3TXSA

Crystal structure of phage 44rr small terminase gp16
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
QVYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHVEVFAQLMGQMTTTNKEMLKMHKEMKDLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Terminase DNA packaging enzyme small subunit
publication title Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages.
pubmed doi rcsb
source organism Aeromonas phage 44rr2.8t
molecule tags Viral protein
total genus 30
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3txsA01
3GVMA 3G80A 3ZBHA 3FAVB 2B9ZA 1WA8B 3HR0A 3TXQA 2AZ2A 2DE0X 3FAVA 1WA8A 4GZRB 4ABMA 4I0XB 3Q4HB 2VS0A 2VRZA 3TXSA 3GWKC 4I0XA 2KG7B 3Q4HA 2KG7A 4LWSB 2AZ0A 3FD9A 4LWSA 3OGIB 3O9OA
chains in the Genus database with same CATH superfamily
3E2EA 3DXRA 2Q9LA 4D7TA 1AI6A 3RYIA 1XNRO 3APOA 4H44B 1HWYA 4H37A 4PDVA 3LUTB 2DN9A 3BRCA 4UFZA 4LF7B 4IL6Z 5H6RA 1SQBH 4LF9O 2ZKOA 4BW9A 1AILA 1QU7A 4HZ3A 3D3QA 4NYKA 2D3OW 4JI3B 2DMXA 4RWUA 3BY6A 2H8PC 3JARB 1V54C 3APQA 3CS5A 4IYHA 2Y4TA 2JRIA 2GV9A 2XHBA 1YIJV 4O2BB 4QPKA 4ABMA 2ZR2A 4CS2A 5JWPA 1BMFG 4FIPC 3OR7C 5IY5B 5KUKA 1MZFA 1BHAA 4LF5O 1XL6A 1NH2B 4NXMO 1XREA 2JEXA 4QPJA 4RO2A 4EFBA 2Y0IA 4HNAB 1KQSU 4PJ0Z 1GKFA 2EIJB 2LGWA 1XNRB 4DR4O 2AW9A 4I4TA 4WBNB 5EC2C 4LF9B 1Q3EA 1KC8W 1WNSA 3N2GB 2Q68A 4NTXA 4HAMA 1FD9A 3CRAA 3DTUB 5L3CA 3B8MA 4FLZA 1FXKA 1VQMV 3K9SA 3E35A 4NTYA 5HFMA 1E1RG 4LF5B 5LYJB 4NXMB 2UXDO 3ABLB 3L75H 2GUZB 1OCOB 4YXWG 2JIZG 4DR4B 4LF6O 2VQEO 1S5JA 2EIKB 5CA0A 5CBGA 4G28B 2QR4A 1SESA 1WA8B 4D6TH 3ASOB 3OEEG 4EB6B 4CS4A 4BAYA 3KZIZ 4PA7A 1AJQA 3TGUH 2F1MA 2HVKC 4QGPA 2PGGA 4JAAA 4H33A 3THOA 2Q0AA 3CSXA 4E2LA 1H2NA 3FB8C 1OCCC 2JK5C 4DXWA 2UXDB 5IYDO 4DW0A 2IU0A 4X66O 1LUVA 1R6NA 3OD4A 2CGOA 2QKAA 5C93A 1JA8A 2EIKC 3GWKC 4IHJA 1K5QA 2WA4A 4P9OA 4LF6B 2VQEB 4OX9O 2P7TC 3OM3B 3ASOC 3C90A 1UPGA 3OW2U 4DK1A 4B3RO 4U7NA 1K5SA 4JAUA 4U3FH 2Q4PA 1T5EA 1XDCA 4PELA 4B7KA 1GTOA 3D8CA 4CC6A 1CEZA 4DV7O 2YC0A 3BABA 4PDMA 2IJKA 3L72H 1NR1A 1X4TA 3CE2A 4JGSA 4CBCA 1GM8A 1TUBB 2PZSA 1UFIA 5H2FZ 3ETQA 4CH4A 1MMMA 1VQ5V 3SPGA 1RSOA 3LSQA 1AR1B 4X66B 2ZDIA 4X8AA 4MVQA 3ZHRA 4H0LB 3CB2A 2M6YA 1NTZH 2LQTA 4MSWC 3LDEA 4J11A 3LDCA 2D2CB 4WFGA 4OX9B 4K3AA 2LFRA 1HNWO 4BIOA 1S5HC 2R72A 3AG4C 4N21A 1YJNV 1XL4A 3E22A 4DV7B 3DGEA 3LNMB 3SPIA 1BZKA 2A9HA 1H8EG 3JARA 3TXQA 3JAMN 2IW5A 1J95A 4DUZO 2ZM6O 3AK3A 1PNLA 4E4EA 1PNMA 3RWRD 3E8GA 2X7RB 2G38A 2UXXA 4IYIA 4DO2A 1SKVA 2FMLA 4HNAA 4UB8Z 3OGIB 1AJNA 1ZAUA 4UUJC 1VF7A 3CCSV 4WBNA 4RQEA 1HNWB 2BOCC 4WF9V 1MSWD 2P22C 1KECA 1R3JC 3N2GA 3S3XA 1AP6A 1WPBA 2WLIB 2QWOB 1NKDA 3CP1A 3E8BA 2C2AA 4DUZB 2ZM6B 4O4HA 3RT3C 1QLNA 2P06A 3BPZA 2A79B 2QWNB 3ZS8C 5LYJA 1HW7A 5GONB 1FPOA 2GUZA 3ZMTA 1VQ4V 1LNQA 4KFMA 3SYCA 3B4SA 5BZBA 5JH7B 4N23A 2HHHO 5EBWC 5IJ9A 3LNNA 2PUSA 4AILC 5IWAB 1NI8A 4W4KA 1WA8A 1A32A 2ZXWB 3BEHA 2LO1A 1N0JA 2WA3A 4P2ZA 3SJAC 2Q73A 3ZRXA 4CS3A 5JQGB 2NR5A 2JVDA 1SS3A 4DRXB 5KLVH 3HB3B 3UQ8A 1F4MA 1BSMA 4DV3O 1NH2D 4DR1O 3ZRSA 3GVMA 4IT5A 2QEXV 2YS8A 4GX0A 4JYBA 2H94A 3AEIA 1EZVH 1FAFA 2Y0PA 3SYQA 3OMAB 2E3CA 5KHJA 1IX9A 2IU3A 2HHHB 3PN1A 3I5DA 4DV0O 2ZE7A 5CA3A 1G4YB 1YXBA 2Z3YA 2RDCA 2ZR3A 4PA9A 4UV9A 3JD4A 3OTFA 2LP7A 3EHBB 5LP6A 2FKXA 5DN6G 3ETDA 3K5OA 1BS3A 4J41A 3L70H 3CCQV 4DV3B 2KG7A 4DR1B 1HDJA 2ZE8A 1TUBA 1M57B 1RPOA 5IYCO 1NU1H 3RYIB 2KQXA 2RCVA 1EM1A 4DV0B 1J5EO 3EVKA 3AG1C 2UXCO 4TV8B 3BFRA 4A5UB 3O9OA 1JX9A 1N4CA 2Q5ZA 3U11A 3H1HH 2LW1A 5LXTA 4CH6A 4ZI7B 2ATKC 4GZRB 1N33O 1VQ8V 4NB5A 1D2DA 2R9IA 5ITZB 3K5MA 4DW1A 2PI4A 4FVMA 2BTOA 1J5EB 4PDRA 4DR5O 2LW7A 2JJ1G 4CH5A 2UXCB 1Z5VA 3KCXA 1NBMG 2ZE6A 1I7FA 3MD0A 5D5PA 4J10A 3K57A 4JI6O 1CPYA 4WFHA 2AXTZ 4LH6A 4UVAA 2XOKG 3RYCB 1BL8A 1QHTA 4K35A 3SYPA 1JQ0A 4FLUA 5H9CA 2PY5A 3RYHA 4MW8A 1F7YA 4FFBA 4PA3A 1N33B 1Z2GA 1JJOA 1NR7A 2QWRB 1WN7A 1SQPH 2LGQA 1B6QA 5GONA 1RFYA 4NXNO 1IURA 5JH7A 4DR5B 2WLJA 4UB6Z 4JI0O 4JI6B 2NLJC 3K06A 5JJJB 3ZCCA 5L3DA 2DJVA 4PV1B 1E1QG 1ORQC 1AI4A 1FXKC 4PI0A 3ZJZA 4LBEC 4L87A 2WWWA 4GCZA 1IBLO 5JQGA 1R3IC 2ODMA 1NTKH 5KHKA 1KKDA 4DRXA 1SA0B 1OCZC 3RW0A 1H2SB 1K4DC 2OT5A 5KMGB 1HR0O 2EINB 3T1CA 5EYPA 2DE0X 3DC5A 4FJCC 1SQXH 1Y74B 1OJHA 1N36O 1S77D 4J7KA 2GBOA 3T2MA 1F23A 4NXNB 1WP7A 4F4LA 3SPJA 4JI0B 4XBFA 4LFCO 2Q7HA 4IIJB 1B3QA 5KUMA 4FZ0A 4O2AB 3RN4A 4BIZA 4MVRA 4BWAA 1S72V 4R8CA 3FB6C 1JCHA 3M8AA 1IBLB 4F6RB 3SPCA 4JI8O 1H2LA 4LWSB 2QGNA 2EINC 1XOUA 4X1KB 5LGNA 2V4DA 1HR0B 1VQKV 2AHYA 1G1XB 4J9ZB 3T4DA 1FYJA 1N36B 3CEIA 4EFEA 2MW2B 4IGGA 1OCRC 1FJGO 1NS1A 2YIBD 4MT8A 2HJDA 4LFCB 3ML0A 5A9GA 4OPHA 5K1XA 4FLXA 5LBQA 2MK3A 1KP2A 3AG7A 3CD6V 2N05A 3E22B 2F23A 2QM4A 4TV8A 2YDEA 4DR6O 1AROP 4FLWA 1TAEA 1S3JA 3G6EV 2EIMC 1JJ2U 4JI8B 1VF5B 4B3SO 4JF3A 4ZI7A 3L73H 4LF8O 3JAKA 2ZDIC 1KUQA 2CGNA 4PA6A 1SQGA 2UXNA 3UM7A 2VWKA 2GDSA 3E8FA 3IAYA 4J7ZA 1O9HA 5ITZA 2P5OA 1SRYA 1Q7YW 1P84F 1WB7A 1FJGB 4NR1A 3MHSC 1FFXB 3D3IA 1X59A 2DYRB 3TK1A 2UUBO 3RVZA 4LH7A 1IBMO 1Z5WA 2WLKA 3CMEV 2XAHA 4X1YA 3UO2A 4DR6B 4YY3O 3UO3A 2WLNA 1IXMA 5B1OA 4I9WA 4DV4O 3I55V 3RYCA 2XAGA 4B3SB 5IY5C 4MTOA 4LF8B 4O4HB 4GUNA 1ZTEA 2P4VA 4O4LB 3TCUA 2YICA 3E86A 4GKKO 2Q67A 2WSSG 5H6QA 1PL4A 2EIJC 2QKSA 3A0RA 1M1KW 2DOSA 2QTOA 3AK2A 4DV6O 4ASUG 5IJ9B 1KP3A 2Q0OC 3H1KH 3O65A 4R6ZA 2UUBB 1H2GA 2P90A 1QLEB 1IBMB 1Q81W 3UCSC 1AB3A 2FB5A 4BW5A 4YY3B 3Q4HB 1KU9A 4JTCB 1MA1A 3AG2B 2IM9A 4DV4B 4LNUB 2QA4V 2QWPB 3H1JH 2ITCC 3ZN1A 3ABMB 3P30A 1VQ6V 3A2FA 4MVSA 2YI9A 3ABLC 4UVCA 1H38A 1SERA 1SA0A 1OCOC 4GKKB 1IXBA 1SZXA 2HKOA 3ZHQA 4DYLA 3IC7A 1XQ8A 5KMGA 5HFLA 1JPXA 5IE9A 1Q6UA 5KX5A 2IJJA 1Y74A 3N2KB 4DV6B 1YHQV 4I7ZB 3W7TA 2OYQA 2NNUA 1Y6XA 1QLEC 2WPDG 4LP8A 3QO7A 1D5NA 3NXSA 4IIJA 2A7WA 2UXBO 4O2AA 5EBLC 2JJ2G 5LP6B 1RM1B 4BIUA 3ABMC 1Y66A 3TETA 2KG7B 3D36C 2O57A 4F6RA 3CCEV 1H2MA 4MVZA 4NVPA 1I5YA 3B2EE 4WCEV 4LWSA 1M56B 3K5LA 2QJ1A 2ZNJA 4X1KA 3K0DA 4YIOA 3CC2V 3UKMA 2YIAA 4MTXA 3H1IH 2QTSA 1GN4A 1P7GA 2YI8A 1TVKB 1L0LH 2CTRA 3T1HO 5B3SB 2HFEC 3HKDB 4TT3G 3AK1A 1YDXA 4B3RB 2Z0AA 3CC7V 5IT9N 3CJHA 5LP6C 3CCMV 2EJRA 3HKEA 1RM1C 2UXBB 3ZMUA 5LXTB 2YEVB 2B9ZA 3ZIAG 4LCUC 4FLTA 1TA8A 2QKCA 3M99B 1U97A 3ABUA 1QR9A 2L35A 4DV5O 3FB5C 2OWOA 2JGUA 2VQFO 1KBHA 4G27B 3T1HB 3AG3B 1YVWA 2ZE5A 1NVPB 4X9QA 4JI1O 3QTCA 4FZ1A 3OEHG 5L3BA 1FFXA 2VS0A 3JALB 1IDSA 1B04A 1URFA 2JDIG 4XDKA 3QG5A 1GO3F 1ZLZA 3L9DA 3RYHB 4FFBB 4I55B 1M93A 2WLHA 5JCOA 2HR3A 3X2QB 1Q43A 3RYFB 1JR9A 4GT1A 3JD3A 2QM7A 1NJIW 1HNXO 1YZBA 1DF4A 4O4LA 5IJ0B 4KL1A 2P4KA 4WFBV 4DV5B 2A06H 3CRRA 1JFFB 1I0HA 3RGBA 4JI2O 2PI5A 2PTMA 2VQFB 1PP9H 5EZYA 3QVNA 3ZRWB 2VWJA 4JI1B 4TV9B 4AQYO 1K8AW 5KA6A 1D5AA 1EN6A 4CC5A 3CCVV 3Q4HA 4YHHO 1GN6A 4LNUA 3UT5B 1BT8A 3LSUA 3WFVA 3I56V 4PDLA 3WB2A 4PI2A 2K9PA 3JYCA 3C3TA 4UV8A 1HNXB 1QR8A 4X1IB 2LJ2A 3ZBHA 5EYPB 3D36A 1IBKO 3SPHA 5BY1A 5E79Z 3ZHSA 2ETNA 3B77A 4GX5A 2BE3A 3L71H 4JI2B 1BCCH 1K33A 1R1BA 4P9PA 1YCIA 1O9GA 1R73A 3N2KA 2Y48A 4AQYB 2Q7GA 2ZXWC 1XMOO 1U96A 5AG2A 5DECA 2DYSB 2YIDA 5L3FA 1M90W 2HG5C 4YJ3B 3JASB 2K1EA 4YHHB 4JV5O 4ZHQB 2Y69B 3K9AA 3G71V 4J42A 3TJTA 3B09A 4Q20A 2CTWA 1AP5A 1GM9A 5CB4B 1KD1W 2OTLV 2DW4A 2X6AA 2ILMA 5DEDA 2Q8VA 3ZHUA 1OHHG 5B1AB 5LGTA 1GMGA 1IBKB 3CRCA 5LMNO 4JYYA 4AHCA 5CBFA 1SQVH 3CCJV 4K0KO 4C7UA 1VP7A 2QM8A 1TVKA 3P3NA 2DYSC 3HKDA 1XMOB 1YTFB 2UUAO 1NZ6A 3NR7A 4KXRA 1XEQA 4EEQA 3C3SA 1GM7A 1KMIZ 4FFKA 1EFRG 1SQQH 2Y69C 3G80A 3OR6C 3OUFA 4JV5B 3MDSA 3BAAA 1XUQA 2YEVA 1YJWV 4JYCA 5LOVB 1GH6A 2BTQA 3JAKB 1M57C 3DC6A 3CCRV 2UU9O 1L8DA 3K79A 1GRJA 4UCTA 2PYLA 5CN0A 2ITDC 2BOBC 4TQDA 3QF7A 4K0KB 2PYJA 3A0BZ 4LR3A 2FYUH 2ZCEA 4LC1A 2A3QA 1ZUQA 4QNHB 2ARHA 1K73W 2Q69A 2UUAB 4DR2O 1W0JG 4MS2A 4DK0A 1K34A 2JS3A 2Y4UA 3SJBC 3JALA 4X1YB 2OIGA 4R50A 1YEWA 2EZOA 4H13B 3VQVA 4B7EA 3CC4V 2R9AA 2EILB 1EBOA 2GTSA 3CXHF 1KB9F 4I55A 4QE7A 2UU9B 1N32O 3A0HZ 5EBMC 3HKBB 3RYFA 4F6EA 5FLXN 1SZTA 5EK0A 3FFQA 1QCEA 5IJ0A 3M7MX 3FYEB 1GK9A 3JD1A 1N34O 1JFFA 5LHGA 3CRMA 4FK5C 3ABTA 3ZRWA 4DR2B 2EZPA 4TV9A 3HR0A 1MSDA 1ZL8B 5F2VO 1JVMA 5J9PC 3R65A 4RUEA 3U10A 4NKGB 3ZMSA 5KHIA 2ZQMA 4QE9A 1SQFA 5L3GA 4MTFA 4W4LA 2HLDG 1YSCA 4JTAB 3F7VC 4J7JA 1XHXA 2N74A 1N32B 3UT5A 3IFXA 4EKWA 3F5WC 3IJ4A 2V1DA 4X1IA 3E8HA 1R3KC 1WB8A 5KX5B 2N04A 1N34B 1WLEA 3CYOA 4Q6GA 3T4ZA 4X64O 1GN2A 4PA4A 4YJ2B 1OZ0A 3T1YO 4GYCB 4JPRA 1K4CC 2DQ0A 5LA6A 3MHHC 4OXSA 3CWBH 1FXHA 1V55B 3STLC 5KHHA 4YJ3A 3JASA 2E75B 3OMNB 3WG7B 2WLLB 4ZHQA 2IH3C 2A0LA 4MTGA 5CB4A 2XT9A 4QIWF 4X20B 1M4UA 3ICXA 3KCYA 3RFRA 2GSMB 1MOFA 2RQ6A 4D7SA 2ZT9B 1V54B 2CDYA 3OGCC 3T1YB 2KSDA 1TGOA 4FLYA 4FM2A 4GKJO 3CJHB 3CRQA 3K03A 1V55C 3HKEB 2DQ3A 3WG7C 1R3LC 1XMQO 3ZN0A 1W0KG 5D5QA 5LHIA 5LOVA 1RPRA 4MVMA 4UXNA 3ZEDA 3ABKB 1XILA 3CCUV 4PHZA 3KKYA 4FM1A 2XAQA 2B5UA 5LHHA 1F4NA 2LFSA 3JCZA 3K04A 4TUYB 5B66Z 4FM0A 2IJIA 3G4SV 3SYOA 4X65O 4GKJB 1VF6A 2IJHA 3ZMVA 1ROPA 2XAJA 2EULA 4XDJA 1XMQB 4DR7O 2M7WA 2QWQB 1AI5A 1ENVA 2AGAA 4J9YB 2E74B 1I5XA 2XTAA 3ETEA 1K92A 3ABKC 2BSKB 4U7OA 5FPRA 2CTQA 3PJSK 3GB7C 1YF2A 2Q6AA 3HKBA 5B1NA 3SJQC 2JGDA 2R70A 1SF9A 3S3WA 4WFEA 5EZYB 2ADQB 1V9PA 2DYRC 1MG1A 3ZHTA 3BA8A 4TOIA 1YTFD 1MNGA 4X65B 1WJZA 3FAVB 5IYZB 2F4VO 3U0ZA 1ZL8A 4DR7B 1JMKC 4I0XB 1OCCB 3VOUA 5JCOC 5FL7G 1Q8IA 1S76D 1L0NH 1VARA 2CTPA 5EIBD 2YSUB 1QVFU 4FMTA 1Y76B 5KAFZ 4JI4O 1ZX3A 4JZGA 1VQ7V 3K08A 2FL4A 2R9RB 2RJZA 3VBBA 2GHYA 4O4IB 2F66C 2HP8A 4UCSA 3GWOA 5BXZA 3BHPA 2F95B 3KG2A 4OGQB 2QDOA 3VQXA 1P7BA 1N0NA 1CXZB 4B3TO 5FNVB 2X6BA 3P3PA 4YJ2A 3SYAA 3RBZA 5A2QN 2HVJC 2WAMA 3H01A 2CH7B 2F4VB 1VIBA 1DF5A 5KAIZ 3AG2C 4X62O 4PD4F 3RVYA 2GTAA 1E79G 4JI4B 2WLLA 2YXYA 2F43G 2AZ0A 1FKAO 4I5SA 5LGUA 1Q86W 4CZZA 5K1PA 1BGYH 4X20A 1COWG 2OCHA 3AG4B 1EN5A 1K7DA 1MABG 3L74H 1K97A 3K58A 5CA1A 4JAVA 3K0GA 3QO8A 4B3TB 5J2UB 5IDJA 4Z1VA 3OTOO 2V7QG 4I50B 5GTIZ 3W7WA 5J2TA 3IC9A 5C8YB 2YUAA 4JYAO 4X62B 1OV9A 3VQYA 2OCCB 1AI7A 1PKXA 1LUWA 2BTQB 5BMVB 1KKCA 2Q7EA 1AJPA 3FB7C 1M56C 5FPOA 5IYBO 3SJCC 4WFAV 1LR1A 5B1BB 4GX2A 3OUSA 1Q90D 2KKWA 2IH1C 1L1FA 1IVSA 3FD9A 5TISZ 3K5NA 5H5NA 1TUEB 1AR4A 5LMUO 3J7AU 5B3SC 5JJEB 3W7SA 3CHXA 1ZSPA 1M9NA 2OTJV 3OTOB 4TSFG 4TUYA 1S0VA 4L8JA 1W59A 4KUMA 1PNKA 3LSSA 5DM6V 4O2BA 3ZX6A 2OCCC 4JYAB 5CBHA 4Z1MG 3VQWA 5JVDB 1PD3A 2AHZA 4UCOA 4X89A 3JAWB 5B1BC 3ZRVA 1Y67A 4K8ZA 2CAZC 4DR3O 2BSKA 1P4RA 5CMUA 2E76B 3ASNB 1PV0A 5IWAO 3CPWU 2RMKB 2RN9A 4U3JB 5LMUB 3OT7A 2FTKA 3AG3C 1HP8A 1Q6HA 1S5LZ 1ZWIC 3BA9A 1DGSA 1K3EA 3BVOA 3DSQA 3G6BA 1VQNV 2KB1A 3HKCB 1DLBA 1Y4MA 5BR8O 3CMAV 1WP8A 2CUGA 2JS5A 3FAVA 5IYZA 1NT2B 3OFNG 4O4JB 2QSAA 1GAXA 4I0XA 3OMIB 4MW3A 3X2QC 5LL6Y 2QE7G 3WU2Z 4LFBO 3E89A 5B5EZ 5JJNB 5E1AC 1GN3A 3F5TA 1Y76A 3ZMZA 4DR3B 3ASNC 3H1LH 3J80N 1MZEA 1VMGA 4HBNA 4ZOLB 1CP9A 2CE4A 4O4IA 2IBZH 4EB6A 2EJ7A 4B08A 4JI7O 1I08A 1QVGU 1DTOA 3SR2C 4RQFA 1NQTA 5BR8B 1P49A 4JASA 4G2KA 1FXVA 5FNVA 4UCUA 4J80A 5LA6B 2CH7A 4MVUA 3MAQA 1HNZO 1I94O 2B1GA 2AZ2A 4K8XA 3JATB 1H2KA 1IZ3A 4KHPO 4LFBB 2W0FC 3QNEA 2EBOA 3A8TA 1THZA 3W7UA 4YIPA 4QJFB 1JOYA 3AG1B 2YXHA 4JI7B 2Z5UA 1RP3B 3SDLA 4KP4A 1VEWA 5GW7A 3H9VA 1PM9A 1PL0A 2OIEA 2WLMA 5J2UA 3SGIA 3B8NA 4I50A 1G6UA 1KYOF 5L3EA 1HNZB 5C8YA 1I94B 1BE3H 2HEPA 3DXRB 4B3MO 1EZJA 3BCCH 2YXLA 1PPJH 4KHPB 1XI1A 2F93B 2XASA 3STZC 2JEUA 4GLXA 4ZIBA 5BMVA 2XUMA 2RNBA 2ZIMA 5B1AC 1K9MW 1F51A 3FX7A 3J81N 3CXCU 1R6KA 3JD0A 3EXAA 5LMNB 1YITV 4OPAA 3FKSG 1B06A 4DUYO 1YJ9V 2PF4E 4LFAO 1H8HG 2ZD9A 4P30A 3K59A 4XDLA 3HPLC 4ZBMA 4JTDB 3WB0A 1G8MA 4Z2WA 1NTMH 1FS0G 4JZ2A 4B3MB 1XNQO 4FLVA 3CX5F 4TWKA 5EIBC 4I4TB 2X6CA 5JVDA 4X88A 4ZKIA 3JCUZ 1AVMA 1WAZA 1N8RW 3JAWA 1US6A 1QQCA 4JI5O 1QNMA 4RUFA 2B1IA 1QBZA 2JGDB 1VQOV 3FYIB 1XBLA 3JD2A 3ZHVA 1SETA 3R66A 4DUYB 3F7YC 4LFAB 1BQ0A 4U3JA 1VF6C 1FXKB 2WLIA 3P32A 3E83A 4UCRA 2X0LA 1Q5OA 3OE7G 3HKCA 2UUCO 5GTHZ 2L6LA 3K3WA 1BQZA 2XNDG 1SC5B 1OCZB 3QO5A 1XNQB 2DWDC 3WB1A 4O4JA 2EILC 4AI8A 2W6IG 2ZNIA 1VQ9V 5CA0B 4UVBA 1DK1A 4JI5B 4FPPA 4DV1O 2W6JG 5KA5A 1Q6IA 5KHGA 1VQLV 2YIBA 4R7CA 3CCLV 4GX1A 4ZOLA 1AR5A 3N27A 3G67A 1NVPD 1WPXA 2CK3G 2HJFC 1W2BU 2UUCB 1M5IA 3B40A 1R6TA 4LF4O 4DV2O 4CH3A 2E5LO 4BR6A 2ADPA 2ZINA 3JSLA 4WFFA 3EFFK 4IHJB 2XAFA 3W7XA 2ZIOA 3JATA 4UCVA 2VRZA 3TXSA 2NN4A 1BHBA 2EX3A 5EC1C 2W0XA 1UJWB 3OAAG 1XHZA 1Q82W 4DV1B 4I9QA 2H3OA 4LF7O 1OCRB 4NTWA 1VQPV 2P6JA 1EN4A 2DWEC 4MVOA 4JI3O 3IGAC 4HYOA 4RAIA 5CA1B 3LDDA 4X64B 2P67A 4ICGA 5J2TB 1YI2V 2BCCH 2EIMB 1FFTB 1RSOB 4LF4B 4DV2B 2E5LB 4TQFA 3JSNA 3ETGA
chains in the Genus database with same CATH topology
3GVMA 3G80A 3ZBHA 3FAVB 2B9ZA 1WA8B 3HR0A 3TXQA 2AZ2A 2DE0X 3FAVA 1WA8A 4GZRB 4ABMA 4I0XB 3Q4HB 2VS0A 2VRZA 3TXSA 3GWKC 4I0XA 2KG7B 3Q4HA 2KG7A 4LWSB 2AZ0A 3FD9A 4LWSA 3OGIB 3O9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVM A;  3G80 A;  3ZBH A;  3FAV B;  2B9Z A;  1WA8 B;  3HR0 A;  3TXQ A;  2AZ2 A;  2DE0 X;  3FAV A;  1WA8 A;  4GZR B;  4ABM A;  4I0X B;  3Q4H B;  2VS0 A;  2VRZ A;  3TXS A;  3GWK C;  4I0X A;  2KG7 B;  3Q4H A;  2KG7 A;  4LWS B;  2AZ0 A;  3FD9 A;  4LWS A;  3OGI B;  3O9O A; 
#chains in the Genus database with same CATH topology
 3E2E A;  3DXR A;  2Q9L A;  4D7T A;  1AI6 A;  3RYI A;  1XNR O;  3APO A;  4H44 B;  1HWY A;  4H37 A;  4PDV A;  3LUT B;  2DN9 A;  3BRC A;  4UFZ A;  4LF7 B;  4IL6 Z;  5H6R A;  1SQB H;  4LF9 O;  2ZKO A;  4BW9 A;  1AIL A;  1QU7 A;  4HZ3 A;  3D3Q A;  4NYK A;  2D3O W;  4JI3 B;  2DMX A;  4RWU A;  3BY6 A;  2H8P C;  3JAR B;  1V54 C;  3APQ A;  3CS5 A;  4IYH A;  2Y4T A;  2JRI A;  2GV9 A;  2XHB A;  1YIJ V;  4O2B B;  4QPK A;  4ABM A;  2ZR2 A;  4CS2 A;  5JWP A;  1BMF G;  4FIP C;  3OR7 C;  5IY5 B;  5KUK A;  1MZF A;  1BHA A;  4LF5 O;  1XL6 A;  1NH2 B;  4NXM O;  1XRE A;  2JEX A;  4QPJ A;  4RO2 A;  4EFB A;  2Y0I A;  4HNA B;  1KQS U;  4PJ0 Z;  1GKF A;  2EIJ B;  2LGW A;  1XNR B;  4DR4 O;  2AW9 A;  4I4T A;  4WBN B;  5EC2 C;  4LF9 B;  1Q3E A;  1KC8 W;  1WNS A;  3N2G B;  2Q68 A;  4NTX A;  4HAM A;  1FD9 A;  3CRA A;  3DTU B;  5L3C A;  3B8M A;  4FLZ A;  1FXK A;  1VQM V;  3K9S A;  3E35 A;  4NTY A;  5HFM A;  1E1R G;  4LF5 B;  5LYJ B;  4NXM B;  2UXD O;  3ABL B;  3L75 H;  2GUZ B;  1OCO B;  4YXW G;  2JIZ G;  4DR4 B;  4LF6 O;  2VQE O;  1S5J A;  2EIK B;  5CA0 A;  5CBG A;  4G28 B;  2QR4 A;  1SES A;  1WA8 B;  4D6T H;  3ASO B;  3OEE G;  4EB6 B;  4CS4 A;  4BAY A;  3KZI Z;  4PA7 A;  1AJQ A;  3TGU H;  2F1M A;  2HVK C;  4QGP A;  2PGG A;  4JAA A;  4H33 A;  3THO A;  2Q0A A;  3CSX A;  4E2L A;  1H2N A;  3FB8 C;  1OCC C;  2JK5 C;  4DXW A;  2UXD B;  5IYD O;  4DW0 A;  2IU0 A;  4X66 O;  1LUV A;  1R6N A;  3OD4 A;  2CGO A;  2QKA A;  5C93 A;  1JA8 A;  2EIK C;  3GWK C;  4IHJ A;  1K5Q A;  2WA4 A;  4P9O A;  4LF6 B;  2VQE B;  4OX9 O;  2P7T C;  3OM3 B;  3ASO C;  3C90 A;  1UPG A;  3OW2 U;  4DK1 A;  4B3R O;  4U7N A;  1K5S A;  4JAU A;  4U3F H;  2Q4P A;  1T5E A;  1XDC A;  4PEL A;  4B7K A;  1GTO A;  3D8C A;  4CC6 A;  1CEZ A;  4DV7 O;  2YC0 A;  3BAB A;  4PDM A;  2IJK A;  3L72 H;  1NR1 A;  1X4T A;  3CE2 A;  4JGS A;  4CBC A;  1GM8 A;  1TUB B;  2PZS A;  1UFI A;  5H2F Z;  3ETQ A;  4CH4 A;  1MMM A;  1VQ5 V;  3SPG A;  1RSO A;  3LSQ A;  1AR1 B;  4X66 B;  2ZDI A;  4X8A A;  4MVQ A;  3ZHR A;  4H0L B;  3CB2 A;  2M6Y A;  1NTZ H;  2LQT A;  4MSW C;  3LDE A;  4J11 A;  3LDC A;  2D2C B;  4WFG A;  4OX9 B;  4K3A A;  2LFR A;  1HNW O;  4BIO A;  1S5H C;  2R72 A;  3AG4 C;  4N21 A;  1YJN V;  1XL4 A;  3E22 A;  4DV7 B;  3DGE A;  3LNM B;  3SPI A;  1BZK A;  2A9H A;  1H8E G;  3JAR A;  3TXQ A;  3JAM N;  2IW5 A;  1J95 A;  4DUZ O;  2ZM6 O;  3AK3 A;  1PNL A;  4E4E A;  1PNM A;  3RWR D;  3E8G A;  2X7R B;  2G38 A;  2UXX A;  4IYI A;  4DO2 A;  1SKV A;  2FML A;  4HNA A;  4UB8 Z;  3OGI B;  1AJN A;  1ZAU A;  4UUJ C;  1VF7 A;  3CCS V;  4WBN A;  4RQE A;  1HNW B;  2BOC C;  4WF9 V;  1MSW D;  2P22 C;  1KEC A;  1R3J C;  3N2G A;  3S3X A;  1AP6 A;  1WPB A;  2WLI B;  2QWO B;  1NKD A;  3CP1 A;  3E8B A;  2C2A A;  4DUZ B;  2ZM6 B;  4O4H A;  3RT3 C;  1QLN A;  2P06 A;  3BPZ A;  2A79 B;  2QWN B;  3ZS8 C;  5LYJ A;  1HW7 A;  5GON B;  1FPO A;  2GUZ A;  3ZMT A;  1VQ4 V;  1LNQ A;  4KFM A;  3SYC A;  3B4S A;  5BZB A;  5JH7 B;  4N23 A;  2HHH O;  5EBW C;  5IJ9 A;  3LNN A;  2PUS A;  4AIL C;  5IWA B;  1NI8 A;  4W4K A;  1WA8 A;  1A32 A;  2ZXW B;  3BEH A;  2LO1 A;  1N0J A;  2WA3 A;  4P2Z A;  3SJA C;  2Q73 A;  3ZRX A;  4CS3 A;  5JQG B;  2NR5 A;  2JVD A;  1SS3 A;  4DRX B;  5KLV H;  3HB3 B;  3UQ8 A;  1F4M A;  1BSM A;  4DV3 O;  1NH2 D;  4DR1 O;  3ZRS A;  3GVM A;  4IT5 A;  2QEX V;  2YS8 A;  4GX0 A;  4JYB A;  2H94 A;  3AEI A;  1EZV H;  1FAF A;  2Y0P A;  3SYQ A;  3OMA B;  2E3C A;  5KHJ A;  1IX9 A;  2IU3 A;  2HHH B;  3PN1 A;  3I5D A;  4DV0 O;  2ZE7 A;  5CA3 A;  1G4Y B;  1YXB A;  2Z3Y A;  2RDC A;  2ZR3 A;  4PA9 A;  4UV9 A;  3JD4 A;  3OTF A;  2LP7 A;  3EHB B;  5LP6 A;  2FKX A;  5DN6 G;  3ETD A;  3K5O A;  1BS3 A;  4J41 A;  3L70 H;  3CCQ V;  4DV3 B;  2KG7 A;  4DR1 B;  1HDJ A;  2ZE8 A;  1TUB A;  1M57 B;  1RPO A;  5IYC O;  1NU1 H;  3RYI B;  2KQX A;  2RCV A;  1EM1 A;  4DV0 B;  1J5E O;  3EVK A;  3AG1 C;  2UXC O;  4TV8 B;  3BFR A;  4A5U B;  3O9O A;  1JX9 A;  1N4C A;  2Q5Z A;  3U11 A;  3H1H H;  2LW1 A;  5LXT A;  4CH6 A;  4ZI7 B;  2ATK C;  4GZR B;  1N33 O;  1VQ8 V;  4NB5 A;  1D2D A;  2R9I A;  5ITZ B;  3K5M A;  4DW1 A;  2PI4 A;  4FVM A;  2BTO A;  1J5E B;  4PDR A;  4DR5 O;  2LW7 A;  2JJ1 G;  4CH5 A;  2UXC B;  1Z5V A;  3KCX A;  1NBM G;  2ZE6 A;  1I7F A;  3MD0 A;  5D5P A;  4J10 A;  3K57 A;  4JI6 O;  1CPY A;  4WFH A;  2AXT Z;  4LH6 A;  4UVA A;  2XOK G;  3RYC B;  1BL8 A;  1QHT A;  4K35 A;  3SYP A;  1JQ0 A;  4FLU A;  5H9C A;  2PY5 A;  3RYH A;  4MW8 A;  1F7Y A;  4FFB A;  4PA3 A;  1N33 B;  1Z2G A;  1JJO A;  1NR7 A;  2QWR B;  1WN7 A;  1SQP H;  2LGQ A;  1B6Q A;  5GON A;  1RFY A;  4NXN O;  1IUR A;  5JH7 A;  4DR5 B;  2WLJ A;  4UB6 Z;  4JI0 O;  4JI6 B;  2NLJ C;  3K06 A;  5JJJ B;  3ZCC A;  5L3D A;  2DJV A;  4PV1 B;  1E1Q G;  1ORQ C;  1AI4 A;  1FXK C;  4PI0 A;  3ZJZ A;  4LBE C;  4L87 A;  2WWW A;  4GCZ A;  1IBL O;  5JQG A;  1R3I C;  2ODM A;  1NTK H;  5KHK A;  1KKD A;  4DRX A;  1SA0 B;  1OCZ C;  3RW0 A;  1H2S B;  1K4D C;  2OT5 A;  5KMG B;  1HR0 O;  2EIN B;  3T1C A;  5EYP A;  2DE0 X;  3DC5 A;  4FJC C;  1SQX H;  1Y74 B;  1OJH A;  1N36 O;  1S77 D;  4J7K A;  2GBO A;  3T2M A;  1F23 A;  4NXN B;  1WP7 A;  4F4L A;  3SPJ A;  4JI0 B;  4XBF A;  4LFC O;  2Q7H A;  4IIJ B;  1B3Q A;  5KUM A;  4FZ0 A;  4O2A B;  3RN4 A;  4BIZ A;  4MVR A;  4BWA A;  1S72 V;  4R8C A;  3FB6 C;  1JCH A;  3M8A A;  1IBL B;  4F6R B;  3SPC A;  4JI8 O;  1H2L A;  4LWS B;  2QGN A;  2EIN C;  1XOU A;  4X1K B;  5LGN A;  2V4D A;  1HR0 B;  1VQK V;  2AHY A;  1G1X B;  4J9Z B;  3T4D A;  1FYJ A;  1N36 B;  3CEI A;  4EFE A;  2MW2 B;  4IGG A;  1OCR C;  1FJG O;  1NS1 A;  2YIB D;  4MT8 A;  2HJD A;  4LFC B;  3ML0 A;  5A9G A;  4OPH A;  5K1X A;  4FLX A;  5LBQ A;  2MK3 A;  1KP2 A;  3AG7 A;  3CD6 V;  2N05 A;  3E22 B;  2F23 A;  2QM4 A;  4TV8 A;  2YDE A;  4DR6 O;  1ARO P;  4FLW A;  1TAE A;  1S3J A;  3G6E V;  2EIM C;  1JJ2 U;  4JI8 B;  1VF5 B;  4B3S O;  4JF3 A;  4ZI7 A;  3L73 H;  4LF8 O;  3JAK A;  2ZDI C;  1KUQ A;  2CGN A;  4PA6 A;  1SQG A;  2UXN A;  3UM7 A;  2VWK A;  2GDS A;  3E8F A;  3IAY A;  4J7Z A;  1O9H A;  5ITZ A;  2P5O A;  1SRY A;  1Q7Y W;  1P84 F;  1WB7 A;  1FJG B;  4NR1 A;  3MHS C;  1FFX B;  3D3I A;  1X59 A;  2DYR B;  3TK1 A;  2UUB O;  3RVZ A;  4LH7 A;  1IBM O;  1Z5W A;  2WLK A;  3CME V;  2XAH A;  4X1Y A;  3UO2 A;  4DR6 B;  4YY3 O;  3UO3 A;  2WLN A;  1IXM A;  5B1O A;  4I9W A;  4DV4 O;  3I55 V;  3RYC A;  2XAG A;  4B3S B;  5IY5 C;  4MTO A;  4LF8 B;  4O4H B;  4GUN A;  1ZTE A;  2P4V A;  4O4L B;  3TCU A;  2YIC A;  3E86 A;  4GKK O;  2Q67 A;  2WSS G;  5H6Q A;  1PL4 A;  2EIJ C;  2QKS A;  3A0R A;  1M1K W;  2DOS A;  2QTO A;  3AK2 A;  4DV6 O;  4ASU G;  5IJ9 B;  1KP3 A;  2Q0O C;  3H1K H;  3O65 A;  4R6Z A;  2UUB B;  1H2G A;  2P90 A;  1QLE B;  1IBM B;  1Q81 W;  3UCS C;  1AB3 A;  2FB5 A;  4BW5 A;  4YY3 B;  3Q4H B;  1KU9 A;  4JTC B;  1MA1 A;  3AG2 B;  2IM9 A;  4DV4 B;  4LNU B;  2QA4 V;  2QWP B;  3H1J H;  2ITC C;  3ZN1 A;  3ABM B;  3P30 A;  1VQ6 V;  3A2F A;  4MVS A;  2YI9 A;  3ABL C;  4UVC A;  1H38 A;  1SER A;  1SA0 A;  1OCO C;  4GKK B;  1IXB A;  1SZX A;  2HKO A;  3ZHQ A;  4DYL A;  3IC7 A;  1XQ8 A;  5KMG A;  5HFL A;  1JPX A;  5IE9 A;  1Q6U A;  5KX5 A;  2IJJ A;  1Y74 A;  3N2K B;  4DV6 B;  1YHQ V;  4I7Z B;  3W7T A;  2OYQ A;  2NNU A;  1Y6X A;  1QLE C;  2WPD G;  4LP8 A;  3QO7 A;  1D5N A;  3NXS A;  4IIJ A;  2A7W A;  2UXB O;  4O2A A;  5EBL C;  2JJ2 G;  5LP6 B;  1RM1 B;  4BIU A;  3ABM C;  1Y66 A;  3TET A;  2KG7 B;  3D36 C;  2O57 A;  4F6R A;  3CCE V;  1H2M A;  4MVZ A;  4NVP A;  1I5Y A;  3B2E E;  4WCE V;  4LWS A;  1M56 B;  3K5L A;  2QJ1 A;  2ZNJ A;  4X1K A;  3K0D A;  4YIO A;  3CC2 V;  3UKM A;  2YIA A;  4MTX A;  3H1I H;  2QTS A;  1GN4 A;  1P7G A;  2YI8 A;  1TVK B;  1L0L H;  2CTR A;  3T1H O;  5B3S B;  2HFE C;  3HKD B;  4TT3 G;  3AK1 A;  1YDX A;  4B3R B;  2Z0A A;  3CC7 V;  5IT9 N;  3CJH A;  5LP6 C;  3CCM V;  2EJR A;  3HKE A;  1RM1 C;  2UXB B;  3ZMU A;  5LXT B;  2YEV B;  2B9Z A;  3ZIA G;  4LCU C;  4FLT A;  1TA8 A;  2QKC A;  3M99 B;  1U97 A;  3ABU A;  1QR9 A;  2L35 A;  4DV5 O;  3FB5 C;  2OWO A;  2JGU A;  2VQF O;  1KBH A;  4G27 B;  3T1H B;  3AG3 B;  1YVW A;  2ZE5 A;  1NVP B;  4X9Q A;  4JI1 O;  3QTC A;  4FZ1 A;  3OEH G;  5L3B A;  1FFX A;  2VS0 A;  3JAL B;  1IDS A;  1B04 A;  1URF A;  2JDI G;  4XDK A;  3QG5 A;  1GO3 F;  1ZLZ A;  3L9D A;  3RYH B;  4FFB B;  4I55 B;  1M93 A;  2WLH A;  5JCO A;  2HR3 A;  3X2Q B;  1Q43 A;  3RYF B;  1JR9 A;  4GT1 A;  3JD3 A;  2QM7 A;  1NJI W;  1HNX O;  1YZB A;  1DF4 A;  4O4L A;  5IJ0 B;  4KL1 A;  2P4K A;  4WFB V;  4DV5 B;  2A06 H;  3CRR A;  1JFF B;  1I0H A;  3RGB A;  4JI2 O;  2PI5 A;  2PTM A;  2VQF B;  1PP9 H;  5EZY A;  3QVN A;  3ZRW B;  2VWJ A;  4JI1 B;  4TV9 B;  4AQY O;  1K8A W;  5KA6 A;  1D5A A;  1EN6 A;  4CC5 A;  3CCV V;  3Q4H A;  4YHH O;  1GN6 A;  4LNU A;  3UT5 B;  1BT8 A;  3LSU A;  3WFV A;  3I56 V;  4PDL A;  3WB2 A;  4PI2 A;  2K9P A;  3JYC A;  3C3T A;  4UV8 A;  1HNX B;  1QR8 A;  4X1I B;  2LJ2 A;  3ZBH A;  5EYP B;  3D36 A;  1IBK O;  3SPH A;  5BY1 A;  5E79 Z;  3ZHS A;  2ETN A;  3B77 A;  4GX5 A;  2BE3 A;  3L71 H;  4JI2 B;  1BCC H;  1K33 A;  1R1B A;  4P9P A;  1YCI A;  1O9G A;  1R73 A;  3N2K A;  2Y48 A;  4AQY B;  2Q7G A;  2ZXW C;  1XMO O;  1U96 A;  5AG2 A;  5DEC A;  2DYS B;  2YID A;  5L3F A;  1M90 W;  2HG5 C;  4YJ3 B;  3JAS B;  2K1E A;  4YHH B;  4JV5 O;  4ZHQ B;  2Y69 B;  3K9A A;  3G71 V;  4J42 A;  3TJT A;  3B09 A;  4Q20 A;  2CTW A;  1AP5 A;  1GM9 A;  5CB4 B;  1KD1 W;  2OTL V;  2DW4 A;  2X6A A;  2ILM A;  5DED A;  2Q8V A;  3ZHU A;  1OHH G;  5B1A B;  5LGT A;  1GMG A;  1IBK B;  3CRC A;  5LMN O;  4JYY A;  4AHC A;  5CBF A;  1SQV H;  3CCJ V;  4K0K O;  4C7U A;  1VP7 A;  2QM8 A;  1TVK A;  3P3N A;  2DYS C;  3HKD A;  1XMO B;  1YTF B;  2UUA O;  1NZ6 A;  3NR7 A;  4KXR A;  1XEQ A;  4EEQ A;  3C3S A;  1GM7 A;  1KMI Z;  4FFK A;  1EFR G;  1SQQ H;  2Y69 C;  3G80 A;  3OR6 C;  3OUF A;  4JV5 B;  3MDS A;  3BAA A;  1XUQ A;  2YEV A;  1YJW V;  4JYC A;  5LOV B;  1GH6 A;  2BTQ A;  3JAK B;  1M57 C;  3DC6 A;  3CCR V;  2UU9 O;  1L8D A;  3K79 A;  1GRJ A;  4UCT A;  2PYL A;  5CN0 A;  2ITD C;  2BOB C;  4TQD A;  3QF7 A;  4K0K B;  2PYJ A;  3A0B Z;  4LR3 A;  2FYU H;  2ZCE A;  4LC1 A;  2A3Q A;  1ZUQ A;  4QNH B;  2ARH A;  1K73 W;  2Q69 A;  2UUA B;  4DR2 O;  1W0J G;  4MS2 A;  4DK0 A;  1K34 A;  2JS3 A;  2Y4U A;  3SJB C;  3JAL A;  4X1Y B;  2OIG A;  4R50 A;  1YEW A;  2EZO A;  4H13 B;  3VQV A;  4B7E A;  3CC4 V;  2R9A A;  2EIL B;  1EBO A;  2GTS A;  3CXH F;  1KB9 F;  4I55 A;  4QE7 A;  2UU9 B;  1N32 O;  3A0H Z;  5EBM C;  3HKB B;  3RYF A;  4F6E A;  5FLX N;  1SZT A;  5EK0 A;  3FFQ A;  1QCE A;  5IJ0 A;  3M7M X;  3FYE B;  1GK9 A;  3JD1 A;  1N34 O;  1JFF A;  5LHG A;  3CRM A;  4FK5 C;  3ABT A;  3ZRW A;  4DR2 B;  2EZP A;  4TV9 A;  3HR0 A;  1MSD A;  1ZL8 B;  5F2V O;  1JVM A;  5J9P C;  3R65 A;  4RUE A;  3U10 A;  4NKG B;  3ZMS A;  5KHI A;  2ZQM A;  4QE9 A;  1SQF A;  5L3G A;  4MTF A;  4W4L A;  2HLD G;  1YSC A;  4JTA B;  3F7V C;  4J7J A;  1XHX A;  2N74 A;  1N32 B;  3UT5 A;  3IFX A;  4EKW A;  3F5W C;  3IJ4 A;  2V1D A;  4X1I A;  3E8H A;  1R3K C;  1WB8 A;  5KX5 B;  2N04 A;  1N34 B;  1WLE A;  3CYO A;  4Q6G A;  3T4Z A;  4X64 O;  1GN2 A;  4PA4 A;  4YJ2 B;  1OZ0 A;  3T1Y O;  4GYC B;  4JPR A;  1K4C C;  2DQ0 A;  5LA6 A;  3MHH C;  4OXS A;  3CWB H;  1FXH A;  1V55 B;  3STL C;  5KHH A;  4YJ3 A;  3JAS A;  2E75 B;  3OMN B;  3WG7 B;  2WLL B;  4ZHQ A;  2IH3 C;  2A0L A;  4MTG A;  5CB4 A;  2XT9 A;  4QIW F;  4X20 B;  1M4U A;  3ICX A;  3KCY A;  3RFR A;  2GSM B;  1MOF A;  2RQ6 A;  4D7S A;  2ZT9 B;  1V54 B;  2CDY A;  3OGC C;  3T1Y B;  2KSD A;  1TGO A;  4FLY A;  4FM2 A;  4GKJ O;  3CJH B;  3CRQ A;  3K03 A;  1V55 C;  3HKE B;  2DQ3 A;  3WG7 C;  1R3L C;  1XMQ O;  3ZN0 A;  1W0K G;  5D5Q A;  5LHI A;  5LOV A;  1RPR A;  4MVM A;  4UXN A;  3ZED A;  3ABK B;  1XIL A;  3CCU V;  4PHZ A;  3KKY A;  4FM1 A;  2XAQ A;  2B5U A;  5LHH A;  1F4N A;  2LFS A;  3JCZ A;  3K04 A;  4TUY B;  5B66 Z;  4FM0 A;  2IJI A;  3G4S V;  3SYO A;  4X65 O;  4GKJ B;  1VF6 A;  2IJH A;  3ZMV A;  1ROP A;  2XAJ A;  2EUL A;  4XDJ A;  1XMQ B;  4DR7 O;  2M7W A;  2QWQ B;  1AI5 A;  1ENV A;  2AGA A;  4J9Y B;  2E74 B;  1I5X A;  2XTA A;  3ETE A;  1K92 A;  3ABK C;  2BSK B;  4U7O A;  5FPR A;  2CTQ A;  3PJS K;  3GB7 C;  1YF2 A;  2Q6A A;  3HKB A;  5B1N A;  3SJQ C;  2JGD A;  2R70 A;  1SF9 A;  3S3W A;  4WFE A;  5EZY B;  2ADQ B;  1V9P A;  2DYR C;  1MG1 A;  3ZHT A;  3BA8 A;  4TOI A;  1YTF D;  1MNG A;  4X65 B;  1WJZ A;  3FAV B;  5IYZ B;  2F4V O;  3U0Z A;  1ZL8 A;  4DR7 B;  1JMK C;  4I0X B;  1OCC B;  3VOU A;  5JCO C;  5FL7 G;  1Q8I A;  1S76 D;  1L0N H;  1VAR A;  2CTP A;  5EIB D;  2YSU B;  1QVF U;  4FMT A;  1Y76 B;  5KAF Z;  4JI4 O;  1ZX3 A;  4JZG A;  1VQ7 V;  3K08 A;  2FL4 A;  2R9R B;  2RJZ A;  3VBB A;  2GHY A;  4O4I B;  2F66 C;  2HP8 A;  4UCS A;  3GWO A;  5BXZ A;  3BHP A;  2F95 B;  3KG2 A;  4OGQ B;  2QDO A;  3VQX A;  1P7B A;  1N0N A;  1CXZ B;  4B3T O;  5FNV B;  2X6B A;  3P3P A;  4YJ2 A;  3SYA A;  3RBZ A;  5A2Q N;  2HVJ C;  2WAM A;  3H01 A;  2CH7 B;  2F4V B;  1VIB A;  1DF5 A;  5KAI Z;  3AG2 C;  4X62 O;  4PD4 F;  3RVY A;  2GTA A;  1E79 G;  4JI4 B;  2WLL A;  2YXY A;  2F43 G;  2AZ0 A;  1FKA O;  4I5S A;  5LGU A;  1Q86 W;  4CZZ A;  5K1P A;  1BGY H;  4X20 A;  1COW G;  2OCH A;  3AG4 B;  1EN5 A;  1K7D A;  1MAB G;  3L74 H;  1K97 A;  3K58 A;  5CA1 A;  4JAV A;  3K0G A;  3QO8 A;  4B3T B;  5J2U B;  5IDJ A;  4Z1V A;  3OTO O;  2V7Q G;  4I50 B;  5GTI Z;  3W7W A;  5J2T A;  3IC9 A;  5C8Y B;  2YUA A;  4JYA O;  4X62 B;  1OV9 A;  3VQY A;  2OCC B;  1AI7 A;  1PKX A;  1LUW A;  2BTQ B;  5BMV B;  1KKC A;  2Q7E A;  1AJP A;  3FB7 C;  1M56 C;  5FPO A;  5IYB O;  3SJC C;  4WFA V;  1LR1 A;  5B1B B;  4GX2 A;  3OUS A;  1Q90 D;  2KKW A;  2IH1 C;  1L1F A;  1IVS A;  3FD9 A;  5TIS Z;  3K5N A;  5H5N A;  1TUE B;  1AR4 A;  5LMU O;  3J7A U;  5B3S C;  5JJE B;  3W7S A;  3CHX A;  1ZSP A;  1M9N A;  2OTJ V;  3OTO B;  4TSF G;  4TUY A;  1S0V A;  4L8J A;  1W59 A;  4KUM A;  1PNK A;  3LSS A;  5DM6 V;  4O2B A;  3ZX6 A;  2OCC C;  4JYA B;  5CBH A;  4Z1M G;  3VQW A;  5JVD B;  1PD3 A;  2AHZ A;  4UCO A;  4X89 A;  3JAW B;  5B1B C;  3ZRV A;  1Y67 A;  4K8Z A;  2CAZ C;  4DR3 O;  2BSK A;  1P4R A;  5CMU A;  2E76 B;  3ASN B;  1PV0 A;  5IWA O;  3CPW U;  2RMK B;  2RN9 A;  4U3J B;  5LMU B;  3OT7 A;  2FTK A;  3AG3 C;  1HP8 A;  1Q6H A;  1S5L Z;  1ZWI C;  3BA9 A;  1DGS A;  1K3E A;  3BVO A;  3DSQ A;  3G6B A;  1VQN V;  2KB1 A;  3HKC B;  1DLB A;  1Y4M A;  5BR8 O;  3CMA V;  1WP8 A;  2CUG A;  2JS5 A;  3FAV A;  5IYZ A;  1NT2 B;  3OFN G;  4O4J B;  2QSA A;  1GAX A;  4I0X A;  3OMI B;  4MW3 A;  3X2Q C;  5LL6 Y;  2QE7 G;  3WU2 Z;  4LFB O;  3E89 A;  5B5E Z;  5JJN B;  5E1A C;  1GN3 A;  3F5T A;  1Y76 A;  3ZMZ A;  4DR3 B;  3ASN C;  3H1L H;  3J80 N;  1MZE A;  1VMG A;  4HBN A;  4ZOL B;  1CP9 A;  2CE4 A;  4O4I A;  2IBZ H;  4EB6 A;  2EJ7 A;  4B08 A;  4JI7 O;  1I08 A;  1QVG U;  1DTO A;  3SR2 C;  4RQF A;  1NQT A;  5BR8 B;  1P49 A;  4JAS A;  4G2K A;  1FXV A;  5FNV A;  4UCU A;  4J80 A;  5LA6 B;  2CH7 A;  4MVU A;  3MAQ A;  1HNZ O;  1I94 O;  2B1G A;  2AZ2 A;  4K8X A;  3JAT B;  1H2K A;  1IZ3 A;  4KHP O;  4LFB B;  2W0F C;  3QNE A;  2EBO A;  3A8T A;  1THZ A;  3W7U A;  4YIP A;  4QJF B;  1JOY A;  3AG1 B;  2YXH A;  4JI7 B;  2Z5U A;  1RP3 B;  3SDL A;  4KP4 A;  1VEW A;  5GW7 A;  3H9V A;  1PM9 A;  1PL0 A;  2OIE A;  2WLM A;  5J2U A;  3SGI A;  3B8N A;  4I50 A;  1G6U A;  1KYO F;  5L3E A;  1HNZ B;  5C8Y A;  1I94 B;  1BE3 H;  2HEP A;  3DXR B;  4B3M O;  1EZJ A;  3BCC H;  2YXL A;  1PPJ H;  4KHP B;  1XI1 A;  2F93 B;  2XAS A;  3STZ C;  2JEU A;  4GLX A;  4ZIB A;  5BMV A;  2XUM A;  2RNB A;  2ZIM A;  5B1A C;  1K9M W;  1F51 A;  3FX7 A;  3J81 N;  3CXC U;  1R6K A;  3JD0 A;  3EXA A;  5LMN B;  1YIT V;  4OPA A;  3FKS G;  1B06 A;  4DUY O;  1YJ9 V;  2PF4 E;  4LFA O;  1H8H G;  2ZD9 A;  4P30 A;  3K59 A;  4XDL A;  3HPL C;  4ZBM A;  4JTD B;  3WB0 A;  1G8M A;  4Z2W A;  1NTM H;  1FS0 G;  4JZ2 A;  4B3M B;  1XNQ O;  4FLV A;  3CX5 F;  4TWK A;  5EIB C;  4I4T B;  2X6C A;  5JVD A;  4X88 A;  4ZKI A;  3JCU Z;  1AVM A;  1WAZ A;  1N8R W;  3JAW A;  1US6 A;  1QQC A;  4JI5 O;  1QNM A;  4RUF A;  2B1I A;  1QBZ A;  2JGD B;  1VQO V;  3FYI B;  1XBL A;  3JD2 A;  3ZHV A;  1SET A;  3R66 A;  4DUY B;  3F7Y C;  4LFA B;  1BQ0 A;  4U3J A;  1VF6 C;  1FXK B;  2WLI A;  3P32 A;  3E83 A;  4UCR A;  2X0L A;  1Q5O A;  3OE7 G;  3HKC A;  2UUC O;  5GTH Z;  2L6L A;  3K3W A;  1BQZ A;  2XND G;  1SC5 B;  1OCZ B;  3QO5 A;  1XNQ B;  2DWD C;  3WB1 A;  4O4J A;  2EIL C;  4AI8 A;  2W6I G;  2ZNI A;  1VQ9 V;  5CA0 B;  4UVB A;  1DK1 A;  4JI5 B;  4FPP A;  4DV1 O;  2W6J G;  5KA5 A;  1Q6I A;  5KHG A;  1VQL V;  2YIB A;  4R7C A;  3CCL V;  4GX1 A;  4ZOL A;  1AR5 A;  3N27 A;  3G67 A;  1NVP D;  1WPX A;  2CK3 G;  2HJF C;  1W2B U;  2UUC B;  1M5I A;  3B40 A;  1R6T A;  4LF4 O;  4DV2 O;  4CH3 A;  2E5L O;  4BR6 A;  2ADP A;  2ZIN A;  3JSL A;  4WFF A;  3EFF K;  4IHJ B;  2XAF A;  3W7X A;  2ZIO A;  3JAT A;  4UCV A;  2VRZ A;  3TXS A;  2NN4 A;  1BHB A;  2EX3 A;  5EC1 C;  2W0X A;  1UJW B;  3OAA G;  1XHZ A;  1Q82 W;  4DV1 B;  4I9Q A;  2H3O A;  4LF7 O;  1OCR B;  4NTW A;  1VQP V;  2P6J A;  1EN4 A;  2DWE C;  4MVO A;  4JI3 O;  3IGA C;  4HYO A;  4RAI A;  5CA1 B;  3LDD A;  4X64 B;  2P67 A;  4ICG A;  5J2T B;  1YI2 V;  2BCC H;  2EIM B;  1FFT B;  1RSO B;  4LF4 B;  4DV2 B;  2E5L B;  4TQF A;  3JSN A;  3ETG A; 
#chains in the Genus database with same CATH homology
 3GVM A;  3G80 A;  3ZBH A;  3FAV B;  2B9Z A;  1WA8 B;  3HR0 A;  3TXQ A;  2AZ2 A;  2DE0 X;  3FAV A;  1WA8 A;  4GZR B;  4ABM A;  4I0X B;  3Q4H B;  2VS0 A;  2VRZ A;  3TXS A;  3GWK C;  4I0X A;  2KG7 B;  3Q4H A;  2KG7 A;  4LWS B;  2AZ0 A;  3FD9 A;  4LWS A;  3OGI B;  3O9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...