3TXSA

Crystal structure of phage 44rr small terminase gp16
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
b'QVYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHVEVFAQLMGQMTTTNKEMLKMHKEMKDLAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Terminase DNA packaging enzyme small subunit
publication title Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages.
pubmed doi rcsb
source organism Aeromonas phage 44rr2.8t
molecule tags Viral protein
total genus 30
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3txsA01
2VRZA 2KG7B 3FAVA 1WA8A 3OGIB 3O9OA 2AZ0A 3Q4HB 4GZRB 4ABMA 4I0XB 3G80A 4LWSB 2KG7A 3FD9A 3TXQA 2B9ZA 2VS0A 3Q4HA 3FAVB 1WA8B 3HR0A 4I0XA 3GVMA 3ZBHA 4LWSA 3GWKC 2DE0X 3TXSA 2AZ2A
chains in the Genus database with same CATH superfamily
2VRZA 2CGNA 1V55B 3N2GB 3K03A 4JAAA 3CMAV 1G6UA 4JV5B 4I0XB 4GX1A 3HKEB 4LFCB 1SQVH 2Y0IA 2E5LB 2EIMB 4LF6O 1OZ0A 4RWUA 2R9RB 3SYPA 5GTHZ 1HNZO 1XL4A 1TA8A 3L70H 3THOA 5IDJA 4GKJO 3IC9A 4RAIA 3K5NA 3DSQA 4UB8Z 1Q86W 3FAVA 2E3CA 2H8PC 1VQ6V 1HW7A 3L9DA 3SYOA 5LA6A 3G80A 3N27A 4D7TA 1AI5A 2UXCB 1K3EA 4LH6A 1R6NA 2GTSA 1BL8A 1F23A 4FLTA 1TUBA 4LH7A 4NKGB 3K04A 4JAVA 2A79B 1SC5B 1EFRG 4ZKIA 3SPIA 3H01A 4IGGA 1Q8IA 3SJCC 3TXQA 3O65A 1U96A 1AP5A 4B3RB 1BQ0A 5EBMC 3CC7V 1K5QA 1I94O 1EN4A 4JZ2A 4J80A 1XNQO 5B1AB 3IC7A 4I4TA 2O57A 5EBLC 1JOYA 3BCCH 2KQXA 2R9IA 4GT1A 4UCTA 3P3NA 1Z5WA 4F6RA 1S3JA 2VQFB 3ETGA 1QR8A 4NR1A 1AI6A 4JAUA 1N8RW 4J9ZB 3RT3C 4IIJB 3KCXA 4TV9B 3ICXA 3VBBA 2RQ6A 3JATA 2Y48A 1FJGO 1XMQB 2DYRB 3WG7C 3ZJZA 1FD9A 1VQKV 4K35A 1MMMA 3CPWU 3HKCB 4MW3A 1J5EB 2JS5A 5CA0B 1BT8A 1DF4A 2OYQA 3OE7G 3STLC 4DR2B 4F4LA 2P90A 4LF8B 4JTCB 4TUYB 2ITDC 2YI8A 3ASNB 1KYOF 1B06A 1K73W 2DYSC 2WWWA 2CTPA 1VQPV 1PD3A 2QKCA 1H38A 1V55C 4UB6Z 1ZTEA 4ZBMA 4DV2O 4G27B 2QGNA 1CXZB 2ZXWB 5B1NA 1URFA 4MVQA 4CS3A 3OR6C 3JD1A 4BWAA 1SERA 1YJ9V 1GKFA 4MTFA 3ABLB 4B08A 5K1PA 1M56B 3CE2A 3TCUA 1KQSU 1BGYH 1B04A 2XAHA 3APQA 3VOUA 3TXSA 3AG3C 4QPJA 2ATKC 2ZQMA 4X65B 1KP2A 1HP8A 2E75B 3CHXA 3JSNA 4P2ZA 2E5LO 2LW1A 2NLJC 4B7KA 1S5JA 5JH7B 2ZIMA 5IE9A 1P4RA 4JTAB 1K9MW 2X0LA 4NVPA 1Q82W 4DW1A 2D2CB 4MVUA 2ZDIC 5IWAO 1NTMH 4I55B 2HJDA 3LDCA 1Q6IA 3LSUA 5FL7G 5DECA 4HNAB 3G6EV 4YIPA 4GX0A 4NTXA 1SKVA 2HR3A 4TQFA 4DW0A 3SR2C 4L87A 2PYLA 2ZM6B 1I7FA 3TGUH 4J41A 4KP4A 1ORQC 4MW8A 1MZFA 4J7JA 2CK3G 2ODMA 1AP6A 2P7TC 3OEHG 2IJIA 3C90A 4JASA 1N0NA 1F4NA 1QHTA 1FYJA 2IBZH 2W0FC 1FS0G 3T1HB 4MTXA 1YSCA 5KX5A 2DYRC 2HHHB 4ZHQB 1YIJV 4B3RO 1YI2V 4YY3O 4DR1O 3PN1A 5KAFZ 1AB3A 1M1KW 4IHJA 3B8MA 1I5YA 4WFGA 3W7XA 1Y66A 3OTOB 1IURA 2FL4A 4DV4B 4NYKA 1NR1A 5LGNA 3A0BZ 3S3WA 5FNVB 4ZIBA 5EYPA 1SF9A 3P32A 1KMIZ 3UT5A 2QEXV 4PI0A 1RPRA 3K08A 4WBNB 1SS3A 4TV8A 1K5SA 1XMQO 5C8YB 2QTOA 3FB5C 1FKAO 3JALA 2Y69C 2VWJA 3SJAC 3B4SA 3AG1C 1NQTA 4B3MB 3FB6C 4CBCA 3FB8C 2YUAA 2Q68A 1VQ8V 1AILA 3SJBC 5FPRA 1J95A 2Q6AA 4MS2A 1EZJA 2PZSA 1KU9A 1W2BU 4CS4A 3MAQA 2JEUA 5EIBD 3ZMTA 4DUZB 1XHZA 5LMUO 2JVDA 3OTFA 4MVZA 5IT9N 3UCSC 1OHHG 2WPDG 3P30A 2CGOA 4CH5A 5CA1B 1IZ3A 2QM7A 2XAJA 1Q5OA 5KHHA 4BW9A 4X1YA 4CH3A 1D5NA 1GO3F 1XREA 4FFBA 1S77D 5B1OA 1FXHA 3K57A 3W7TA 4DV7B 4LF4B 1DLBA 5F2VO 3U10A 3JAKB 5B1BC 1XEQA 3QF7A 2PI4A 5IYDO 2BTOA 5LMNO 3UO3A 4Z1VA 4FPPA 3L75H 3GWOA 1NKDA 4X65O 3S3XA 5EK0A 2YSUB 1Y4MA 4A5UB 4LF7O 4GUNA 5JJEB 4O4JB 4J7ZA 3GVMA 5ITZB 4PV1B 1HNZB 3T1YO 4AHCA 2EZOA 4PD4F 4GKJB 4Z1MG 4WFAV 5EYPB 2M7WA 4KXRA 4UCUA 2GDSA 2UU9O 2ZM6O 3BVOA 5IJ0A 4O2BA 1R3IC 4QPKA 4GKKO 3K9SA 1WAZA 3OT7A 1K34A 2Q0AA 3F5TA 3EXAA 1SQBH 3N2GA 1IBLO 4P9PA 4E4EA 5J2UA 3DTUB 4EFEA 1I94B 1NTKH 2RNBA 1XNQB 4RUFA 4X20A 3OTOO 1NT2B 3DC5A 1WP8A 2NR5A 2QSAA 3QVNA 2AHZA 2UXXA 5JJJB 3OUSA 3KCYA 4O4LB 1YVWA 4FFBB 1H2SB 1EN5A 3F7VC 3IGAC 2W6JG 3K79A 3CMEV 1E1RG 2UXNA 4LFAO 3H1HH 1SZXA 3RVYA 1XBLA 1VQ5V 2KB1A 4HYOA 2R70A 2CDYA 1FJGB 1PKXA 3WU2Z 3AG4C 4FLZA 3QO5A 4YXWG 4B3MO 2QWOB 1PNKA 4P9OA 2IW5A 5B66Z 4HZ3A 2XT9A 2F1MA 1VQNV 3QO8A 2ZDIA 1EN6A 2XAFA 4HAMA 2OIEA 5J2TB 4D7SA 2QM8A 1OJHA 5H9CA 4JI5O 3H1JH 3RWRD 4BR6A 5JVDB 1PL4A 4N23A 4PDLA 3WG7B 1VQMV 3T2MA 1FXVA 2KKWA 3STZC 3AK3A 1WJZA 1HNXO 3CCRV 1T5EA 3DGEA 3K0GA 3G6BA 4TV9A 3ZS8C 4JI8O 4O2BB 4LBEC 1RM1C 2B9ZA 2WLJA 1IXBA 1BHAA 3OAAG 5KMGB 3ABMC 2H94A 5CA0A 5LBQA 3CX5F 2LJ2A 3Q4HB 3AEIA 4TUYA 1UFIA 1AJPA 1BQZA 5J2UB 2ARHA 3RYIA 2ZR2A 4AQYB 5DN6G 2WLLA 4X20B 1FFTB 4UUJC 4PDMA 3FFQA 1NH2B 3DXRA 4U7OA 4MT8A 3ETDA 2P4VA 5IWAB 2NN4A 1I08A 1P49A 2Y0PA 4FM1A 1R1BA 1GN4A 2UUAO 3E22A 1W0KG 2AW9A 3AG3B 2FB5A 4UCRA 5H6QA 3SPCA 3H1IH 1KKDA 4XDKA 2DWEC 1KP3A 3UKMA 3R66A 1N34O 1TGOA 1N32O 5EC2C 1YHQV 3M8AA 2YXLA 4QE7A 3ZRSA 4ZOLB 3HKDB 3CB2A 3ZMVA 4UV8A 3JD4A 2PY5A 3SYAA 1OV9A 3T4ZA 2QWRB 4YY3B 4DR1B 4U3FH 5JH7A 3J80N 5K1XA 1R3KC 1FAFA 1XHXA 4O2AB 1S72V 2WA3A 1QQCA 1HWYA 2BSKA 4O4HB 2JGUA 2R9AA 4I55A 4FK5C 4GX5A 2ADPA 2RJZA 4H13B 4HNAA 3H9VA 4J7KA 1VMGA 5LHGA 4WF9V 4B7EA 2QR4A 5BY1A 1XQ8A 1H2GA 2F23A 2ZT9B 1R6KA 4DR5O 2DN9A 2PGGA 1ZL8A 5KHJA 3SPHA 1THZA 4I50B 1OCRC 4QE9A 5HFMA 1Z5VA 5LHIA 4BIZA 1GN6A 1Q3EA 1RFYA 2Q4PA 2KG7B 4DV5O 1QCEA 3CP1A 3K5MA 4ZHQA 3ABKC 1U97A 1NH2D 1LNQA 3FB7C 3RYIB 4CH4A 2PUSA 4W4LA 1N33O 5LMUB 2WLLB 1S76D 1XOUA 1IBMO 2LW7A 3DXRB 2ZNJA 2XAGA 1WN7A 3CRQA 1AR5A 2Y69B 2F43G 3BEHA 1D5AA 2PTMA 3AG1B 2E76B 3OW2U 3E22B 5FNVA 3B77A 4YJ2A 1GTOA 3RW0A 4DYLA 2LQTA 3T1CA 1K8AW 1VQ7V 1SESA 1X59A 5JCOA 1B6QA 2ZIOA 2ZR3A 4WBNA 5H6RA 3JASB 2HKOA 5C8YA 4K8XA 1YCIA 5EBWC 3WFVA 1ZUQA 3K58A 1QU7A 1DK1A 1KKCA 2PI5A 1Q90D 3B8NA 3TK1A 5LGTA 3CCSV 5LMNB 4NB5A 1YDXA 3LSQA 1YITV 2UXBB 3ZHRA 1VF5B 3ZMZA 2XUMA 1K92A 1K33A 2YC0A 4O4IA 3RBZA 2EIKC 2WSSG 3CCQV 4AI8A 4LF7B 4AQYO 3BA8A 3R65A 5IJ9B 4PDRA 1JJ2U 3OR7C 3SPGA 3RYCB 4JI0B 4X9QA 1LR1A 3T1YB 1SQFA 2F4VB 1NJIW 5CA1A 2BSKB 2JDIG 4X1KA 2AXTZ 2YDEA 4PA4A 2IU3A 1MSWD 2CH7A 5B1BB 1JX9A 4WCEV 5LXTB 2XHBA 2GV9A 2EINC 3ABUA 1ZAUA 2UU9B 2VWKA 2BE3A 1QVGU 3VQXA 4OGQB 2XAQA 3K9AA 5KUMA 1CEZA 2HJFC 4DK1A 4NXMO 2GBOA 3D36C 2X6AA 3MHSC 3JAKA 1ZL8B 4GKKB 5LL6Y 3B2EE 2BTQA 2QWPB 1NU1H 4KFMA 4R7CA 4F6EA 1EM1A 4PJ0Z 5EZYB 2V4DA 1IBLB 3APOA 1QBZA 3E8GA 3CWBH 3ZHVA 1VQ9V 1P7GA 4O4JA 5CB4B 2EZPA 5L3EA 1H2NA 5ITZA 3AG2C 4JI6O 3ZMUA 1S0VA 5KHIA 1RPOA 4ASUG 1FFXB 5D5PA 2V1DA 4YJ2B 1KC8W 3ZRWA 1SETA 2WLKA 3D8CA 1HNWO 2Q5ZA 2HVJC 4LFAB 3L72H 2AHYA 2UUCB 3CCEV 1JVMA 4BIUA 1CPYA 3CC4V 3OMIB 1AJNA 2DQ0A 4FM0A 1PNMA 2PYJA 1Y6XA 1QR9A 5L3CA 2DE0X 2HLDG 4DR3O 3CRCA 1NVPD 1EBOA 2ZE5A 4X66O 1OCCC 4O4IB 1MOFA 1BHBA 2GTAA 2F95B 4LCUC 1V9PA 4JI5B 2Z5UA 4TOIA 5KHKA 4LWSA 4JI3O 1P84F 3OEEG 4UVCA 4X1KB 3EVKA 1GMGA 2P6JA 2QWQB 1M93A 3AG4B 4O4LA 1K97A 2CH7B 2IJHA 3UO2A 1R73A 2DMXA 4CC6A 2JJ2G 1HNXB 1VP7A 5JQGB 4JI8B 1Y74B 1VF6C 3X2QB 1BMFG 4PA6A 3K06A 1KB9F 4LFBO 2ADQB 2Q73A 1AI7A 1JMKC 4FMTA 4NXNB 2BTQB 1IBKO 3M99B 2Q7EA 2UXBO 4NTYA 4BAYA 2QWNB 3HKBB 3RYFA 2ETNA 5EC1C 1GAXA 1OCOC 2HP8A 4K8ZA 4TSFG 2VQEO 4JZGA 2YI9A 2YIBD 1WB8A 5J2TA 3CJHB 3EFFK 4JI0O 2G38A 3PJSK 1OCZC 4HBNA 4DV6O 2F4VO 2JEXA 2LP7A 4X89A 3CRAA 1HR0O 4LR3A 5L3BA 1RM1B 4X62O 5JVDA 4DR6O 1GN3A 3KG2A 3K3WA 3E83A 4WFEA 1QLEC 4MSWC 1YF2A 2UUAB 2WAMA 2JK5C 1FXKC 3ZRWB 1TVKB 1WA8B 3ABMB 3OFNG 2V7QG 1NBMG 2EILC 4LP8A 3RVZA 5IYZB 3JAMN 3LUTB 1ZSPA 1N34B 4YHHB 2Q9LA 2K9PA 2W6IG 4DR7O 2BOBC 1N32B 4EKWA 2DW4A 1KD1W 2YEVB 5KMGA 2UUBB 1PL0A 3CC2V 3Q4HA 2YICA 2QA4V 5HFLA 2JRIA 1PPJH 3CXCU 2F66C 3SGIA 2N04A 1XNRO 1L8DA 3P3PA 4TWKA 2ZINA 3JCUZ 4K3AA 4C7UA 2L35A 4ZI7A 3L71H 3BY6A 4LWSB 4DV3O 3AG7A 4JPRA 2FKXA 1FPOA 1QNMA 4X88A 1PP9H 2WLHA 2OCCC 3CRMA 3M7MX 1KECA 5LP6B 1A32A 1WNSA 4X8AA 1L1FA 4FJCC 1M9NA 1K4DC 5IY5B 5LGUA 4PDVA 3RYHA 2UUCO 5BXZA 2ZNIA 5LYJB 3U11A 1GH6A 1SZTA 4P30A 4X64O 3CS5A 4JI2O 3SJQC 4DR5B 3E8BA 1QLNA 1F51A 1M4UA 3UM7A 1PV0A 1VEWA 4EB6A 1Q7YW 4PA3A 2CTRA 1ZX3A 4LF5B 2HVKC 3RYFB 4ZOLA 1VF7A 1IX9A 3HKDA 3X2QC 3ZCCA 3OUFA 3WB1A 4RQFA 1WP7A 4J11A 4DV5B 4FLXA 5FLXN 3WB0A 4KHPB 1AJQA 2B1IA 2EJRA 2WLNA 4U7NA 2YIDA 4DV1O 4X1IB 1BE3H 4YJ3A 3E8HA 1N33B 4PA9A 4I9QA 3JAWA 3ZN1A 1O9GA 1SRYA 2MW2B 4O2AA 4Z2WA 2FTKA 1IBMB 4JYAO 2OIGA 4MVRA 4O4HA 4DV0B 2M6YA 5DEDA 1IDSA 1DF5A 4OX9B 3D36A 1AR1B 4GCZA 1H2KA 3ASOC 3ZHQA 1OCRB 3L73H 3I55V 4H37A 2ZE6A 3LDEA 3ABKB 4MVSA 5TISZ 1NI8A 2ZD9A 4NXNO 3K0DA 4LNUB 4NTWA 1N36B 3JYCA 1YTFD 4QNHB 1W59A 5GW7A 1UJWB 4I50A 2EIJC 1IXMA 4CS2A 4UVBA 3ETQA 3JARA 1H8EG 3SYQA 3J81N 4DXWA 2FYUH 2KG7A 4EEQA 4JI4O 4U3JB 5CBGA 1US6A 3E89A 2CTWA 2UXDB 4ZI7B 4PHZA 2JS3A 3OGIB 4JGSA 3NR7A 4JI1O 1VIBA 2Q7GA 4DR4B 2Y4UA 5H2FZ 5GTIZ 2CAZC 3ZBHA 3RYHB 5BMVA 4B3TO 5IYCO 3JASA 4R50A 4H0LB 2QDOA 2N74A 4NXMB 4YHHO 2P5OA 3QTCA 2LFRA 2EIKB 2LGQA 5LP6C 2W0XA 4EB6B 2UUBO 4BW5A 2YS8A 5IY5C 3ZRXA 1DTOA 4OXSA 2EJ7A 1G8MA 3VQYA 2JJ1G 2Q69A 2OTJV 1CP9A 5E1AC 4J10A 1YEWA 5JJNB 1SQPH 5IJ9A 5LOVA 3B09A 1SQXH 4YJ3B 3RYCA 3JAWB 5AG2A 2EINB 2DOSA 2DWDC 2DJVA 4W4KA 4JI6B 3JD0A 2A06H 3CD6V 1VF6A 4XDJA 1MG1A 1LUWA 1ZWIC 3G67A 2Y4TA 4JYCA 5KA5A 4G2KA 2HFEC 3OD4A 5CBFA 3OM3B 5LXTA 4IYIA 2EULA 3MHHC 1HNWB 5JWPA 2WLIA 3LNMB 1KBHA 4KL1A 1GM9A 3OGCC 3N2KB 2RMKB 2OTLV 3OMAB 1E1QG 4DRXA 3FKSG 2Q7HA 4LF5O 3AG2B 3JARB 1M57C 1V54C 3BAAA 5EZYA 4PI2A 2QKAA 4DR3B 3ZHTA 3CYOA 1G1XB 3ML0A 4X66B 4KHPO 4JI7O 1XI1A 2XOKG 3CEIA 5CB4A 1FXKA 1RP3B 3BPZA 1L0LH 4UXNA 4CZZA 3G71V 4JF3A 4FVMA 3SDLA 2ZE7A 4FLYA 4K0KO 3E35A 4JI3B 4DV0O 1XMOO 2YIBA 4N21A 5B3SC 4OX9O 3BHPA 4BIOA 2AZ0A 1GRJA 1FFXA 1W0JG 4DUYB 1AR4A 5BMVB 1R3LC 3BABA 1K7DA 2F93B 3FAVB 2P4KA 2ZKOA 1G4YB 3RGBA 1OCCB 4LFBB 5LA6B 4UCOA 2EIMC 5KHGA 1N36O 3OMNB 1IBKB 3BFRA 1IVSA 4FLVA 1TUBB 3CXHF 3RFRA 2VS0A 4I7ZB 2YXYA 2VQEB 2X7RB 3BA9A 4EFBA 3I5DA 3VQVA 5LOVB 3E8FA 1GM7A 4PELA 2UXDO 4FLWA 4UCSA 2IJJA 4DV6B 1NVPB 1VQ4V 3U0ZA 1D2DA 4FZ0A 2XNDG 1NTZH 1HR0B 4GZRB 1PNLA 2A9HA 5J9PC 4JV5O 2Z0AA 4LFCO 4X62B 4DR6B 3H1LH 2P06A 1JFFA 4RUEA 1VQLV 4DR4O 1WB7A 1QVFU 5H5NA 4I4TB 1JR9A 4TQDA 2B1GA 1JJOA 1Q81W 5JQGA 1Y74A 2WLIB 3ZHSA 1WLEA 4F6RB 3CCUV 1OCOB 2QE7G 5KAIZ 5IYBO 3ABTA 4I9WA 3ZIAG 2OT5A 1H2MA 2QKSA 4LF9B 2N05A 1SQGA 4RQEA 4DRXB 3D3QA 5B1AC 4DR7B 1TUEB 2UXCO 3ZX6A 3ZEDA 1OCZB 1NS1A 2OWOA 1KUQA 4GYCB 2ITCC 3HKBA 4D6TH 3JATB 4UV9A 2WLMA 2Q8VA 3T4DA 2R72A 1XILA 1JQ0A 4PA7A 3QG5A 4OPHA 4DO2A 3A0HZ 1JPXA 4UFZA 2CUGA 1QLEB 5BZBA 3CJHA 3KKYA 4YIOA 2XASA 1XNRB 2QJ1A 3A8TA 1FXKB 1BZKA 4DV3B 2EILB 5L3GA 2RDCA 4UCVA 2XTAA 1YXBA 5CMUA 4WFBV 3ZHUA 5CA3A 3NXSA 1TVKA 2AZ2A 3QO7A 1WA8A 5GONA 1XDCA 2LO1A 3SPJA 4MVMA 3ASNC 4JI2B 4X64B 1X4TA 1SQQH 2VQFO 5IYZA 2GSMB 3AK1A 4QJFB 1YZBA 2RN9A 5L3DA 3G4SV 3B40A 2IM9A 3HR0A 2MK3A 3HPLC 3ZMSA 2YEVA 1Y76A 3L74H 4L8JA 3CCJV 3K5LA 4UVAA 1JA8A 2JIZG 2ZXWC 2EX3A 4H33A 1MA1A 3F7YC 1J5EO 3HB3B 3LSSA 2JGDA 2OCCB 1RSOA 4DV1B 4I5SA 3E86A 2IJKA 4R6ZA 1MZEA 4DR2O 4LF8O 3ABLC 4Q6GA 4AILC 4IL6Z 1M5IA 2Z3YA 1M56C 1I5XA 4JYYA 5A9GA 4JYAB 2L6LA 1Q6UA 3FX7A 1JFFB 3O9OA 3CCVV 4DUYO 1B3QA 3QNEA 2ZCEA 3CRRA 5LP6A 1ROPA 2RCVA 1L0NH 5KA6A 2HEPA 4IT5A 1GM8A 5BR8B 3RN4A 3I56V 5LYJA 3JD3A 3UQ8A 1WPBA 2KSDA 3FYIB 4E2LA 5CN0A 1Z2GA 3IAYA 2BOCC 1HDJA 1H8HG 3W7WA 2YIAA 1R6TA 3TJTA 3FYEB 2X6BA 4LC1A 3JSLA 4FFKA 5EIBC 4B3SB 4CC5A 3AK2A 4JI4B 2QM4A 4JYBA 3BRCA 4FZ1A 3WB2A 4MVOA 3W7SA 2NNUA 2P67A 1NZ6A 4X1IA 3ASOB 5A2QN 4J9YB 2A3QA 3EHBB 5B5EZ 3LNNA 3CSXA 3VQWA 1AI4A 5CBHA 1UPGA 4XDLA 4QGPA 5KX5B 3IFXA 4ABMA 5D5QA 3JD2A 4JI1B 1NR7A 3JCZA 4ICGA 3LDDA 2K1EA 4LF6B 2LGWA 4OPAA 5GONB 4IHJB 2EIJB 1K4CC 4WFFA 2B5UA 1WPXA 1F7YA 2OCHA 2ZE8A 4B3TB 2BCCH 5E79Z 1SA0A 3ETEA 2IH1C 2GUZA 1MSDA 2Q67A 4LF9O 3GB7C 3A0RA 4LNUA 3UT5B 1Y76B 4TV8B 3GWKC 1F4MA 3JALB 2AGAA 1YTFB 4U3JA 1AROP 3ZRVA 2HG5C 3J7AU 2JGDB 2Q0OC 1BSMA 1RSOB 1GK9A 1DGSA 5FPOA 3MDSA 5JCOC 3T1HO 1BS3A 4J42A 2P22C 2CTQA 2HHHO 1H2LA 3A2FA 3D3IA 4I0XA 3HKEA 5L3FA 1S5HC 1R3JC 1ENVA 5KLVH 4Q20A 3SYCA 1XL6A 2GHYA 2FMLA 2IU0A 5LHHA 1MABG 3CCMV 2D3OW 2ILMA 3TETA 1YJNV 3ZN0A 2C2AA 1LUVA 1Q6HA 1GN2A 4GLXA 4DV4O 2EBOA 3H1KH 4X1YB 2A0LA 1O9HA 2CE4A 4GX2A 1EZVH 5DM6V 4CH6A 4IYHA 4KUMA 4FLUA 1XUQA 4RO2A 4FM2A 3KZIZ 1Y67A 1VQOV 1ZLZA 1BCCH 5C93A 1PM9A 4JI7B 3IJ4A 3C3TA 2YXHA 3K59A 4K0KB 1XMOB 4WFHA 1COWG 4H44B 4DUZO 4R8CA 2PF4E 3F5WC 3W7UA 1TAEA 1Q43A 3FD9A 4JTDB 1E79G 5BR8O 1M57B 1V54B 5KUKA 1SA0B 3E2EA 2GUZB 4MTOA 4DV2B 4MTGA 4TT3G 3N2KA 2DQ3A 2WA4A 1MNGA 2E74B 3C3SA 4DK0A 2X6CA 4XBFA 4QIWF 4DV7O 4IIJA 2H3OA 5IJ0B 1N0JA 4LF4O 2IH3C 1P7BA 4G28B 4B3SO 1YJWV 2LFSA 2QTSA 1M90W 3K5OA 2A7WA 5B3SB 1I0HA 1AVMA 1JCHA 1S5LZ 1VARA 2DYSB 3MD0A 3HKCA 4FIPC 3DC6A 3CCLV 1N4CA
chains in the Genus database with same CATH topology
2VRZA 2KG7B 3FAVA 1WA8A 3OGIB 3O9OA 2AZ0A 3Q4HB 4GZRB 4ABMA 4I0XB 3G80A 4LWSB 2KG7A 3FD9A 3TXQA 2B9ZA 2VS0A 3Q4HA 3FAVB 1WA8B 3HR0A 4I0XA 3GVMA 3ZBHA 4LWSA 3GWKC 2DE0X 3TXSA 2AZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRZ A;  2KG7 B;  3FAV A;  1WA8 A;  3OGI B;  3O9O A;  2AZ0 A;  3Q4H B;  4GZR B;  4ABM A;  4I0X B;  3G80 A;  4LWS B;  2KG7 A;  3FD9 A;  3TXQ A;  2B9Z A;  2VS0 A;  3Q4H A;  3FAV B;  1WA8 B;  3HR0 A;  4I0X A;  3GVM A;  3ZBH A;  4LWS A;  3GWK C;  2DE0 X;  3TXS A;  2AZ2 A; 
#chains in the Genus database with same CATH topology
 2VRZ A;  2CGN A;  1V55 B;  3N2G B;  3K03 A;  4JAA A;  3CMA V;  1G6U A;  4JV5 B;  4I0X B;  4GX1 A;  3HKE B;  4LFC B;  1SQV H;  2Y0I A;  2E5L B;  2EIM B;  4LF6 O;  1OZ0 A;  4RWU A;  2R9R B;  3SYP A;  5GTH Z;  1HNZ O;  1XL4 A;  1TA8 A;  3L70 H;  3THO A;  5IDJ A;  4GKJ O;  3IC9 A;  4RAI A;  3K5N A;  3DSQ A;  4UB8 Z;  1Q86 W;  3FAV A;  2E3C A;  2H8P C;  1VQ6 V;  1HW7 A;  3L9D A;  3SYO A;  5LA6 A;  3G80 A;  3N27 A;  4D7T A;  1AI5 A;  2UXC B;  1K3E A;  4LH6 A;  1R6N A;  2GTS A;  1BL8 A;  1F23 A;  4FLT A;  1TUB A;  4LH7 A;  4NKG B;  3K04 A;  4JAV A;  2A79 B;  1SC5 B;  1EFR G;  4ZKI A;  3SPI A;  3H01 A;  4IGG A;  1Q8I A;  3SJC C;  3TXQ A;  3O65 A;  1U96 A;  1AP5 A;  4B3R B;  1BQ0 A;  5EBM C;  3CC7 V;  1K5Q A;  1I94 O;  1EN4 A;  4JZ2 A;  4J80 A;  1XNQ O;  5B1A B;  3IC7 A;  4I4T A;  2O57 A;  5EBL C;  1JOY A;  3BCC H;  2KQX A;  2R9I A;  4GT1 A;  4UCT A;  3P3N A;  1Z5W A;  4F6R A;  1S3J A;  2VQF B;  3ETG A;  1QR8 A;  4NR1 A;  1AI6 A;  4JAU A;  1N8R W;  4J9Z B;  3RT3 C;  4IIJ B;  3KCX A;  4TV9 B;  3ICX A;  3VBB A;  2RQ6 A;  3JAT A;  2Y48 A;  1FJG O;  1XMQ B;  2DYR B;  3WG7 C;  3ZJZ A;  1FD9 A;  1VQK V;  4K35 A;  1MMM A;  3CPW U;  3HKC B;  4MW3 A;  1J5E B;  2JS5 A;  5CA0 B;  1BT8 A;  1DF4 A;  2OYQ A;  3OE7 G;  3STL C;  4DR2 B;  4F4L A;  2P90 A;  4LF8 B;  4JTC B;  4TUY B;  2ITD C;  2YI8 A;  3ASN B;  1KYO F;  1B06 A;  1K73 W;  2DYS C;  2WWW A;  2CTP A;  1VQP V;  1PD3 A;  2QKC A;  1H38 A;  1V55 C;  4UB6 Z;  1ZTE A;  4ZBM A;  4DV2 O;  4G27 B;  2QGN A;  1CXZ B;  2ZXW B;  5B1N A;  1URF A;  4MVQ A;  4CS3 A;  3OR6 C;  3JD1 A;  4BWA A;  1SER A;  1YJ9 V;  1GKF A;  4MTF A;  3ABL B;  4B08 A;  5K1P A;  1M56 B;  3CE2 A;  3TCU A;  1KQS U;  1BGY H;  1B04 A;  2XAH A;  3APQ A;  3VOU A;  3TXS A;  3AG3 C;  4QPJ A;  2ATK C;  2ZQM A;  4X65 B;  1KP2 A;  1HP8 A;  2E75 B;  3CHX A;  3JSN A;  4P2Z A;  2E5L O;  2LW1 A;  2NLJ C;  4B7K A;  1S5J A;  5JH7 B;  2ZIM A;  5IE9 A;  1P4R A;  4JTA B;  1K9M W;  2X0L A;  4NVP A;  1Q82 W;  4DW1 A;  2D2C B;  4MVU A;  2ZDI C;  5IWA O;  1NTM H;  4I55 B;  2HJD A;  3LDC A;  1Q6I A;  3LSU A;  5FL7 G;  5DEC A;  4HNA B;  3G6E V;  4YIP A;  4GX0 A;  4NTX A;  1SKV A;  2HR3 A;  4TQF A;  4DW0 A;  3SR2 C;  4L87 A;  2PYL A;  2ZM6 B;  1I7F A;  3TGU H;  4J41 A;  4KP4 A;  1ORQ C;  4MW8 A;  1MZF A;  4J7J A;  2CK3 G;  2ODM A;  1AP6 A;  2P7T C;  3OEH G;  2IJI A;  3C90 A;  4JAS A;  1N0N A;  1F4N A;  1QHT A;  1FYJ A;  2IBZ H;  2W0F C;  1FS0 G;  3T1H B;  4MTX A;  1YSC A;  5KX5 A;  2DYR C;  2HHH B;  4ZHQ B;  1YIJ V;  4B3R O;  1YI2 V;  4YY3 O;  4DR1 O;  3PN1 A;  5KAF Z;  1AB3 A;  1M1K W;  4IHJ A;  3B8M A;  1I5Y A;  4WFG A;  3W7X A;  1Y66 A;  3OTO B;  1IUR A;  2FL4 A;  4DV4 B;  4NYK A;  1NR1 A;  5LGN A;  3A0B Z;  3S3W A;  5FNV B;  4ZIB A;  5EYP A;  1SF9 A;  3P32 A;  1KMI Z;  3UT5 A;  2QEX V;  4PI0 A;  1RPR A;  3K08 A;  4WBN B;  1SS3 A;  4TV8 A;  1K5S A;  1XMQ O;  5C8Y B;  2QTO A;  3FB5 C;  1FKA O;  3JAL A;  2Y69 C;  2VWJ A;  3SJA C;  3B4S A;  3AG1 C;  1NQT A;  4B3M B;  3FB6 C;  4CBC A;  3FB8 C;  2YUA A;  2Q68 A;  1VQ8 V;  1AIL A;  3SJB C;  5FPR A;  1J95 A;  2Q6A A;  4MS2 A;  1EZJ A;  2PZS A;  1KU9 A;  1W2B U;  4CS4 A;  3MAQ A;  2JEU A;  5EIB D;  3ZMT A;  4DUZ B;  1XHZ A;  5LMU O;  2JVD A;  3OTF A;  4MVZ A;  5IT9 N;  3UCS C;  1OHH G;  2WPD G;  3P30 A;  2CGO A;  4CH5 A;  5CA1 B;  1IZ3 A;  2QM7 A;  2XAJ A;  1Q5O A;  5KHH A;  4BW9 A;  4X1Y A;  4CH3 A;  1D5N A;  1GO3 F;  1XRE A;  4FFB A;  1S77 D;  5B1O A;  1FXH A;  3K57 A;  3W7T A;  4DV7 B;  4LF4 B;  1DLB A;  5F2V O;  3U10 A;  3JAK B;  5B1B C;  1XEQ A;  3QF7 A;  2PI4 A;  5IYD O;  2BTO A;  5LMN O;  3UO3 A;  4Z1V A;  4FPP A;  3L75 H;  3GWO A;  1NKD A;  4X65 O;  3S3X A;  5EK0 A;  2YSU B;  1Y4M A;  4A5U B;  4LF7 O;  4GUN A;  5JJE B;  4O4J B;  4J7Z A;  3GVM A;  5ITZ B;  4PV1 B;  1HNZ B;  3T1Y O;  4AHC A;  2EZO A;  4PD4 F;  4GKJ B;  4Z1M G;  4WFA V;  5EYP B;  2M7W A;  4KXR A;  4UCU A;  2GDS A;  2UU9 O;  2ZM6 O;  3BVO A;  5IJ0 A;  4O2B A;  1R3I C;  4QPK A;  4GKK O;  3K9S A;  1WAZ A;  3OT7 A;  1K34 A;  2Q0A A;  3F5T A;  3EXA A;  1SQB H;  3N2G A;  1IBL O;  4P9P A;  4E4E A;  5J2U A;  3DTU B;  4EFE A;  1I94 B;  1NTK H;  2RNB A;  1XNQ B;  4RUF A;  4X20 A;  3OTO O;  1NT2 B;  3DC5 A;  1WP8 A;  2NR5 A;  2QSA A;  3QVN A;  2AHZ A;  2UXX A;  5JJJ B;  3OUS A;  3KCY A;  4O4L B;  1YVW A;  4FFB B;  1H2S B;  1EN5 A;  3F7V C;  3IGA C;  2W6J G;  3K79 A;  3CME V;  1E1R G;  2UXN A;  4LFA O;  3H1H H;  1SZX A;  3RVY A;  1XBL A;  1VQ5 V;  2KB1 A;  4HYO A;  2R70 A;  2CDY A;  1FJG B;  1PKX A;  3WU2 Z;  3AG4 C;  4FLZ A;  3QO5 A;  4YXW G;  4B3M O;  2QWO B;  1PNK A;  4P9O A;  2IW5 A;  5B66 Z;  4HZ3 A;  2XT9 A;  2F1M A;  1VQN V;  3QO8 A;  2ZDI A;  1EN6 A;  2XAF A;  4HAM A;  2OIE A;  5J2T B;  4D7S A;  2QM8 A;  1OJH A;  5H9C A;  4JI5 O;  3H1J H;  3RWR D;  4BR6 A;  5JVD B;  1PL4 A;  4N23 A;  4PDL A;  3WG7 B;  1VQM V;  3T2M A;  1FXV A;  2KKW A;  3STZ C;  3AK3 A;  1WJZ A;  1HNX O;  3CCR V;  1T5E A;  3DGE A;  3K0G A;  3G6B A;  4TV9 A;  3ZS8 C;  4JI8 O;  4O2B B;  4LBE C;  1RM1 C;  2B9Z A;  2WLJ A;  1IXB A;  1BHA A;  3OAA G;  5KMG B;  3ABM C;  2H94 A;  5CA0 A;  5LBQ A;  3CX5 F;  2LJ2 A;  3Q4H B;  3AEI A;  4TUY A;  1UFI A;  1AJP A;  1BQZ A;  5J2U B;  2ARH A;  3RYI A;  2ZR2 A;  4AQY B;  5DN6 G;  2WLL A;  4X20 B;  1FFT B;  4UUJ C;  4PDM A;  3FFQ A;  1NH2 B;  3DXR A;  4U7O A;  4MT8 A;  3ETD A;  2P4V A;  5IWA B;  2NN4 A;  1I08 A;  1P49 A;  2Y0P A;  4FM1 A;  1R1B A;  1GN4 A;  2UUA O;  3E22 A;  1W0K G;  2AW9 A;  3AG3 B;  2FB5 A;  4UCR A;  5H6Q A;  3SPC A;  3H1I H;  1KKD A;  4XDK A;  2DWE C;  1KP3 A;  3UKM A;  3R66 A;  1N34 O;  1TGO A;  1N32 O;  5EC2 C;  1YHQ V;  3M8A A;  2YXL A;  4QE7 A;  3ZRS A;  4ZOL B;  3HKD B;  3CB2 A;  3ZMV A;  4UV8 A;  3JD4 A;  2PY5 A;  3SYA A;  1OV9 A;  3T4Z A;  2QWR B;  4YY3 B;  4DR1 B;  4U3F H;  5JH7 A;  3J80 N;  5K1X A;  1R3K C;  1FAF A;  1XHX A;  4O2A B;  1S72 V;  2WA3 A;  1QQC A;  1HWY A;  2BSK A;  4O4H B;  2JGU A;  2R9A A;  4I55 A;  4FK5 C;  4GX5 A;  2ADP A;  2RJZ A;  4H13 B;  4HNA A;  3H9V A;  4J7K A;  1VMG A;  5LHG A;  4WF9 V;  4B7E A;  2QR4 A;  5BY1 A;  1XQ8 A;  1H2G A;  2F23 A;  2ZT9 B;  1R6K A;  4DR5 O;  2DN9 A;  2PGG A;  1ZL8 A;  5KHJ A;  3SPH A;  1THZ A;  4I50 B;  1OCR C;  4QE9 A;  5HFM A;  1Z5V A;  5LHI A;  4BIZ A;  1GN6 A;  1Q3E A;  1RFY A;  2Q4P A;  2KG7 B;  4DV5 O;  1QCE A;  3CP1 A;  3K5M A;  4ZHQ A;  3ABK C;  1U97 A;  1NH2 D;  1LNQ A;  3FB7 C;  3RYI B;  4CH4 A;  2PUS A;  4W4L A;  1N33 O;  5LMU B;  2WLL B;  1S76 D;  1XOU A;  1IBM O;  2LW7 A;  3DXR B;  2ZNJ A;  2XAG A;  1WN7 A;  3CRQ A;  1AR5 A;  2Y69 B;  2F43 G;  3BEH A;  1D5A A;  2PTM A;  3AG1 B;  2E76 B;  3OW2 U;  3E22 B;  5FNV A;  3B77 A;  4YJ2 A;  1GTO A;  3RW0 A;  4DYL A;  2LQT A;  3T1C A;  1K8A W;  1VQ7 V;  1SES A;  1X59 A;  5JCO A;  1B6Q A;  2ZIO A;  2ZR3 A;  4WBN A;  5H6R A;  3JAS B;  2HKO A;  5C8Y A;  4K8X A;  1YCI A;  5EBW C;  3WFV A;  1ZUQ A;  3K58 A;  1QU7 A;  1DK1 A;  1KKC A;  2PI5 A;  1Q90 D;  3B8N A;  3TK1 A;  5LGT A;  3CCS V;  5LMN B;  4NB5 A;  1YDX A;  3LSQ A;  1YIT V;  2UXB B;  3ZHR A;  1VF5 B;  3ZMZ A;  2XUM A;  1K92 A;  1K33 A;  2YC0 A;  4O4I A;  3RBZ A;  2EIK C;  2WSS G;  3CCQ V;  4AI8 A;  4LF7 B;  4AQY O;  3BA8 A;  3R65 A;  5IJ9 B;  4PDR A;  1JJ2 U;  3OR7 C;  3SPG A;  3RYC B;  4JI0 B;  4X9Q A;  1LR1 A;  3T1Y B;  1SQF A;  2F4V B;  1NJI W;  5CA1 A;  2BSK B;  2JDI G;  4X1K A;  2AXT Z;  2YDE A;  4PA4 A;  2IU3 A;  1MSW D;  2CH7 A;  5B1B B;  1JX9 A;  4WCE V;  5LXT B;  2XHB A;  2GV9 A;  2EIN C;  3ABU A;  1ZAU A;  2UU9 B;  2VWK A;  2BE3 A;  1QVG U;  3VQX A;  4OGQ B;  2XAQ A;  3K9A A;  5KUM A;  1CEZ A;  2HJF C;  4DK1 A;  4NXM O;  2GBO A;  3D36 C;  2X6A A;  3MHS C;  3JAK A;  1ZL8 B;  4GKK B;  5LL6 Y;  3B2E E;  2BTQ A;  2QWP B;  1NU1 H;  4KFM A;  4R7C A;  4F6E A;  1EM1 A;  4PJ0 Z;  5EZY B;  2V4D A;  1IBL B;  3APO A;  1QBZ A;  3E8G A;  3CWB H;  3ZHV A;  1VQ9 V;  1P7G A;  4O4J A;  5CB4 B;  2EZP A;  5L3E A;  1H2N A;  5ITZ A;  3AG2 C;  4JI6 O;  3ZMU A;  1S0V A;  5KHI A;  1RPO A;  4ASU G;  1FFX B;  5D5P A;  2V1D A;  4YJ2 B;  1KC8 W;  3ZRW A;  1SET A;  2WLK A;  3D8C A;  1HNW O;  2Q5Z A;  2HVJ C;  4LFA B;  3L72 H;  2AHY A;  2UUC B;  3CCE V;  1JVM A;  4BIU A;  1CPY A;  3CC4 V;  3OMI B;  1AJN A;  2DQ0 A;  4FM0 A;  1PNM A;  2PYJ A;  1Y6X A;  1QR9 A;  5L3C A;  2DE0 X;  2HLD G;  4DR3 O;  3CRC A;  1NVP D;  1EBO A;  2ZE5 A;  4X66 O;  1OCC C;  4O4I B;  1MOF A;  1BHB A;  2GTA A;  2F95 B;  4LCU C;  1V9P A;  4JI5 B;  2Z5U A;  4TOI A;  5KHK A;  4LWS A;  4JI3 O;  1P84 F;  3OEE G;  4UVC A;  4X1K B;  3EVK A;  1GMG A;  2P6J A;  2QWQ B;  1M93 A;  3AG4 B;  4O4L A;  1K97 A;  2CH7 B;  2IJH A;  3UO2 A;  1R73 A;  2DMX A;  4CC6 A;  2JJ2 G;  1HNX B;  1VP7 A;  5JQG B;  4JI8 B;  1Y74 B;  1VF6 C;  3X2Q B;  1BMF G;  4PA6 A;  3K06 A;  1KB9 F;  4LFB O;  2ADQ B;  2Q73 A;  1AI7 A;  1JMK C;  4FMT A;  4NXN B;  2BTQ B;  1IBK O;  3M99 B;  2Q7E A;  2UXB O;  4NTY A;  4BAY A;  2QWN B;  3HKB B;  3RYF A;  2ETN A;  5EC1 C;  1GAX A;  1OCO C;  2HP8 A;  4K8Z A;  4TSF G;  2VQE O;  4JZG A;  2YI9 A;  2YIB D;  1WB8 A;  5J2T A;  3CJH B;  3EFF K;  4JI0 O;  2G38 A;  3PJS K;  1OCZ C;  4HBN A;  4DV6 O;  2F4V O;  2JEX A;  2LP7 A;  4X89 A;  3CRA A;  1HR0 O;  4LR3 A;  5L3B A;  1RM1 B;  4X62 O;  5JVD A;  4DR6 O;  1GN3 A;  3KG2 A;  3K3W A;  3E83 A;  4WFE A;  1QLE C;  4MSW C;  1YF2 A;  2UUA B;  2WAM A;  2JK5 C;  1FXK C;  3ZRW B;  1TVK B;  1WA8 B;  3ABM B;  3OFN G;  2V7Q G;  1NBM G;  2EIL C;  4LP8 A;  3RVZ A;  5IYZ B;  3JAM N;  3LUT B;  1ZSP A;  1N34 B;  4YHH B;  2Q9L A;  2K9P A;  2W6I G;  4DR7 O;  2BOB C;  1N32 B;  4EKW A;  2DW4 A;  1KD1 W;  2YEV B;  5KMG A;  2UUB B;  1PL0 A;  3CC2 V;  3Q4H A;  2YIC A;  2QA4 V;  5HFL A;  2JRI A;  1PPJ H;  3CXC U;  2F66 C;  3SGI A;  2N04 A;  1XNR O;  1L8D A;  3P3P A;  4TWK A;  2ZIN A;  3JCU Z;  4K3A A;  4C7U A;  2L35 A;  4ZI7 A;  3L71 H;  3BY6 A;  4LWS B;  4DV3 O;  3AG7 A;  4JPR A;  2FKX A;  1FPO A;  1QNM A;  4X88 A;  1PP9 H;  2WLH A;  2OCC C;  3CRM A;  3M7M X;  1KEC A;  5LP6 B;  1A32 A;  1WNS A;  4X8A A;  1L1F A;  4FJC C;  1M9N A;  1K4D C;  5IY5 B;  5LGU A;  4PDV A;  3RYH A;  2UUC O;  5BXZ A;  2ZNI A;  5LYJ B;  3U11 A;  1GH6 A;  1SZT A;  4P30 A;  4X64 O;  3CS5 A;  4JI2 O;  3SJQ C;  4DR5 B;  3E8B A;  1QLN A;  1F51 A;  1M4U A;  3UM7 A;  1PV0 A;  1VEW A;  4EB6 A;  1Q7Y W;  4PA3 A;  2CTR A;  1ZX3 A;  4LF5 B;  2HVK C;  3RYF B;  4ZOL A;  1VF7 A;  1IX9 A;  3HKD A;  3X2Q C;  3ZCC A;  3OUF A;  3WB1 A;  4RQF A;  1WP7 A;  4J11 A;  4DV5 B;  4FLX A;  5FLX N;  3WB0 A;  4KHP B;  1AJQ A;  2B1I A;  2EJR A;  2WLN A;  4U7N A;  2YID A;  4DV1 O;  4X1I B;  1BE3 H;  4YJ3 A;  3E8H A;  1N33 B;  4PA9 A;  4I9Q A;  3JAW A;  3ZN1 A;  1O9G A;  1SRY A;  2MW2 B;  4O2A A;  4Z2W A;  2FTK A;  1IBM B;  4JYA O;  2OIG A;  4MVR A;  4O4H A;  4DV0 B;  2M6Y A;  5DED A;  1IDS A;  1DF5 A;  4OX9 B;  3D36 A;  1AR1 B;  4GCZ A;  1H2K A;  3ASO C;  3ZHQ A;  1OCR B;  3L73 H;  3I55 V;  4H37 A;  2ZE6 A;  3LDE A;  3ABK B;  4MVS A;  5TIS Z;  1NI8 A;  2ZD9 A;  4NXN O;  3K0D A;  4LNU B;  4NTW A;  1N36 B;  3JYC A;  1YTF D;  4QNH B;  1W59 A;  5GW7 A;  1UJW B;  4I50 A;  2EIJ C;  1IXM A;  4CS2 A;  4UVB A;  3ETQ A;  3JAR A;  1H8E G;  3SYQ A;  3J81 N;  4DXW A;  2FYU H;  2KG7 A;  4EEQ A;  4JI4 O;  4U3J B;  5CBG A;  1US6 A;  3E89 A;  2CTW A;  2UXD B;  4ZI7 B;  4PHZ A;  2JS3 A;  3OGI B;  4JGS A;  3NR7 A;  4JI1 O;  1VIB A;  2Q7G A;  4DR4 B;  2Y4U A;  5H2F Z;  5GTI Z;  2CAZ C;  3ZBH A;  3RYH B;  5BMV A;  4B3T O;  5IYC O;  3JAS A;  4R50 A;  4H0L B;  2QDO A;  2N74 A;  4NXM B;  4YHH O;  2P5O A;  3QTC A;  2LFR A;  2EIK B;  2LGQ A;  5LP6 C;  2W0X A;  4EB6 B;  2UUB O;  4BW5 A;  2YS8 A;  5IY5 C;  3ZRX A;  1DTO A;  4OXS A;  2EJ7 A;  1G8M A;  3VQY A;  2JJ1 G;  2Q69 A;  2OTJ V;  1CP9 A;  5E1A C;  4J10 A;  1YEW A;  5JJN B;  1SQP H;  5IJ9 A;  5LOV A;  3B09 A;  1SQX H;  4YJ3 B;  3RYC A;  3JAW B;  5AG2 A;  2EIN B;  2DOS A;  2DWD C;  2DJV A;  4W4K A;  4JI6 B;  3JD0 A;  2A06 H;  3CD6 V;  1VF6 A;  4XDJ A;  1MG1 A;  1LUW A;  1ZWI C;  3G67 A;  2Y4T A;  4JYC A;  5KA5 A;  4G2K A;  2HFE C;  3OD4 A;  5CBF A;  3OM3 B;  5LXT A;  4IYI A;  2EUL A;  3MHH C;  1HNW B;  5JWP A;  2WLI A;  3LNM B;  1KBH A;  4KL1 A;  1GM9 A;  3OGC C;  3N2K B;  2RMK B;  2OTL V;  3OMA B;  1E1Q G;  4DRX A;  3FKS G;  2Q7H A;  4LF5 O;  3AG2 B;  3JAR B;  1M57 C;  1V54 C;  3BAA A;  5EZY A;  4PI2 A;  2QKA A;  4DR3 B;  3ZHT A;  3CYO A;  1G1X B;  3ML0 A;  4X66 B;  4KHP O;  4JI7 O;  1XI1 A;  2XOK G;  3CEI A;  5CB4 A;  1FXK A;  1RP3 B;  3BPZ A;  1L0L H;  4UXN A;  4CZZ A;  3G71 V;  4JF3 A;  4FVM A;  3SDL A;  2ZE7 A;  4FLY A;  4K0K O;  3E35 A;  4JI3 B;  4DV0 O;  1XMO O;  2YIB A;  4N21 A;  5B3S C;  4OX9 O;  3BHP A;  4BIO A;  2AZ0 A;  1GRJ A;  1FFX A;  1W0J G;  4DUY B;  1AR4 A;  5BMV B;  1R3L C;  3BAB A;  1K7D A;  2F93 B;  3FAV B;  2P4K A;  2ZKO A;  1G4Y B;  3RGB A;  1OCC B;  4LFB B;  5LA6 B;  4UCO A;  2EIM C;  5KHG A;  1N36 O;  3OMN B;  1IBK B;  3BFR A;  1IVS A;  4FLV A;  1TUB B;  3CXH F;  3RFR A;  2VS0 A;  4I7Z B;  2YXY A;  2VQE B;  2X7R B;  3BA9 A;  4EFB A;  3I5D A;  3VQV A;  5LOV B;  3E8F A;  1GM7 A;  4PEL A;  2UXD O;  4FLW A;  4UCS A;  2IJJ A;  4DV6 B;  1NVP B;  1VQ4 V;  3U0Z A;  1D2D A;  4FZ0 A;  2XND G;  1NTZ H;  1HR0 B;  4GZR B;  1PNL A;  2A9H A;  5J9P C;  4JV5 O;  2Z0A A;  4LFC O;  4X62 B;  4DR6 B;  3H1L H;  2P06 A;  1JFF A;  4RUE A;  1VQL V;  4DR4 O;  1WB7 A;  1QVF U;  5H5N A;  4I4T B;  1JR9 A;  4TQD A;  2B1G A;  1JJO A;  1Q81 W;  5JQG A;  1Y74 A;  2WLI B;  3ZHS A;  1WLE A;  4F6R B;  3CCU V;  1OCO B;  2QE7 G;  5KAI Z;  5IYB O;  3ABT A;  4I9W A;  3ZIA G;  2OT5 A;  1H2M A;  2QKS A;  4LF9 B;  2N05 A;  1SQG A;  4RQE A;  4DRX B;  3D3Q A;  5B1A C;  4DR7 B;  1TUE B;  2UXC O;  3ZX6 A;  3ZED A;  1OCZ B;  1NS1 A;  2OWO A;  1KUQ A;  4GYC B;  2ITC C;  3HKB A;  4D6T H;  3JAT B;  4UV9 A;  2WLM A;  2Q8V A;  3T4D A;  2R72 A;  1XIL A;  1JQ0 A;  4PA7 A;  3QG5 A;  4OPH A;  4DO2 A;  3A0H Z;  1JPX A;  4UFZ A;  2CUG A;  1QLE B;  5BZB A;  3CJH A;  3KKY A;  4YIO A;  2XAS A;  1XNR B;  2QJ1 A;  3A8T A;  1FXK B;  1BZK A;  4DV3 B;  2EIL B;  5L3G A;  2RDC A;  4UCV A;  2XTA A;  1YXB A;  5CMU A;  4WFB V;  3ZHU A;  5CA3 A;  3NXS A;  1TVK A;  2AZ2 A;  3QO7 A;  1WA8 A;  5GON A;  1XDC A;  2LO1 A;  3SPJ A;  4MVM A;  3ASN C;  4JI2 B;  4X64 B;  1X4T A;  1SQQ H;  2VQF O;  5IYZ A;  2GSM B;  3AK1 A;  4QJF B;  1YZB A;  2RN9 A;  5L3D A;  3G4S V;  3B40 A;  2IM9 A;  3HR0 A;  2MK3 A;  3HPL C;  3ZMS A;  2YEV A;  1Y76 A;  3L74 H;  4L8J A;  3CCJ V;  3K5L A;  4UVA A;  1JA8 A;  2JIZ G;  2ZXW C;  2EX3 A;  4H33 A;  1MA1 A;  3F7Y C;  1J5E O;  3HB3 B;  3LSS A;  2JGD A;  2OCC B;  1RSO A;  4DV1 B;  4I5S A;  3E86 A;  2IJK A;  4R6Z A;  1MZE A;  4DR2 O;  4LF8 O;  3ABL C;  4Q6G A;  4AIL C;  4IL6 Z;  1M5I A;  2Z3Y A;  1M56 C;  1I5X A;  4JYY A;  5A9G A;  4JYA B;  2L6L A;  1Q6U A;  3FX7 A;  1JFF B;  3O9O A;  3CCV V;  4DUY O;  1B3Q A;  3QNE A;  2ZCE A;  3CRR A;  5LP6 A;  1ROP A;  2RCV A;  1L0N H;  5KA6 A;  2HEP A;  4IT5 A;  1GM8 A;  5BR8 B;  3RN4 A;  3I56 V;  5LYJ A;  3JD3 A;  3UQ8 A;  1WPB A;  2KSD A;  3FYI B;  4E2L A;  5CN0 A;  1Z2G A;  3IAY A;  2BOC C;  1HDJ A;  1H8H G;  3W7W A;  2YIA A;  1R6T A;  3TJT A;  3FYE B;  2X6B A;  4LC1 A;  3JSL A;  4FFK A;  5EIB C;  4B3S B;  4CC5 A;  3AK2 A;  4JI4 B;  2QM4 A;  4JYB A;  3BRC A;  4FZ1 A;  3WB2 A;  4MVO A;  3W7S A;  2NNU A;  2P67 A;  1NZ6 A;  4X1I A;  3ASO B;  5A2Q N;  4J9Y B;  2A3Q A;  3EHB B;  5B5E Z;  3LNN A;  3CSX A;  3VQW A;  1AI4 A;  5CBH A;  1UPG A;  4XDL A;  4QGP A;  5KX5 B;  3IFX A;  4ABM A;  5D5Q A;  3JD2 A;  4JI1 B;  1NR7 A;  3JCZ A;  4ICG A;  3LDD A;  2K1E A;  4LF6 B;  2LGW A;  4OPA A;  5GON B;  4IHJ B;  2EIJ B;  1K4C C;  4WFF A;  2B5U A;  1WPX A;  1F7Y A;  2OCH A;  2ZE8 A;  4B3T B;  2BCC H;  5E79 Z;  1SA0 A;  3ETE A;  2IH1 C;  2GUZ A;  1MSD A;  2Q67 A;  4LF9 O;  3GB7 C;  3A0R A;  4LNU A;  3UT5 B;  1Y76 B;  4TV8 B;  3GWK C;  1F4M A;  3JAL B;  2AGA A;  1YTF B;  4U3J A;  1ARO P;  3ZRV A;  2HG5 C;  3J7A U;  2JGD B;  2Q0O C;  1BSM A;  1RSO B;  1GK9 A;  1DGS A;  5FPO A;  3MDS A;  5JCO C;  3T1H O;  1BS3 A;  4J42 A;  2P22 C;  2CTQ A;  2HHH O;  1H2L A;  3A2F A;  3D3I A;  4I0X A;  3HKE A;  5L3F A;  1S5H C;  1R3J C;  1ENV A;  5KLV H;  4Q20 A;  3SYC A;  1XL6 A;  2GHY A;  2FML A;  2IU0 A;  5LHH A;  1MAB G;  3CCM V;  2D3O W;  2ILM A;  3TET A;  1YJN V;  3ZN0 A;  2C2A A;  1LUV A;  1Q6H A;  1GN2 A;  4GLX A;  4DV4 O;  2EBO A;  3H1K H;  4X1Y B;  2A0L A;  1O9H A;  2CE4 A;  4GX2 A;  1EZV H;  5DM6 V;  4CH6 A;  4IYH A;  4KUM A;  4FLU A;  1XUQ A;  4RO2 A;  4FM2 A;  3KZI Z;  1Y67 A;  1VQO V;  1ZLZ A;  1BCC H;  5C93 A;  1PM9 A;  4JI7 B;  3IJ4 A;  3C3T A;  2YXH A;  3K59 A;  4K0K B;  1XMO B;  4WFH A;  1COW G;  4H44 B;  4DUZ O;  4R8C A;  2PF4 E;  3F5W C;  3W7U A;  1TAE A;  1Q43 A;  3FD9 A;  4JTD B;  1E79 G;  5BR8 O;  1M57 B;  1V54 B;  5KUK A;  1SA0 B;  3E2E A;  2GUZ B;  4MTO A;  4DV2 B;  4MTG A;  4TT3 G;  3N2K A;  2DQ3 A;  2WA4 A;  1MNG A;  2E74 B;  3C3S A;  4DK0 A;  2X6C A;  4XBF A;  4QIW F;  4DV7 O;  4IIJ A;  2H3O A;  5IJ0 B;  1N0J A;  4LF4 O;  2IH3 C;  1P7B A;  4G28 B;  4B3S O;  1YJW V;  2LFS A;  2QTS A;  1M90 W;  3K5O A;  2A7W A;  5B3S B;  1I0H A;  1AVM A;  1JCH A;  1S5L Z;  1VAR A;  2DYS B;  3MD0 A;  3HKC A;  4FIP C;  3DC6 A;  3CCL V;  1N4C A; 
#chains in the Genus database with same CATH homology
 2VRZ A;  2KG7 B;  3FAV A;  1WA8 A;  3OGI B;  3O9O A;  2AZ0 A;  3Q4H B;  4GZR B;  4ABM A;  4I0X B;  3G80 A;  4LWS B;  2KG7 A;  3FD9 A;  3TXQ A;  2B9Z A;  2VS0 A;  3Q4H A;  3FAV B;  1WA8 B;  3HR0 A;  4I0X A;  3GVM A;  3ZBH A;  4LWS A;  3GWK C;  2DE0 X;  3TXS A;  2AZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...