3TXZA

Oye1-w116q complexed with r-carvone
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
399
structure length
398
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLQVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 158
structure length 398
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3txzA00
1SU5A 1XKYA 3PG9A 2C14A 4XTDA 2ZZ4A 4O54A 3ATYA 3M6YA 3QSTA 3EWYA 1K7XA 3N2XA 3S6DA 4O13A 5D09A 1FCBA 1I8JA 2C19A 3Q94A 3ATZA 4O12A 1KBJA 4UMBA 2E6FA 3G18A 4Y6GA 2J24A 3TSDA 2C0AA 1YTDA 4UTTA 1PV8A 2UV8G 3HG4A 4PCFA 1JCLA 4Z1DA 1SO4A 3DZ1A 3EWBX 5F2MA 1ICPA 3TE9A 3M5YA 4DBEA 2X2GA 4LY8A 5HMSA 2V81A 4LVFA 1LP6A 3TXVA 3TA6A 5BMWA 4BF9A 1LLWA 3W87A 1UBSA 3G8EA 1LBLA 1JCXA 3M16A 1L2UA 4WUIA 3LOTA 4HNUA 4A29A 4ZQPA 3T44A 3JRKA 3C56A 4NNAA 1BTMA 2R14A 5KMYA 3IIPA 1AMKA 1N7KA 1VYPX 1YDVA 3LTPA 1JUKA 4FIRA 3GDMA 3JR2A 1G7UA 4UFKA 3CB8A 1L6YA 2XFWA 3QRHA 2BWGA 2B7NA 5E93A 3B06A 5AC8A 3ZWSA 1FXPA 5DN1A 5FF2A 5IBXC 3DFPA 4C1LA 5F2GA 2W6RA 3E12A 3CIWA 3MYOA 4UCGA 1GOXA 2CLIA 5DBUA 4QIUA 1TRIA 3L68A 4JN6A 3QPZA 1OFAA 1H7WA 5HULA 4O15A 5FF7A 4BWLC 1QCWA 1IF2A 2QJHA 5CZSA 3TJLA 1OFOA 1O4UA 1HTIA 3USBA 1SUXA 5CSRA 4EWND 5D38A 1XUZA 1T96A 1EIXA 2YR1A 2NUWA 1ZAJA 3W1QA 2VOMA 3N19B 5HWNA 2Y62A 4GXMA 2GOUA 4LS1A 1AW2A 1VJIA 5I3HA 4ZQOA 1ICQA 2NLIA 1W54A 3WJXA 3UZJA 2FLIA 2TSYA 4LVGA 3LHWA 2A85A 3W2NA 4QSHA 4ONVA 1TCDA 5CGQA 3W7LA 1QMLA 1L6WA 4OU1A 3HQ1A 3DI1A 1KTNA 2EPHA 3TMQA 2PURA 3LI1A 4FEZA 1W3IA 1KTBA 4ZVJA 3TFXA 2RHGA 2X1TA 1LLZA 2A1YA 4HNNA 3QPYA 3YPIA 4MY9A 3EKZA 1C29A 4MLJA 3NQGA 4UR7A 3M7WA 3F03K 3EXRA 2VEKA 1TPH1 3I7QA 2WPBA 3GB6A 1HO1A 2E6YA 3NA8A 5DCBA 2Y7GA 3PBWA 1AL8A 5K4ZA 2QCMA 3DI0A 5EA9A 3QYQA 4UTHA 3BV4A 4FF7A 2X1RA 5F4XA 1PCKA 4LNYA 5F4SA 5TQLA 1XBYA 2QUVA 5AHEA 1H5YA 3NQ8A 4LV9A 3L5MA 4GUJA 4Y96A 1HO4A 4M6QA 2ZRUA 2WO5A 4K37A 3MP3A 1EWEA 3C2RA 1GYNA 4X3ZA 1VCVA 4XZ9A 4ML9A 2QDHA 4FNQA 3O6YX 1KM4A 3ABQA 3GDTA 3PG8A 4N4QA 2Q8ZA 2B7PA 2JK2A 3QQ1A 3G3DA 3TSBA 1TV8A 5HUOA 3MHFA 2TYSA 4Y90A 4DF0A 1W31A 4JR5A 1PVNA 2GJLA 3M5ZA 1LZOA 1DL3A 1QR7A 3A22A 1W5PA 2VFDA 4A22A 3GX9A 1XUUA 1VRDA 3CEUA 5AN7A 1VHNA 3W86A 3PR2A 7TIMA 5AYZA 4GUIA 1FUYA 1KLZA 3W7NA 1PHQA 1U5JA 2Y7FA 3ZWTA 1GJPA 5CKSA 2F84A 5C55A 1JQXA 1LRTA 4MIMA 1VZWA 1VHCA 4IXHA 4HKPA 2Y6ZA 3TW7A 4R33A 3B0UX 1X1ZA 2V82A 4B5NA 1JCNA 3NL3A 5G2IA 1MO0A 2V0TA 4NVTA 2NXGA 1OF6A 2ZCGA 3FA5A 3MP5A 4O50A 3A21A 3TR2A 2A4AA 3C52A 4IWWA 1R46A 4JTFA 4OV4A 3THQA 1Z41A 1MZHA 2O7SA 3NL5A 4YCOA 2ZZ1A 1F7BA 1SZGA 1KFLA 1BEUA 4JYDA 1OF8A 3IIZA 3HBLA 5DXYA 4H6KA 3N2MA 4WZHA 2VELA 4ADSA 4E38A 3EX1A 3P82A 1IXPA 1LBFA 2ZRXA 1GT8A 3NPUA 3GIYA 4AXKA 5AYYA 1F2JA 3SJ3A 1M5WA 3EX6A 1VPXA 3LM7A 4IGHA 4BI7A 2YDAA 3FFSA 5CPLA 4UFHA 2J27A 4O57A 5K4XA 5EYWA 3RMJA 1A50A 1B57A 2ZYFA 1WYIA 3GZ3A 3LCGA 3G1FA 4CQAA 1FDYA 3T4CA 1V5XA 2YSWA 5C6MA 3BG3A 2RDTA 4NX5A 3KOFA 2YYUA 3LERA 4HNTA 4TO8A 4FX6M 3HGOA 3BVJA 3O07A 4UXDA 2V2HA 2GQAA 2QCGA 1PS9A 4OGZA 3P62A 3STFA 1RR2A 4GE8A 1KW1A 3T55A 1Z44A 3EXSA 3FJ6A 3R5EA 4PA8A 3NEVA 3UWZA 1GZGA 3L0KA 2I9EA 3KRZA 3W7EA 3G22A 2Y70A 1HFBA 1ONRA 4CCEA 2QAPA 1PE1A 1H7OA 1ZAHA 2QUUA 3LGEA 3ELFA 4HSNA 5CPOA 1TTPA 4HPJA 3O8AA 4XBKA 4N9DA 1Z48A 4W9TA 2CZ5A 2DU2A 4O14A 3SR7A 5U4NA 5I3FA 1RZMA 4A21A 3PBVA 3UY7A 5K7JA 3QFEA 1OYBA 2V2DA 3RK8A 3HGJA 1DKWA 4I7VA 4EF9A 2ISWA 1RD5A 3TC7A 4FHAA 3KVLA 2HSAA 1A5BA 1ZENA 4IX0A 3HGRA 4N9EA 4Z08A 3DXIA 3KHJA 3W7JA 1FXQA 3PUEA 2GUUA 1XBVA 4HN4A 4UTKA 5FEWA 1TPFA 3W7QA 1QWGA 1S5VA 3HOJA 4XKYA 4K7YA 1G4EA 5DCEA 3N3MA 2VC6A 4AWSA 3TIMA 2QUTA 1IIGA 2WKJA 4QAIA 3W2UA 3W1PA 3HMJG 2A0NA 3QW3A 1L9WA 1GQNA 6TIMA 2E09A 2ZFAA 3LXAA 4UFLA 4HIBA 1KM6A 1OFBA 1G4SA 3NO5A 4JYFA 3B0VC 2VFFA 4XKYB 3EWWA 2ATSA 1VCGA 4RZ6A 2Y61A 3SI9A 1VQTA 4IMCA 1W5MA 3H53A 1KFJA 4H3DA 2CU0A 4OQVA 3I7RA 4ZL1A 4KFNA 4LV4A 1OABA 2VENA 2QDGA 2RDWA 1OFRA 1MEIA 4GFSA 1THFD 5AC7A 3O6CA 1Q45A 1QNVA 2ZZ2A 3DU0A 3G1HA 1VYRA 3NG3A 4FXRA 2CLLA 4O19A 3DFQA 2V5BA 3BG9A 2YGYA 2A7PA 3B05A 4IPJA 3RFAA 3LCWA 4X22A 1VLIA 2ZRYA 3SGUA 1SW3A 3P5ZA 3THAA 4JD4A 3S0CA 4GJ1A 5CSSA 1KV5A 1AW5A 4QISA 2E5CA 2DZWA 1SZEA 2RFGA 1YDNA 3LCLA 1DV7A 4O28A 1PCWA 4O8RA 5IBXA 2Y88A 3PUOA 5F1UA 2Q3RA 3LV5A 1LM1A 1W5NA 4ORMA 1XFBA 3HIJA 2WJZA 1ZNNA 2HS6A 2VKZG 3NL2A 4BWLA 2CZEA 4PODA 2DZPA 2Y89A 3BG5A 3E0IA 3UY8A 2GJNA 4A2RA 3AO0A 3W1AA 1QO5A 3DAQA 1OFQA 3KRSA 4JDBA 2ZRVA 1IXOA 3EX2A 1RPXA 4UTJA 3TAOA 1GWJA 4NNCA 1KV8A 2GVJA 1OG0A 2WV8A 2ZA1A 3W1NA 2QCHA 1H7NA 2LLEA 4MYAA 4YWIA 2ZZ7A 3W7MA 1JCMP 1JRBA 4Y8FA 3LHYA 3LRLA 4GRSA 3QH2A 2BXVA 4RZ4A 3KFTA 4UUIA 4GC4A 1JUBA 4QNEA 5AHFA 3P61A 3ABOA 2AAMA 4UTLA 2ABBA 3O06A 3P67A 1M7OA 4UFMA 4AB4A 1UUMA 2FTPA 3GDLA 4JTHA 4ZQCA 3TJXA 1O5XA 3CWOX 3VE7A 3W1XA 1H51A 4WD0A 3WJYA 1A5CA 3QQ0A 3LLDA 3M9YA 3L0NA 3BARA 3P5YA 4P2VA 5G2WA 4XUGA 2QF7A 3P8IA 1JULA 4JTUA 1YXCA 4TX9A 1WAUA 1BWKA 1X1OA 1WOAA 2PE4A 3T40A 4DO5A 1KTCA 4XTIA 3F4WA 3LXCA 1H63A 2YFOA 3NM1A 5D2XA 2NX3A 4AVFA 4OBTA 4KWVA 1EEPA 1GPWA 3KRUA 4FXSA 1K8YA 4UMCA 2VFHA 4MZ1A 2GQ9A 5DBTA 1XM3A 3G1SA 1QPOA 3BW3A 3QSRA 1B9BA 2RKXA 2JKEA 3G8RA 3HG5A 3LLFA 4XBSA 4X9SA 2ABAA 5HQEA 4ZQMA 4YCPA 4CQ8A 2NX1A 3PAJA 1Q6OA 3VCRA 3FJLA 5C2XA 4G1KA 2VEIA 1X7FA 2RH9A 2GQ8A 5T26A 4FNRA 3NGJA 1Q6LA 3F1QA 2OJPA 3M44A 5AHMA 4NZJA 3UWWA 4JX4A 2Y7EA 4JTEA 1FWTA 3P81A 5G2HA 4O4VA 1D9EA 1NF0A 3W3OA 1G69A 1L6SA 4MKNA 3SW6A 1YLVA 4O1BA 3MI3A 3IGUA 3CT7A 4OE7A 4RCXA 3W7RA 1TV7A 2Y85A 3HPZA 3MI6A 5J5RA 4GWEA 2WOQA 1F74A 3P74A 3W73A 2E6AA 2DZVA 3L5LA 3STEA 4E2DA 2PC4A 1AG1O 1OFPA 4AHQA 2EKCA 1ME9A 4EF8A 4BR1A 4GUHA 2P10A 4JNMA 3NXFA 3NQAA 3TFCA 4U28A 2B7QA 3P84A 2R91A 4N2YA 1FBAA 5LKYA 3GNDA 3O15A 4DO6A 4YLWA 3S1XA 1SFJA 4DELA 5LGXA 4LC8A 2TMDA 3DH7A 2XN0A 4GUFA 3M5XA 1F6PA 1LYXA 1B3OA 2V8ZA 4NJKA 3EWXA 1QPQA 3BW2A 3G24A 2H3BA 3HF3A 4NJJA 3S1UA 3N9RA 1EP3A 3HJZA 1IXQA 3QMSA 4YXGA 1J2WA 4Z1BA 4DPPA 4MPQA 4WY0A 1SW0A 5HWJA 4E2BA 3W7KA 3RLUA 3CIXA 3P8JA 3CTLA 4WJEA 2CLOA 1LROA 4RR4A 2E1DA 2ZTJA 2FIQA 4MFEA 4ZMGA 4MFDA 2ZZ6A 4MY1A 2A7RA 2JBMA 3HO8A 4FNTA 1K7EA 1HUVA 5DELA 2H8XA 3W1UA 4WQ6A 4JEQA 3PVFA 5DXXA 1F5ZA 1K8XA 3NQ2A 4UFJA 1ME7A 1QAPA 3CU2A 4M7SA 2Q8LA 4M19A 3TMLA 2ALDA 1ALDA 4AAJA 4WY0B 3LI0A 3C3NA 3EKLA 3MI2A 4CCDA 1JCJA 3W7CA 5LZLA 1Y0EA 1OFDA 4LUJA 5LGZA 5D03A 3W7OA 1OK4A 3FOKA 1UCWA 3EX4A 1H7XA 1LCOA 1O95A 4D2JA 2QJGA 3I65A 5D32A 1RV8A 1N8FA 3AJXA 4WY0F 3QMTA 1DBTA 1O60A 5K9DA 1H61A 2W79A 2QCEA 2NX9A 3NDOA 3QM3A 4RX0A 2BX7A 5AFDA 1W37A 1LRNA 4K8EA 4H4IA 5AOUA 1EP1A 1CX9A 4HT3A 1TPUA 1EB3A 3IIOA 3NAVA 2Q3OA 3L65A 3TK7A 5LNVA 4CLMA 3NVTA 1QFEA 3FEMA 1O94A 1YTEA 5AHIA 3IGXA 1YPIA 3A5FA 4QNWA 3UNDA 3W22A 3OVQA 2YCEA 2V2CA 2Z1BA 1LDCA 2ISVA 2VFGA 2GPTA 3NNTA 3IIVA 2YW3A 1VLWA 4DF1A 1YXYA 4LVDA 3I7SA 2A6LA 3UWVA 3W76A 5FESA 3CWNA 3A9IA 3G1XA 2OT0A 3CQ0A 3W2LA 1XBZA 3LTSA 3IRDA 1JR1A 2X1SA 3PSVA 3VE9A 4CQ9A 4JX6A 3TUUA 4MVAA 3DFTA 3W74A 2OMAA 3EXTA 4TIMA 3G3MA 3NOEA 3KVJA 2FPTA 1TPC1 3L2IA 5LHEA 4BI6A 4A3UA 3QJAA 2KZHA 3LHTA 3K30A 1WXJA 3INPA 1XCFA 1P1XA 1S5TA 3NPVA 1R2TA 4JY9A 5G4WA 5C5YA 4JIPA 3N14A 5HINA 2CLHA 2FDSA 2OZ0A 2V30A 3NPWA 4K39A 3UWYA 3LV6A 4LT9A 4O53A 5D02A 3MO7A 3PBUA 3PB2A 5EMUA 1SSDA 4UC5A 3LHVA 5I3GA 4UTMA 3DKLA 5L9FA 3CPRA 4JYEA 2PRMA 1C8VA 3UQNA 2CLMA 2ZZ5A 4I9AA 2NUXA 2F7FA 3W7IA 2OT1A 3MHGA 5J5DA 4WXYA 1CW2A 3LBMA 1TPDA 3TH6A 3BLEA 3U6WA 1FY6A 3SY5A 3S5NA 5D30A 3W7HA 3C6CA 5MHBA 2WSQA 1F76A 3A23A 2C1HA 1TTIA 1FWRA 3PBYA 3F4NA 3C0JA 3QMRA 1OX4A 3BW4A 3IVTA 1D3GA 1GEQA 4GBUA 1NEYA 5D04C 3NQCA 4JY8A 1P0KA 3E9AA 3PSWA 4P61A 3H55A 2QCFA 4UTIA 3M5VA 3HG2A 4OT7A 3EEGA 4N6EA 1H7RA 5DLCA 4E0CA 3BLIA 3OIXA 1SO3A 3WK2A 3LHZA 3W2JA 4JTGA 4M5PA 3O16A 3L9CA 1OX4B 1Q6RA 3DENA 3GXPA 3STGA 3M47A 1TQJA 1ZAIA 1TREA 4IMGA 1Q6QA 3QC3A 5FEZA 1JRCA 4LVAA 4CNPA 1U83A 2C13A 1Z42A 2WNZA 5A8GA 4JXCA 4NUWA 1MEHA 4M6PA 1TQXA 4AWTA 2FB2A 2FJKA 3LCIA 4O1CA 2QCLA 4I7WA 3B0PA 3C61A 3W75A 1KM0A 4O17A 3W7GA 1JQVA 3NQMA 4IOTA 3PF3A 4AF0A 3S5OA 1WBHA 3UWUA 1FWWA 3C2FA 5KZMA 4JDYA 4ALDA 3L0GA 1SPQA 3V1PA 3BPWA 3U2OA 3LCXA 4O4WA 3ZFHA 4O1DA 2J9XA 3RLVA 2QCDA 3GR8A 4UTUA 1I2OA 2YPIA 1D3HA 2CFFA 3TQKA 2XN1A 3UPWA 1OK6A 4IMFA 1PL9A 4RKAA 4AF0B 2E68A 1BKSA 4YMZA 4KFPA 2EAWA 4N9CA 1WA3A 4POCA 4AHOA 5KINA 1GTEA 1I2PA 4FNSA 2H90A 4PTNA 2C3ZA 4K36A 3GKAA 1W3TA 3N34A 1WBJA 2V9DA 1R2RA 4R7JA 4L4MA 5GVJA 2QCDB 1TTQA 2G95A 5I3KA 3S5ZA 3TQ0A 1XI3A 3W72A 2TPSA 3RNDA 5D05A 5FF4A 1OX5A 5D2VA 1KBIA 1EWDA 4O10A 2NXHA 5K9CA 1W5QA 2JGYA 3I68A 5F1VA 3WK3A 3LHUA 1O5KA 1W0MA 5D2YA 3GDRA 3L67A 4LU0A 3VI2A 4RJEA 4Q33A 2A7NA 3P80A 3P7YA 2FPYA 4UTWC 3S42A 1EUNA 3TC6A 1K8ZA 3M43A 1R47A 2YW4A 2Z6IA 2R8WA 3HGSA 4L4LA 1G7VA 1R30A 1IIHA 4DQWA 3OEXA 2J9YA 1UJPA 4PH6A 4WOZA 4IJBA 1WOBA 1AK5A 5CPNA 1QPNA 2QCCA 1MXSA 5BNKA 2PRHA 5EBUA 1G67A 4MY8A 4IXXA 1SO6A 5K9XA 3WJZA 1N55A 3TAKA 1ZCOA 3NQ7A 3LCHA 1GVRA 1YXDA 2DZSA 4HSOA 4YL2A 3VNDA 1IGSA 4FNPA 3W1RA 1W8SA 3MHUA 1S3HA 2CZDA 1MEWA 5BW6A 4AWUA 3G0SA 2X30A 2WSRA 3NPXA 1VGAA 5TBOA 1GG0A 4HPXA 4RXGA 3T7VA 3SIZA 3B04A 3W83A 2BTMA 2A2IA 1KM5A 4O18A 5KSWA 5BMXA 1TMHA 3MW7A 3GK0A 3W2MA 4AH7A 1KFBA 2EF9A 4TR9A 3W1TA 5LNUA 1XC4A 3C2EA 4N02A 1TIMA 3U8GA 3NM3A 1DQXA 4K7VA 4FO4A 5ABTA 1SFLA 1UB3A 2B4GA 4N6FA 2J6XA 2QCNA 4UMAA 2DZUA 4UNLA 4LRSA 3W7DA 3GLCA 3LRKA 2BZNA 3B03A 3TQVA 2YXGA 3MBFA 3CC1A 3WJWA 1RQBA 1M7PA 3FYPA 3CM4A 1GYLA 1EA0A 1LORA 1P4CA 4Z1AA 1BWLA 5G5IA 3C8FA 1LRQA 3SSJA 4PL2A 3GAKA 4TMCA 4EIVA 5K3VA 2FPVA 3W23A 1R2SA 3IGSA 3S5YA 3L5AA 1DOSA 4ORIA 1A5SA 1YYAA 4XWUA 2QR6A 4RK8A 2V5LA 5FEXA 3W07A 1XXXA 3S1VA 1P0NA 3W88A 5D37A 5KZDA 3EWZA 2VFIA 4NT0A 3PY2A 2ZDRA 3NL6A 4J9JA 3B4UA 2CWNA 3IIXA 5EKYA 1WDWA 5EY5A 1KLYA 1JCYA 3NZ1A 4NJIA 1LOSA 3RU6A 3IVSA 3SZ8A 1GVFA 4O0KA 2WSYA 4K8HA 4WOQA 5KTLA 3C2OA 2H8ZA 3EB2A 3GVGA 3BK0A 1K7FA 1LTDA 3IV3A 4K38A 5AB3A 3NQDA 4UNKA 1GVOA 2Z6JA 4JTJA 5TIMA 4PEKA 3DFSA 1TO3A 3UD6A 1TPB1 4IX2A 4KKXA 3HPSA 3FIGA 4DF2A 2C16A 1W3NA 5DY2A 4TMBA 2EGZA 4MYXA 3DKJA 2NV1A 4IUOA 3O63A 4S2BA 2A21A 2CLFA 1FDJA 3OHIA 4WX2A 3DBPA 3LX9A 1H60A 1P5BA 3PUDA 3TROA 3KVKA 5C54A 3UWQA 1G6CA 3G1VA 4MOZA 4XQ6A 3G1DA 1OYCA 2I1OA 3TNOA 1I4NA 3SECA 3O05A 1KA9F 3A5VA 5HJLA 1TTJA 1WQ5A 3IEBA 2H6RA 3N9SA 4GNJA 4EVZA 3T78A 2GVGA 5AC6A 2BLEA 2X16A 3PM6A 4DXVA 5HR6A 4UFIA 4O52A 3ZS4A 3LXBA 4JICA 3TW6A 4FNUA 3R12A 4JGDA 1ADOA 2OX1A 2HMCA 3DGRA 2G5WA 5EPDA 4Z0JA 1FX6A 1ZHAA 3GXTA 2YFNA 5LHFA 4R34A 2DJLA 3C2VA 4WXZA 3TCEA 1QDSA 3PS7A 3TV8A 2YYTA 2P1FA 3UPBA 3W70A 1YDOA 3QW4B 3R13A 1RQEA 2QEZA 5CZ0A 5F2LA 4QM1A 3P60A 3UXAA 1VH7A 5HNRA 2O7QA 1FQ0A 5D2WA 3BLFA 5L6UA 1OJXA 5CZTA 2NZLA 4DPQA 1TRDA 3GKFA 4JX5A 3W71A 2ZTKA 4ZQRA 4EOUA 1H1YA 3S1WA 3QEZA 5G1YA 2E77A 3DFNA 5KZEA 4AEOA 4FX7A 1I2RA 1ZALA 1DJQA 4QQ3A 4UTTC 4FX8A 1VYSX 1LBMA 3NQEA 3FKKA 3PB0A 3W2KA 2X1UA 1W5OA 4LVBA 4NNBA 4DEFA 4X2RA 5LNSA 1Q3NA 1FCUA 3KVMA 3LBCA 3IVUA 3MJYA 4NX0A 3BGGA 4LC6A 4A2SA 3WFAA 3OG3A 4QJ1A 4Y9AA 2DORA 1K03A 2ZRWA 3E49A 5D33A 3V75A 1VC4A 3GR7A 2C6QA 2CZFA 3GDKA 1J4EA 5FF3A 2ZBTA 1ML1A 1DHPA 4PC8A 2P0OA 3QF0A 1H62A 4O0ZA 1XDLA 1MSSA 4NJGA 5HUPA 4NXKA 1QO2A 5FEPA 3NYZA 5H2ZA 1RVGA 4LWWA 3TSMA 3FKRA 3MUXA 1QOQA 1G4PA 1RQHA 1F05A 1TYGA 5LSMA 5F2IA 1I2QA 5CPMA 3SGZA 2PRLA 1SZNA 1JJKA 3PULA 4KWWA 3MBDA 1H50A 1GTHA 1X6UA 1OHLA 1A53A 3OA3A 3W1LA 4CNNA 1DQWA 3WJSA 3NQFA 1F73A 1K02A 3MWAA 4AHPA 3UZ5A 1K3UA 2FB3A 4Q4KA 1FWNA 5U7SA 4C1KA 2D73A 2CLKA 3S8HA 5A5WA 5SWUA 1NVMA 2HS8A 3SFKA 1PIIA 3TU9A 3HPXA 4OWGA 3LCFA 1B4EA 4JIQA 1NF7A 3TXZA 1CI1A 4PFMA 1C9DA 3DHDA 5AHNA 1XL9A 5IM51 3Q37A 3R8RA 3LDVA 2CLEA 3LTYA 1LOLA 2ZQ0A 4RLIA 2I14A 4NU7A 4NXSA 1I2NA 2JKAA 4RZ5A 3CLMA 3GNNA 3KAOA 2NWRA 2FFCA 4CNOA 3O1NA 1T99A 1EX5A 1F6KA 3EWUA 4LUIA 4IMDA 4MZ8A 1SW7A 1OVDA 2NV2A 4ZQNA 3M1ZA 4MJMA 5AHLA 1HL2A 2EHHA 2W0UA 1B4KA 2G96A 3GXNA 2ZZ3A 1JVNA 2OCZA 1SSGA 1GVSA 2VEPA 3A24A 3W7PA 2PCQA 4O11A 1J5TA 3GAYA 5CG7A 3C4UA 2AGKA 1VS1A 4MZYA 2Y7DA 4M6VA 1NFBA 1TJRA 1DJNA 2NUYA 3HB9A 6ALDA 4UTWA 1TV5A 1NAL1 3G0UA 4Z1CA 3DHFA 4IPIA 2YZRA 5G1TA 4JTIA 1SQ7A 1XDMA 1OX6A 1WX0A 4GUGA 3FYOA 3ZR4A 2H3DA 5I3IA 2QJIA 3M0ZA 5K2ZA 3FLUA 3MMTA 2A6NA 2WNQA 3BGJA 2R94A 1QOPA 4BK9A 2B0MA 2Z0IA 2ZA3A 3CHVA 3UYCA 3LRMA 4Z0SA 2XN2A 4I7UA 2DP3A 3OBKA 2QAFA 5BOOA 4S2CA 2C15A 1LOQA 3DFOA 3VKJA 4JTSA 3ANYA 2FQIA 4FB7A 3PC0A 3NQ6A 1ZY9A 2DZTA 5HR7A 3W1MA 2ISSA 1EPXA 1ICSA 4ADTA 5E0KA 1UASA 5AYXA 1DVJA 4DO4A 5CZJA 4MUZA 1VCFA 4PL1A 2JGQA 3ABSA 4FIQA 1T0OA 1ME8A 1W1ZA 2G97A 4LRTA 1TPEA 1E51A 4M7TA 5LNRA 1FDZA 2ATMA 3ABRA 2ZRZA 4CCCA 2J9ZA 1NSJA 2AQWA 3L21A 2Y63A 2YX0A 1KM2A 3KX6A 4DBDA 2NXIA 1A5AA 1W56A 2NWSA 1IXNA 3BO9A 4ICNA 3FS2A 1YTKA 1TSIA 2GVLA 4Q32A 4JTTA 5F4WA 8TIMA 3L66A 5G4EA 3B8DA 1VR6A 1AW1A 1KFEA 3N73A 4MJZA 2IQTA 1TPWA 4AMAA 4OHQA 2E6DA 5LNWA 3WK0A 5E1QA 1WV2A 1H1ZA 5BRBA 5FI8A 1M6JA 1HG3A 1S5WA 4LS0A 2B7OA 3R89A 1FCVA 4LS2A 3W84A 1X8FA 2E5DA 3D0CA 3E02A 4K6AA 3STCA 3W85A 3TX9A 3NQVA 1I45A 3HG3A 3M41A 1DORA 1TJPA 3VFLA 2WQPA 4ZZ9A 4HNVA 3LB0A 4TU1A 1KM3A 3NZRA 1GVQA 1FWSA 3EX3A 3MYPA 1GG1A 1FCQA 4RXFA 2JKPA 1EP2A 3KXQA 1YADA 2Z2UA 4QITA 1G4TA 3MP4A 2DJXA 1TB3A 3Q58A 5H91A 4NQ1A 2A5HA 5D2TA 4NZFA 3H54A 1OYAA 4R53A 4RV8A 1PHWA 1KM1A 1UUOA 2J88A 2RDUA 3NR0A 4KFOA 4HHPA 3R2GA 2QKFA 3PWAA 1T8XA 3OVPA 2VXNA 2HTMA 4BFAA 1SO5A 5HWMA 5I3JA 4JS3A 2VEMA 5EL1A 4S1FA 4BI5A 1OFEA 3O6DA 1KFCA 3Q2DA 1QPRA 3QZEA 4LTSA 4U4MA 2E5BA 3E96A 3OVRA 3S9YA 1V7YA 2ZA2A 3GYEA 3G0XA 3G1AA 3TKFA 2VFEA 3W6YA 3W9ZA 5FF0A 4MLRA 4UIOA 5DY3A 1YPFA 1KFKA 3JS3A 1ZJIA 3G1YA 2TRSA 4NJHA 2BSLA 4O1AA 3RF9A 4O16A 4N4PA 2DZXA 5DCDA 1TPVA 2C18A 3WK1A 4ADUA 1AL7A 5KITA 3CEPA 4IMEA 1H7PA 1JUEA 1XBXA 2WNNA 3UXDA 3I6RA 4OV9A 4IQLA 4LW7A 3TDFA 1SR9A 2CW6A 4LOCA 1EUAA 4UR8A 4JTLA 4JTKA 1SZFA 4N9BA 1ZFJA
chains in the Genus database with same CATH superfamily
1ESWA 4B9ZA 4JBRA 4E4UA 1CGYA 4O54A 4ES4A 2XVLA 4PBGA 1GOIA 4L56A 1WXYA 4O13A 2E7FA 1FCBA 4C91A 1IR1A 1CDGA 1PWLA 2C19A 3Q94A 2QV4A 2Y4SA 4AX7A 3ZT7A 2EO7A 2J24A 3CYVA 3SQSA 4KETA 3WG6A 1YTDA 5DMLA 3SURA 2GDUA 1HJWA 2XIOA 4KCTA 4JTRA 4H1ZA 3TYUA 2XM2A 4O1FA 4PMRA 5HMSA 4LVFA 4JTCA 4OFCA 1LP6A 3COTA 3TXVA 1RLDA 5BCAA 2JALA 1FP9A 3SADA 3G8EA 3POHA 2CLPA 3AMLA 2WXDM 4WUIA 3CZLA 4LF1A 3WQ6A 1ONWA 2I57A 5JIPA 2QHAA 1AMKA 1I9CB 2XM1A 3KCJA 4F66A 3MPGA 4G8TA 4CQBA 2JEPA 5IBXC 4C1LA 2VZVA 5F2GA 2W6RA 3SRHA 4CEXC 1GOOA 2WZTA 3R7MA 1GOXA 5A2BA 1F4HA 2D2OA 2GDVA 1VP5A 1QVBA 3L68A 1D8CA 3ZOAA 1H7WA 1QCWA 4RE2A 4PMUA 4RPPA 2QJHA 2ZUVA 3GXFA 3DG3A 1HTIA 3M0YA 5CSRA 1XUZA 2EPLX 2NUWA 5CGTA 1VJIA 4S3AA 2NLIA 1W54A 1UKTA 2OWCA 2FLIA 1XH2A 1YE4A 2TSYA 1OIMA 3LHWA 3W2NA 2IKJA 4ONVA 4W89A 1TCDA 3KE0A 5CGQA 3W7LA 4S3JA 4UCFA 4OU1A 4C6IA 3DI1A 1ZU8A 3KW3A 3VX1A 4FEZA 3EDEA 1KTBA 2IW0A 4ZVJA 3IACA 3TFXA 3N4EA 1WKFA 1LLZA 2YLAA 1A5KC 3G77A 3NQGA 1SFTA 3S4TA 1NQKA 2WPBA 2HXTA 2W9MA 1NJJA 3RN6A 5DCBA 3PBWA 2GUBA 1AL8A 4WDTA 3VGHA 5EA9A 5HMDA 1UH4A 4H19A 3UBPC 5DEZA 1PCKA 2POZA 3OLEA 5A94A 2CHRA 1Q4WA 2YB4A 1GJUA 2WO5A 1XF0A 2VGGA 1P6BA 1EWEA 1GYNA 3RX4A 1X96A 3GG7A 4GVGA 4X3ZA 2HNEA 1S2VA 2J7HA 3GY1A 3RDKA 1QASA 2JK2A 3TSBA 4C1NB 4HSHA 3SCTA 1JI1A 3LG3A 4AY8A 5D9OA 3ZYZA 3U5UA 4DF0A 3DGBA 3TN5A 1W31A 1OC7A 3URAA 1QHZA 4JR5A 3FVDA 4ZOEA 2DIJA 3A22A 1XUUA 3CEUA 1MW2A 3CUIA 3DN5A 5AYZA 4GUIA 1KLZA 1OB0A 1ZP3A 1QRQA 2PLMA 4XZBA 2QJNA 4PUNA 3GW3A 3PZIA 1Y5WA 1C7SA 3R4IA 4WHBA 2PTZA 1E0XA 1X1ZA 2V82A 2GSHA 1LWHA 3NL3A 3CAVA 4CGTA 4AU0A 4PMQA 1Q2SA 3FA5A 3T8LA 3A21A 2Z2BA 1R46A 4JTFA 3BZJA 3EGJA 1MZHA 3UCCA 1E1FA 3E74A 1F7BA 4OECA 1RJPA 1BEUA 4JYDA 2XTKA 2GGEA 5DXYA 3GNOA 3BLLA 4QFUA 3H12A 3GTFA 1GOQA 2ZRXA 4GY1A 1CTNA 2J77A 4AXKA 2D2JA 4CN6A 2YDAA 1B57A 2ZYFA 4UZSA 4KS0A 1YX1A 3G1FA 4CQAA 1QPKA 1W1PA 2V3DA 4GKTA 3F2BA 1BWVA 1E55A 1V5XA 4HB7A 4NX5A 3LPOA 4HNTA 2A3EA 4DWSB 1FHVA 3WLIA 4UXDA 3O07A 1B3WA 1AMYA 2FH6A 4W86A 2XFRA 2REQA 3KHDA 2XGIA 1BYBA 5EFDA 4PRWA 2VD9A 3R5EA 2OQLA 4KBXA 3UWZA 2PLCA 4HCDA 3W7EA 3HMCA 4H83A 3G22A 7ENLA 3V35A 3EPMA 4ZBCA 1HL9A 3LGEA 3V0TA 5CPOA 3BLPX 3O8AA 4OKDA 1Z48A 2VC9A 2CZ5A 4IIBA 2VCCA 4O14A 3SR7A 5U4NA 5AVHA 5I3FA 1RZMA 1HVQA 1C7TA 1JPHA 4NY2A 4X61A 3UY7A 4GCXA 3QFEA 2P0IA 1Z3NA 1OYBA 4H41A 4HCLA 1DKWA 1AQHA 3T09A 1RD5A 2VWSA 3TC7A 2EBNA 1KBKA 4AZ6A 1BQGA 3CK5A 1J0JA 3WLTA 2BMBA 3KHJA 4AWEA 3KM8A 2OQHA 3PUEA 2GUUA 3BC9A 4UTKA 1TPFA 3W7QA 1QWGA 3ZJ8A 3HOJA 4KEVA 4QDMA 4QAIA 2WZMA 1XLCA 3W2UA 4QG6A 3EWDA 4HA0A 3ZMRA 5JUVA 2NQJA 2J62A 3QW3A 3T9PA 1GQNA 2FTYA 4HYVA 2Y5EA 2VP8A 3QR0A 1OFBA 1G4SA 1UBPC 3NO5A 3WBXA 3U5YA 4JYFA 1E9IA 1WNOA 2VFFA 5HANA 1E3ZA 1NDVA 4LAOA 2YB1A 4E3VA 1BF2A 4IMCA 4XD6A 4HA3A 1W5MA 5EGRA 3CO8A 3FGCB 4H3DA 4OQVA 5G1MA 2AMGA 5FIPA 1I6NA 3I7RA 4L65A 4YTRA 2G4JA 3FXGA 3M6DA 2BXYA 3MY9A 1GW1A 1HKWA 3O6CA 1QNVA 1PKYA 2D20A 1G0CA 4PN2A 3VM7A 3NG3A 1XQKA 1K4HA 3DFQA 3GTXA 4FK9A 1A3HA 3APTA 3TP4A 5A6SA 1VLIA 2ZRYA 4DJEA 3THAA 2VGIA 1V0LA 4HMNA 5E70A 2Z25A 2E5CA 2DZWA 1IEVA 1TUFA 5BWAA 3LCLA 2GJXB 3H23A 3D46A 3LZ5A 3PUOA 4Y2WA 3H2MA 3LV5A 2BG5A 1OCQA 3M0MA 4Z2LA 3HIJA 4FF5A 4HVXA 3W6MA 4NZCA 4BWLA 1Q6EA 2CZEA 5A2CA 1REQA 4PODA 3EOOA 1BRLA 3BG5A 3U2ZA 3QGAC 4A2RA 2XSBA 4ZEPA 3A47A 3AO0A 3LMZA 4IGMA 4YS1A 1ISZA 5E6ZA 3VIMA 3BCFA 4FXJA 1OFQA 4QCEA 4DYKA 1SR0A 4M82A 1S1RA 3EX2A 1GWJA 1JNDA 4NNCA 1KV8A 1E4IA 1RH9A 2QCHA 1MRQA 2LLEA 1K9TA 5AECA 4DI9A 4YWIA 3W7MA 4Y8FA 3PZGA 3E2SA 1PX3A 5TAOA 3ARVA 3P93A 2HVOA 4A3YA 2BXVA 1LG2A 3OQ8A 4F0RA 1W1B1 3OYXA 3O06A 1B54A 3P67A 5IXEA 4PTMA 3D47A 1UUMA 2FTPA 1E4NA 3VOJA 4ZQCA 5BWFA 3RJXA 3ARWA 3TJXA 5I6SA 1DJXA 3CWOX 2YBTA 4S3FA 1H51A 2OSYA 3WJYA 3EOLA 1P7TA 3LLDA 2BVTA 4CNSA 3AMGA 4L1WA 4PYSA 4JL1A 3C3UA 6CGTA 1X1OA 4GQ0A 2PE4A 1UR2A 3T40A 2CXGA 1ZBWA 4PUWA 3RM4A 1CGWA 3F4WA 3LXCA 2CKRA 1XRTA 1CXHA 5D2XA 2NX3A 2WJDA 2WSPA 1GPWA 4UMCA 2VFHA 2Z26A 2GQ9A 4M0XA 1GYMA 3G1SA 1QPOA 3QSRA 3PK7A 4A3RA 2PUZA 7REQB 3SCQA 3G8RA 3LLFA 4GX8A 3AIWA 4IIGA 4CQ8A 2NX1A 3FCPA 3VCRA 3FJLA 2GJRA 1XYCA 1V8EA 4G1KA 2VEIA 3WDPP 2IPWA 4FNRA 2FZDA 2XH2A 2J75A 2W4XA 2AL1A 5B7YA 1V93A 3CMJA 5CPTA 1HQTA 3TNBA 4BQ5A 1NWUA 1D9EA 4HD5A 1XDJA 3SW6A 1YLVA 4O1BA 1TUXA 3UG3A 3IGUA 1L2QA 4OE7A 3W7RA 1PYMA 3HPZA 3A4XA 5J5RA 5DMNA 2WOQA 2DH3A 3DC8A 1F74A 3P74A 3W73A 2E6AA 2DZVA 3S2NA 5HOSA 1M68A 3TYDA 4AHQA 1ME9A 4QROA 3V3WA 2PFHA 2P10A 4JNMA 3NXFA 3B0YA 2I5QA 1CGTA 3VOCA 3O0KA 4U28A 4K3ZA 1XR2A 2B7QA 3P84A 3GSMA 1FBAA 2DZAA 3O15A 4DO6A 1QK0A 4YLWA 4DELA 3NSMA 4KEMA 3AIRA 4LC8A 3OW1A 1B3OA 1KRCC 1V0MA 4NJKA 4A3QA 3VNZA 3EWXA 1E5JA 1QPQA 2J4GA 1IV8A 2X0HA 1CGXA 3CB3A 4NJJA 4GIYA 2QXWA 1EP3A 1IXQA 1Q7ZA 1J2WA 2YXOA 2QDDA 2ZE0A 4AY7A 4ZMGA 3GVQA 1MUCA 4MFDA 4E2VA 2GLKA 3ABXA 1F9CA 3KP1A 1HUVA 2V69A 2H8XA 1E9ZB 4L6HA 2HXUA 2BDQA 4QE4A 5GNZA 1J18A 1QAPA 3CU2A 4E6MA 2Q8LA 4M19A 1FH7A 4JKKA 4UQEA 2J8GA 1R7AA 3AS0A 3TJ4A 3R8GA 5LGZA 5D03A 3W7OA 2PGFA 3ZLGA 1O95A 3I65A 3IJQA 5FJOA 4WSHA 5M3WA 1XSKA 3NDOA 3QM3A 2I56A 5AOUA 2E1WA 4M29A 1DXFA 1CX9A 3L2MA 4HT3A 1TPUA 1EB3A 3GR4A 2Q3OA 3HM7A 4M8UA 5AC4A 3L65A 3LS9A 4CLMA 3T08A 2FZMA 3FEMA 1Q65A 4IFKB 4JIEA 1YTEA 4BA0A 3A5FA 3BUVA 5LIKX 2YCEA 2X1IA 4J3VA 2ISVA 3AAMA 2UWFA 5E5CA 4AFYA 1VLWA 1LT8A 3I7SA 4LVDA 3GXIA 3VZZA 1ITUA 4LY4A 3PSVA 3VIKA 3QR3A 3DFTA 4XAPA 4I9JA 1TPC1 4BI6A 2EPOA 3IV8A 4CCZA 3P6LA 4XD4A 3AXIA 4PSRA 3V0SA 3LHTA 5EMLA 1BD0A 4OOUA 3NPVA 2ACSA 3LSBA 4U31A 4JIPA 1I0DA 3N14A 4Z2KA 2CLHA 6REQB 2OZ0A 2YCLA 1L8PA 2HE8A 3UWYA 4LT9A 2QYGA 3MO7A 3PBUA 2OEMA 4UTMA 3DKLA 5L9FA 3CPRA 3UCQA 1H11A 2CLMA 4GXPA 1UR3M 4FLSA 3W7IA 4US5A 3FDKA 2GGGA 3RU8X 1J79A 3BJSA 1GOMA 2P76A 3TH6A 1XCXA 5JIWA 4PMOA 1XH0A 3U6WA 5HJXA 4LGXA 1WAWA 3L4YA 4Q8TA 3K46A 1EPVA 2FH8A 3A23A 4P7NA 1QW9A 1TTIA 3C0JA 3AIUA 4HYWA 1I1WA 2PDYA 1GEQA 2WHJA 1H0GA 3FJ4A 3UYIA 4P61A 2QCFA 2WHLA 4OT7A 2FHBA 4N6EA 4E0CA 5DLCA 2PDXA 3BLIA 4BF5A 4DWSD 1NDYA 1VEPA 1MW1A 4JTGA 1V6XA 4M5PA 1NOFA 4Y9OA 3FN9A 1OX4B 1YNPA 1Q85A 1U33A 1TREA 2FGBA 1PKNA 3WCZA 1Q6QA 3E2QA 3QC3A 3HJEA 1MDRA 2INFA 3NWRA 1EJRC 3SN4A 2WNZA 1TQXA 1SJBA 2FJKA 1JF5A 3R11A 3C61A 3PTDA 4O17A 3W7GA 4QRNA 1JQVA 4WJ8A 3NQMA 3ES7A 4IOTA 3PF3A 1EBHA 1WBHA 4ZCWA 1WKDA 5CZKA 1KCXA 4QCFA 4ALDA 2ACRA 3UEQA 4EE9A 1AJ0A 1UZDA 4O4WA 2QDEA 4O1DA 3GR8A 1I2OA 4OTKA 3TQKA 1OK6A 1M01A 1CB2A 3RR1A 4BS0A 4WDUA 5I23A 4KFPA 4C6LA 4AHOA 5KINA 4I90A 1I2PA 4FNSA 2QUMA 1CPUA 3PWIA 3ZJ6A 4CD7A 1W1IE 2V9DA 4R7JA 4N42A 2G95A 4GYPA 4ROPA 3LQLA 3TQ0A 1XI3A 1W91A 2TPSA 4IFRA 3RNDA 1OX5A 1HGYA 1EWDA 3E0FA 1PZ3A 5HBFA 5K9CA 1IT0A 3I68A 5F1VA 2Z1XA 1O5KA 5B80A 4AZBA 2HBXA 3ITTA 1X7IA 3OGVA 3VI2A 2FPYA 4Q4OA 1A5LC 3M43A 6A3HA 2YW4A 2A3HA 4U10A 1R30A 1IIHA 4DQWA 4XG1A 2BOFX 3PNUA 4ENLA 1WOBA 2G8ZA 3AI0A 4QHRA 2OX4A 2PRHA 2WBGA 3W38A 3C0SA 1SO6A 1XLIA 3TAKA 3N13A 3LCHA 1YXDA 4MWAB 4HSOA 3JZUA 3GIPA 2YA0A 3VNDA 1H0IA 1BYAA 1JYNA 4KWSA 1Q4NX 4QLLA 3UJ2A 1FA2A 1R85A 5DRCA 3NUKA 1IE7C 1XIFA 4JFVA 3K4DA 4GC3A 4HPXA 4RXGA 3N15A 4IQDA 2BTMA 4NASA 1BG9A 1Q66A 5BMXA 3LGGA 4CN1A 3PJXA 4AH7A 4JQ2A 1UR4A 3W1TA 4F0SA 3U8GA 3T0BA 4N6FA 4F9DA 2J6XA 4Q8MA 1W1A1 4UMAA 4W93A 2E4TA 2DZUA 1H41A 4H2HA 2BZNA 4GY7A 4KCWA 2ZUWA 3WJWA 3ZQ9A 1PJ9A 1RQBA 1S2WA 2VGFA 3HURA 4RNFA 1KGUA 1T6MA 4DM1A 1OCNA 4U5IA 1P4CA 4CU6A 4Z1AA 5G5IA 4YWSA 4LSBA 3C8FA 4WDWA 1LRQA 4QJ5B 3P14A 1TV2A 2FPVA 2PZNA 3BOFA 1XWYA 3S5YA 3WF1A 5DT7A 2ZX9A 5GNYA 2V5LA 3IJ9A 4M51A 1P0NA 3W88A 4IQEA 4H7VA 5KZDA 1LJYA 2VFIA 3MA8A 4NT0A 4J5NA 4J9JA 1IR2A 4KPLA 3IIXA 3POCA 3RU6A 3A3WA 4GYFA 1ZJBA 3QGVA 2WSYA 4WOQA 2VDGA 5KTLA 2DUZA 3GVGA 1O1ZA 4HN8A 2Z6JA 1TWSA 2DIKA 2FVKA 1UWQA 4IX2A 4GIRA 3S9ZA 3FIGA 4DF2A 3E5BA 1FHUA 4QDWA 4MYXA 1QK2A 3DKJA 4S2BA 1QU4A 2BNJA 4MB3A 1QI3A 2HPIA 3TROA 4LQ1A 3DFHA 2HPMA 2GJPA 3WKZA 1UD8A 3TNOA 1I4NA 1JCTA 4J4KA 3O05A 4PFHA 2ZICA 1OEPA 1TG7A 4HZ6A 1WQ5A 3IEBA 4Z2JA 2WCAA 1W8GA 3ICJA 4EVZA 4TX6A 3OGSA 4Q4QA 1NOUA 3PZVA 4MF4A 1XSIA 2BLEA 1B3ZA 1LUCB 4UFIA 1CXFA 4H2CA 3LXBA 4GABA 4PTWA 3WNLA 1PUDA 3R10A 4GNVA 3VC5A 4CD6A 1E0VA 1FX6A 1ZHAA 3GXTA 2YFNA 4R34A 1HGWA 5AKQA 2XU2A 3PS7A 3WBEA 4HOZA 4KWOA 3UR8A 1J9YA 1TMQA 3H6OA 4OVXA 3R13A 3WO8A 4LCSA 3EEZA 3IJ6A 3B9OA 1M53A 1FQ0A 3BLFA 4AC1X 4JX5A 1X38A 1H1YA 4EPBC 1RA5A 1F4AA 3DFNA 4ZA0A 5BRPA 2FHFA 1DWAM 1UP0A 1VYSX 4J3SA 4MSSA 3FKKA 3QHOA 2VDHA 4D6EA 1GOWA 4P7RA 3N2OA 1GQJA 1Q3NA 2ZX6A 2O9RA 1E5NA 3MJYA 4NX0A 4F48A 3E3HA 3F7JA 4YVVA 2ZRWA 2G3NA 1TA3B 3SUSA 1EGZA 3NVDA 3QV6A 1J4EA 2PC8A 4REQB 3ZT5A 4DJFD 5BROA 1H62A 4O0ZA 4GI4A 3KBSA 3WD3A 5DF0A 5I77A 1P0EA 3TSMA 3CBWA 1QOQA 1G4PA 1XRSA 1RQHA 5BXTA 3H7RA 1TYGA 5LSMA 1KQYA 3MBDA 1PAMA 1GTHA 1GJWA 2FTWA 3KTCA 1ENUA 4WEVX 4B5SA 1IGWA 2CBVA 1K02A 3VKKA 2D73A 3BE7A 4C7FA 2HS8A 1M04A 3TU9A 4A05A 3J7HA 2CZVA 4HMDA 2PP1A 1B4EA 2YA1A 1UOZA 3DHDA 4I5XA 3APYA 3MUIA 3G2GA 2GSJA 4DB7A 1AA1B 3R8RA 4FOUA 2Q09A 2CLEA 4HK7A 3LTYA 1LOLA 2ZQ0A 7XIMA 3WDJA 3RM9A 3TYCA 4GH1A 3WNKA 4LALA 2PDHA 3TN4A 3VD9A 5I00A 2FFCA 4CNOA 1HJQA 1OC6A 1VIWA 3F2CA 3EWUA 4LUIA 3UZZA 3GNPA 1KR1A 2NV2A 3NQBA 1M1BA 1EZWA 2XG9A 1B4KA 3GXNA 4F79A 1SSGA 1OD0A 3BOXA 4GA8A 3AS3A 3A24A 2BODX 3WNOA 3N04A 1J5TA 3GAYA 2JF7A 3PPGA 3KOZA 2AGKA 3MTWA 4GZ7A 1K77A 3KOYA 2Y7DA 1W32A 2EXOA 3WENA 3QY7A 4G9PA 3OP2A 4GD0A 3LN3A 3VKAA 1DJNA 1SJDA 3WDQA 2YCJA 4UTWA 1NAL1 5CBBA 5E9XA 4DUWA 1WDDA 1XDMA 1WX0A 4GUGA 4TX8A 2YCKX 5I3IA 5EFFA 4HU0A 8CGTA 3AMDA 3QPEA 1LQ0A 1PBGA 3BGJA 1HXJA 1QOPA 4BK9A 2B0MA 2D24A 2ZA3A 1FTXA 1UC5A 5DFAA 4W7VA 5LXXA 4FOJA 2DP3A 3LLXA 1WZKA 3GS6A 3G6MA 3AHTA 3U4FA 5A6TC 3WQEA 4PMXA 3VKJA 4JTSA 2J79A 2WCSA 5CAHA 3WX7A 3ANYA 1M65A 3VNLA 4TQTA 4FB7A 3H4GA 5FA5A 2ICSA 1TV3A 2VZTA 1J96A 3W1MA 4D6FA 2E9MA 1XLDA 3M07A 1ICSA 3A4AA 2VDIA 5JU6A 5C7VA 1UASA 4ATWA 2G50A 5CZJA 4MUZA 2PDBA 2ZVRA 3UXIA 3ABSA 1Z9AA 4FIQA 1EA9C 4JKMA 1ME8A 1W1ZA 3K8KA 5FACA 1A3XA 4MAVA 1E6XM 4ROQA 2Y5JA 1VFSA 1S2AA 2ATMA 2OLAA 4CCCA 4DY1A 2Y63A 1FKWA 2YX0A 1KM2A 1A5AA 1W56A 2NWSA 2ACQA 5GJMA 4TVCA 2P8CA 1TSIA 1ODUA 4Q32A 5LA2A 8TIMA 4PRRA 5G4EA 3AFBA 1PZ0A 3N73A 1EIBA 1TPWA 4AMAA 2E6DA 1J0IA 3BAIA 1A0CA 2V67A 2J25A 2J78A 4F9JA 1FCVA 2YBVA 3CV2A 4ZOBA 3CH0A 5MKGA 3D0CA 3E02A 4AXNA 3STCA 3W85A 3TX9A 1KGWA 1F3XA 1JD9A 4ZZ9A 1TJPA 4WVXA 2W67A 3LB0A 3ME3A 1P0BA 3GBDA 2GWGA 4EK7A 1GVQA 3CQIA 1FWSA 3EX3A 2A79A 3N18A 1FCQA 3IARA 3AMCA 3CUHA 4GQBA 2UY2A 3KXQA 1D7KA 1H1NA 1YADA 2DJXA 1JF6A 4JTAA 5H91A 5D2TA 4RV8A 1UUOA 3QN3A 1XGDA 1W3JA 1EYWA 4HYRA 4A6GA 1T8XA 3OVPA 2VXNA 1WE5A 4BFAA 2P3ZA 5I3JA 2VZUA 4JS3A 1JDDA 3VYLA 4NI3A 1OFEA 5AZ1A 3Q2DA 2YJQA 3FSTA 3S9IA 1UROA 3E96A 3UJEA 2DSKA 3OVRA 1V7YA 4AD2A 3G0XA 3VNJA 2VOTA 1JGIA 3IRSA 3EPNA 2J13A 3BLKA 1ZJIA 1W9UA 3A4JA 3PHAA 3I3DA 3KOWA 2R1MA 3GFXA 3CNYA 4O16A 2C1GA 3GZAA 1H7PA 4DXKA 4MWAD 5LIWX 4MNLA 1PZ2A 2GVEA 4IQLA 4JN7A 3VGGA 1VPYA 1SR9A 2C79A 1EUAA 4N9BA 1ZFJA 3DERA 3E38A 3PG9A 1XD0A 2C14A 3ATYA 1TJ2A 3VIFA 3L4WA 2ZE3A 2WMJA 3ARPA 1YNYA 5D09A 1O68A 3AHYA 2PI6A 4B3LA 2HWGA 1T8QA 1EJSC 1PV8A 2UV8G 4R5EA 2PB1A 2VD8A 4Z1DA 5A2AA 3W6LA 1SO4A 3DZ1A 3EWBX 1ICPA 3TE9A 4FA3A 4GO9A 2D2HA 4C6PA 4LY8A 4YVXA 5AY7A 6ENLA 3TA6A 1LLWA 3VABA 5D9MA 3KCLA 3W87A 1RP8A 5CQ1A 4IPLA 4KRUA 1UKQA 5TNVA 3A4WA 2VZOA 2DVTA 1ZQ5A 3K5XA 2VR2A 4HNUA 2HVNA 3GBEA 3MV11 4LYRA 3ALFA 4LX4A 4NNAA 1BTMA 4GO8A 3V0UA 4DJEC 1X6LA 4LAUA 3LTPA 1JUKA 1V6WA 3ZSSA 2X40A 3WF2A 3JR2A 1G7UA 1L6YA 1RBLA 4IHCA 3PPHA 3QRHA 2B7NA 3Q65A 5E93A 3ZWSA 2Q6ZA 5FF2A 3GE7A 1Q5MA 4UCGA 4QLJA 4QIUA 1IZCA 4Q22A 4UR9A 3UW6A 4Q4RA 4JN6A 3QPZA 3AIVA 4BWLC 5EB8A 3QZ6A 2IMRA 1OFOA 1KRAC 4FLOA 4K1GA 4I8DA 1EIXA 2BASA 1O6IA 1J6OA 1MWOA 2WMGA 3N19B 4I6VA 5HWNA 3GUGA 3HTWA 3NYDA 1NH6A 2ZXAA 4QSHA 1JZ2A 3WQVA 4IP7A 2V5KA 4C60A 2X8RA 1KTNA 1MDLA 2ZVIA 3T2OA 1UZ4A 2PURA 3SB0A 3UGVA 3ITOA 3VK5A 1TR9A 4YU1A 4LAZA 1WPCA 3WQWA 2OSWA 3B9NA 2PAJA 1DE5A 3EKZA 4LB4A 4MLJA 4UR7A 3A3HA 2VEKA 3G5EA 3SDOA 3GB6A 1T41A 3VTRA 1MXGA 2UY3A 4ERAA 5K4ZA 3QOKA 4C1NA 3TWBA 3ITCA 4DHGA 5F4SA 3RPDA 3GFZA 5TQLA 2QMJA 3OA5A 3FV9A 3MJMA 3WF4A 4E3TA 1HO4A 2IKGA 4W8BA 3O0FA 4M6QA 4K37A 1YE6A 1WDSA 3ZVIA 3C2RA 1PIFA 2J8FA 1VCVA 2VX7A 2DV0A 3AS2A 3TOYA 4JTDA 4FNQA 5AYBA 3O6YX 3FA4A 3QC0A 3GDTA 3ABQA 1Q6GA 3AZSA 1JYVA 2PTDA 3OB8A 2G37A 3G3DA 1QNQA 1TV8A 5HUOA 3MHFA 1JDFA 4GIEA 4BQ3A 4PTVA 2GJLA 3M5ZA 3IK2A 2PWHA 2C8NA 1XIJA 5JXQA 1HKKA 4A22A 3UG8A 3SCNA 5AN7A 1VHNA 3REQB 2XZ9A 1FUYA 3OQEA 5CJNA 3W7NA 2Y7FA 3CL8A 1GJPA 3R0UA 3CQHA 1JQXA 1LRTA 4MIMA 3R8HA 3FW6A 1VHCA 4HKPA 3TW7A 4C6EA 4PCNA 4B5NA 3VOHA 1JCNA 2DSWA 2ONEA 2V0TA 3WUEA 2RUSA 1OF6A 2ZCGA 4B91A 2A4AA 3T0AA 1J2BA 5DX7A 4DLMA 4I6KA 1Z41A 4JIIX 2ZZ1A 4LUSB 3WF0A 5CC6A 1KFLA 4GVFA 1E9LA 2D0FA 5BOFA 4J2MA 5CC7A 4DWSA 4J3ZA 1Z7AA 3GHRA 2HE5A 2WC3A 1M5WA 4CD5A 1JZ4A 1RVKA 3SCPA 3IUDA 3FFSA 1PKLA 1G1YA 4O57A 4LF2A 4NG3A 5EYWA 3RMJA 3GZ3A 2RGLA 1V51A 1Y7VA 1FDYA 1GHSA 3OG2A 4W88A 3SUTA 3T4CA 2CC0A 2UY5A 4HHMA 4S3BA 4XD3A 2YYUA 3LERA 5CLWA 3MVIA 3HGOA 4U5KA 3KLKA 4GI6A 3OZPA 4P8UA 1RR2A 4GE8A 5HNUA 1UH3A 3KBNA 1Z44A 4WKAA 3NEVA 2WVUA 1S3TC 7A3HA 1C9WA 2Y70A 3ZJ7A 1HFBA 3UCDA 1ONRA 3S2MA 3TLQA 4ZTYA 4CCEA 2QAPA 3T05A 1PE1A 4AEFA 1H7OA 1C3FA 3BSMA 1OD8A 4C6QA 5D8ZA 4MTVA 2ISDA 1PKMA 4D71A 2YLLA 4D6JA 2FZ9A 4AZCB 2XSXA 3E1F1 1XYZA 2XYLA 3PBVA 4A21A 3CZ8A 4DWDA 5CXPA 1K8CA 1CLKA 2ZKMX 9XIMA 3CH9A 3TYBA 3K8LA 1XS2A 4S3EA 4WSKA 4K1WA 3ZR5A 2ISWA 3GTHA 3U57A 3ERPA 3RCNA 3GM8A 3F4DA 4Z08A 4N9EA 3DXIA 4W5UA 2XFFA 1POJA 1FXQA 4YIWA 3JZEA 3OHMB 4HN4A 4GISA 4XAZA 3U0HA 1XHGA 1WUFA 4AWSA 3TIMA 4J27A 2VQUA 3RG6A 3H21A 3CMFA 3S2CA 1U1UA 2G4FA 4MAZA 3W1PA 3HMJG 1GQLA 4TXEA 3FGCA 4NZ3A 1NQ6A 4FLRA 3DG6A 1RALA 1DP0A 2UY4A 1GZ1A 4IIHA 6TIMA 3SY1A 3O3RA 1M7XA 4H6QA 4UFLA 1XLJA 5FJPA 1K1DA 1V08A 3VMPA 2ATSA 3FEQA 4JHMA 1YEYA 3SI9A 4GG9A 1S2TA 2W5FA 2VCAA 4R27A 2Z24A 3AMKA 3HN3A 3SUWA 5D9NA 4BEQA 3SBFA 4ZL1A 3R94A 3L4XA 4B92A 1KD0A 5AC7A 1RSCA 2ZZ2A 4ACYA 3CIVA 3M0VA 2GJXA 3G1HA 4YPJA 1UG6A 4FXRA 3WQ4A 3IGHX 3WQ5A 4KESA 3B05A 3E6EA 3RFAA 3TTSA 3SGUA 1SW3A 1FWBC 1HKJA 4GJ1A 5HMFA 1AW5A 2FGLA 1CGVA 3RM8A 3D3AA 5EBAA 4HJWA 5PTDA 4Z1YA 2PU1A 1B1YA 1C8YA 1XLEA 2Y88A 1V3IA 1XIMA 4HK5A 4QR6A 1W5NA 4HTBA 2VR4A 1ZNNA 9XIAA 2E28A 3AWNA 4G7FA 3NL2A 4D6HA 4CVWA 2DZPA 1OWQA 3E0IA 3RAOA 2NQLA 1FP8A 3ARXA 1QO5A 1R3SA 2ZRVA 1UYQA 3FX4A 1JPKA 1OG0A 2ZA1A 3DBNA 1TIWA 3SCWA 2ZZ7A 4TVDA 3VX0A 1IEIA 4H01A 3N9KA 3QH2A 1O7AA 4AD1A 2A3CA 4KMQA 4UTLA 2ABBA 3R6IA 4P7QA 1M7OA 4UFMA 1NFPA 4LEQA 1A4LA 2SFPA 1JXJA 2Z29A 4WD0A 7REQA 1JDEA 4XUGA 2NQ9A 1JULA 4JTUA 2V3GA 1WAUA 1BWKA 1WOAA 4DO5A 1KTCA 4XTIA 1LQ2A 1KXTA 2FKPA 3NM1A 3BAWA 2Z27A 1K8YA 4MZ1A 2IXVA 3BW3A 2JKEA 4JNYA 5CBJA 2Q71A 3H22A 4FALA 3PAJA 3NZQA 4ECLA 1X7FA 3OLDA 3MDUA 5A6AA 1Q6LA 4RUBA 5T9CE 1HNYA 5AHMA 4NZJA 1IZKA 3QLDA 2PS2A 3CT2A 1V02E 4JTEA 1FWTA 1Z8AA 1P6CA 3UG4A 3MUZ1 1NF0A 1L6SA 1TE6A 4CQCA 3CT7A 1TV7A 3WL0A 3MI6A 3WYZA 5ABEA 1PSCA 5A1AA 2HQAA 2PGRA 1YRRA 1AG1O 2J66A 4R7WA 2EKCA 4EF8A 1KWGA 3T42A 2G3JA 3VDCA 1UKOA 2ZIDA 4LYKA 1UD3A 1UOKA 1R9XA 4AYGA 1W17A 3S1XA 2TMDA 5BZAA 2V8ZA 4Z17A 3UFYA 1HVXA 4EACA 1UQZA 3G24A 3BW2A 2H3BA 4QJ3B 1GKRA 5ECVA 4MDPA 4AX6A 5HQLA 3HJZA 4H00A 1LQAA 4DJFA 2J6VA 2WSKA 4MNMA 1HZYA 2OLHA 1BXNA 1PZ1A 4MPQA 4DPPA 1V02A 3VIJA 5HWJA 4E2BA 3W7KA 2BY0A 3RLUA 3CIXA 3MANA 3TTOA 2VJXA 2F6XA 4GZIA 3T6CA 4WJEA 4U2YA 1W9XA 4MFEA 3KZSA 2NT1A 2R1PA 4EPEC 2ZZ6A 5A8QA 4MY1A 3HO8A 2YDQA 3VMNA 1MQRA 3NSNA 5DELA 3W1UA 4WQ6A 3PVFA 3V5CA 1KFWA 4UFJA 4M7SA 3EMCA 4AAJA 4OUEA 1BPLB 1GCYA 3LI0A 3BCDA 4BZYA 3MI2A 1VFHA 1XC6A 4S3GA 1Y0EA 4LUJA 1OK4A 3WQ8A 3FOKA 3DESA 4PBEA 4OBSA 4RDYA 4WDXA 2J7CA 3AJXA 4WY0F 1DBTA 3IJ7A 1K6WA 1H61A 2CITA 1HIZA 5AFDA 1W37A 1QNRA 2V6AA 1OCJA 3RUBL 3H24A 3IIOA 4KEZA 3NAVA 1XG4A 3N2BA 3TK7A 4H8HA 1XLHA 4JAWA 3VD7A 1QFEA 3IGXA 1EXPA 3GH5A 1TX0A 4E4PA 3OVQA 2YW3A 3IJDA 5M2FX 2WWCA 2A6LA 2QMKA 3A9IA 4L5ZA 1CXIA 1JR1A 6REQA 4ZE4A 3TUUA 1RAKA 1PXGA 3W74A 2IPFA 3NOEA 1GNXA 3L2IA 3B9AA 4V2XA 4ZODA 2KZHA 2Z00A 1V4YA 1VD6A 3K30A 3AWOA 4XK2A 1XCFA 4ZGYA 2NQZA 1BVNP 4Q7BA 3TYEA 2V30A 2J74A 4PRTA 3HFYA 4O53A 1O66A 2MNRA 3CUGA 2VCBA 3PB2A 1SSDA 2PDJA 2XHYA 5I3GA 2OWXA 4CU8A 4JYEA 3VIOA 5CPQA 1C8VA 1H4PA 2ZZ5A 1NOWA 3U4AA 2NUXA 3GNRA 2F7FA 3H70A 1XLAA 2JEQA 3WLLA 3MHGA 5J5DA 1EHAA 3N1AA 4BCEA 3WL1A 3L4VA 1OZMA 2VX4A 3ES8A 3FA3A 1T5AA 4EXBA 2GFTA 3BDKA 3BLEA 3NXLA 4LPCA 3SY5A 3S5SA 5D30A 1FWEC 2WSQA 1F76A 5TD4A 4CD8A 1CB7B 3AZTA 1DJGA 2G3MA 3KOXA 3F4NA 8XIAA 1OX4A 2QIIA 3IVTA 1D3GA 2QPXA 1NP0A 2D2GA 4XB3A 4NZ1A 4B5XA 3EEGA 4MHBA 4QE5A 4F4RA 5KEZA 1KXQA 1QATA 4XUYA 3UGRA 3O16A 1B5TA 1Q6RA 3DENA 3M47A 1XLMA 1ZAIA 4L6OA 3AALA 4IMGA 4R88A 1JYWA 3GVVA 3OBEA 1Z69A 5AZ0A 5A8GA 3CYJA 4NUWA 1MEHA 3DEQA 3LCIA 3TQPA 3B0PA 3W75A 1AD1A 2NVCA 2AKMA 3OODA 3DFYA 2Q8XA 3C2FA 5KZMA 1UZHA 4MWAE 5CPSA 2OFJA 2VHLA 4YTTA 3CUFA 1E6RA 1SPQA 1CECA 1E4LA 3LCXA 2DT0A 2J9XA 4DBSA 5JBEA 2WMFA 2YPIA 3M0KA 3LGDA 1K9FA 2CFFA 2Z1WA 1PL9A 1DYSA 2CIPA 2I17A 2BY2A 1BKSA 4YMZA 4POCA 3RLHA 3KUMA 4PTNA 4ZSUA 5A8OA 1UUQA 3CAWA 4GX9A 4AMCA 3W53A 3VNYA 5E9AA 2QCDB 4ZO8A 1L8NA 4TV6A 5D05A 3RMEA 1P43A 2HEJA 2OLSA 3EA3A 3MZ2A 2NV9A 4O10A 2NXHA 4WRHA 3KL5A 1A49A 3WK3A 4F8XA 4O8AA 3NZPA 4IISA 3L67A 4RJEA 4Q33A 3P7YA 1AODA 3RCYA 4UTWC 1EUNA 3WD4A 2EQDA 4MWAA 3VPLA 4RE3A 2R8WA 3R25A 3WELA 4D8LA 1UJPA 2Q02A 3H26A 4WOZA 3A12A 2W62A 4WLCA 3DCPA 1MXSA 5DMMA 3T0CA 5BNKA 2V38A 5K9XA 4W85A 1BHGA 3WJZA 1ZCOA 3NQ7A 1EC8A 4YL2A 4WKFA 1OINA 1DWHM 1IGSA 1W8SA 3AICA 4ZE5A 4C6DA 2E8YA 1KNWA 1S38A 3TVAA 1MEWA 2UZ9A 5CJMA 3MVTA 2WSRA 1VGAA 5TBOA 3SIZA 6TAAA 1KXHA 1UWTA 4U3CA 2A2IA 1UC4A 2A3LA 3GK0A 1VBHA 1KFBA 2XZ7A 2EF9A 1HL8A 5I79A 4TR9A 3OLIA 5LNUA 1W1VA 3NM3A 3S46A 1UB3A 2B4GA 3O2LA 1T7LA 3GLCA 3FVMA 1JZ3A 4S39A 3MBFA 3CC1A 4HU8A 2WKGA 3CM4A 2AOSA 3QZAA 1DIOA 2CETA 1B0IA 4DX3A 5H1WA 4HMCA 3P2VA 1Q6CA 1RK6A 1AZ1A 2GK1B 2WWDA 2G41A 2WM0A 4PL2A 5HNNA 3W23A 3IANA 1R2SA 1T40A 1N8IA 1DOSA 3GC4A 2J47A 4A8RA 4J7RA 3LUTA 2DDXA 5FEXA 3W07A 1VEOA 1XXXA 4U2ZA 2YOCA 3BAYA 1FWFC 3S1VA 2R1NA 5C70A 1ISWA 5D37A 3EWZA 4NIRA 3VGBA 3F5LA 2Z1SA 1EDQA 2CWNA 2HBVA 1XINA 1WDWA 2Y0FA 5EY5A 1BAGA 1XYBA 1JCYA 4XO6A 2CNCA 1DWFM 3IVSA 3BQ6A 4P5UA 2VX5A 3WNMA 3QYSA 1BG4A 2PDCA 1YNQA 2H8ZA 3EB2A 2PWUA 1LTDA 4PR4A 2W27A 4K8GA 5AB3A 4JFSA 3NQDA 1GVOA 4JTJA 5TIMA 1BXCA 3PTMA 2C16A 5DY2A 1E0WA 3B8UA 4QTGA 4X0NA 3M46A 4Y9PA 2NV1A 3O63A 5M5DA 2CLFA 3WQGA 4IG2B 1LUCA 2GYIA 1R9YA 1YDYA 3FAXA 4AVOA 1G5AA 3G1VA 4EPDC 4MOZA 3C0LA 4XQ6A 3G1DA 2I1OA 1X97A 1KA9F 1DJHA 3VNKA 4LEFA 4JEJA 1AD4A 2H6RA 3VCCA 1J12A 2BXZA 3W82A 3CL6A 1LLOA 4XAYA 2GVGA 3EYPA 1WDPA 2X16A 1TELA 3N4FA 4QSFA 4PE8A 1EJWC 4O52A 1DIDA 1VKFA 4RE4A 3TW6A 1ADOA 3DGRA 4J40A 7CGTA 1L6GA 1JNEA 3C2VA 4S3CA 4WXZA 2HJPA 1QDSA 3R1ZA 1V3HA 3FYYA 3KRBA 3T81A 4KWUA 4WGXA 1CXKA 5A95A 2YYTA 3W70A 2Z7GA 1RQEA 3LM3A 8A3HA 4QG8A 5CZ0A 1IT8A 3UXAA 1VH7A 1X6NA 4LUTB 2C91A 3I10A 1GOKA 4JIRA 2NSOA 1TWWA 1UWRA 1XQLA 2BY1A 3S1WA 2YDSA 3QEZA 5G1YA 5C0QA 1DJYA 2E77A 1TA3A 3AXXA 1E0UA 4AEOA 5KZEA 4DN1A 7ODCA 2VVNA 3OTRA 1NARA 4QQ3A 3U2EA 3NQEA 3CV6A 4REQA 3W2KA 2PD5A 1TCMA 4PZVA 2VNCA 5LNSA 3KVMA 1PDZA 4ILSA 3UA4A 4JZ5A 5T9BG 3BGGA 4LC6A 4QJ1A 1PTAA 1K03A 3E49A 3V75A 1JDAA 3GDKA 1QNOA 4GXWA 1W3LA 5FAJA 1ML1A 4PC8A 4LXFA 3WEZA 2P0OA 3VA8A 4GMEA 2OKOA 5HUPA 1GHRA 1QO2A 3NYZA 1RVGA 4LWWA 3FKRA 3MUXA 4BJHA 1F05A 1BGAA 3U7VA 1I2QA 1EKOA 1A5NC 3HZ3A 4CNNA 1DQWA 4AIEA 1F73A 4AHPA 3WLKX 3KL0A 4Q4KA 2XUCA 4MB4A 1FWNA 3F5JA 1VJZA 3S8HA 1WKEA 3LEPA 1NVMA 1BLIA 5FJRA 3SFKA 4XZIA 4KRTA 3WMCA 1J6PA 3W00A 4PUJA 1JFXA 1XYLA 4JIQA 1NF7A 3VINA 1C9DA 1RBAA 1R8LA 1L6FA 3N4AA 3ITGA 1XL9A 5IM51 2XGZA 4PMDA 3Q37A 1E1EA 4HK6A 3VKBA 5HXMA 3CZEA 2I14A 4X63A 1S2UA 4MMWA 4XD5A 1YPXA 2QW5A 4DNHA 2JKAA 4RZ5A 3CLMA 4HNOA 3GNNA 3PTKA 1QI5A 1IEWA 3AIQA 1GK8A 4GPNA 4AIBA 4GKLA 4IMDA 4MZ8A 1SW7A 5I78A 4MJMA 5AHLA 1R0MA 3BJFA 4US6A 1GORA 1HL2A 2BV9A 1JVNA 2OCZA 1OZQA 2WMIB 4GFIA 3IJ8A 2PDQA 4H9VA 5A6BD 1OSEA 1VS1A 3O6AA 5E0FA 4XSLA 1KRMA 4B4HA 1MW0A 1NFBA 4MJ4A 3W0KA 3SCSA 3HB9A 6ALDA 2WKLA 4UOJA 3G0UA 4LJ3A 2QS8A 1VF8A 3PZ9A 1SQ7A 1OX6A 1YIXA 3WNNA 5K2ZA 4GOAA 2O4QA 5RUBA 2CXEA 1YQ2A 3GU9A 1PTGA 1ZL1A 4I7UA 2ALRA 1ZZMA 5I07A 3ARZA 1UIOA 2VYOA 1AZ2A 2C15A 4F0HA 2ANUA 1IWPA 1FKXA 1Q63A 4PUUA 1DTUA 4ZFMA 3NQ6A 2PWVA 5HR7A 2ISSA 3ISIX 4RDWA 1EPXA 1E6SM 1FH8A 3URQA 3NURA 4ZOAA 3UU0A 5AYXA 1DVJA 2WANA 2JGQA 3CHEA 5LA1A 2R9RA 1T0OA 4JNZA 4AW7A 4LRTA 1E51A 4H9ZA 1J0YA 3M7SA 3OU8A 3ABRA 4EPKA 2ZRZA 2AQWA 3L21A 3WQOA 2NXIA 4MKSA 3BZGA 3KBWA 2YCIX 3XISA 2PA6A 3FS2A 2GQ3A 3HPFA 2GVLA 1D8WA 2BVDA 4DWSC 2BFGA 1VFMA 5CCZA 4QS5A 3WDIA 1TE1A 3WK0A 1MI3A 2BOGX 4B2DD 1KCLA 4WK9A 2OB3A 2GOKA 1M6JA 5E6YA 3W84A 3TTEA 2WPGA 2OKTA 3T2PA 2EJ1A 2D0HA 3NQVA 1I45A 2PWFA 3HG3A 3ID7A 1DORA 3VFLA 3SO7A 1AUSL 3A13A 1PTDA 3NZRA 2FVMA 4GQGA 4R7OA 2OWWA 3HQNA 1LL7A 1OT2A 3CZJA 2QZRA 3KP0A 2B81A 3OJGA 5DANA 5ECUA 2VWTA 5FSEC 3VUPA 3VKCA 3H54A 4R53A 2J88A 2RDUA 1LWJA 3RYSA 4KFOA 3EWCA 3GHTA 1IHIA 1OGBA 2QKFA 4IMAA 3PWAA 2HTMA 3CWHA 5HWMA 4TTGA 1FWAC 2WZIA 2PCEA 3V36A 4BI5A 3GC5A 1KFCA 3UZXA 3QZEA 2ODOA 4D1IA 5CGMA 2PWGA 3FHQA 4LTSA 2ZC8A 2XWEA 4U4MA 2E5BA 3PJUA 4XIMA 1V79A 3WNPA 4AZ5A 3G1AA 5C2CA 2VFEA 1C93A 3W6YA 5ABHA 1WDQA 4YHGA 3W9ZA 5FF0A 2Z4GA 2PU0A 1GVYA 2BGQA 4E5TA 1GUVA 1LF1A 3G1YA 2BSLA 4O1AA 1Q6DA 1B3YA 4N4PA 4W8AA 2C18A 2YL5A 3WK1A 3CEPA 4AIUA 2ADAA 1JUEA 1XBXA 5EMKA 3AISA 5FCZA 3GC2A 4NAFB 4OV9A 4LW7A 4NAEB 1OM0A 2CW6A 3UR5A 4IM4A 4LOCA 1US3A 3EOSA 1VFOA 1CCWB 1XKYA 4YTSA 1HN1A 4XTDA 3QSTA 3K8MA 1K7XA 3N2XA 2QULA 3TLLA 3S6DA 3CPGA 3DG7A 3RCMA 3ATZA 4L1GA 1WZAA 3G18A 1C8XA 3TSDA 2C0AA 4UTTA 3BMVA 3LSCA 1JCLA 4Z2GA 3A9BA 5F2MA 3GVRA 3M5YA 4PUEA 3AROA 2OEKA 3WFZA 1RY8A 2V81A 2QV5A 3LNMA 4HZ7A 5BMWA 4BF9A 2EG6A 2VC7A 5A8PA 1EZ2A 1UBSA 4ZO6A 3GG8A 1LBLA 1JCXA 3M16A 4NP7A 3T44A 5I03A 3B0XA 2DVUA 5KMYA 3IIPA 1E1CB 4J2PA 2G0WA 1XIBA 3FNDA 3GDMA 4UFKA 3CB8A 2XFWA 4P8VA 4PMJA 1PYFA 1Y5XA 4DVOA 3B06A 1ZPTA 5DN1A 2XIQA 3DFPA 4JQ1A 2J8TA 3E12A 1BYCA 2BGNE 1JL8A 3MYOA 1EO5A 4O1EA 2VT0A 4MJ2A 1AVAA 1EJTC 1TRIA 1DIKA 1WP6A 3S6OA 4LNCA 4S3DA 5HULA 4O15A 1IF2A 5CZSA 4WCJA 1O4UA 4EWND 1K9DA 1T96A 4DZ5A 2Z28A 1ZAJA 3W1QA 4GXMA 2DSZA 1ZJAA 4D6CA 3CO4A 4LS1A 3WSUA 1ICQA 3MCOA 3WJXA 3UZJA 3T8QA 2Z1VA 2D1ZA 1QMLA 1L6WA 3SM0A 5DMYA 3HQ1A 4PMNA 4DM2A 4I5UA 3TMQA 2P53A 3LI1A 1W3IA 3QHMA 2X1TA 2A1YA 1NDZA 3QPYA 1OBAA 3KS6A 4S23A 5XINA 3TOPA 1EGMA 3F03K 3EXRA 2F2HA 2E6YA 3NA8A 2Y7GA 4A4AA 3DI0A 3BV4A 4FF7A 2X1RA 5F4XA 4M81A 3L12A 2I5GA 3UR2A 1XBYA 1JD7A 3VAVA 3IJLA 4LCRA 4LV9A 4Y96A 3ARRA 4WR3A 2V5DA 3MP3A 3C86A 2X7VA 3REQA 1V0NA 2NQHA 2PDWA 4EP8C 3M0HA 3SCRA 2QDHA 5BXPA 3F4VA 1UWAA 1BQCA 5JQ9A 4JFUA 2TYSA 4Y90A 3H4WA 4DJDD 4UQBA 4IP5A 3PZOA 1PVNA 1QR7A 3QY8A 2VFDA 3GX9A 1VRDA 4CNUA 3PR2A 4FI4A 3THUA 1PHQA 3ZWTA 4DAIA 5CKSA 2F84A 4LUSA 2QQ6A 4XVDA 1VZWA 5HK4A 4E4FA 3PPCA 4IXHA 3S6TA 2WJFA 2Y6ZA 3B0UX 5G2IA 4KT2A 2E67A 1MO0A 4NVTA 3UG5A 3CJPA 4O50A 4ZR8A 4IWWA 2O56A 4OV4A 3THQA 2O7SA 1AH3A 1IEQA 4GLEA 1SZGA 1TVLA 4C6JA 3WFLA 1BVZA 1IWAA 3GDBA 1SJAA 3IIZA 1KWKA 3N2MA 2VELA 4E38A 1KO0A 3EX1A 5A69A 3CV1A 3F5KA 1LBFA 1MNSA 1GT8A 2QUNA 3NPUA 3GIYA 5AYYA 3H7UA 2EPKX 3SJ3A 1VPXA 4WIWA 1BGGA 4DJFC 4IGHA 5CPLA 3L4TA 4MNKA 3RPMA 4AZIA 3M0LA 4ZXLA 1A50A 1WYIA 3LCGA 1EC7A 4IL2A 3SGGA 4UTFA 2YSWA 5C6MA 5EMYA 3BG3A 2ISFA 2RDTA 3KOFA 4NYUA 3ZLFA 3U48A 1O5RA 1AH4A 2V2HA 3GH4A 4M24A 5BU9A 2QCGA 1E70M 2O9PA 3P62A 4OGZA 3STFA 4QQUA 3B3DA 4PMVA 2AGTA 3T55A 1R38A 3FJ6A 4PA8A 4AZCA 3ZM8A 1GZGA 3KRZA 3VILA 1HX0A 4IPPA 2WC7A 2F8QA 1R3YA 4FLQA 2QUUA 2PMQA 1TTPA 2JF6A 4HPJA 1UKSA 4XBKA 4N9DA 4C6CA 1BXBA 2DU2A 1XH1A 1D2KA 4PGLA 1I75A 2PWEA 4DO7A 1PWMA 3RXZA 1Q7MA 4ICMA 3S83A 3MCMA 1XX1A 2RDXA 5DRIA 3RK8A 5AYIA 2W91A 1JFHA 3QKEA 2XIMA 4DZIA 1C90A 4Q8QA 4WF7A 4Q6XA 1XD1A 3ZXWA 4FHAA 2WNWA 3KVLA 1A5BA 1ZENA 4IX0A 3HGRA 3CS2A 3CTTA 5I3DA 3IK4A 2WVVB 3NO1A 1XBVA 1FWHC 5FEWA 3MCNA 1M7JA 3RRAA 1RPKA 1S5VA 4ERGA 4PMYA 4K7YA 5DCEA 1V6UA 1TMLA 1QW7A 1IIGA 2WKJA 2YBUA 1JI2A 3D6NA 3DC0A 3NOYA 4EX4A 3SAZA 2D3NA 4G56A 2A0NA 3WD2A 1Q7QA 1HKMA 4JN8A 1X39A 2E09A 3UZYA 3LXAA 1M03A 4HIBA 1VBUA 4P7OA 4K2SA 4XKYB 3EMQA 2OQYA 4Q4SA 3EWWA 2XVGA 4W87A 3UVIA 1VCGA 5IHRA 5LIUX 2WVSA 1VRXA 3MZNA 4QP0A 1IQ8A 1QI0A 3ANVA 2HV5A 4QDPA 2JIWA 1KFJA 4HZ8A 2CU0A 2V3EA 2O92A 4KFNA 1NDWA 2VENA 1J5SA 2QDGA 1MEIA 4ICCX 4C6NA 1Q45A 1ONXA 5BOEA 3MDWA 4O0QA 4PMZA 2D22A 2CLLA 4O19A 1ADDA 4F2TA 2V5BA 3H2EA 3BG9A 4AIOA 4X22A 2W61A 4ZB2A 3RX3A 3BH4A 3S0CA 5CSSA 1KV5A 5FJIA 2FHCA 3EAUA 4QISA 3WQFA 1SZEA 3KL3A 3EDKA 2ZUSA 1YDNA 1DV7A 1JPIA 3S47A 1PCWA 1S39A 3CUJA 4O8RA 4GNKB 5D4YA 2Q3RA 2DUAA 3FJNA 1LM1A 1TWIA 3STPA 1EH9A 1J93A 4HQVA 3ZVHB 3W26A 4CD4A 4EAMA 2WJZA 5LA0A 4J3TA 2Y89A 3UY8A 2GJNA 5J04A 4HZMA 3GU2A 4YJ5A 1RY0A 4U33A 3S2LA 1J0HA 3TAOA 1RPXA 4UTJA 2OU4A 2GVJA 2WV8A 4Z2HA 4MYAA 2OYMA 3SCUA 1JCMP 5A8NA 1UR9A 3QFWA 4RZ4A 3ALGA 3KFTA 2VL4A 4QNEA 1JUBA 3M0JA 3P61A 3R0KA 4DYEA 3EDJA 4AD4A 4AB4A 3GDLA 3GQYA 4JTHA 5CLTA 4LFYA 3W1XA 1A5CA 4LANA 4GGHA 3KTXA 3P5YA 4P2VA 4MB5A 2VEFA 1MQQA 2FDMA 1ZUAX 1YXCA 4M1BA 3ITYA 4HPNA 2ZUMA 1QOXA 1H63A 2PF8A 2XVNA 4OBTA 1V3MA 4Y8EA 1XPGA 4KWVA 2PDNA 1EEPA 1XW8A 4HHLA 3KRUA 4FXSA 4J3WA 1JYXA 4CU7A 1B9BA 1E9YB 3CHFA 3H2OA 2BBFA 4XBSA 4X9SA 4H7ZA 4CVUA 2ABAA 4XX6A 5HQEA 3TWAA 1R3QA 2PDUA 1QUMA 1H3GA 1XSJA 1Q6OA 4GACA 5C2XA 2I7GA 3LMYA 4B3ZA 2FFIA 4C6KA 3ZZ1A 2RH9A 4P7LA 5T26A 4JIHA 5M1TA 4MWAC 3NGJA 4GYJA 3F1QA 3M44A 4KCUA 1HP5A 1EO7A 4IPNB 3ECQA 4ZO9A 3UWWA 4JX4A 2Y7EA 1RHCA 3P81A 5G2HA 5GNXA 1DXIA 3VIGA 3VGEA 1EYEA 4O4VA 2E25A 3WEOA 3W3OA 1E15A 4RCXA 2QIWA 3VCNA 3HA1A 1NM9A 2O4MA 2O9TA 4KCVA 3L5LA 3MMWA 1PPIA 1OIFA 3F4CA 4IJRA 2PC4A 4B5TA 3GNXA 4GUHA 2PBGA 3WMLA 3NQAA 4IUGA 1RD6A 3W4RA 3TFCA 1ZGDA 2R91A 4N2YA 5LKYA 1S2CA 1QT1A 4X60A 2FZNA 3DOPA 4A35A 2XN0A 4GUFA 1F6PA 1LYXA 1VAHA 4C6BA 3HF3A 3A6OA 1NWSA 2P8BA 4CKQA 3S1UA 1ISVA 2QGYA 2YL9A 1IWBA 1ZLPA 4R3UA 4CN4A 4ZO7A 1S46A 2DT3A 5DQPA 9CGTA 1SW0A 1YBQB 3P8JA 2DEPA 3AS1A 2CLOA 1TVNA 2ZTJA 3BXWA 1MVYA 3PP7A 2A7RA 1K7EA 4HTYA 3SCVA 3VOIA 1DEDA 5DXXA 3EOUA 3NQ2A 2X2YA 1ME7A 2O9OA 3AIBA 3BTNA 3ITLA 1ALDA 2DH2A 3V5OA 1EBGA 4XO7A 1DWGM 1ZRQA 4WY0B 3C3NA 1OQFA 2CKSA 3TC3A 4CCDA 5LZLA 3SUVA 1OFDA 2MANA 1UCWA 3EX4A 3WZ0E 2AL2B 4D2JA 2OR2A 5I7GA 2QJGA 1R6WA 5D32A 3AUOA 3WUBA 1O60A 3WY1A 1JXKA 4QEEA 1R7OA 2QCEA 1RA0A 1GONA 2NX9A 4RX0A 2BX7A 1LRNA 4K8EA 4H4IA 1CXEA 1B30A 3E2VA 4XZLX 3SN1A 4Q7IA 5LNVA 4MPKA 4GINA 3VIIA 5HDRA 1O94A 2ZUNA 3W22A 4QNWA 2L5HA 4B90A 3UNDA 2V2CA 1OGSA 4E8DA 1C91A 2GPTA 3UP8A 1XP3A 1YXYA 3UWVA 3W76A 5FESA 3CWNA 3CQ0A 1VBJA 1XBZA 3KWXA 5A6JA 4Q8WA