3TXZA

Oye1-w116q complexed with r-carvone
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
399
structure length
398
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLQVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
molecule tags Oxidoreductase
source organism Saccharomyces pastorianus
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
total genus 158
structure length 398
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3txzA00
4JTIA 3C2FA 4LV9A 1BTMA 1KBIA 4JTJA 5AN7A 1OYCA 2ZTKA 3UPWA 1UCWA 2O7SA 3DFTA 3IGXA 3NPVA 4RK8A 1JCNA 4FB7A 5F2GA 2VKZG 1ZAJA 1TRDA 2P10A 5HULA 4CNOA 2XFWA 3A21A 1P0KA 3IVSA 3LCIA 4O1DA 1HG3A 2QEZA 4NUWA 4DF0A 3PUDA 1IXOA 3TSMA 2YXGA 3DENA 3MI6A 4OV4A 4BWLA 3S1UA 2I1OA 4Y6GA 1FDYA 3BW4A 1Q6QA 2QKFA 3KOFA 4Y9AA 4YXGA 2QCFA 4UTIA 3W83A 4MPQA 2NX9A 2VFGA 4UFJA 4NJIA 1XCFA 2RDUA 1VQTA 3ZWSA 4ZQNA 1XUUA 1FWTA 1K8YA 3PBWA 2C18A 4MIMA 4ZQRA 4LW7A 2V82A 1QDSA 1KW1A 1EX5A 4A21A 1TPEA 1KTNA 3O8AA 5D2XA 3C8FA 4W9TA 4I7VA 3L5AA 1VLWA 4OU1A 3KRUA 3NQEA 4N9EA 3DBPA 3QJAA 1W5QA 2P1FA 3W2LA 3TMLA 8TIMA 1WAUA 3HG2A 1QPQA 4X9SA 1BWLA 1W5OA 2CWNA 4DQWA 4ORIA 4L4MA 4AHOA 2Q8LA 1R2RA 4IMCA 1VYPX 1KM4A 2FLIA 2HS6A 1ICPA 4DELA 3M5VA 3W7HA 1PS9A 1ME8A 1P5BA 3BLEA 4BF9A 1EB3A 2E5CA 3UQNA 4PL1A 2YCEA 2PCQA 1OHLA 1JJKA 4O57A 3TU9A 4IX0A 1S5WA 1TJRA 2QAFA 1XI3A 3LBMA 3SIZA 3C3NA 2EAWA 3G1AA 4MFDA 1H7XA 4H3DA 4MY9A 4KKXA 1DL3A 1DQXA 3FOKA 3M43A 1I2NA 2ZZ7A 1GVRA 2JKPA 3T78A 2ATSA 2A5HA 2NX1A 3PWAA 2DU2A 3QM3A 3TJLA 1JQVA 2QCHA 3GNDA 3DU0A 3GKFA 3TW7A 2DZPA 3W1TA 3NDOA 3DH7A 4O10A 1VZWA 4RCXA 2V8ZA 1VCFA 3NOEA 1F7BA 4OWGA 5CPNA 4PH6A 1H7RA 2C1HA 4K37A 1ZY9A 3NQGA 3EXTA 1RQBA 3UYCA 3TQVA 4N9BA 3TFXA 1BEUA 3RF9A 4UTHA 3UPBA 2FJKA 4WX2A 5CZJA 3SY5A 3DFNA 1F05A 2I14A 2H8ZA 4LVDA 4UNLA 3W86A 1EUNA 1H50A 3DFSA 2ZRZA 4QSHA 4MY1A 3W1NA 1BWKA 3LX9A 1TV5A 5LNVA 1JRBA 1N55A 2JKAA 1QPNA 5DCDA 3TMQA 3S1XA 4FX7A 1LLWA 1O4UA 3N9RA 4O50A 3W85A 3LI0A 1GTHA 1JULA 3LM7A 1TTJA 2DZVA 2R91A 3C61A 3L0GA 1T96A 3N19B 1K03A 3FFSA 1P4CA 5AYXA 3L66A 1VJIA 2X30A 3C56A 3DHFA 1G69A 2CLIA 3TH6A 4AH7A 3DZ1A 1YXDA 2VEMA 4RX0A 2YR1A 2H8XA 3W7QA 4MY8A 2TRSA 1SR9A 1JQXA 3NA8A 3Q2DA 2B0MA 3LGEA 3HQ1A 3MP3A 1QO5A 3GLCA 3FKKA 3G24A 4I9AA 2V81A 3P61A 4IGHA 1A5CA 1TSIA 3W1RA 2CW6A 3WJYA 1EP2A 2R14A 2JKEA 4U4MA 1VH7A 1F6PA 5KITA 3UWUA 3EX6A 3NQMA 2R94A 5I3GA 1LBFA 1WQ5A 4NJHA 1R46A 1U83A 1VPXA 3HOJA 2NWRA 3TAOA 5FF4A 1LRTA 4Y8FA 5G2IA 1SW0A 4JYFA 1CI1A 1W37A 3OVPA 4JTTA 4M7SA 4ZZ9A 4WY0A 1YTDA 3V75A 4JTEA 3IIXA 3YPIA 5DCEA 1MO0A 4N6FA 4EF9A 4FNRA 3CEUA 1KV8A 1PVNA 4TX9A 4CNNA 2WNNA 1KM6A 2ABAA 4BFAA 2QDHA 2NV1A 3EWWA 4UC5A 5U7SA 1KBJA 4AF0A 2G95A 1VYRA 3WJXA 5FEWA 1Q3NA 2ISVA 5A8GA 1TB3A 1DORA 3LV5A 2WV8A 1EP1A 1KM3A 5FEPA 2C14A 1GOXA 4N9DA 3OG3A 3C52A 1RVGA 3W72A 1AK5A 4PEKA 1KV5A 3S5OA 1GT8A 2QCGA 1CW2A 2EPHA 3QPZA 1QFEA 4JDBA 5K3VA 3KX6A 4OGZA 1KTBA 3EWBX 3HG4A 1Z42A 3O16A 1NEYA 4NZFA 3QC3A 3PUEA 2A2IA 4P2VA 3HB9A 3I7RA 3TV8A 1GTEA 1V5XA 1LZOA 4MYXA 3QMTA 1JUEA 1VYSX 4K7YA 3NQCA 1TPB1 4AMAA 3USBA 1WX0A 3FS2A 3W7NA 3NQAA 2YYUA 1FCUA 3GDTA 4UUIA 5LGZA 5CPMA 1OFAA 4K8EA 3TC6A 3PBVA 4PA8A 4MZYA 3F4WA 2NX3A 1GVFA 3HF3A 1G4SA 3BO9A 2NWSA 3IVTA 5G4EA 3W2NA 3ANYA 3NXFA 5FEXA 1YDNA 2VFIA 5K9XA 1GEQA 2QUVA 4GXMA 5DY3A 2B4GA 4O28A 1I2RA 2A7RA 3HMJG 1YLVA 3EWZA 4M6PA 3ABRA 1THFD 2V30A 2G5WA 1OFDA 1KTCA 4KFOA 1WOBA 3CQ0A 3QMSA 2ZZ6A 1S3HA 4HKPA 1UASA 3O63A 3NPUA 1WDWA 1GVSA 1WBHA 3ELFA 4I7UA 4UXDA 5BMXA 3S1VA 1KLYA 3LRKA 3G8EA 4S2BA 2RDWA 2KZHA 4JR5A 3E96A 4DPQA 3HBLA 3W7KA 4WY0B 5G1YA 2ZTJA 1ML1A 2B7NA 3W1XA 5C6MA 4MJZA 4Z1BA 1WXJA 3P67A 1SFJA 2BXVA 3FLUA 2PC4A 3S9YA 4HNVA 1H5YA 3EX1A 2QR6A 4X3ZA 1D3GA 3CB8A 1G7UA 2E1DA 1A53A 4PCFA 2QJGA 3NL6A 3STCA 5AC8A 1XBVA 1XBYA 3MP4A 1YXYA 3EX3A 1SPQA 5D32A 1GYNA 3FEMA 5K2ZA 3W7CA 4D2JA 4N9CA 3IGUA 2E09A 4HN4A 4ML9A 4UTJA 1S5VA 1YPIA 1ZNNA 3BG5A 4JX5A 5F1VA 1Y0EA 4UFIA 3B0VC 3A5FA 2VFFA 1DQWA 1LLZA 1H60A 2Z6JA 2YYTA 4MVAA 2F84A 3BK0A 4UTTC 5KSWA 2OJPA 2W0UA 4AWSA 2Y88A 3L68A 4S2CA 1OF8A 3B04A 3LTYA 3MHFA 4BI5A 3BPWA 2NXIA 1LROA 3BARA 1X1OA 4LRTA 1C9DA 4JTLA 3LERA 3W7DA 3BGGA 4NT0A 1OYAA 2QJHA 2EHHA 1JCMP 1MEHA 2RKXA 4N02A 4XUGA 4QISA 1MEIA 1LTDA 3TKFA 2WSRA 3U8GA 1C8VA 2ALDA 4IPJA 2OT0A 4QJ1A 4IJBA 1C29A 3SFKA 3HO8A 1XC4A 3P8IA 5HR7A 2VEIA 4ZVJA 5BRBA 5EPDA 4TIMA 5J5RA 2BWGA 1H63A 4TMCA 1O60A 5I3FA 1G4TA 1OJXA 5KMYA 1OX6A 4LUIA 2OX1A 3LHUA 4MJMA 1UB3A 5C54A 3HG5A 2YPIA 5DN1A 2QCDB 3G0SA 4UTMA 3ZFHA 1GYLA 4AWTA 1LRQA 3ZR4A 5CSSA 4AVFA 2RHGA 2VOMA 3NL5A 3VE7A 4RZ4A 5HR6A 1FWNA 4JD4A 5BMWA 1SW3A 5FF2A 3W2KA 4MFEA 2GVGA 3P8JA 3Q58A 4RXGA 2Y7GA 5AYYA 4JTFA 2A1YA 3SI9A 1GJPA 3G1HA 3KRSA 3W7PA 3QMRA 1AW2A 3M6YA 2IQTA 3NQ2A 1FX6A 1OK4A 1OFEA 3G1DA 4GE8A 5LGXA 1KFKA 4UCGA 5AYZA 1TCDA 5TQLA 1SSGA 3QPYA 1RQEA 3W2JA 1SZNA 4PODA 3HIJA 2C13A 4X2RA 4UTUA 3CWOX 1G7VA 4Z1CA 4Y90A 1TPFA 1R2TA 1TTIA 4DPPA 4LTSA 2ABBA 3MBFA 5D2TA 5BNKA 1M7OA 2E77A 1O5KA 3O6CA 3PUOA 3UZJA 3WK2A 4O13A 2VC6A 4R34A 1G4EA 3W87A 4JXCA 1HL2A 3P80A 1W0MA 4JYDA 3C6CA 3V1PA 5CZTA 3HPZA 5L6UA 3ZWTA 5HWNA 4UTWA 2LLEA 1L9WA 3LV6A 3F03K 4H4IA 3TQ0A 1SZGA 5LHFA 4XBSA 4LV4A 5HQEA 4PFMA 1HFBA 4JTKA 5D09A 1W3NA 1OYBA 2VFHA 3T40A 3EWYA 4A2RA 2PURA 2C19A 4XTIA 4FIRA 2XN0A 5I3IA 2YFNA 4UMCA 5ABTA 2QAPA 2ATMA 2B7QA 2BLEA 3G22A 1F6KA 1QPOA 2Q8ZA 4XKYA 1VHCA 4LVFA 3O07A 4EVZA 2ZZ1A 3LHTA 4POCA 2ZRUA 1KM5A 2FPYA 2NXGA 5MHBA 1LOQA 1ZHAA 5CPLA 2DJLA 1X6UA 5HUPA 1H62A 1AW1A 1QAPA 1YADA 3I65A 4GRSA 4FNTA 2TMDA 4HSOA 4Q4KA 5H91A 4AXKA 1K3UA 4L4LA 3QH2A 1UBSA 3R5EA 2FFCA 2Z6IA 4LY8A 4NJGA 4O4WA 4NX0A 1HO1A 3HG3A 4LVBA 4UTTA 3CC1A 3LHZA 4YLWA 3LBCA 3N3MA 3CT7A 3F4NA 1FDJA 5EMUA 1FQ0A 4GFSA 3A23A 1TRIA 5AC7A 5J5DA 1N8FA 1NF0A 3CEPA 3UY8A 3BLIA 4JY9A 2XN2A 3G1FA 2JGYA 1J4EA 2VXNA 4WXYA 1VRDA 3W9ZA 4QM1A 4MUZA 4IUOA 4UFHA 4MLRA 3EB2A 1ME7A 4FXSA 3EWXA 5EKYA 1JCYA 2ZBTA 1ONRA 3TX9A 3EX2A 1P1XA 2ISSA 3W1AA 2WQPA 1RPXA 3HPXA 1K7XA 3L67A 3C2VA 3QQ1A 3BW2A 4DBEA 1GG1A 4O52A 3S6DA 2PRLA 4O53A 2FPTA 3GR7A 3NL2A 4WJEA 3QYQA 4X22A 4A2SA 4QNEA 2GUUA 3W70A 4DF2A 2VFDA 1TTQA 3G1SA 3IIPA 4O15A 3QRHA 4Z1AA 1TTPA 3GR8A 3W74A 1IIHA 3CHVA 2E5BA 3UZ5A 3LCXA 3QW4B 3N73A 3P5YA 3PSWA 5EY5A 4RKAA 3CU2A 3DFQA 3LXAA 1SUXA 1SZFA 4RJEA 2ZRYA 2Y6ZA 2C15A 2WJZA 2QCNA 5LHEA 1JCXA 3PBYA 3W1QA 4MYAA 2CLHA 4UTWC 2QUUA 4E38A 1RQHA 1NVMA 4K39A 2TYSA 3DKJA 4CCEA 3N14A 2RDTA 3S5ZA 2X16A 4BR1A 4GUHA 3UWYA 4WOZA 4MZ8A 3G1VA 4TMBA 2OCZA 4ADTA 3T55A 3TW6A 3IVUA 1DBTA 1LDCA 5D38A 4RLIA 1W54A 2D73A 5CGQA 1OVDA 3WJZA 1M7PA 4YCOA 1RZMA 3NQ6A 1DKWA 4FNUA 2YW4A 4Z08A 4E2BA 4XWUA 1W5NA 5E1QA 1V7YA 1XBZA 4MZ1A 5F2IA 4UTKA 4OE7A 5TBOA 5G1TA 4A22A 4O1CA 2TSYA 1O95A 3PG9A 4Z0SA 1L2UA 2DZUA 5C55A 3B8DA 5KTLA 3H54A 4N4PA 3UXDA 1OK6A 3L65A 3MHGA 1M6JA 2RFGA 1IXQA 3E12A 2WPBA 4JTGA 1L6WA 4FX8A 1FWWA 2P0OA 5BW6A 1QO2A 5HWJA 1Z48A 1I45A 3UWQA 2CLMA 2E68A 3NYZA 4UMBA 4E2DA 1VCGA 5DXXA 1KM1A 3M16A 3MYOA 2QJIA 1LORA 2DZTA 4M19A 3KXQA 1B4KA 1EPXA 3TXZA 3R89A 5AHLA 1OX4A 1XFBA 3CM4A 3P5ZA 3QF0A 3UXAA 4EWND 2VELA 4WUIA 1KLZA 1PCWA 3WFAA 1SO5A 3P62A 4OT7A 1CX9A 5D2VA 4LS2A 2YFOA 3W71A 3CWNA 5E93A 3DFPA 2ZZ3A 1LYXA 3PVFA 1UJPA 2V9DA 4GC4A 3W23A 1FWSA 2A4AA 5TIMA 2DZSA 2J9XA 3GXPA 3QEZA 3P74A 1TPWA 3WK1A 4FNSA 2V5BA 3LRLA 3LXBA 1H7OA 4WZHA 3TA6A 1Q6RA 4Z1DA 1SO3A 3FKRA 3TSDA 4N4QA 1KM0A 3MO7A 3F1QA 1B4EA 1GZGA 1W3TA 4QIUA 1MXSA 5D2YA 5D37A 2DZWA 5K9DA 4UNKA 3VFLA 1R2SA 3RLVA 3GIYA 1H7PA 3BV4A 2CU0A 1T99A 4O17A 4QITA 3MYPA 3N34A 3QW3A 4O18A 1Z41A 5F4SA 4GWEA 5EYWA 1A5SA 5F2MA 1NAL1 2FTPA 2E6FA 1XKYA 1H1YA 1LRNA 4AB4A 3DI0A 2NLIA 1XBXA 2ZRWA 3QZEA 2ZDRA 3HGJA 3P82A 1K7FA 1JVNA 5K4ZA 2RH9A 3BVJA 4IOTA 3RFAA 4MOZA 3TSBA 1ZJIA 3NQVA 4IWWA 3WK3A 1S5TA 5H2ZA 4DXVA 1RD5A 2FDSA 4O1BA 1DV7A 3IIVA 4MLJA 5F2LA 3W7IA 1OFPA 4YWIA 5HMSA 3OIXA 3W73A 2FPVA 2J27A 4GNJA 1W1ZA 5AB3A 5LKYA 3EEGA 2GQAA 3OHIA 1IIGA 2ZYFA 4O1AA 1T0OA 3TXVA 3N2MA 1TPVA 3L9CA 4CQ8A 4K36A 2WNQA 3LLFA 1X1ZA 5IBXA 2JGQA 1AG1O 1AMKA 5G2HA 1ICQA 3A22A 3ABOA 3B06A 2CLFA 3FYPA 3RU6A 2ZCGA 1R30A 3TCEA 1MSSA 2DP3A 5DBTA 5EL1A 1K7EA 3O05A 1EA0A 3GZ3A 2AGKA 3M44A 4LT9A 3UNDA 3PULA 3NO5A 3WJSA 1ADOA 1UUMA 3P84A 2FB2A 1NFBA 3KVKA 1SQ7A 4HIBA 5EA9A 3STGA 2NUYA 3NQDA 4N6EA 3OVRA 1O5XA 4HPXA 3UWWA 2BSLA 3H55A 2ZRVA 3LB0A 3L0NA 3LHWA 2CLLA 3NL3A 4NNCA 2FQIA 1DOSA 1P0NA 4FIQA 2CZ5A 4JDYA 4FF7A 1FBAA 1XL9A 3MUXA 1WBJA 3LCWA 1LBMA 1I2QA 3QSTA 3L21A 4FXRA 1IGSA 5KINA 4S1FA 3PB0A 4NXKA 2DZXA 3NPXA 3FJ6A 3NQFA 4GUFA 2W6RA 1QCWA 2VEPA 1GWJA 1HTIA 3W07A 2X1UA 2QCDA 3H53A 4K6AA 4O8RA 2PE4A 2PRHA 1K8XA 2R8WA 5D30A 2H90A 1FY6A 4JTSA 1F5ZA 1JUKA 1I8JA 4LOCA 4RV8A 3W76A 5G2WA 4C1KA 3HGOA 4O54A 2QDGA 1VS1A 3O06A 3G18A 3OEXA 3DKLA 1EWEA 4IXHA 3S5YA 4DO4A 3W3OA 3A5VA 3LI1A 3M1ZA 3SR7A 3S42A 3NZ1A 1ZALA 3W7JA 4OQVA 2Z0IA 3M41A 2A7PA 1A5BA 4ZQMA 1J5TA 3GVGA 3FYOA 4PTNA 4WY0F 2EGZA 1ZFJA 3INPA 4I7WA 2A21A 4NNBA 1PIIA 4KFPA 3G3DA 3W2MA 3DI1A 4QNWA 3TQKA 4LU0A 1TPH1 3I68A 3S8HA 3SGUA 5G4WA 2X1TA 4R53A 1KFBA 4UFKA 1OX5A 3G3MA 2Z1BA 3MMTA 3M5ZA 4AHPA 5LZLA 1T8XA 3BGJA 2Y61A 1EIXA 1HUVA 4CCCA 2ZRXA 5LNSA 5D05A 4BI7A 2ZA3A 3I7SA 4PC8A 4O11A 4ZQOA 3M5YA 2H3BA 2A6NA 2GVLA 2Y7DA 2Y89A 5F4WA 1W31A 3GXTA 4K38A 3AO0A 2NUXA 3L5LA 3U2OA 1ZAHA 2B7OA 1H7NA 2BTMA 2ZA2A 1XM3A 1IXPA 5DLCA 3IV3A 4K8HA 5L9FA 3UWZA 4NQ1A 5HINA 4JIPA 3HGSA 1SFLA 2JK2A 5T26A 4O4VA 4IQLA 1EWDA 1SO4A 3IGSA 2AQWA 2I9EA 3TAKA 1MZHA 4FO4A 4XKYB 1A50A 4TU1A 2GPTA 4HPJA 2J24A 3TJXA 3EKLA 4RZ5A 2BX7A 4ALDA 3UD6A 1XXXA 4O16A 4JY8A 1ZCOA 3IIOA 3NM3A 3GDLA 1PL9A 3LDVA 5BOOA 5DCBA 4O14A 2H3DA 4GUJA 3TFCA 3A24A 4ONVA 3RLUA 3W1MA 1SW7A 1FCBA 2NV2A 3LOTA 1DVJA 3LHVA 5KZEA 3PBUA 4CLMA 1DJNA 5K4XA 1B9BA 3ATYA 3MHUA 1XUZA 5F1UA 1YXCA 5D33A 2C16A 4Q32A 1VGAA 2GQ9A 2GQ8A 4HSNA 5AHEA 4FNPA 1ME9A 4NXSA 1FCQA 4DO5A 3W7EA 6TIMA 3SECA 3R8RA 2JBMA 2QCLA 2AAMA 5LNWA 4NJJA 3W75A 1TYGA 5AHIA 2YDAA 1H1ZA 4CQ9A 3B0PA 1K8ZA 3B4UA 4JN6A 3R2GA 2ZA1A 2GVJA 4IMGA 1E51A 4LUJA 1TQJA 1L6YA 3EXSA 2FIQA 3G1YA 4RR4A 1OFOA 4TR9A 1TIMA 3HPSA 4XQ6A 3PG8A 4R7JA 3GNNA 1YTEA 1TV8A 5AOUA 1F73A 2HMCA 2QCEA 2ISWA 5D2WA 3GDRA 3O6DA 3NNTA 3PS7A 5LNRA 1OG0A 4JX4A 2CLKA 2NXHA 3RMJA 5CSRA 4YMZA 3UY7A 3PM6A 4ORMA 5I3KA 1W56A 4EIVA 4XBKA 3W22A 2A6LA 3EWUA 3GB6A 3B05A 1GG0A 3W6YA 2C6QA 2UV8G 2Z2UA 1IXNA 3STEA 3PAJA 2E5DA 3MW7A 1I4NA 5HJLA 2J6XA 4AEOA 4O0ZA 4E0CA 1TPDA 4NNAA 3VNDA 3G8RA 2ZFAA 4B5NA 2HSAA 1KFLA 1G67A 1GVQA 2OT1A 3PF3A 4JX6A 4CNPA 5K7JA 3TK7A 2XN1A 3GK0A 4JEQA 1QR7A 5F4XA 1GQNA 4RZ6A 5AHNA 4M5PA 1FXQA 3EX4A 1FWRA 3UWVA 1LCOA 4EF8A 3B0UX 4CQAA 3LCHA 5C2XA 1U5JA 3PSVA 1VC4A 3S5NA 5KZMA 1YPFA 1JR1A 3GDKA 1W3IA 4LWWA 3LCLA 3TROA 1AL7A 1QOPA 4QQ3A 2DJXA 1NF7A 5HUOA 3PR2A 2VENA 3U6WA 2ZZ2A 1B57A 2DORA 5CPOA 3C0JA 3STFA 2A85A 2CZFA 1W5MA 3VCRA 2E6AA 3QFEA 5IM51 2ZQ0A 1I2PA 4NVTA 1SU5A 1WOAA 4J9JA 3WJWA 3GAKA 2OMAA 3LCGA 4BI6A 3KFTA 3W1LA 3T44A 5D02A 1EUAA 2Y7EA 1LM1A 4UIOA 2QCMA 3SW6A 4P61A 1R47A 3DGRA 1BKSA 1TPUA 2V2HA 3BW3A 3KRZA 4N2YA 1DHPA 2PRMA 1KFJA 4GUGA 4HT3A 4O12A 5EBUA 1X7FA 3N9SA 3SZ8A 2WO5A 1OX4B 4GUIA 3I7QA 4FNQA 3MI2A 4LC6A 3W7GA 3NG3A 1VCVA 1H7WA 5GVJA 3I6RA 4BWLC 4QAIA 4K7VA 4YL2A 3LLDA 2F7FA 3W7OA 3JRKA 4ADSA 3L5MA 1J2WA 3HGRA 3O6YX 3DFOA 4JS3A 1VHNA 3IEBA 5I3JA 4LC8A 3JS3A 2H6RA 4OHQA 1JCJA 4TO8A 3OA3A 2X1RA 2FB3A 2Y62A 3S1WA 4R33A 1KA9F 3EKZA 3OBKA 1SZEA 4AHQA 3KVMA 3B03A 1Q45A 2CZDA 3R13A 3GX9A 3W1PA 1PCKA 4A3UA 1G6CA 1VLIA 3AJXA 1F74A 5D04C 2J9ZA 5AHFA 3DHDA 5SWUA 1MEWA 4WXZA 3T7VA 4M7TA 5AHMA 3THAA 4UTLA 5LSMA 2WNZA 3RNDA 1GVOA 3PC0A 1FDZA 2CFFA 4RXFA 2CZEA 2YX0A 3M7WA 3C4UA 6ALDA 2A7NA 3BG9A 2WOQA 4UFLA 1LOLA 4IXXA 1TMHA 1IF2A 2X2GA 4A29A 4NU7A 1AL8A 1NSJA 1YDVA 1YDOA 2HS8A 3C2EA 3G0XA 5D03A 1I2OA 3P7YA 2GJNA 3SSJA 4AAJA 3NAVA 4LVAA 3IIZA 2J88A 3M5XA 3O15A 3LTSA 1ZAIA 1ALDA 3G1XA 3L2IA 4ADUA 3E02A 3W2UA 3VKJA 2ZZ4A 3EXRA 3NVTA 3MBDA 1B3OA 1UUOA 4JGDA 1QNVA 1FXPA 4JICA 4XZ9A 2E6YA 1KFEA 3QQ0A 1DJQA 1YTKA 3E0IA 1JUBA 2VEKA 5K9CA 2NZLA 4MKNA 5DXYA 2YGYA 3CTLA 3TNOA 4LRSA 3MJYA 2QCCA 5CG7A 4WQ6A 3VE9A 4EOUA 4KWWA 3C2RA 2GOUA 2NUWA 2C3ZA 1PHQA 4Y96A 4OBTA 3M0ZA 1OFBA 2CLEA 5FF7A 4BK9A 1N7KA 4WD0A 2GJLA 2YW3A 3ABQA 2ZZ5A 1KFCA 5KZDA 1OFQA 3ATZA 1EP3A 2W79A 4JTUA 4JNMA 1XDMA 3OVQA 5DBUA 3Q37A 3O1NA 4YCPA 3DXIA 4UR8A 4OV9A 1JCLA 4XTDA 3LHYA 2YZRA 4IX2A 5AC6A 1WA3A 3W84A 2J9YA 2Y7FA 4HNTA 5E0KA 3FIGA 4FHAA 2WSYA 3M47A 2V2DA 1YYAA 4JIQA 5FESA 4UMAA 2V0TA 3CPRA 3P60A 3LTPA 5I3HA 3GKAA 2B7PA 1F76A 3NR0A 1A5AA 5FEZA 2Q3OA 3CIWA 4O0KA 2OZ0A 3BG3A 4WOQA 2QUTA 1XDLA 3MP5A 3TR2A 2A0NA 5FI8A 1GPWA 4O19A 4U28A 1PV8A 4NZJA 3W7RA 4ZL1A 2Y85A 3E9AA 4IMEA 3D0CA 4LNYA 1D3HA 4AWUA 3NGJA 1TREA 3GXNA 3LRMA 4DBDA 4Q33A 3GYEA 3T4CA 1HO4A 2WKJA 4C1LA 1TV7A 3GAYA 3RK8A 3R12A 3MI3A 4ZMGA 1EEPA 2V5LA 1LP6A 3TIMA 3GDMA 3ZS4A 1WYIA 1TQXA 3QSRA 3W7MA 3W7LA 3JR2A 3WK0A 3BLFA 1M5WA 3KVLA 4ZQCA 3TUUA 5DELA 2G96A 2X1SA 4IMDA 2YSWA 4DF1A 3LXCA 3C2OA 5C5YA 5FF0A 3N2XA 3K30A 2EF9A 3PY2A 1SO6A 4HNNA 1VR6A 1H51A 4HNUA 7TIMA 3W1UA 1PHWA 4PL2A 4M6VA 4NX5A 4IMFA 3P81A 1TJPA 2O7QA 4LVGA 2G97A 5AFDA 5CKSA 4NJKA 1FCVA 4LS0A 3SGZA 5G5IA 2VFEA 3CLMA 4KWVA 1LOSA 4DEFA 3ABSA 4LS1A 2QF7A 2V2CA 1TO3A 3NM1A 4CCDA 1OABA 3NQ7A 1W8SA 3NPWA 2Y63A 4FX6M 3CIXA 3LCFA 3NZRA 1TPC1 5LNUA 3NQ8A 5U4NA 2CLOA 1JRCA 2Q3RA 5CZ0A 5IBXC 3M9YA 3W88A 1KM2A 4ZQPA 3S0CA 4KFNA 4Z0JA 4UFMA 5CZSA 1QPRA 1OFRA 1LBLA 4IPIA 1QOQA 4AF0B 5HNRA 1OF6A 3SJ3A 5A5WA 3A9IA 1SSDA 3TE9A 1H61A 4ICNA 4HHPA 3L0KA 3Q94A 2EKCA 2E6DA 1Q6LA 2BZNA 4H6KA 4G1KA 1W5PA 2WSQA 3TC7A 1ZENA 1RR2A 2TPSA 1QWGA 1F2JA 4GBUA 1FUYA 1Z44A 3THQA 3NEVA 3VI2A 1QMLA 3KVJA 3TDFA 2Y70A 4DO6A 1K02A 1AW5A 3FA5A 3KAOA 5DY2A 1D9EA 1L6SA 3MWAA 3FJLA 3PB2A 1O94A 1X8FA 1ICSA 1G4PA 3IRDA 4FEZA 1WV2A 4M6QA 3HJZA 4GJ1A 5HWMA 2C0AA 3DAQA 3KHJA 3E49A 4JYEA 1RV8A 5FF3A 3G0UA 1PE1A 2HTMA 4JTHA 1Q6OA 4UR7A
chains in the Genus database with same CATH superfamily
4JTIA 2PP3A 3CNYA 4QTGA 2XINA 3UZXA 5AN7A 4M29A 4D6HA 1UCWA 1UR0A 3VD5A 3IGXA 5B7ZA 5TNVA 5IDIA 2PD5A 1JCNA 5F2GA 4HMEA 2VKZG 1XIEA 1TRDA 1PUDA 5HULA 3A21A 1DEDA 3VMOA 3LCIA 2G3IA 7CGTA 1AODA 4FPSA 4GVGA 3K13A 2D3LA 2BOFX 3UNTA 1DXFA 3BW4A 1HKKA 1IE7C 3K4AA 3KOFA 1TA3A 4Y9AA 3B97A 4YXGA 2PS2A 2QCFA 3T6CA 2VYOA 2VFGA 2WW5A 3B8WA 4MB1A 2PTXA 3ZWSA 3PBWA 2C18A 3VNMA 1KW1A 4PUWA 4A21A 4WF7A 2FZ8A 4L6DA 1KTNA 4I7VA 3L5AA 1X98A 3OZYA 2TODA 1VLWA 1UP3A 3XIMA 2ZXDA 4GQGA 1XLKA 3NQEA 4C5ZA 4L56A 1JEZA 1ZLPA 3T8QA 1W5QA 3L4WA 1WAUA 4D6FA 5E70A 1BWLA 4DQWA 2VGIA 1JZ5A 7TAAA 4V15A 5ABGA 4XO7A 1KM4A 2I5QA 1FRBA 3BLEA 1P5BA 3GUWA 3UR7A 4BF9A 1QI2A 4LQ1A 3UQNA 1OHLA 2FHCA 3MDWA 2DUZA 4O57A 2HDJA 1AZ1A 1S5WA 1O66A 4AW7A 1TJRA 1XI3A 3LBMA 1W1B1 3H2AA 1DQXA 3FOKA 2EO7A 2JKPA 3T78A 3DOPA 2WCAA 4REQB 4JPGA 4BZYA 2D3NA 4R5EA 2NVCA 3W1TA 2DZPA 1QW9A 3NDOA 3RM9A 1XIIA 1V6TA 1F6YA 3V1HA 3I4KA 3QGKC 4OWGA 5BYWA 3TC3A 3UYCA 3BCDA 2PTYA 3CB3A 2FJKA 3DFNA 1F05A 1XLAA 1MI3A 3W1NA 1BWKA 3LX9A 1TV5A 1E0TA 1N55A 3VIOA 4S3AA 1X1NA 4FX7A 2WSKA 3BSGA 1O4UA 4PB4A 5MF5A 1UWTA 3SUVA 3ITGA 3R0KA 1JULA 1ITUA 2DZVA 1T96A 3H23A 1K03A 5FJPA 3WNPA 5ECUA 4C6BA 3L66A 3UXLA 2X30A 3EWDA 1G69A 1XS2A 4DB7A 2IKJA 5BOFA 2VX7A 4AH7A 4HYRA 2YR1A 4F2TA 4I6KA 3EOUA 3W7QA 5CAKA 3NA8A 1JQXA 2B0MA 5C9ZA 3B9EA 3WD2A 1J0IA 2ACUA 3FKKA 1NWTA 2V81A 4D1JA 3P61A 3UU0A 1MDRA 4IGHA 1TSIA 1A3XA 2JKEA 3WQEA 3T05A 3RX4A 3KS5A 5C9XA 4NJHA 2PUZA 5G1MA 1M65A 2ZVIA 5LXEA 1TKKA 2WKGA 5HDRA 4JYFA 3TLLA 4ZZ9A 4WY0A 4I8DA 2V63A 2ZX7A 4MG4A 1MWOA 3GFZA 2OO0A 4L1WA 5FL0A 4FLSA 1KV8A 3BICA 1PVNA 3S2JA 1EA9C 3EDJA 4CNNA 3AWNA 1KM6A 3DCPA 2ABAA 3LBOA 4P7QA 2A3CA 2NV1A 3BURA 4G1NA 2ISVA 1TB3A 4H01A 3GH4A 4ROPA 1Y8BA 4U10A 1VEOA 1EP1A 2EPOA 5FEPA 3RN6A 3A6OA 1PKYA 1GOXA 2VR5A 1GK8A 1H4PA 2BBFA 2OKTA 1KV5A 1GOIA 2PGRA 2QCGA 3S5OA 3NCOA 3CS2A 4CQDA 3FAXA 3KBSA 4BHYA 1KTBA 1DTNA 5EU9A 2XIIA 1UWSA 1UMLA 4NZFA 7PTDA 3PUEA 3BLDA 3ABZA 3CV7A 1GTEA 1F4HA 4HZ8A 3GD6A 5CAHA 1RJPA 1TPB1 4WSHA 1XLCA 3NQAA 2YYUA 3ARXA 5LGZA 1RP8A 4GX9A 3RG6A 4K8EA 1US0A 1HKMA 2Y8UA 1GVFA 1PIFA 4FR1A 2NWSA 4TVCA 3GG1A 1NM9A 5G4EA 3NXFA 5FEXA 1TVLA 3VGEA 1AZ2A 2J8FA 2B4GA 1J0KA 2A7RA 4A3HA 4B5XA 3GTFA 3POHA 1UKPA 3CHFA 1THFD 2GFTA 1KFWA 4AY7A 1ECEA 4KFOA 2XH4A 3W01A 3QMSA 4WEVX 1U1HA 2ZZ6A 1E3ZA 1XLDA 2JF7A 4HKPA 1UASA 3O63A 3WCZA 4HTYA 1WDWA 4P8UA 3ZJKA 3BJTA 4I5UA 2Z1XA 5E5CA 4L6OA 2XTKA 2ZUMA 3G8EA 1GCYA 3GVWA 3EAUA 4QLJA 1BF6A 4WY0B 2ZTJA 5ABFB 5C6MA 2AQVA 3P67A 2PC4A 3S9YA 3FJNA 1FVPA 1UQYA 4NI8A 1A5UA 3GO2A 1D3GA 4KRUA 3TYZA 4QX4A 2WSPA 4WCJA 2AQOA 1R6WA 1PX3A 3NL6A 3STCA 1OCNA 1XBVA 3MP4A 1YXYA 1H41A 1GYNA 3LPFA 1IEQA 3IARA 1DTUA 1UIPA 3W7CA 4DJDC 3IGUA 2IKIA 2A3BA 4UTJA 5JMUA 4UFIA 3FEQA 3A5FA 2VFFA 1H60A 3BMXA 1JPKA 4KCUA 4UTTC 3BZJA 4S2CA 3FSUA 1RJRA 3LTYA 1OZQA 3BPWA 3AS3A 2NXIA 3NO3A 3C5QA 3QYSA 4RL3A 1Z9AA 1X1OA 3TN3A 3WUBA 3UA3A 3RO8A 1E71M 4E8DA 5CLTA 1OYAA 2QJHA 4LAKA 3W0KA 3H7VA 2RKXA 4BJHA 2WZTA 3R6IA 4QISA 2GDQA 1LTDA 3TKFA 3U8GA 2IS7A 5EMJA 2OT0A 4CNSA 5FOOA 2QPUA 4C6PA 1PSCA 3P8IA 4C6OA 5BRBA 5EPDA 4TIMA 3BQ5A 2BWGA 1E9ZB 3M7SA 1O60A 5I3FA 5D9NA 3CIVA 4LUIA 3LHUA 4MJMA 1YQ2A 3A47A 3HG5A 3QV7A 1BQCA 2DV0A 4AFYA 2Q8XA 1V0NA 4B2DA 5DN1A 3G0SA 3I6EA 2E4TA 4AWTA 2XH2A 3DBNA 3UBPC 3RPTA 4XD4A 4AVOA 3AWOA 3NL5A 1Q63A 3VE7A 4RZ4A 3ZIZA 4GO8A 1SW3A 5I7GA 1XRSA 3Q58A 4N0RA 1TV4A 1PYMA 2FVKA 2WANA 3FNDA 2FH6A 2OWCA 2AL2B 2VO5A 1TCDA 2AMGA 4ZE4A 2POTA 2YJQA 1BAGA 3W2JA 1E70M 1SZNA 2YCLA 3N25A 2G4FA 1TPFA 5I06A 2C0HA 2ABBA 2BHUA 4AUBA 5BNKA 3UZWA 4NZ5A 3PUOA 1R86A 1OCQA 4O13A 2VC6A 4R34A 1G4EA 4JXCA 1HL2A 1MDLA 5I0DA 3U2CA 4JKLA 1E55A 1PX8A 3C6CA 3V1PA 1Z8AA 2V5JA 3HPZA 3WLOA 2LLEA 2VNCA 2X7VA 1XSJA 2VOTA 3TQ0A 1V02E 5EGRA 4FF5A 5IDZA 2OYMA 3AU2A 4PFMA 1X96A 1HFBA 4JTKA 5DRIA 4UCFA 3T40A 2PURA 2C19A 2WJDA 4Q7NA 4XTIA 4QS5A 5I3IA 3B3DA 4IZGA 2UY4A 4M51A 2VMFA 2QAPA 2BLEA 3DC0A 2C8NA 1QPOA 4XKYA 4LVFA 1UPMB 4LAZA 4HU3A 4POCA 4BCEA 3FSTA 2NXGA 1LOQA 4ZOAA 1ZHAA 2DJLA 1OQFA 1IGWA 3WL0A 1A5MC 1AW1A 1YADA 3I65A 3U48A 4BF7A 4WKAA 4HSOA 1U1UA 1CGYA 5XIAA 2GLKA 3R94A 3ZJ6A 1MFUA 2FVLA 1W1VA 3UZZA 3B8UA 2FFCA 4NJGA 5IOBA 1V77A 4NX0A 3VC6A 3BOXA 5E0FA 4RE0A 2YLLA 3LHZA 1VFFA 3N3MA 3CT7A 4IJCA 4FLRA 4MDOA 4Y9MA 1W3LA 1Q6FA 3VD9A 4AEFA 3D47A 1NF0A 3CEPA 3LENA 2VXNA 7ODCA 3HZ3A 3VMPA 3W9ZA 4MUZA 4IUOA 4UFHA 3EB2A 5EKYA 1JCYA 1K9FA 2ZBTA 1ONRA 3W1AA 3QQ1A 1EDGA 4L1GA 3PPGA 1JAKA 5LIKX 4WSKA 4TXEA 3S6DA 1UR9A 3GR7A 4WJEA 1FWJC 5T8GA 4X22A 3WG6A 3BH4A 5IRPA 1VFOA 1TZ7A 4DF2A 3U4FA 1TTQA 4U3CA 3N11A 3G1SA 3SCRA 2BOEX 1V93A 3GR8A 1IIHA 1UOZA 3UZ5A 4JL1A 3LCXA 3QW4B 1P7TA 3N73A 3P5YA 3PSWA 4LUSB 3CU2A 3DFQA 5BXRA 2PA6A 1OT1A 4NILA 1SZFA 2Y6ZA 2C15A 4KWUA 1JCXA 1C90A 4AISA 3CL7A 4E38A 1EGVA 1JZ7A 4DYJA 2TYSA 3C2YA 4CCEA 1BPLB 2G3MA 3UG8A 4DBWA 3KBVA 1XCXA 2OCZA 3KL5A 1POJA 3VZYA 3V3WA 1J6OA 3TEVA 2I5GA 5MKGB 4GQQA 1QASA 4FNUA 1MXDA 3GFXA 3N2BA 3PHAA 3QHMA 3N1AA 3IJDA 5GNZA 3R8GA 5KTLA 3UXDA 3F2BA 2QLYA 3L65A 3UJSA 1M6JA 2DW6A 4J3ZA 4JTGA 1FWWA 5T9BG 1QNPA 1PTGA 1AVAA 3GTHA 1ZU8A 1QO2A 5HWJA 2DPEA 1ZBWA 4YYCA 1Z48A 1N82A 3WDPP 1VPQA 4XIMA 3W53A 3PZOA 4UMBA 4MTVA 1XPYA 5DO8A 3CYVA 4E2DA 2WVUA 1KM1A 3MYOA 2DZTA 1ISWA 1K9DA 3R89A 5AHLA 3KP1A 1XFBA 3CM4A 3P5ZA 5EMMA 2XISA 4ZR8A 4BY3A 1DIEA 2RJGA 3CAWA 2JIWA 1KR0A 5I23A 2XVKA 1BSLA 3CWNA 3DFPA 2ZZ3A 2KAUC 4DRSA 2J9XA 2XJ7A 3GXPA 3QEZA 3BOFA 5FKYA 3M0XA 2ZUVA 3LXBA 3OOQA 1H7OA 1A0EA 3L2MA 4N4QA 2Z29A 4QR6A 1W3TA 1HN1A 5D2YA 1MXSA 2Y8KA 4HK7A 1QTWA 2X09A 3VFLA 3GIYA 1EGZA 1JPMA 2WLYA 4ZXLA 5B80A 4DUWA 1V4YA 5I5RA 4O18A 3LSBA 4LBSA 1NAL1 1XG4A 4UQEA 1XKYA 2HK1A 1M01A 1SFSA 3OTRA 1EKOA 1LRNA 2NLIA 1XBXA 3EGJA 3P82A 2VGFA 1JVNA 4URIA 2RH9A 3RFAA 4MAVA 3TSBA 3NQVA 5DMLA 2NQ5A 5H2ZA 4EXQA 1N8WA 3MCOA 1DIOA 4NIRA 3NFUA 5FJJA 2FPVA 2J27A 5AB3A 3TN5A 2Z28A 1VFLA 1T0OA 3TXVA 4D1IA 1TPVA 2V6AA 4J2PA 2WNQA 2DSUA 5IBXA 3VNZA 5G2HA 1ICQA 3AU6A 2CLFA 2VL4A 4WK9A 4DXKA 4TX8A 3UEQA 5EL1A 2AGKA 1CECA 4QEEA 2HV5A 3WJSA 2EBNA 3WL1A 1CLKA 3P84A 4JQ2A 1KGUA 3KVKA 5EA9A 4GHRA 2BY0A 3NQDA 1XYBA 1O5XA 2ONEA 3UWWA 2E28A 3H55A 3LB0A 1WKEA 2CLLA 2WC3A 2FQIA 1DOSA 4AIUA 1W17A 4FSAA 1V6UA 4DJEC 4XX6A 1W9XA 2QDDA 4MKSA 3VAVA 3L21A 5KINA 3JU2A 3PB0A 4NXKA 3NPXA 2BASA 2W6RA 2P50A 3E2VA 1QCWA 2VEPA 4DAIA 1HTIA 2PPGA 1QXLA 3WN6A 3H53A 4K6AA 1WDDA 1K8XA 2R8WA 5D30A 4EXAA 1IR2A 1UWIA 4E2VA 4XISA 4J3TA 4XD6A 3HGOA 4O54A 1VS1A 5T91A 4NHVA 3OEXA 2DFAA 5M17A 4DO4A 2YCKX 4GIYA 3K5XA 1HKWA 2OZ8A 3KOYA 3UJ2A 4Z1YA 2A7PA 2G3JA 1A5BA 4ZQMA 3GVGA 4C1NB 3M0YA 4CUCA 4B9YA 3INPA 2XVLA 4I7WA 1EL3A 1GQKA 4GH3A 5D9PA 5FAJA 4F0KA 1PIIA 4KFPA 4AY8A 1UR8A 1KXQA 3DI1A 3MSDA 1O1HA 3S8HA 2VC7A 3WBYA 1M7JA 3CL6A 4MJ4A 4ASTA 5G4WA 2VX5A 2FMNA 2ZXQA 4AHPA 1EIXA 3BL3A 3CUFA 1HUVA 3T08A 4TTGA 2ZA3A 1ZBVA 1XGDA 3I7SA 3UETA 4PC8A 4O11A 4F8XA 2A6NA 3K2GA 1J79A 2J7BA 3TW9A 2NUXA 2WAGA 3L5LA 1ZAHA 3QGAC 2ZA2A 1XM3A 2VM8A 5HNUA 2VD9A 3VKDA 4HA4A 4NQ1A 3V0SA 5B7YA 4JIPA 2CC0A 1JPHA 4JHZA 1R87A 4IIEA 4TV5A 4IQLA 3TQPA 1KXHA 4U2ZA 3LK6A 4F0SA 3ANVA 2PDMA 1MZHA 4PMUA 4XKYB 1A50A 2FYMA 4ZOCA 4ZENA 2J24A 3TJXA 3EKLA 4RZ5A 1BG4A 3UD6A 2GQ3A 4ALDA 1J12A 4C6MA 3PFMA 3SY1A 4A3YA 1EJTC 4J3VA 4K2SA 4MNLA 1YKWA 2POZA 3LDVA 4PN2A 5DCBA 3HQPA 1NU5A 3LOTA 3LNPA 5KZEA 3PBUA 1U5HA 3W28A 2P3EA 3N3TA 4KGLA 3U7VA 5F1UA 2CXGA 3E3HA 4Q32A 1KCKA 1XLJA 1VGAA 2GQ9A 4HSNA 3PBGA 4FNPA 4DUVA 1FCQA 5HK4A 4KF1A 3W7EA 1NOWA 4E3VA 6TIMA 3SECA 3R8RA 4DX3A 7REQA 1TWDA 2AAMA 4I9TA 4WJ8A 3W75A 4CQ9A 2PWGA 2WYSA 4JN6A 4ZO6A 1WKYA 1JFXA 3K4WA 1TQJA 3B8SA 1JDAA 2FIQA 4TTUA 2ACQA 4RR4A 3M07A 1OFOA 4WGXA 3UJRA 4OFCA 3GNNA 2QCEA 1JG9A 3K8KA 5D2WA 3GDRA 2BXYA 2GUBA 3NNTA 4PSRA 3QV6A 5A6JA 2IXUA 2CLKA 4IG2B 3VGDA 4GI9A 1E4MM 4YMZA 2R1MA 3WEZA 1KC7A 2EG6A 2QZRA 5A8QA 2PTDA 4EIVA 2A6LA 6XIAA 1PDZA 3EWUA 1E3XA 2YIHA 2J7GA 5AKQA 2UV8G 3PAJA 3MANA 4DZ5A 4JZ5A 1I4NA 2VR4A 3LNMA 4AEOA 4AYGA 1CEOA 1UR2A 3NXLA 3VNDA 3H12A 3AIVA 4YHGA 3J7HA 3SRKA 1MNSA 5C8BB 2FZNA 4CNPA 2PWHA 4V27A 2XN1A 4O1EA 2IQ0A 3GK0A 3ZO9A 4JEQA 4YHEA 4B5TA 5AVHA 1XCWA 3LCHA 1QRQA 3WDIA 4W8AA 4DZAA 1YPFA 4W93A 3R79A 1WUEA 1AL7A 4QQ3A 1UA3A 3EMZA 3PR2A 3A4WA 1C7TA 5REQA 5DMMA 4C6KA 5M1TA 3RLGA 1RPKA 3AS2A 4LAMA 4TX6A 5J04A 3TVAA 3ARWA 3KFTA 4KPLA 3EDKA 3W1LA 3T44A 4Z42C 4XD5A 2Y7EA 4UIOA 4RNIA 4DJDD 4AWEA 3T2OA 3WLMA 1UC4A 4IMAA 4O12A 1M1BA 2Q6ZA 4DZHA 2WO5A 3I7QA 5DEZA 1H7WA 3I6RA 4BWLC 3NSMA 3DGBA 7A3HA 3LLDA 1ENUA 2F7FA 3H2NA 4GIEA 4MB4A 1VHNA 3IEBA 1XWYA 4LC8A 3U5UA 3ITYA 1CZ1A 3URNA 1P0BA 3RX3A 3QR0A 4ZB2A 1MUMA 2X1RA 4M1BA 4F2BA 1A5KC 1RVKA 2JQXA 1EZWA 3AICA 4ZBCA 3KVMA 4FI4A 2SFPA 2GUYA 4A3UA 5A6MA 1KXTA 4C91A 3DHDA 5SWUA 4GH1A 1E6XM 2DVTA 1M04A 3BAIA 4QGCA 1X6NA 1ZBKA 1KKOA 4UTLA 1JD9A 2OLHA 4E5TA 3PC0A 4EPKA 5FJRA 4ZB0A 6ALDA 2A7NA 2F38A 1LOLA 3SDOA 4AEEA 2X2GA 1GUVA 9RUBA 3KM8A 3TWBA 3UZYA 2HS8A 1I2OA 2OQYA 3K46A 4P8XA 5GJMA 4PTVA 3SSJA 3GM8A 4AAJA 1WKFA 1PPIA 1J93A 3IIZA 1U30A 2BS9A 3BDKA 3M5XA 1E6RA 2X0SA 4QG6A 3I6TA 4RE2A 1POKA 3WNMA 3L2IA 2J6VA 1UWAA 1GVYA 2OYKA 1FXPA 4D8LA 1W9PA 1KFEA 2TAAA 4P7RA 4DI8A 3HFTA 1YTKA 3GFYA 4UZSA 4R9OA 3VOIA 3P3BA 5XIMA 3WUGA 2ODOA 3MJYA 3FVMA 4YN5A 1DWJM 4KWWA 2H9AB 3ONCA 2GOUA 4Y96A 4ZA0A 3M0ZA 4AMCA 5FF7A 1XG3A 2GJLA 2YW3A 1EC7A 1J5SA 3URAA 1EP3A 3EEZA 3MKKA 4JTUA 3WNOA 5DBUA 3Q37A 2XWDA 3LHYA 3PN8A 4E4PA 3RPMA 2FJUB 1WA3A 2J9YA 1Y5XA 4HNTA 5E0KA 4HHMA 4G5DA 3M47A 2V2DA 1CXIA 2PTWA 2V0TA 3P60A 3LTPA 3HJEA 3CIWA 3BAXA 2QUTA 1XDLA 4XZLX 5FI8A 1E4IA 4DLMA 5A69A 2WB5A 1XLHA 3SUTA 2PZNA 1O7AA 3W81A 3ZR5A 3W7RA 3P6LA 4IMEA 4LNYA 4QQUA 4BA0A 3OBEA 3ES8A 3N29A 2PWEA 4Q33A 2C91A 3MMDA 3WUFA 4ZOEA 4C1LA 1E6SM 3GAYA 4PMOA 3RK8A 3S47A 2VVSA 4ZMGA 3CQKA 4HYWA 6A3HA 4Z2HA 4YVVA 4X0VA 3H4GA 3QSRA 1WDRA 1XKJA 2PGWA 3JR2A 3WK0A 2P5NA 3LGGA 3UGRA 3AYRA 1M5WA 5DELA 2G96A 3VKCA 3LXCA 5FF0A 3EDFA 2PF0A 4F0LA 4GQBA 1T41A 3VM7A 3PY2A 1SO6A 1TV3A 4IIFA 3VGGA 3VZXA 4RUBA 4M6VA 5PTDA 4C65A 1V08A 1TJPA 3V0TA 2XFFA 5G5IA 3CLMA 1FWBC 3VA8A 3VOFA 3WYZA 3FV9A 3L4YA 1RBAA 4LS1A 2QF7A 3OZOA 4PTWA 4CCDA 4Q8OA 1OABA 4LYKA 3NPWA 2Y63A 4PMNA 5BXSA 5LNUA 3GC5A 5IBXC 3M9YA 3ARRA 4BKNA 4ZQPA 3S0CA 3WLPA 5CZSA 5BXTA 1W1A1 2W92A 1X8CA 1DQUA 1Q4NX 1M41A 3QXBA 1PDYA 3AIRA 4H2HA 2INEA 1K77A 4EWJA 5ENLA 4LX4A 4N42A 1ZENA 3AHTA 3C0SA 1F2JA 1VAHA 1XD1A 1KRCC 4G8TA 4A8NA 1REQA 4PTXA 1MRQA 2OOGA 3KAOA 1Q85A 3T42A 3MWAA 4AZ5A 3N04A 2XH7A 4GJ1A 5HWMA 1LUCB 2OZTA 3POCA 3E49A 1I9CB 3VX1A 4EAYA 1KBIA 1YPXA 2VVNA 2NW0A 4JTJA 4G56A 1B3ZA 1OYCA 2ZTKA 2XIQA 3UPWA 1MYRA 3NPVA 2WM1A 1ZJBA 2GJPA 2NV9A 4CNOA 2QULA 4O1DA 1VJSA 2W4XA 4BEUA 2FTYA 2VX6A 5CCZA 4DF0A 3KTCA 4NAFA 4BWLA 4M81A 4S38A 2MANA 3B9OA 1FDYA 3ZOAA 3SN0A 3AIWA 4QJ4B 3ZLHA 1O5QA 3LMZA 1H49A 3W83A 3WDRA 2NX9A 4H8UA 1TUXA 3GIQA 3Q67A 2RDUA 4U5KA 2PLMA 4ZQNA 4NYYA 1FWTA 1QDSA 3JVAA 4ZO8A 3W6MA 3KS6A 3O8AA 5AZ0A 3OZMA 3PJUA 4X9YA 2I17A 4PB3A 4R88A 2E8YA 4OU1A 2ZUTA 3HMCA 2BVWA 3OQ8A 4JN7A 3QJAA 1OT2A 1YRRA 2P1FA 3WMLA 3TMLA 8TIMA 3HG2A 3EOLA 3LA4A 3A3WA 2CWNA 5DX7A 1R3SA 2Q8LA 4IMCA 1VYPX 1V3HA 1JFHA 2HS6A 1QNOA 3W7HA 3F7JA 3UG4A 2J47A 2J4GA 4GD0A 3VIMA 4NZ4A 3VC5A 3TU9A 1D3CA 1LT8A 1VFTA 3S9ZA 1H7XA 1BF2A 3M43A 3NEHA 2ZZ7A 3UXIA 3FAWA 3VIIA 3TN6A 2NX1A 2DU2A 1U1JA 3QM3A 3OYXA 1W3HA 3AYVA 2QCHA 4L65A 1P0DA 3KOZA 3TW7A 4QAWA 3DH7A 3VUSA 4IPLA 1XIFA 5DQPA 4WKHA 3H7UA 2C1HA 2QQ6A 3EXTA 4KEUA 3CAQA 3E0VA 4UTHA 3UPBA 4UNIA 4WX2A 1A4LA 3OGVA 3ZT7A 3WQ8A 1WDSA 1H50A 3BSHA 3DFSA 4MY1A 1VKFA 2WVVB 3NJ3A 1TVPA 1QPNA 4HBKA 4OTKA 2HBVA 4L61A 2DDXA 4MWAD 4PSPA 4YVXA 4U2YA 4MM1A 1V3LA 3LI0A 3CQJA 1GTHA 1TTJA 2R91A 3L0GA 3N19B 2FDMA 1M3UA 1TCMA 3URBA 3FFSA 4GYPA 1XYFA 4H9MA 1G5AA 5AYXA 4Z2GA 1MFVA 2YZ5A 3O9NA 1N2VA 4B5WA 1UUQA 1TZ9A 6CGTA 3SQMA 2ZUWA 3VDGA 3AHVA 4N7QA 2H8XA 3C86A 4WJXA 4GXPA 3MMWA 4ERIA 3HQ1A 5CPQA 4PUJA 5A2BA 3IANA 3UA4A 5D8WA 3G24A 4I9AA 1KBBA 2X2YA 3SAZA 3VO0A 1PYFA 2FHFA 3W1RA 2CW6A 3WJYA 3WQPA 4JTDA 1EP2A 1HW6A 1XX1A 4C6NA 1WCGA 3EX6A 3NQMA 2PBGA 1JDDA 2R94A 1A80A 1PEZA 3I3EA 4KW2A 3QY6A 2OWWA 3HOJA 5FF4A 2MNRA 3GBDA 1CI1A 3OVPA 2G41A 2G37A 4JKKA 1OEPA 3LM3A 4P7NA 2WBKA 1R38A 3CEUA 5H1WA 5C7HA 2R9RA 1W91A 2QDHA 2VQUA 3EWWA 4UC5A 2G95A 1VYRA 4AZ6A 3AC0A 3OBAA 4H8HA 2X41A 4PMVA 2WV8A 4FOJA 4Q7BA 4ATLA 1DJHA 4JNZA 4N9DA 4ERGA 1AK5A 4KCWA 4PEKA 1GT8A 2GK1A 2HPIA 3CUZA 3QPZA 2PODA 3EDDA 5K3VA 1ZPTA 1H3GA 3EWBX 1E9YB 4Q8WA 2BXZA 3WD0A 3GH7A 2G50A 1NEYA 9XIMA 4IIBA 4P2VA 5I24A 3HB9A 4Q8MA 3TV8A 4GOAA 1PTDA 1ISVA 1DE5A 4MYXA 4S23A 4UR9A 1ZQ5A 4Q6JA 3N4AA 3L4UA 3GDTA 2WMHA 1R9ZA 4MZYA 4D8AA 2C7FA 1GORA 4PUDA 3FY1A 4CQCA 2PDBA 4C1NA 4LALA 3IVTA 5IXEA 2GGEA 4C6JA 5A6BD 3ANYA 2VDHA 1UQZA 3SJNA 4WIWA 4MWAA 3EWZA 3UVIA 1AD4A 3S6TA 4AIBA 3WH6A 1EPVA 1S3HA 4H1ZA 2DIJA 3VGFA 4DJFA 2F61A 4W7UA 3EOSA 1GVSA 1SVDA 1WBHA 3EA1A 2NQLA 4UXDA 5BMXA 1KLYA 1XGEA 3LRKA 4GY7A 4YYFA 3OODA 2KZHA 3HBLA 1SZRA 3ITCA 4Z1BA 1WXJA 1E6ZA 3VK5A 2XFRA 3FLUA 4M82A 2YL8A 4HNVA 2NT1A 3EX1A 3GU2A 2QR6A 3VIJA 1FWCC 2XIBA 1ZB5A 1KRAC 3SCSA 2F2HA 2E1DA 3BZGA 1E0VA 1FWAC 3CTTA 5AC8A 4JL2A 3B8TA 1QT1A 5D32A 2GGIA 3ZLFA 4QROA 3WMBA 2CNCA 5FD0A 4EANA 5BWAA 2E09A 1TR1A 4G2DA 4HN4A 1YPIA 4H00A 3TYCA 5F1VA 1Y0EA 4RDYA 3R4IA 1LLZA 4H83A 2Z6JA 4IPNB 3PBMA 5KSWA 1JNDA 2W0UA 1B5TA 4B4HA 4AWSA 2QJJA 1OF8A 3PTKA 3NWRA 1REQB 4FXJA 3PFRA 1UP0A 4PFHA 3WF1A 1S1RA 1YX1A 4LRTA 1C9DA 3IK4A 3WQGA 3LERA 3W7DA 5ABHA 3K8LA 5CBIA 3SCOA 4NT0A 2WJEA 1ZZMA 3PJXA 3ARSA 3KCOA 2Y8VA 1JZ3A 2VX4A 3KL3A 2RAGA 4J5NA 4AD2A 1MEIA 2YA1A 4DUOA 1C8VA 5HMDA 4B91A 4IPJA 3K8MA 1C29A 3SFKA 3ANUA 3CXOA 4X60A 1XC4A 3TYAA 4H6RA 2VT0A 4ZVJA 3DERA 4TMCA 5CC5A 2ZWYA 3H2MA 5KMYA 1JAEA 4K68A 4XZNX 5A6BA 3R0UA 1PKLA 1SJCA 4PMXA 4NAFB 3USZA 4UTMA 3U5YA 1F8IA 1ZL1A 2IQDA 1GYLA 2F2KA 3D6NA 3ZFHA 1DJXA 4ZTXA 3MCNA 1NWUA 1NOUA 4AVFA 1KBKA 2JIEA 2VOMA 4BS0A 1B3XA 2XSAA 5HR6A 2JALA 5FF2A 4JBRA 3P8JA 5AYYA 4RXGA 3SI9A 4GK8A 1IT7A 1P6CA 1AW2A 2DVUA 2IQTA 3NQ2A 2BMBA 1FX6A 4PYSA 1OFEA 3G1DA 5FA5A 4UCGA 3R25A 3K1GA 1UROA 2NQHA 4US5A 4GI8A 2E9BA 4J2MA 4EP8C 1SSGA 4YPJA 2W27A 3AMGA 1RQEA 2E3ZA 3HIJA 4X2RA 4UTUA 1C8XA 4Z1CA 1ZP3A 2CIPA 4DPPA 2WMKA 3BC9A 1A49A 1E72M 5REQB 2D0HA 1O5KA 3O6CA 5FACA 4HK5A 2F6KA 2XGZA 3P80A 3WQ6A 2DSWA 2FZ9A 4JYDA 4HMDA 4PRRA 1E6QM 5L6UA 3UR8A 1XV8A 3F03K 1SZGA 4UZUA 3B40A 1EJ7L 4LV4A 1IEWA 4JIIX 5HQEA 3ABXA 1UKTA 4W8BA 4MADA 4A2RA 4NYUA 1TWZA 4FIRA 3WMCA 4H2CA 2PFHA 2XN0A 2A3HA 1QHZA 1Q65A 4UMCA 1Q5MA 2B7QA 3TTQA 3G22A 5H8UA 1AD1A 1W9VA 3O07A 4EVZA 2ZZ1A 3LHTA 3DFYA 3ARZA 3DHUA 5CPLA 4DNMA 1DWHM 4LCRA 1X6UA 1QWKA 5HUPA 1H62A 4WLCA 1QAPA 2WZHA 3NVDA 2WPGA 2TMDA 1B3VA 3ZM8A 4JIRA 4Q4KA 5H91A 3BJFA 1H1NA 1K3UA 3BMWA 4I90A 3CZLA 2EPNA 3TZFA 4O1FA 1UR1A 3CBWA 1YNPA 3CC1A 3N15A 3TA9A 3LBCA 3F4NA 3KOXA 4NZ1A 1OBAA 1FQ0A 4J7RA 2Y5SA 4HSHA 3V35A 1PIGA 2B81A 3UY8A 2CERA 4JY9A 2JGYA 2Y4SA 1XLEA 4XAZA 4JFTA 3EB4A 1ME7A 4B4FA 1C8YA 3TX9A 3EX2A 4QXIA 4ZFMA 1K7XA 1ZP4A 3C2VA 1EO7A 1GG1A 1PKMA 3CK5A 3T0TA 2PRLA 3QY7A 5JH1A 1BXNA 4YTRA 3QYQA 3PZVA 1H0GA 1I75A 3IIPA 4O15A 3SURA 1TTPA 2JFEX 5C9UA 1NY1A 1JZ4A 5EY5A 2G0WA 4NF7A 5HJXA 1SUXA 2ZRYA 2WJZA 3VKKA 1DIKA 4IJRA 3PBYA 3W1QA 2VC5A 1JDFA 4K39A 2ESCA 2PP1A 3VCNA 1OC5A 2INZA 4YTTA 3DKJA 5C2CA 4L9ZA 1HXJA 4HP5A 3N14A 1XD0A 3GHTA 4BR1A 3UWYA 1EJUC 4MZ8A 4OECA 4PCPA 3TW6A 3R1ZA 5CGQA 1EH9A 3WJZA 1QI3A 4MWAC 1RZMA 2YW4A 3WQVA 4E2BA 1W5NA 4BQ2A 3RUBL 1XBZA 5F2IA 1IWAA 4A8LA 1JYNA 5CBJA 1GJUA 5TBOA 2TSYA 1L2UA 5C55A 3B8DA 2R1LA 3H54A 1BYCA 3VNIA 3RYSA 1KWKA 1V6VA 1L6WA 3CJPA 2PDPA 3B8IA 4I3GA 3PJTA 3C3UA 3KZPA 3EA3A 3RRAA 3NYZA 1DJIA 5DXXA 1E5NA 3LQLA 1EPXA 1ZS2A 1P6WA 1YBQB 2ZE3A 6REQA 3M0IA 4LEFA 3OO2A 4K1WA 2PDWA 2BNJA 3WFAA 1SO5A 1FH7A 3FGCA 4OT7A 4LS2A 4LY4A 1XINA 1XLLA 4XAPA 4NRRA 1LYXA 5AC5A 1UJPA 2V9DA 3W23A 1FWSA 1DWGM 3HQNA 2GJXA 1ZJHA 3M0JA 1P43A 3P74A 4FNSA 1E4LA 2OFJA 4IQDA 1OIFA 3TA6A 2PLCA 3AROA 4Z1DA 3QR3A 5BU6A 5EFDA 3FKRA 1CYGA 3MO7A 3F1QA 2IKGA 4QIUA 1CLXA 4HQVA 2BGNE 1MW2A 1HL8A 4XVEA 3VOJA 1VEPA 4QLKA 1KRBC 1R2SA 2PI6A 3KBNA 4NAEA 1H7PA 4IQJA 3BV4A 2CU0A 2CHRA 1T99A 1HKVA 4ZB5A 3QW3A 1QUMA 4M24A 5F4SA 1A5SA 5C71A 1PKNA 4S3GA 3MZNA 4YTUA 3TTSA 1UD3A 4GMEA 3VM5A 1B1YA 2ZDRA 4D72A 4KRZA 3ZYZA 2AAAA 1VP5A 4B92A 4BEQA 4UB9A 3CH9A 2FDSA 1DV7A 4F66A 4MLJA 4ZFCA 3W7IA 1OFPA 5FSDC 1DPMA 3WLRA 3LQGA 1F8MA 4GNJA 4DUXA 3GNRA 3GXDA 5LKYA 3EEGA 3OHIA 2HBXA 3TTOA 1R3TA 2BVTA 4K36A 1V3IA 2YDRA 1X1ZA 5CJMA 2QVNA 3V5OA 2HRWA 2PDHA 5CZKA 2OSYA 1L8NA 2XDFA 3ABOA 5IFTA 1R5YA 3D3FA 3WF3A 1LT7A 3FYPA 3RU6A 3S5SA 3UGVA 1GW1A 2DP3A 4Z2KA 2J7HA 4KH2A 3GZ3A 1S3TC 4LT9A 4H6QA 3BUVA 4GO9A 1Q6EA 1UUMA 2XVNA 4AD1A 2EJ1A 1JPDX 3FDGA 2ICSA 3ENLA 1WXZA 1SQ7A 4PUKA 4ACZA 2W5FA 2EG8A 1I6NA 4HPXA 2ZRVA 1MZRA 2BY2A 4QDMA 4EK7A 4JDYA 2Z1VA 4FF7A 1XL9A 3WQ5A 3QSTA 3OGSA 3LG3A 4S1FA 1Q66A 3WLKX 3IJ8A 4JFSA 5BOEA 4B3LA 1GWJA 3W07A 5AVNA 2V3DA 1JUKA 1WXYA 4HZMA 4FAMA 1OSEA 5G2WA 4C1KA 1JNEA 3CQIA 1YDYA 3QOKA 3WSUA 3FCPA 3W3OA 1DIDA 3S42A 2BOGX 1ZALA 1UOKA 4TUFA 4HN8A 1CENA 1J5TA 3IS4A 2ZOXA 1HGYA 3FYOA 4PTNA 1RLDA 4WY0F 2OZ3A 1EJXC 1EIBA 2ACRA 1R3WA 3G3DA 4AX6A 2NQJA 4GQRA 2VP8A 3TQKA 1LWJA 4LU0A 1R3VA 4QCEA 3H4XA 3SGUA 1KB3A 4R53A 2P8CA 1OX5A 2Z1BA 4W8LA 3MMTA 2RUSA 4Q8UA 5LZLA 1T8XA 3BGJA 2Y61A 4D9PA 4E2OA 3W6LA 4BI7A 1ZCCA 4EPBC 3M0VA 4U3AA 3U3HA 1GPFA 1S46A 2Y89A 3GRIA 5F4WA 1BVNP 1W31A 3U2OA 4F3HA 2B7OA 5ABFA 4DJED 1KQZA 2P88A 1J6PA 2XGIA 5HINA 2CETA 3HGSA 1GOOA 3AI0A 1EWDA 2AQWA 2I9EA 1T7LA 3TAKA 2WWCA 3SEPA 4TU1A 2GPTA 2PGFA 2Z1KA 4H9UA 4HPJA 1KCZA 4GG9A 2Z7GA 1UG6A 4GABA 2VEGA 1VB9A 1ZCOA 3GDLA 4ZE5A 3ALFA 4DO7A 4O14A 3H21A 4GUJA 3RLUA 4XAFA 3W1MA 4I5XA 3GXFA 3LHVA 5LA2A 4CLMA 4QSFA 1DJNA 3PANA 4MB3A 4LB3A 3ID7A 3MHUA 5A8NA 2D20A 2WVVA 2GDVA 3A64A 2ZC1A 3AISA 1ADDA 2P8BA 2HNEA 2VZOA 4NJJA 1KO0A 5CPTA 3GR4A 1K8ZA 3RHGA 3B4UA 1R7AA 1ECQA 2GVJA 4IMGA 4C7GA 1E51A 1L6YA 3G1YA 4GY0A 5CH9A 4UWMA 2HE8A 4PULA 3PG8A 5AOUA 1V7AA 3W38A 3MUZ1 5CPSA 1OG0A 4JX4A 2DUXA 2NXHA 3RMJA 1RA5A 5JUVA 1YNQA 4KERA 4ORMA 2Z27A 4QE4A 3W22A 4PR4A 3GB6A 3MCMA 3B05A 3W6YA 2C6QA 4B3ZA 3WH7A 2QUMA 4OVXA 2ZIDA 3MW7A 4HCHA 2J6XA 1TPDA 4NNAA 4PRWA 4Y8EA 4Z17A 4ZSUA 2HSAA 1G67A 1W1PA 1GVQA 1F9CA 1HKJA 1V51A 3OLGA 4YIWA 1P48A 3PF3A 2XVGA 4JCLA 3TK7A 5LYRA 3S6OA 2D24A 4K1GA 2XIMA 2DH3A 3CHDA 1IYXA 5AHNA 4LBRA 5EMYA 2I7GA 2AL2A 4J3XA 4IUGA 1Z69A 3VDHA 3AAMA 3B0UX 4EF8A 1J0ZA 4AZ7A 1U5JA 4ATDA 2XUCA 3S5NA 3UJFA 4LWWA 1WZLA 4P7LA 3LCLA 4YS1A 3B0XA 5HUOA 3KHDA 2VENA 2I5IA 3U6WA 4CEXC 2ZZ2A 1B57A 2DORA 2CBVA 1GVEA 2QNEA 4X63A 3AXMA 2A85A 1B0IA 2CZFA 5DMYA 2E6AA 1FP8A 3QFEA 3Q65A 4PMYA 1WOAA 4J9JA 3RO6A 3DG3A 4Y9PA 2OMAA 1IWPA 3PZQA 4BI6A 1CXHA 2CESA 1EUAA 4L7ZA 4CN4A 2VCAA 5EBAA 2D23A 3DGRA 1JZ8A 4GZIA 1JF6A 1BKSA 2V2HA 4Q4RA 1DHPA 1I0DA 6ENLA 1OX4B 2OQHA 2WHJA 1CXEA 3DX5A 3KP0A 3MI2A 3W7GA 3NG3A 2VD8A 1VCVA 3BWWA 5GVJA 3F4DA 2PB1A 4ACZB 2UY3A 3S2NA 4YL2A 3GWQA 3O7UA 3L5MA 3HGRA 2A3AA 4LYRA 5HQLA 1RK5A 3IJ7A 3PZIA 3URQA 4Q4PA 2IPJA 3ECQA 1QPKA 2H6RA 4OHQA 1JCJA 3NQBA 4W86A 4PEEA 3EKZA 3OBKA 4AD4A 3CMGA 3IUIA 1L2QA 3IAPA 1G6CA 1EZ2A 1DJYA 4AZCA 2DVXA 4X61A 3VIPA 4M7TA 1AQMA 3CPGA 1ITQA 3A12A 2DT3A 4YVPA 3GNOA 5H8MA 3BAKA 4H6EA 1FDZA 2CZEA 3GU1A 4JIEA 3M7WA 3C4UA 3ES7A 4F9JA 3BG9A 3VDBA 3WFZA 2C1GA 4V33A 3RM8A 3GVVA 2VDGA 4NU7A 4IGSA 1W32A 3P7YA 3W00A 2X0HA 1LLOA 1US2A 2J8GA 2VQTA 3O15A 4FR6A 2W66A 3ITOA 4QJ5B 1ALDA 4EE9A 3EOEA 3G1XA 4ADUA 3E02A 1JYVA 3MBDA 1B3OA 4XZ9A 2E6YA 4IICA 4Q4SA 2WJFA 1NJJA 2QV5A 3PZNA 3SUWA 1DJQA 2YKKA 2VEKA 1P7TB 4GLEA 3W4RA 4LUSA 2YA0A 3BE7A 4U33A 4EOUA 4J4KA 2ZICA 1W2VA 2NUWA 3GU9A 1PHQA 4OBTA 1OFBA 2CLEA 4AIEA 3TOPA 1S2UA 1N7KA 2IPWA 2ZZ5A 3C0LA 4W87A 4CD6A 3T1GA 2W79A 2HCVA 1CXFA 2HQAA 1XYLA 4YCPA 3DXIA 4X2PA 1OD8A 1JCLA 4LSBA 4IX2A 5AC6A 3W84A 1V3KA 3ME3A 1VFSA 2V3FA 4FHAA 1YYAA 3QLLA 4JIQA 3OB8A 5FESA 3CPRA 3B4YA 5HBFA 3GKAA 2B7PA 2VC9A 1AH0A 1VBGA 4O0KA 3ITXA 3BG3A 1OINA 4H7ZA 4WOQA 3UR2A 4Y2WA 1XLMA 3F4CA 4GYKA 1S2CA 4F4RA 3WQDA 3MSRA 1RCQA 2OEMA 4NZJA 2CYGA 4E8CA 5EB8A 4RW3A 1QK2A 5LIUX 3VMNA 2E67A 3TONA 4AWUA 3QLDA 5M03A 1Q7ZA 5C2GA 2IW0A 2OPJA 4M1RA 1TV7A 1BG9A 4GBDA 3R12A 3KOWA 4JQAA 3SCWA 3EMQA 1EEPA 4DNHA 1TFVA 1MUCA 3ALGA 5M5DA 2V5LA 2V5DA 1A0DA 1Z6KA 3DFHA 3GDMA 3AXKA 3ZS4A 4J1OA 2UY2A 4Q8TA 2FFIA 4ZQCA 3CGTA 4LYPA 4MWAE 4DF1A 2QF8A 5BZAA 3C2OA 3RPDA 3W24A 1I60A 4HNNA 1H51A 1OCBA 4HNUA 1XPGA 1TJ2A 1HF6A 1V0MA 1XIDA 2QXWA 3WNKA 4IMFA 5GJPA 2G97A 4NJKA 3D5HA 1FCVA 4G9PA 5FSEC 3R7MA 3RR4A 1LOSA 2HWGA 4DI9A 1TO3A 3NQ7A 4KWOA 1W8SA 3RGTA 3VIHA 4FX6M 1HT6A 2VWTA 1WO2A 2JEQA 4HVXA 3NQ8A 4FMVA 5BROA 5CZ0A 3SADA 1XYZA 1MXGA 4B3KA 4GKTA 1LBLA 1XH1A 4UQBA 1KGXA 2QJNA 1QHPA 2CXEA 3APTA 1EDQA 3UJEA 5JBEA 1IZCA 1SSDA 3TE9A 3IPWA 4HHPA 3W25A 3CZGA 1X38A 4GKLA 3SCUA 4H6KA 5A94A 2FTWA 1HX0A 3B9AA 1RR2A 2TPSA 1QWGA 4HOZA 2P3ZA 4S3KA 3KVJA 3TDFA 4DO6A 1GKRA 1K02A 3FW6A 1AW5A 1EYWA 4AX7A 5DY2A 3U7BA 3RITA 2DH2A 2DT0A 3WQCA 3IJ9A 1O94A 1WZMA 1QNQA 4A05A 1G4PA 3GQYA 3WH8A 2C0AA 1Z3NA 3KHJA 3GNPA 4JYEA 1PE1A 4JTHA 4XZHA 1Q6OA 4EPDC 3C2FA 1DXEA 1F61A 3V16A 1QNRA 2O7SA 2G4JA 3DFTA 1JF5A 2DW7A 3ONBA 4RK8A 4ECLA 4C7FA 2P10A 2XFWA 1ZJAA 3IVSA 1HG3A 2GWGA 4JFWA 3PUDA 3AJ7A 1IXOA 2GJRA 3TSMA 3DENA 4HOWA 4OV4A 4GISA 5LA1A 3FXGA 4Y6GA 1A4MA 1E1CA 4ICCX 3JZEA 1Q6QA 1FWFC 1B9ZA 1K70A 1G1YA 3TJIA 2AGTA 3UG3A 5FL1A 4MDPA 4RDVA 4PZVA 1Q8AA 2Y0FA 1VQTA 3QC0A 1K8YA 4ZQRA 4LW7A 2V82A 1IZJA 1EX5A 1TPEA 4JNYA 5D2XA 3M6DA 3C8FA 3OA5A 4NG3A 3KRUA 1TMQA 4GCXA 4N9EA 4MPKA 1XSIA 3NOYA 5A6SA 4X9SA 3LLXA 4B5UA 4ORIA 4HMNA 3GC2A 5RUBA 4AHOA 3L4VA 3CV6A 4XZMX 1LL7A 1YMYA 3LU2A 1ICPA 1DJWA 3M5VA 3AMDA 3Q45A 1PS9A 3EWCA 1ME8A 3GTXA 4IFOA 2E5CA 1S2VA 4PL1A 3CPUA 3LMYA 3OU8A 4KEVA 5LIWX 1JJKA 2VZSA 3GSMA 1MW0A 4PUEA 3EMCA 4S39A 3MKCA 1LG1A 2Y1HA 2GSHA 1G94A 3C3NA 2EAWA 3G1AA 2D0FA 4MY9A 3CV1A 1EOMA 1DL3A 4A35A 5E9XA 3V36A 4BQ4A 1GVRA 1RH9A 1M03A 3PWAA 3H7RA 3N17A 3SFWA 4HYVA 2ZX6A 3NZPA 3GVQA 1F3WA 3M0KA 4MNJA 3T4WA 2FH8A 4RCXA 3BCJA 3FXYA 2V8ZA 1WP6A 1VCFA 3NOEA 1F7BA 1AUSL 2GJXB 3K1DA 3N18A 3GBEA 3IRSA 1H7RA 3REQA 1VRXA 3NQGA 1RQBA 4N9BA 2W9MA 3TFXA 1BEUA 3QY8A 3SY5A 4PBGA 2PGEA 1I1WA 2I14A 2ZUNA 3IJIA 2D69A 3ITLA 3W86A 2ZRZA 2I56A 3WLIA 1JRBA 2JKAA 3TMQA 3S1XA 1LLWA 1PJ9A 4O50A 3W85A 2J25A 1VIZA 1XIJA 2WC7A 2GVEA 1P4CA 4JEJA 3WLHA 4GY1A 1WKDA 3MMUA 4DIAA 1DWAM 1VJIA 4CD4A 2CLIA 2CBIA 6TAAA 3TH6A 4RX0A 2VEMA 4S3JA 1XQKA 5CSUA 2TRSA 1SR9A 3Q2DA 3LGEA 3MP3A 3S2CA 3AALA 3HPFA 3UESA 4W7WA 2IPFA 4HCLA 1VBHA 3O6AA 2R14A 4Q8PA 4U4MA 4AD0A 1VH7A 5KITA 3UWUA 3DESA 3H2EA 3WBXA 3THUA 2QGYA 4E8GA 2EPKX 1FHUA 4MGGA 1R7OA 1VPXA 2NWRA 1LRTA 5G2IA 1SW0A 1UD8A 2OB3A 5FJUA 1AJZA 2BB0A 4JTTA 4W5ZA 1YTDA 2WQDA 1V6YA 4HMCA 3IIXA 3MVTA 3I4EA 3MUAA 2DSZA 2WNNA 4BFAA 5U7SA 1KBJA 5FEWA 1GZ1A 2VRJA 1KNWA 1PWMA 4JTCA 3L7RA 3LV5A 1KM3A 4QS6A 2C14A 2IKHA 1NOFA 3OG3A 2XIJA 1RVGA 4AU0A 3MSYA 1SMDA 5A95A 4M80A 2EPHA 1QFEA 5BXPA 4LF2A 2YL6A 4OGZA 3VNKA 1PZ2A 2XU2A 1TWSA 2QPXA 3QC3A 2A2IA 3BJSA 4OIFA 3IK2A 1KD0A 3QMTA 4K7YA 3NQCA 3CUGA 1HVXA 3USBA 3W7NA 3KDNA 4C5YA 3TC6A 3PBVA 4PA8A 8XIMA 4C6LA 2NX3A 3HF3A 1UWQA 3IGHX 1E0XA 3AXXA 4EX4A 2GGGA 3W2NA 2J74A 5A3HA 4K8GA 2QUVA 4O28A 1I2RA 1TX2A 3HMJG 2D1ZA 3OJGA 3VIFA 1GEHA 2E40A 1YLVA 3ZVHB 1FFQA 5JQ9A 1EEXA 1WOBA 1XLFA 4AC7C 4HU8A 2BY1A 4W84A 1PO9A 1IV8A 1WE5A 2XHYA 4QEHA 1J10A 3EZ4A 3VZZA 3NSNA 3LUTA 4WDUA 2XG9A 3UERA 4S2BA 3VNLA 2VDIA 4WR3A 5CJ5A 2RDWA 4ZODA 2IPGA 2Z1SA 3KW3A 1E1EA 3NO1A 5G1YA 2B7NA 4MJZA 1QATA 1SFJA 3HQOA 2BXVA 2EKGA 1XIGA 2GWNA 3TYEA 1H5YA 2OGJA 2RGMA 4KS0A 5HOSA 4QJ3B 4IP7A 4GNVA 3OLEA 4I9MA 2GYIA 5M3WA 1D8WA 1G7UA 2DZBA 1UH2A 2QJGA 2XGBA 4C6DA 1K4GA 3RCYA 1V3JA 1XBYA 4O8AA 3EX3A 1SPQA 2FHBA 3KZSA 3FEMA 5K2ZA 2PEVA 4GZJA 4S3FA 1ZRQA 3V5FA 1JGIA 4N9CA 4QDWA 2BHZA 3BG5A 4JX5A 4LF1A 2PWVA 2X0YA 2EXOA 3B0VC 5I3DA 2PBOA 4JHOA 5BRQA 3WFLA 3BK0A 3JZUA 3O0FA 3SN4A 2QYGA 2Y88A 1NTHA 3B04A 3IAQA 4BI5A 1XLIA 4F79A 1YE4A 3BARA 4JTLA 3S1GA 1JGMA 3BGGA 1QOXA 1E5JA 3GY1A 1JCMP 4LUTA 1MEHA 4FK9A 3RU8X 4XO6A 4N02A 4XUGA 2CBUA 2WSRA 5I03A 2ALDA 4IJBA 2BG5A 3HO8A 3P93A 5FJTA 1SJDA 5J5RA 4A3RA 1AQHA 1G4TA 2BP1A 1OJXA 3CWHA 1UB3A 1CCWB 5IHSA 2YPIA 1FTXA 4Y7EA 1HKIA 1FH9A 2QCDB 3E74A 4F0HA 3N6JA 3ZR4A 2XWEA 5FCZA 2J13A 5CSSA 1ITCA 2QIWA 1UD2A 1M7XA 3SCNA 4JD4A 3VD7A 2ZX5A 4IQEA 4MFEA 2GVGA 2QPSA 1W3JA 4JTFA 2A1YA 3G1HA 3KRSA 4LAUA 2ZXBA 2O9PA 2D2HA 4QG8A 1KFKA 5LGXA 1PBGA 5AYZA 4M8UA 3CT2A 2V67A 3KWXA 3DYOA 1FOBA 1XLBA 1XP3A 3THDA 3QPYA 4IPPA 4S3BA 3R8HA 2YCIX 2C13A 1J9YA 4DWDA 1TV2A 4Y90A 3ZJ7A 1JZ2A 2IMRA 4HU0A 4QRNA 3ZT6A 1R2TA 1DYSA 3PPCA 2O9TA 5I6SA 4LTSA 3MBFA 1NDVA 3II1A 4LAOA 5KEZA 2CLPA 5D2TA 3MTWA 1UH3A 3AFBA 2DT2A 5CC3A 2E77A 3UZJA 3WK2A 4IGNA 2YL9A 4W88A 3WLJA 2V5KA 4TVUA 3N4FA 1W0MA 4UOQA 2QDEA 2GOKA 3UT0A 4QCFA 2VZTA 3RJYA 5CZTA 3SUUA 4MNMA 5HWNA 4UTWA 3LV6A 1PZ3A 3F5LA 4X0NA 4RZBA 4PUUA 4XBSA 1GKQA 2Z2AA 4AZHA 3G2GA 3PZTA 3CHEA 1DE6A 5TAOA 1OYBA 2J77A 3L4XA 1ISYA 4JAWA 5I09A 5HXMA 1ZGDA 2WMFA 2NSOA 1BVZA 1NIUA 1VJZA 3NDZA 1FFRA 3MC5A 4F2UA 4RE4A 2NQZA 1F6KA 3TZNA 1GZJA 5C0QA 4GC3A 2Q8ZA 2FZDA 3RAOA 2V68A 4LYQA 1VIWA 4LNCA 1UD4A 4G6CA 3JW7A 2HVMA 3SCTA 1NDWA 1C92A 4PUMA 4FNTA 3CQHA 2DIEA 4IFKA 4KESA 4AXKA 1Q2SA 4L4LA 3QH2A 4H8NA 4UBPC 3R5EA 1PX4A 4LY8A 4B16A 4MMWA 5JH2A 3QKEA 2ZXAA 1LQ2A 3TP4A 4YLWA 5E09A 3ZZ1A 4RV3A 2Y5EA 3LYEA 3TCSA 4GFSA 5C9WA 3A23A 3S2LA 5AC7A 2ANUA 2R1KA 4U5IA 2QT3A 3AIEA 1LUCA 5HANA 1P0EA 3G77A 3G1FA 3ZXWA 3N6HA 4B5SA 1VRDA 1LQAA 4MLRA 2HJPA 3EWXA 5CC7A 2QHAA 2ISSA 1P1XA 1NQ6A 1RPXA 3L67A 3BW2A 3ZVHA 4DBEA 2HXTA 2PAJA 4Q4OA 4O53A 3TYUA 2FPTA 2VTFA 3WNLA 3AXHA 3MPGA 4AVNA 3WO8A 1UD6A 4QNEA 3AQUA 3W70A 2VFDA 1HJSA 4F0MA 1O12A 1RUSA 4C6IA 2E7FA 4Z1AA 3BV7A 3W74A 2PDXA 2E5BA 3QZAA 4PRTA 3A4AA 1RBLA 4RKAA 1O6IA 2ZE0A 1LWIA 2E25A 5D8ZA 1HJUA 3WDQA 4K3ZA 3UG5A 2QCNA 4Q22A 4PTDA 5HPCA 2CLHA 1VBRA 1EJRC 4UTWC 2QUUA 1RQHA 3RX2A 3WLQA 4AIOA 3MV01 3H2FA 4KRTA 3THCA 4GINA 3ORWA 2W67A 2RDTA 3S5ZA 4GUHA 4HTBA 4TMBA 2B31A 1A5LC 3T55A 3IVUA 1DBTA 5D38A 3VOHA 1BWVA 4RLIA 2D73A 1S5MA 3EKGA 5KETA 1RCXB 1J2BA 4Z08A 1JI2A 5LIXX 2REQB 4MZ1A 4UTKA 5G1TA 4A22A 4O1CA 3S9IA 2YDQA 4Z0SA 1WUFA 2DZUA 1AQ0A 2JE8A 3N6QA 1ELSA 4GACA 1GVIA 1YW1A 4KWSA 3JUGA 3P14A 1IXQA 2F8QA 2WPBA 3QVQA 4C90A 2EQDA 4FX8A 3VTRA 5BW6A 3E0WA 3CL8A 1PWLA 3CZKA 3WD3A 6PTDA 4D6CA 1I45A 1PAMA 2CLMA 4MJ2A 3TTEA 3WUEA 1VCGA 2D0GA 4KCVA 3WZ0E 3M16A 1XH2A 1NFPA 1OG6A 2OG9A 4DJDA 3KXQA 3TXZA 1JCTA 5LA0A 3UXAA 4EWND 3EB3A 5T9CE 2WZIA 4AZIA 3UCQA 1PCWA 2WNWA 1EC8A 1CGUA 1CLVA 1CX9A 3WEMA 3RCNA 4FXFA 5D2VA 2YFOA 4WGHA 3ZT5A 1MMFA 5E93A 1KXVA 3PVFA 3T81A 3M0LA 4GC4A 2A4AA 3N2CA 2O56A 2A3EA 3WK1A