IA 3D36C 4Z1MG 1SKVA 1I94B 4O4JA 1Y74B 1IX9A 2Q6AA 2XAFA 3K79A 5J2UA 2Y0IA 2IJKA 3C3TA 3K9AA 3MD0A 4MVRA 2HJDA 2F1MA 3FB5C 1K4CC 1NKDA 2PYLA 5LMUB 3RYFA 3AG4B 3STLC 3BVOA 4I5SA 2CTPA 4O4JB 2YICA 1L1FA 4CS2A 5EBWC 3CS5A 2ZM6B 4NXMB 5DN6G 1FXKC 4DW0A 3ZMZA 2DW4A 1SQPH 1KD1W 1H2KA 4DR4B 2WAMA 2LFSA 1N34B 3RYFB 1YJNV 5GONA 1S72V 5JJJB 3LDCA 4DR5O 3CHXA 1VQMV 1KU9A 2XAGA 3ZHTA 2WWWA 2UUCO 4IL6Z 1JFFA 2PI5A 2N04A 2YIDA 5KMGA 4DV1O 3C3SA 1N36B 3K5OA 4JZGA 4X1IA 3N2KA 3G6EV 2KKWA 3OAAG 5GONB 4EB6A 2VWJA 4FZ0A 4JI7O 3BHPA 3HKEB 4CZZA 1I5YA 3QVNA 1M56B 1HNWB 3E8HA 4DR2O 4YHHO 3T1HO 2CTWA 1JFFB 1EFRG 3RYIA 2F4VB 1VF6A 1EN6A 4DV0B 3KCXA 2H3OA 4H44B 5EBMC 1IBLO 1DF5A 2CGNA 1XL6A 4J42A 3ASOC 2A79B 4X1IB 3N2KB 4EB6B 1S77D 4LBEC 4X66B 1I08A 4I50A 2EZPA 2ATKC 2GTSA 2ZE8A 5LHGA 1H38A 3J80N 4PDRA 3RYIB 4U3FH 5LMNO 4MSWC 2DYSB 4MVSA 2LQTA 4FFBA 1VQ9V 3B4SA 4DV2O 3CRAA 2JEXA 2LW1A 5H5NA 3WB1A 1Y67A 3ABMB 2ZDIC 5FLXN 4I50B 5KLVH 2JJ1G 1SF9A 3ZRXA 4N23A 2UU9B 3E83A 3SYAA 1XI1A 4DR1O 4LFBO 5L3CA 2EIKB 1SQBH 2M6YA 5B1OA 1OCZC 3ZMUA 3TJTA 2JGDA 2RCVA 4FFBB 2UUBB 2KG7A 3ICXA 2HFEC 2EILB 2LW7A 2JRIA 2HVJC 2ZE7A 2Q67A 5GW7A 4HBNA 1Q43A 1COWG 3PN1A 4PDMA 1R6NA 4GX5A 1O9HA 2UUAO 1TGOA 3ETQA 4CH6A 4RWUA 3W7XA 1H2NA 1WB8A 3QO7A 4BW9A 2DE0X 2JGDB 2HHHO 2XASA 3DSQA 1DLBA 2KG7B 4LH6A 3E89A 2YXYA 4E2LA 2LFRA 4CS3A 3HKBA 2DWDC 4WFGA 5C93A 2IU3A 4X65B 2Y69C 1QQCA 3OT7A 4FLTA 2IBZH 1BHBA 1YTFB 1AP5A 4YJ3A 3HR0A 4JI2O 4JYYA 5C8YA 1W0KG 4DV7O 1ENVA 1A32A 5LGUA 3OW2U 4KFMA 1LUWA 1GK9A 3K0DA 4CH4A 3F7VC 4TV8A 1YXBA 1XHXA 1IURA 4K3AA 2Q7HA 1XBLA 4O4HB 4OGQB 3CCVV 1NI8A 1D5NA 4YJ3B 2WLLA 3W7TA 4CC6A 4K0KO 3ZX6A 3N2GA 3F7YC 1IBMO 2LO1A 4LF5O 4TV8B 3G6BA 4FM0A 4DK1A 1IBKO 1BSMA 2Q68A 1MA1A 2E76B 3MHHC 4MVZA 3L73H 2KQXA 4WBNA
chains in the Genus database with same CATH topology
3ZBHA 3G80A 2KG7A 2KG7B 3HR0A 4GZRB 3GWKC 3FD9A 3FAVA 3FAVB 3OGIB 2AZ0A 2VS0A 3O9OA 2AZ2A 1WA8A 3TXQA 1WA8B 4I0XA 4I0XB 2VRZA 2B9ZA 3GVMA 4ABMA 3TXSA 4LWSA 4LWSB 3Q4HA 3Q4HB 2DE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZBH A;  3G80 A;  2KG7 A;  2KG7 B;  3HR0 A;  4GZR B;  3GWK C;  3FD9 A;  3FAV A;  3FAV B;  3OGI B;  2AZ0 A;  2VS0 A;  3O9O A;  2AZ2 A;  1WA8 A;  3TXQ A;  1WA8 B;  4I0X A;  4I0X B;  2VRZ A;  2B9Z A;  3GVM A;  4ABM A;  3TXS A;  4LWS A;  4LWS B;  3Q4H A;  3Q4H B;  2DE0 X; 
#chains in the Genus database with same CATH topology
 1FFT B;  2ADQ B;  4G2K A;  2Q7G A;  2EIJ C;  4DR5 B;  1F51 A;  2WLL B;  3T4Z A;  4R8C A;  3P3P A;  2AZ2 A;  4JI8 O;  2WLI B;  3N2G B;  2UUC B;  4DR3 O;  3K5N A;  1SZT A;  4DV1 B;  5LOV A;  2ITD C;  5BXZ A;  2PF4 E;  4WBN B;  4QNH B;  1WB7 A;  4JI7 B;  4GX0 A;  2F93 B;  1JPX A;  3VQV A;  3SPI A;  5BY1 A;  1RSO A;  3IFX A;  4DR2 B;  4YHH B;  3T1H B;  3UT5 A;  1JJ2 U;  1GH6 A;  2EJR A;  2QEX V;  2MK3 A;  1NH2 B;  1IBL B;  1V55 B;  4OPA A;  5LOV B;  3H1K H;  4N21 A;  1YI2 V;  2L35 A;  4OXS A;  3CCS V;  1FS0 G;  2HP8 A;  3CJH A;  4RO2 A;  3E35 A;  3M99 B;  2B1I A;  2P06 A;  2HR3 A;  2UXC O;  2EX3 A;  2Y4T A;  1K8A W;  1RSO B;  4TWK A;  5LMN B;  1MG1 A;  3UT5 B;  4J11 A;  4XBF A;  3WU2 Z;  3SPJ A;  4DV2 B;  4DO2 A;  1BQ0 A;  2Y4U A;  1NTZ H;  2A0L A;  2Q73 A;  3CJH B;  3DXR A;  4NYK A;  1WJZ A;  1UFI A;  3QO5 A;  4BAY A;  4E4E A;  2ZE6 A;  3AG4 C;  1R6T A;  3I5D A;  3FB7 C;  3K59 A;  1TVK A;  4DR1 B;  3FFQ A;  3K58 A;  5BZB A;  4LFB B;  4P9P A;  4QPK A;  3CP1 A;  1HWY A;  4PI2 A;  1VF7 A;  1GRJ A;  1KUQ A;  5L3F A;  3ZRS A;  4MTO A;  4LCU C;  2DN9 A;  3ETD A;  3IGA C;  2RNB A;  1Q7Y W;  1JJO A;  3AK2 A;  5KUM A;  3SDL A;  1XMO O;  3DXR B;  4X89 A;  4FZ1 A;  1K7D A;  1OJH A;  5L3E A;  3APQ A;  3DGE A;  1CXZ B;  5CBF A;  5HFM A;  4CH5 A;  3FD9 A;  2UXD O;  2UUA B;  5IYZ A;  1BE3 H;  4QE9 A;  1TVK B;  5KUK A;  4JI6 O;  5CA0 A;  2HHH B;  5LYJ A;  1IXB A;  2IM9 A;  4FK5 C;  1SQF A;  1FD9 A;  1PPJ H;  2AGA A;  1E1R G;  1E1Q G;  4UCO A;  5IYZ B;  4JAV A;  5CA0 B;  3OEE G;  1L0N H;  1M56 C;  5CBG A;  1GTO A;  4PI0 A;  2OYQ A;  3A0R A;  1QBZ A;  2ARH A;  4LWS A;  3DC6 A;  4UUJ C;  2H8P C;  4HZ3 A;  4JI2 B;  4DXW A;  4NTW A;  4DV7 B;  3BA8 A;  2B1G A;  1AI4 A;  2QTO A;  5IYD O;  1TUE B;  3BPZ A;  3QG5 A;  1I7F A;  5H6R A;  1S5J A;  5LP6 A;  4QJF B;  4JV5 O;  4DRX A;  1FXV A;  3JYC A;  2QA4 V;  4O2B B;  1ZTE A;  2QKA A;  2HVK C;  4I4T A;  3ABK B;  1EZV H;  2DYS C;  4LWS B;  2QGN A;  4ASU G;  1VF6 C;  1O9G A;  3WB0 A;  1US6 A;  4K8X A;  5IWA B;  5B66 Z;  5KHH A;  1VQK V;  1SC5 B;  4K35 A;  1BS3 A;  4K0K B;  2M7W A;  3ABM C;  1IBM B;  4LF5 B;  5LP6 B;  3OGC C;  3NXS A;  1IBK B;  1ZAU A;  1B06 A;  4XDL A;  3K04 A;  1BZK A;  1MSD A;  3EVK A;  4X9Q A;  2EIK C;  4I4T B;  4MVM A;  1SQV H;  1XRE A;  3QNE A;  1VQO V;  2XAH A;  4K8Z A;  1K4D C;  2ZQM A;  2EIL C;  1BMF G;  3VQX A;  4JI8 B;  4DR3 B;  4GKJ O;  3H1J H;  1K3E A;  1I0H A;  4IT5 A;  1F4M A;  4TUY A;  4OX9 O;  1YTF D;  1SER A;  3W7W A;  3TGU H;  3W7S A;  2JDI G;  2IH1 C;  2JGU A;  2Q5Z A;  3RT3 C;  1N0J A;  2R72 A;  3CEI A;  3SPC A;  1N32 O;  3ZN1 A;  4O2A A;  3B77 A;  3WB2 A;  2EIM B;  2BOC C;  4G28 B;  5B1N A;  3H1I H;  2IW5 A;  2ZNJ A;  3JD4 A;  3LSU A;  4OPH A;  3LSS A;  3UKM A;  1DK1 A;  5EIB D;  3CB2 A;  1NTK H;  2YXH A;  4YIO A;  4O2A B;  4UV8 A;  2UXC B;  4XDJ A;  3THO A;  3H9V A;  1NU1 H;  5DED A;  2IJJ A;  4JAU A;  3VBB A;  1RM1 B;  2P4K A;  3M7M X;  4NXN O;  2ZKO A;  5K1X A;  5KHJ A;  3TK1 A;  1FFX B;  1PNM A;  4D7T A;  2UXX A;  2FTK A;  4MTF A;  1UJW B;  4UV9 A;  1GMG A;  5EIB C;  4PJ0 Z;  3CYO A;  2QWP B;  5DEC A;  2EUL A;  4KP4 A;  3OR6 C;  1QVG U;  3CRM A;  3JAR B;  4JI3 O;  1YEW A;  3UM7 A;  4ABM A;  1XMO B;  4DR6 O;  5CA1 A;  3L74 H;  2QKC A;  2YIB A;  2R70 A;  2GDS A;  2ZNI A;  5LL6 Y;  2UXD B;  1AJP A;  4JI6 B;  3KG2 A;  2X7R B;  2WLJ A;  2QM7 A;  4DV6 O;  1P49 A;  3L75 H;  4MVQ A;  1NH2 D;  3OUS A;  1Y4M A;  3RVY A;  4FM1 A;  2DMX A;  3LUT B;  3OTF A;  2YI9 A;  3B2E E;  5CA1 B;  1KQS U;  5IDJ A;  2EIN B;  5J2U B;  3AK1 A;  5LGN A;  3G71 V;  5A9G A;  4B3R O;  4EKW A;  2AXT Z;  4YJ2 A;  2X0L A;  3PJS K;  4Q6G A;  3JAS A;  3LNN A;  2P6J A;  2KB1 A;  2ZR2 A;  4GYC B;  4PD4 F;  4B08 A;  3KCY A;  1GM8 A;  3FYE B;  5HFL A;  1XHZ A;  1FYJ A;  1V55 C;  4UFZ A;  4WFH A;  1OHH G;  1Y6X A;  3IAY A;  1Y76 A;  4BR6 A;  1M1K W;  3SYQ A;  4GX1 A;  2W6J G;  3ZN0 A;  5AG2 A;  3R65 A;  3X2Q C;  4JV5 B;  3RWR D;  3T2M A;  3JD1 A;  2VQF O;  1X59 A;  3JAS B;  4DV3 O;  4J9Z B;  4JTC B;  2CK3 G;  3E86 A;  1SES A;  1NQT A;  3GB7 C;  2GHY A;  4HNA A;  4J41 A;  4PA4 A;  1FXH A;  2N05 A;  1LNQ A;  5FPR A;  5B3S B;  1OCO B;  1Y76 B;  1VQ8 V;  3JAT A;  5KMG B;  4AI8 A;  1Q6U A;  2R9I A;  4ZOL A;  4Z1V A;  3AK3 A;  4QIW F;  4UCR A;  4JI5 O;  2Q4P A;  2G38 A;  3GWK C;  4W4K A;  2VS0 A;  3FB8 C;  3TXQ A;  3CSX A;  2OCC B;  4HNA B;  3L9D A;  1SZX A;  4UVB A;  3SPH A;  5CB4 A;  4X88 A;  1F7Y A;  1P4R A;  1HP8 A;  4UCS A;  1YCI A;  3QO8 A;  3AEI A;  3JAT B;  1QR8 A;  3K5M A;  2P5O A;  1P7G A;  4GKJ B;  4ZOL B;  1VQ5 V;  4OX9 B;  5JCO A;  4J7Z A;  2OIE A;  1S0V A;  2NR5 A;  1XIL A;  2PTM A;  4DV4 O;  1K92 A;  1Q5O A;  2Z0A A;  2ODM A;  1N32 B;  1AR5 A;  2YUA A;  1EN4 A;  4LFC O;  1JX9 A;  4H33 A;  5LGT A;  1KEC A;  5ITZ A;  2XHB A;  1QR9 A;  3OFN G;  5GTI Z;  2Y48 A;  2AZ0 A;  4RUE A;  3D8C A;  5EK0 A;  3EFF K;  5EBL C;  1MSW D;  3MDS A;  3AG2 B;  3Q4H A;  5H6Q A;  5KHG A;  3UO3 A;  5L3B A;  3FYI B;  3RYC A;  1DF4 A;  5ITZ B;  2CGO A;  2DQ3 A;  4NXN B;  1KP2 A;  4RUF A;  5LBQ A;  2BOB C;  3AG3 B;  3K08 A;  3OE7 G;  3ABK C;  4UCT A;  3CCU V;  1GN3 A;  1VQ6 V;  1DTO A;  3Q4H B;  4J7K A;  4O4I A;  3ASN B;  2HLD G;  2ETN A;  3J7A U;  2Q69 A;  1Q82 W;  2VWK A;  3RYC B;  5LP6 C;  4JI3 B;  2GSM B;  3HKB B;  4DR6 B;  2OCH A;  3VQW A;  1TA8 A;  3JSN A;  4J80 A;  1YDX A;  3CD6 V;  2PY5 A;  1LR1 A;  4O4I B;  1K97 A;  3C90 A;  4P30 A;  4DV6 B;  4DV5 O;  1V9P A;  2QM8 A;  2Q0O C;  2YS8 A;  4UVA A;  5C8Y B;  4I9W A;  2AHZ A;  3T1Y O;  1L8D A;  3BY6 A;  5D5P A;  1YJ9 V;  1W2B U;  3K0G A;  3MAQ A;  4B3R B;  1G6U A;  2QR4 A;  3RW0 A;  4UVC A;  2NLJ C;  5FL7 G;  2WA4 A;  1WP7 A;  1EN5 A;  5K1P A;  2EIM C;  3P30 A;  5E79 Z;  4B7E A;  2HEP A;  1K5Q A;  3CC7 V;  1AR1 B;  2NN4 A;  3CXC U;  3AG1 B;  2E74 B;  3FKS G;  2OTJ V;  2OT5 A;  2A3Q A;  2MW2 B;  4GX2 A;  1S76 D;  2ITC C;  2ZXW B;  4JI4 O;  5FPO A;  3E8F A;  3BAA A;  1FXK A;  1M93 A;  2VQF B;  4UCU A;  4DV3 B;  3A2F A;  2IU0 A;  1B04 A;  4X1K A;  4GZR B;  3OUF A;  5A2Q N;  3P3N A;  2RMK B;  3FAV A;  3ETG A;  1RM1 C;  2PI4 A;  2CH7 A;  2K9P A;  1NBM G;  3JAW A;  3RYH A;  5IJ0 A;  3ZIA G;  4BIO A;  1R6K A;  1SQX H;  2JVD A;  2BCC H;  4TQF A;  4JI5 B;  2H94 A;  3JD0 A;  4KXR A;  2CE4 A;  4X1K B;  1XNR O;  3I56 V;  1H2S B;  2N74 A;  3FAV B;  2CH7 B;  3JAW B;  1WAZ A;  1WA8 A;  4AQY O;  3RYH B;  3ZS8 C;  5IJ0 B;  1K9M W;  2ZR3 A;  1MZE A;  4FIP C;  5EZY A;  2F66 C;  5CA3 A;  4MTX A;  3IC9 A;  3ZBH A;  3CPW U;  4P9O A;  2DQ0 A;  3I55 V;  4J7J A;  3ZED A;  2XAJ A;  1GKF A;  4JAS A;  4DV4 B;  2CDY A;  4LF9 O;  3EHB B;  3WG7 B;  4CBC A;  1AR4 A;  4LFC B;  5EZY B;  5KX5 A;  3ZMT A;  2EIN C;  2GV9 A;  3CRC A;  1JA8 A;  2P90 A;  4NTX A;  5CN0 A;  1ZUQ A;  2WSS G;  3LNM B;  1ZL8 A;  4ZHQ A;  3HKD A;  1Y66 A;  1V54 B;  4YY3 O;  1JOY A;  4LF4 O;  3SPG A;  2ZDI A;  4X20 A;  2CTQ A;  1VEW A;  4QPJ A;  3WFV A;  5KX5 B;  1BQZ A;  4LC1 A;  4L8J A;  3G67 A;  3ZRW A;  1ZX3 A;  2K1E A;  3UCS C;  2W0X A;  2HG5 C;  4DW1 A;  1XMQ O;  1ZL8 B;  4ZHQ B;  3HKD B;  5GTH Z;  3S3W A;  5KAF Z;  3JAM N;  4BIZ A;  4WFF A;  1Q8I A;  3QF7 A;  4X20 B;  2PZS A;  2QE7 G;  1OCC B;  2XUM A;  5B3S C;  4GKK O;  1OCO C;  1PM9 A;  5LYJ B;  3APO A;  3ZRW B;  4YIP A;  1OCZ B;  2EZO A;  1QNM A;  2X6B A;  1AI5 A;  2P67 A;  2QWO B;  3O65 A;  1XEQ A;  3JSL A;  3CRR A;  3SJQ C;  4D6T H;  1GM7 A;  2QWR B;  2ZCE A;  1NZ6 A;  2L6L A;  2OCC C;  5IYC O;  1G4Y B;  2ADP A;  2B9Z A;  2QWQ B;  2FML A;  4UCV A;  4DV5 B;  4JZ2 A;  3QTC A;  2HKO A;  3M8A A;  3U10 A;  3RN4 A;  1KC8 W;  4CS4 A;  3OEH G;  1WPB A;  1GN2 A;  3T1Y B;  1XOU A;  1BL8 A;  4I55 A;  1CEZ A;  1KBH A;  1AIL A;  4JI0 O;  1MOF A;  3CCL V;  3CWB H;  2QM4 A;  4DRX B;  2KSD A;  3CCR V;  5LXT A;  1E79 G;  3IJ4 A;  3T4D A;  4MS2 A;  4QE7 A;  1UPG A;  3JCZ A;  3P32 A;  1MMM A;  2XT9 A;  1N8R W;  1G8M A;  2CUG A;  4G27 B;  1B3Q A;  1PD3 A;  3ML0 A;  5E1A C;  3OMI B;  5JCO C;  2D2C B;  1MZF A;  4O4L A;  1EBO A;  2Q0A A;  4I55 B;  3E22 A;  1M57 B;  4A5U B;  4FLY A;  4JF3 A;  3BFR A;  5B1B B;  3O9O A;  1Q81 W;  4JI4 B;  4RAI A;  1Q90 D;  1PL0 A;  1K33 A;  3AG2 C;  3D3Q A;  1OCR B;  2Q9L A;  4NVP A;  4I7Z B;  3CCQ V;  1T5E A;  2E5L O;  5H9C A;  4GT1 A;  4O4L B;  2VQE O;  1SA0 A;  4IIJ A;  1H2M A;  1G1X B;  3AG3 C;  4IYI A;  2QSA A;  2E3C A;  1IDS A;  3SYO A;  4U3J A;  3B40 A;  4FLW A;  1NVP B;  5CBH A;  4TUY B;  4L87 A;  3FX7 A;  4J10 A;  4MW3 A;  4PV1 B;  3ETE A;  1BT8 A;  3ASN C;  1XNR B;  1B6Q A;  2LJ2 A;  3CX5 F;  2FL4 A;  4HAM A;  2QKS A;  1RPO A;  4UB8 Z;  2F23 A;  3J81 N;  4AQY B;  2YXL A;  3OMN B;  2EIJ B;  1SA0 B;  4IIJ B;  2YSU B;  4JI1 O;  1S5H C;  1VAR A;  4H13 B;  3VQY A;  3RFR A;  2X6A A;  2FYU H;  2NNU A;  1H2G A;  3SGI A;  5B5E Z;  3SYP A;  5JJN B;  1YVW A;  5LHI A;  4GUN A;  1TUB A;  4LF9 B;  1ROP A;  3SYC A;  3L71 H;  5JJE B;  1RFY A;  1U97 A;  3R66 A;  1VQL V;  1YIJ V;  1FPO A;  4PHZ A;  5LA6 A;  3BCC H;  4X64 O;  1HDJ A;  1Q6H A;  1WLE A;  2GTA A;  1TUB B;  4YY3 B;  3W7U A;  4MVO A;  2DOS A;  1PNL A;  3CCJ V;  4LF4 B;  4LF8 O;  4X1Y A;  3AG1 C;  4WF9 V;  1QLE B;  1ORQ C;  1BHA A;  1XDC A;  4KHP O;  2ZXW C;  1D2D A;  2BTQ A;  5LA6 B;  2BE3 A;  2P4V A;  1NTM H;  1Q86 W;  3CE2 A;  3SJA C;  4LP8 A;  1XMQ B;  4CC5 A;  3H1H H;  4TQD A;  5J2T A;  3ZCC A;  3F5T A;  4X1Y B;  2F95 B;  4GKK B;  4U7N A;  1M4U A;  4JGS A;  1P84 F;  4LNU A;  2BTQ B;  5EYP A;  3OM3 B;  5IY5 B;  3K06 A;  1THZ A;  2LGW A;  4JAA A;  4EFE A;  3LDE A;  3KKY A;  4WFE A;  3STZ C;  2RDC A;  2A9H A;  5J2T B;  1VMG A;  2R9R B;  4NKG B;  3SR2 C;  3UQ8 A;  2ILM A;  4YJ2 B;  3K3W A;  2PYJ A;  2ZIM A;  5BMV A;  1M5I A;  2WPD G;  3RBZ A;  4Q20 A;  3JAK A;  3A0B Z;  2WA3 A;  1VQP V;  3HKE A;  3K5L A;  4I0X A;  3ZHU A;  4LNU B;  1K34 A;  2IH3 C;  1Q3E A;  5FNV A;  1HR0 O;  5EYP B;  2YIA A;  1JCH A;  1EM1 A;  5KA5 A;  2XAQ A;  3DC5 A;  5BR8 O;  4JI0 B;  3ZHS A;  1PP9 H;  3JD2 A;  1KP3 A;  1N33 O;  5BMV B;  1GN4 A;  3U11 A;  1H2L A;  3WG7 C;  4DK0 A;  1KKD A;  3JAK B;  1AB3 A;  3ZMV A;  1W0J G;  2CAZ C;  2VRZ A;  4I0X B;  5H2F Z;  1R73 A;  4W4L A;  3ABL B;  4X8A A;  5FNV B;  1NJI W;  2XOK G;  4JTA B;  5KA6 A;  4B3S O;  2O57 A;  4IGG A;  3ZHQ A;  3CC2 V;  1V54 C;  4GCZ A;  1IVS A;  2LGQ A;  2JEU A;  4B3T O;  4XDK A;  4JYC A;  1SRY A;  5CB4 B;  2CTR A;  4FPP A;  1X4T A;  3N27 A;  2W0F C;  2E5L B;  2W6I G;  5KHK A;  1AVM A;  4EFB A;  4KL1 A;  2ZD9 A;  5L3G A;  2VQE B;  1YIT V;  4FJC C;  3S3X A;  1JVM A;  1AJN A;  4F6R A;  4LR3 A;  1F4N A;  2Q7E A;  1CP9 A;  1OCC C;  3OTO O;  2V7Q G;  3CC4 V;  2WLN A;  1JMK C;  3LSQ A;  1N0N A;  1WPX A;  1Z5W A;  1HNZ O;  5IE9 A;  4DUZ O;  4JI1 B;  4MTG A;  1K5S A;  4FLX A;  3RVZ A;  3TET A;  4MT8 A;  5B1A B;  2V1D A;  4C7U A;  4F6R B;  4FM2 A;  3D3I A;  4F6E A;  2OIG A;  3ZHV A;  1ZSP A;  1AI7 A;  1R1B A;  1S3J A;  2DWE C;  4RQF A;  2QJ1 A;  4DR7 O;  1QU7 A;  1N4C A;  1W59 A;  4FVM A;  4D7S A;  1F23 A;  3T1C A;  2EBO A;  1S5L Z;  4LFA O;  3B8M A;  1XUQ A;  1KYO F;  4X64 B;  2ZT9 B;  4B3M O;  4AIL C;  2DYR B;  1R3I C;  4O4H A;  4LF8 B;  2QWN B;  4FLZ A;  3K03 A;  2X6C A;  1NVP D;  4JPR A;  3ZMS A;  4LF6 O;  1M57 C;  3CCM V;  4PA6 A;  5B1B C;  4KHP B;  3HPL C;  3D36 A;  1XNQ O;  5F2V O;  3AG7 A;  1FKA O;  1NR7 A;  3FB6 C;  2WLK A;  1OCR C;  4BW5 A;  1WP8 A;  4LF7 O;  1PNK A;  4FLV A;  4DYL A;  4DUY O;  1FAF A;  1VP7 A;  3VOU A;  4JYA O;  3E2E A;  3G80 A;  1L0L H;  5IWA O;  1YJW V;  5EC1 C;  1HW7 A;  2A7W A;  2AW9 A;  3F5W C;  5KHI A;  2WLI A;  4MW8 A;  1R3L C;  3G4S V;  1PV0 A;  4ZBM A;  3IC7 A;  1JR9 A;  4PA7 A;  1M9N A;  1Z2G A;  4R7C A;  3CME V;  1XL4 A;  2AHY A;  3TCU A;  1J95 A;  4ZIB A;  4HYO A;  1NT2 B;  5EC2 C;  1HR0 B;  1KKC A;  4PA9 A;  1HNX O;  2FKX A;  2WLH A;  4B7K A;  5BR8 B;  5JVD A;  2DJV A;  2XTA A;  3JCU Z;  1FXK B;  3A8T A;  1N33 B;  1CPY A;  3L72 H;  2F43 G;  1SQG A;  2GBO A;  3OR7 C;  1M90 W;  2A06 H;  1GO3 F;  1FJG O;  2PGG A;  3B09 A;  3B8N A;  3CRQ A;  2YIB D;  5IYB O;  3TXS A;  1K73 W;  4B3S B;  2UXB O;  5JVD B;  4QGP A;  4X62 O;  4B3T B;  1RP3 B;  1I5X A;  4TSF G;  1LUV A;  2R9A A;  3X2Q B;  4CH3 A;  5CMU A;  4WFA V;  4UXN A;  3K9S A;  3ABU A;  4PDL A;  5JH7 A;  3SJC C;  1QLE C;  3L70 H;  1WA8 B;  2V4D A;  1AI6 A;  3EXA A;  2EJ7 A;  3BAB A;  1RPR A;  3GVM A;  1J5E O;  1D5A A;  3HKC A;  1WNS A;  2P22 C;  1P7B A;  3RGB A;  2ZE5 A;  4ZI7 A;  4TOI A;  1PKX A;  3OTO B;  5JH7 B;  1ARO P;  3ASO B;  4FFK A;  1OZ0 A;  3MHS C;  1HNZ B;  4GLX A;  2LP7 A;  3K57 A;  5IY5 C;  4DUZ B;  3E8B A;  4MVU A;  5IT9 N;  3HKC B;  1I94 O;  5JWP A;  1QLN A;  3ZRV A;  4WFB V;  3NR7 A;  4ZI7 B;  1YHQ V;  1XQ8 A;  1R3J C;  1VF5 B;  2Y0P A;  3ABT A;  1ZWI C;  1VQ7 V;  2PUS A;  4KUM A;  5LMU O;  2UXN A;  1QVF U;  3GWO A;  2YI8 A;  2JK5 C;  4DR7 B;  1VIB A;  1NS1 A;  2JIZ G;  3BRC A;  2JS3 A;  2ZM6 O;  4JTD B;  4NXM O;  1VQ4 V;  1BCC H;  4LFA B;  1PL4 A;  2YC0 A;  3ZJZ A;  5KAI Z;  5LHH A;  2Z5U A;  1YZB A;  3A0H Z;  2RJZ A;  4B3M B;  4DR4 O;  4R6Z A;  4WCE V;  4O2B A;  3ABL C;  1N34 O;  3H1L H;  3CXH F;  4LF6 B;  4UB6 Z;  3H01 A;  4BIU A;  2OTL V;  2RQ6 A;  1ZLZ A;  5IJ9 A;  1XNQ B;  2IJI A;  4H0L B;  2QDO A;  4FLU A;  1AP6 A;  1KMI Z;  4IYH A;  4P2Z A;  4F4L A;  1N36 O;  2HJF C;  1IXM A;  4LF7 B;  3U0Z A;  4I9Q A;  4FMT A;  4DUY B;  4TT3 G;  2Y69 B;  4JYA B;  3E8G A;  2BTO A;  3JD3 A;  3UO2 A;  1HNW O;  5IJ9 B;  4U7O A;  3CCE V;  2F4V O;  1H8E G;  4DV0 O;  3HB3 B;  4NTY A;  4AHC A;  1SQQ H;  3CMA V;  3SJB C;  3ZHR A;  4PDV A;  2E75 B;  5LXT B;  5TIS Z;  1SS3 A;  1GAX A;  4EEQ A;  4X66 O;  2GUZ A;  2BSK A;  2P7T C;  5J9P C;  4TV9 A;  1GM9 A;  5B1A C;  4Z2W A;  1MAB G;  2YDE A;  1HNX B;  4H37 A;  1AJQ A;  3E22 B;  1NR1 A;  3OD4 A;  1Z5V A;  3KZI Z;  1QHT A;  4ZKI A;  1R3K C;  2GUZ B;  2BSK B;  5JQG A;  1H8H G;  1EZJ A;  2UU9 O;  4TV9 B;  2WLM A;  1U96 A;  1FJG B;  1TAE A;  3DTU B;  2OWO A;  2B5U A;  1VQN V;  4IHJ A;  4R50 A;  2UUB O;  4RQE A;  1JQ0 A;  3BA9 A;  4NR1 A;  1MNG A;  2JS5 A;  2FB5 A;  1YF2 A;  4U3J B;  2UXB B;  4NB5 A;  2YEV A;  4ICG A;  1FFX A;  4PEL A;  1BGY H;  3JAL A;  2C2A A;  2DYR C;  4X62 B;  4PA3 A;  5JQG B;  2IJH A;  2Q8V A;  4LH7 A;  5L3D A;  5D5Q A;  4J9Y B;  1URF A;  1GN6 A;  1QCE A;  2ZIO A;  4YXW G;  4IHJ B;  3OGI B;  1WN7 A;  5DM6 V;  2Z3Y A;  1J5E B;  2XND G;  3JAR A;  1SET A;  1KB9 F;  2YEV B;  1Y74 A;  1YSC A;  4BWA A;  3JAL B;  1DGS A;  2QTS A;  4X65 O;  1IZ3 A;  3LDD A;  3OMA B;  2ZIN A;  1OV9 A;  3BEH A;  2JJ2 G;  2D3O W;  4JYB A;  2RN9 A;  1Q6I A;  3D36 C;  4Z1M G;  1SKV A;  1I94 B;  4O4J A;  1Y74 B;  1IX9 A;  2Q6A A;  2XAF A;  3K79 A;  5J2U A;  2Y0I A;  2IJK A;  3C3T A;  3K9A A;  3MD0 A;  4MVR A;  2HJD A;  2F1M A;  3FB5 C;  1K4C C;  1NKD A;  2PYL A;  5LMU B;  3RYF A;  3AG4 B;  3STL C;  3BVO A;  4I5S A;  2CTP A;  4O4J B;  2YIC A;  1L1F A;  4CS2 A;  5EBW C;  3CS5 A;  2ZM6 B;  4NXM B;  5DN6 G;  1FXK C;  4DW0 A;  3ZMZ A;  2DW4 A;  1SQP H;  1KD1 W;  1H2K A;  4DR4 B;  2WAM A;  2LFS A;  1N34 B;  3RYF B;  1YJN V;  5GON A;  1S72 V;  5JJJ B;  3LDC A;  4DR5 O;  3CHX A;  1VQM V;  1KU9 A;  2XAG A;  3ZHT A;  2WWW A;  2UUC O;  4IL6 Z;  1JFF A;  2PI5 A;  2N04 A;  2YID A;  5KMG A;  4DV1 O;  3C3S A;  1N36 B;  3K5O A;  4JZG A;  4X1I A;  3N2K A;  3G6E V;  2KKW A;  3OAA G;  5GON B;  4EB6 A;  2VWJ A;  4FZ0 A;  4JI7 O;  3BHP A;  3HKE B;  4CZZ A;  1I5Y A;  3QVN A;  1M56 B;  1HNW B;  3E8H A;  4DR2 O;  4YHH O;  3T1H O;  2CTW A;  1JFF B;  1EFR G;  3RYI A;  2F4V B;  1VF6 A;  1EN6 A;  4DV0 B;  3KCX A;  2H3O A;  4H44 B;  5EBM C;  1IBL O;  1DF5 A;  2CGN A;  1XL6 A;  4J42 A;  3ASO C;  2A79 B;  4X1I B;  3N2K B;  4EB6 B;  1S77 D;  4LBE C;  4X66 B;  1I08 A;  4I50 A;  2EZP A;  2ATK C;  2GTS A;  2ZE8 A;  5LHG A;  1H38 A;  3J80 N;  4PDR A;  3RYI B;  4U3F H;  5LMN O;  4MSW C;  2DYS B;  4MVS A;  2LQT A;  4FFB A;  1VQ9 V;  3B4S A;  4DV2 O;  3CRA A;  2JEX A;  2LW1 A;  5H5N A;  3WB1 A;  1Y67 A;  3ABM B;  2ZDI C;  5FLX N;  4I50 B;  5KLV H;  2JJ1 G;  1SF9 A;  3ZRX A;  4N23 A;  2UU9 B;  3E83 A;  3SYA A;  1XI1 A;  4DR1 O;  4LFB O;  5L3C A;  2EIK B;  1SQB H;  2M6Y A;  5B1O A;  1OCZ C;  3ZMU A;  3TJT A;  2JGD A;  2RCV A;  4FFB B;  2UUB B;  2KG7 A;  3ICX A;  2HFE C;  2EIL B;  2LW7 A;  2JRI A;  2HVJ C;  2ZE7 A;  2Q67 A;  5GW7 A;  4HBN A;  1Q43 A;  1COW G;  3PN1 A;  4PDM A;  1R6N A;  4GX5 A;  1O9H A;  2UUA O;  1TGO A;  3ETQ A;  4CH6 A;  4RWU A;  3W7X A;  1H2N A;  1WB8 A;  3QO7 A;  4BW9 A;  2DE0 X;  2JGD B;  2HHH O;  2XAS A;  3DSQ A;  1DLB A;  2KG7 B;  4LH6 A;  3E89 A;  2YXY A;  4E2L A;  2LFR A;  4CS3 A;  3HKB A;  2DWD C;  4WFG A;  5C93 A;  2IU3 A;  4X65 B;  2Y69 C;  1QQC A;  3OT7 A;  4FLT A;  2IBZ H;  1BHB A;  1YTF B;  1AP5 A;  4YJ3 A;  3HR0 A;  4JI2 O;  4JYY A;  5C8Y A;  1W0K G;  4DV7 O;  1ENV A;  1A32 A;  5LGU A;  3OW2 U;  4KFM A;  1LUW A;  1GK9 A;  3K0D A;  4CH4 A;  3F7V C;  4TV8 A;  1YXB A;  1XHX A;  1IUR A;  4K3A A;  2Q7H A;  1XBL A;  4O4H B;  4OGQ B;  3CCV V;  1NI8 A;  1D5N A;  4YJ3 B;  2WLL A;  3W7T A;  4CC6 A;  4K0K O;  3ZX6 A;  3N2G A;  3F7Y C;  1IBM O;  2LO1 A;  4LF5 O;  4TV8 B;  3G6B A;  4FM0 A;  4DK1 A;  1IBK O;  1BSM A;  2Q68 A;  1MA1 A;  2E76 B;  3MHH C;  4MVZ A;  3L73 H;  2KQX A;  4WBN A; 
#chains in the Genus database with same CATH homology
 3ZBH A;  3G80 A;  2KG7 A;  2KG7 B;  3HR0 A;  4GZR B;  3GWK C;  3FD9 A;  3FAV A;  3FAV B;  3OGI B;  2AZ0 A;  2VS0 A;  3O9O A;  2AZ2 A;  1WA8 A;  3TXQ A;  1WA8 B;  4I0X A;  4I0X B;  2VRZ A;  2B9Z A;  3GVM A;  4ABM A;  3TXS A;  4LWS A;  4LWS B;  3Q4H A;  3Q4H B;  2DE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...