3TXZA

Oye1-w116q complexed with r-carvone
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
399
structure length
398
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLQVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 158
structure length 398
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3txzA00
4FIRA 2C16A 4JTUA 3W7JA 4Y96A 3BLIA 1ADOA 3MP5A 4N4QA 3FFSA 3DI1A 1AG1O 2A7RA 2OJPA 4JICA 4WY0A 3LB0A 5K4XA 2DJLA 1JCXA 4S2BA 3QW3A 3NEVA 2F7FA 3NAVA 2WPBA 3HMJG 3CC1A 3TW7A 3G1FA 3N14A 3OEXA 1WBHA 1A5CA 5LNRA 2G5WA 1OF6A 1KA9F 2PRLA 2J9ZA 2QJIA 1B57A 2DZSA 2NUWA 3PULA 5A5WA 3G3MA 3OIXA 3TW6A 1H7XA 5AC7A 1D3HA 4FNSA 1HUVA 3LXAA 2C3ZA 3QM3A 1W31A 1VRDA 3OVRA 2NLIA 1H7PA 4B5NA 4UR7A 4NNBA 1M7OA 4LVAA 3STFA 4NJIA 3QJAA 3MW7A 1GTEA 3MHGA 2Y61A 1LRTA 4AB4A 4JTSA 5AYZA 1DHPA 2Z6IA 3P60A 1JCJA 1L6WA 4QIUA 3LTYA 5AOUA 3RFAA 4NJHA 4A22A 3Q94A 1H7WA 1BWKA 3P5YA 1LLZA 3UQNA 1DQXA 4JNMA 3GB6A 1AW1A 5TBOA 2BX7A 3FIGA 3L5AA 5D2WA 3V1PA 3DFTA 3CEUA 3GKFA 5LNSA 4LRTA 4MKNA 1XXXA 3YPIA 2Y89A 2BWGA 1IXOA 3SZ8A 1EA0A 4WX2A 3SW6A 3L2IA 3HF3A 5F1UA 2OX1A 6TIMA 1EPXA 3N73A 2Q3RA 2VXNA 3C2EA 3KVKA 3CWNA 4JTGA 4XQ6A 1YTKA 3CHVA 1AL8A 4O17A 3L0GA 4NU7A 1WYIA 1SZNA 3IVUA 3CPRA 4LWWA 1QO2A 2FFCA 1GT8A 2QCFA 3S1VA 3TJXA 1KM2A 1PIIA 1Q6LA 3HGSA 4ORMA 5F1VA 2GQAA 3UNDA 5D33A 3CLMA 3I68A 3PBVA 4C1KA 1LRNA 2C13A 2ZRZA 2Y6ZA 3LHVA 4A2RA 1ALDA 2YZRA 1CW2A 1ZNNA 3HG5A 1NAL1 3HBLA 2V5BA 4MJZA 2VFHA 3QQ1A 1NSJA 1M7PA 2WSRA 4UTHA 2X1TA 1GVSA 1TPH1 5LSMA 1WOAA 3GXTA 1QAPA 1SPQA 3I7RA 1VCGA 5I3KA 1TPC1 4KFPA 3BW2A 3OG3A 4IUOA 1LROA 4UFKA 1W8SA 4GUIA 4UXDA 3ABQA 4FNRA 4CQ8A 1QO5A 1ML1A 2E77A 2VEKA 4FEZA 3W6YA 2Y63A 3QEZA 2G97A 4WJEA 3WJWA 1DKWA 2H8XA 3TXZA 1GVQA 3INPA 1GG0A 1NF7A 3W2UA 3IEBA 1OFAA 4JTTA 1KM1A 5F4WA 3TUUA 2QKFA 4PH6A 1KFKA 2I14A 1H50A 5FESA 3EWBX 5U7SA 1YTEA 2E09A 3L66A 3LTPA 1O60A 2CLLA 3T4CA 2DORA 4HSNA 4JYFA 4O0ZA 1ZFJA 2QCMA 4IPIA 2NUXA 3M6YA 3M41A 3NQAA 3HPZA 4N6EA 2VENA 3CT7A 4JDYA 4UTWC 4L4MA 3FA5A 1N55A 5AHEA 5DY2A 4BI7A 5D30A 2ZFAA 3P61A 3LDVA 1Z48A 4RZ6A 3THQA 4JYEA 2WOQA 3UWQA 1F6PA 1X1ZA 3NDOA 5HWMA 3DFOA 3UZ5A 3CIXA 1EP2A 1MSSA 2V82A 5I3HA 1A50A 4X2RA 3UXDA 1DL3A 1H1YA 3EX2A 3M5ZA 4TR9A 5G5IA 3ATYA 3LBMA 1EUNA 3EEGA 3P8IA 3KVMA 3W22A 3DFSA 2YPIA 2XN2A 1X6UA 1PS9A 4MY9A 1R30A 1RVGA 1TPWA 1AK5A 3LI0A 3I65A 2FDSA 4O1CA 3GR7A 5EKYA 2Z2UA 3G1HA 3M5YA 3UWUA 3P74A 5EYWA 1G6CA 3O05A 1KV5A 3QSTA 2QJHA 2ALDA 3DKLA 3NL5A 2NUYA 3N2XA 1JQXA 1OFPA 1UJPA 4HIBA 2ABAA 3STGA 4RR4A 5L9FA 3IIZA 3NPWA 1SW0A 3W7IA 5EY5A 1RQBA 3A24A 3VE9A 1XBZA 3BW3A 1NFBA 3QF0A 3W1RA 3N3MA 3GAYA 4X3ZA 5G4EA 3GX9A 5F2LA 4MVAA 3FKKA 4OE7A 5K3VA 4M7SA 3A23A 1SO5A 4JEQA 3PB2A 2CWNA 2WNNA 1ICPA 3KRZA 2X1SA 5I3JA 1KM6A 3E02A 1S5VA 4JY9A 2ZA3A 4X22A 3NM3A 5K9CA 4Y8FA 3PAJA 5D03A 2ZCGA 4NVTA 1JUKA 3T55A 2B7PA 5EPDA 2DJXA 1VYPX 4I7UA 3LERA 1I2OA 1SO4A 3NNTA 1JQVA 1EEPA 2R14A 1H60A 3F4WA 4ZQRA 2Z1BA 2FPYA 3LV5A 3H55A 3Q37A 4NQ1A 1O94A 3EXRA 2YDAA 2CZ5A 4DF2A 2Q8ZA 3NZRA 2V9DA 3IV3A 3W7RA 3BO9A 4ZQOA 4QM1A 2RDUA 4DQWA 4JY8A 3OA3A 1L9WA 4H6KA 5ABTA 3UWWA 5HULA 4HNVA 5AFDA 5CSSA 1GYNA 5F2GA 2Z0IA 4Y6GA 1OK4A 5AYXA 3NQ8A 2O7SA 4LV9A 2ZZ3A 3TMLA 3NG3A 3NL3A 1F05A 4ZVJA 1I2PA 3TA6A 1I2NA 2Y7EA 3G1XA 1F74A 2A21A 1W5OA 1FDZA 1H1ZA 1H63A 3LXCA 3FLUA 3NQCA 1XCFA 4LVDA 1TCDA 1TSIA 3N9RA 4D2JA 3IVTA 4BFAA 1SO3A 4J9JA 2ZZ7A 4RKAA 3W70A 2CLOA 3LLFA 3Q2DA 3LHTA 1TRIA 1KFEA 4K7YA 3W2KA 4WY0F 2C15A 3BK0A 5KITA 3LGEA 4EVZA 5HR6A 2JGYA 4IMGA 3VI2A 3MHFA 3TSMA 3PB0A 1JULA 1LZOA 5G1YA 2ZZ5A 4O28A 4P2VA 4QSHA 4O1AA 1S3HA 2CFFA 5HUOA 2XFWA 3H53A 2W79A 3CTLA 5G2HA 3N19B 2E6AA 4Z1DA 4DF1A 1JCNA 3P80A 2D73A 5SWUA 1YXCA 2B7OA 4QQ3A 3L21A 3ABRA 5D2XA 3M43A 1W54A 3G24A 2JKAA 3NQGA 5KZDA 5D09A 2A0NA 5J5DA 1AL7A 4AF0B 3PG8A 4M7TA 1UUOA 3O1NA 4UTIA 4OV4A 3WJSA 3T78A 3F03K 3O15A 2RFGA 5AHIA 2JBMA 4LOCA 5F2MA 4UCGA 3IIVA 1SZGA 1OFDA 1IF2A 1SW7A 3MJYA 3ATZA 2H6RA 3C61A 2FB3A 4GNJA 3LCXA 4DBEA 5BW6A 1VHCA 1JUEA 5J5RA 1RQEA 3W3OA 1XDMA 3DENA 4JTEA 4O1BA 1XBVA 2A6LA 3OHIA 1GYLA 3SR7A 4O11A 3P8JA 1EX5A 3VKJA 3TAOA 2FPTA 1IXQA 1W3TA 2G96A 3PUOA 4JTJA 5E1QA 4O50A 4MOZA 3IRDA 3TSBA 5K2ZA 4UR8A 3M7WA 1HFBA 1JUBA 4GC4A 5I3FA 1H61A 5LNWA 3BG3A 2GJLA 4O54A 1DJNA 1RPXA 1EUAA 1DQWA 4E38A 3B03A 3NQ6A 3QFEA 4UFLA 2CZDA 3W7LA 1XBYA 2Y62A 3W7OA 5KZEA 4GUGA 5C2XA 2C6QA 1W0MA 3DI0A 4IWWA 4OV9A 4TMBA 4JTLA 3BW4A 3TJLA 4ZZ9A 1VR6A 4A21A 2X2GA 4NXKA 2WKJA 3GZ3A 4JTFA 3M16A 3G1YA 4W9TA 1TPVA 1O5KA 2PURA 3H54A 3W85A 2OMAA 3FYOA 3S42A 3CM4A 3FKRA 3JR2A 4DPPA 3MI2A 6ALDA 1XKYA 3VNDA 3QW4B 3O06A 1OF8A 1VCFA 1Q6RA 3W1QA 1ICSA 5F4SA 4ONVA 4MLRA 4UUIA 3QPYA 3DH7A 4O8RA 4N9EA 4XTDA 1I8JA 5DXYA 1OYAA 3LCLA 3A22A 1I2RA 3MBFA 3EWUA 1WA3A 1NF0A 4FXSA 2DU2A 3G22A 4PC8A 1YTDA 5TIMA 1XI3A 4DO4A 3BLFA 1D3GA 2PCQA 1GPWA 5CKSA 3TIMA 1TJRA 4K8EA 4JR5A 4FX6M 3MP3A 4M5PA 1J4EA 4RXFA 3TQVA 4TU1A 5BNKA 1ONRA 1YYAA 3F4NA 4JTKA 3WK1A 3MYOA 4FNQA 2BXVA 1AW2A 5IM51 3EKLA 4MFEA 5C6MA 2ZBTA 1IIHA 3LXBA 1LLWA 2E6DA 2EPHA 1KTBA 1Z44A 3GXNA 3E96A 4GXMA 1I45A 1QPRA 5LNVA 4AXKA 3GDTA 3C56A 1CX9A 4RX0A 4Y90A 4HKPA 1PVNA 4LTSA 1SR9A 4AAJA 1KBIA 1N7KA 1W37A 3USBA 3W7CA 1QPNA 5K9DA 4TMCA 1P0NA 3UY7A 4MY8A 4DELA 1J2WA 4EIVA 3GXPA 4IMFA 4AH7A 1FWTA 4A3UA 1DBTA 4BR1A 3EKZA 5D2YA 4LY8A 3LTSA 5LGXA 3HPXA 3S5NA 2NWRA 5AHFA 4Y9AA 4CNOA 4UTKA 3P82A 3M5VA 3U8GA 1ZHAA 1EP3A 1KTNA 2ZYFA 3E12A 3G0UA 3UWVA 2CZEA 1ZAIA 4R53A 2AAMA 1VPXA 2FLIA 5D05A 3OVPA 1KFJA 3A5VA 2NXGA 3NQ2A 2OCZA 3ANYA 4AVFA 3LCFA 1TV8A 3MYPA 1EWDA 3PF3A 4DXVA 2ZTKA 3G1SA 2NWSA 3RLVA 3TNOA 2YCEA 3W7QA 1VC4A 4U4MA 1KBJA 3SSJA 4IJBA 1PHWA 2XN0A 5HMSA 4PCFA 1H51A 5I3IA 1QOQA 4LRSA 4KWVA 1Z41A 3CU2A 2E6YA 1W5MA 4UMBA 5H2ZA 1R2TA 3L0KA 4ML9A 2ISVA 1QOPA 1L6SA 1KM4A 4FNUA 3QMRA 4UMCA 4O4VA 1R2SA 4ADUA 2Y7DA 3IGUA 1PE1A 4MYXA 5C5YA 1GZGA 1VCVA 3HGJA 5EA9A 4PFMA 1OVDA 2Y7FA 5D02A 3TDFA 1TJPA 4ZMGA 3C2RA 3PUDA 1G4EA 4GUJA 5G2WA 1OYCA 4O1DA 3T40A 4XKYB 1TPFA 2E6FA 4I7VA 1P5BA 4OGZA 1W3IA 2V5LA 4JXCA 3O16A 4LNYA 5FEZA 3E9AA 2JK2A 1G4TA 3IIOA 1GVRA 2J6XA 1TV7A 4MYAA 2B7NA 2DZPA 4DO6A 4ORIA 1SO6A 4UNKA 5D37A 3LI1A 4IMDA 4IOTA 8TIMA 3M5XA 2E5BA 1OX4A 1I2QA 2VFFA 3WJYA 3ZR4A 4ZQMA 4Z1AA 4K6AA 2V81A 1ZCOA 1IGSA 4AWUA 1I4NA 3QC3A 3LRKA 1T99A 3ABSA 4MFDA 1C8VA 1OK6A 2YGYA 4K37A 1SZFA 4MJMA 5KSWA 3IGSA 3S0CA 1ZAHA 3KVJA 4OT7A 3TXVA 3W83A 3TQ0A 2J88A 2NXIA 4CCCA 1XBXA 4NNAA 3FS2A 2Y88A 4UTMA 1E51A 1GWJA 3E49A 4LS0A 1TTQA 3W1UA 1ZJIA 4GE8A 5CZTA 4X9SA 2CLFA 5DLCA 2QCGA 1LDCA 5U4NA 3G18A 4IMCA 3W76A 4Z0JA 3DKJA 3IVSA 3LV6A 3HPSA 3DZ1A 1C29A 2HMCA 2RDWA 4M6QA 3W1LA 3HO8A 1FCUA 2JGQA 3EX4A 1K8XA 2GJNA 2NX9A 3HG2A 3LCHA 3M0ZA 5DBUA 5TQLA 1VYRA 1YLVA 4M19A 1PCWA 4LS1A 4YCPA 1TV5A 4XWUA 3UPBA 4JIQA 3C8FA 2YXGA 3RMJA 4HT3A 2H3BA 5AN7A 2QAFA 3B0VC 1PL9A 3MBDA 2J27A 2HS6A 1QFEA 3L9CA 1LP6A 3C2VA 5AB3A 1W5NA 3W1AA 4NT0A 2KZHA 3VE7A 2DZVA 1VZWA 5CPLA 2WNQA 4S2CA 4AMAA 1XFBA 3HOJA 4FIQA 5D04C 3FOKA 1VS1A 4EF8A 2QUVA 3I6RA 2CW6A 5CZSA 3O6CA 4JX6A 3TV8A 3GDLA 1TIMA 1WV2A 2AQWA 3JRKA 2EGZA 2E1DA 3V75A 3UZJA 1OFRA 2VC6A 2ISWA 4QITA 2GVJA 3HGOA 1FWRA 2E68A 4EWND 4FHAA 1UCWA 2QUUA 1GQNA 4ICNA 1F6KA 4A29A 3NQVA 2QEZA 5BMXA 4H4IA 3G3DA 1DORA 2E5CA 1TO3A 1SFLA 3EXSA 1K8YA 2EAWA 4LW7A 3ZWTA 3G8EA 4MY1A 3QQ0A 2GVGA 1SSGA 4JYDA 3GDKA 3PG9A 4HHPA 3QSRA 3EX3A 1ZENA 1U83A 3W2NA 3SJ3A 4Z1BA 5AHLA 3DHFA 4NJJA 1FCBA 1H7NA 1EWEA 3VCRA 3A9IA 2FTPA 2WQPA 1VGAA 4IQLA 1O4UA 3STEA 4BK9A 4N9BA 1HTIA 1V5XA 5KZMA 4WOQA 3PSVA 2VFGA 2C1HA 4LVBA 4O15A 4RV8A 4QNWA 2A2IA 1Y0EA 3P5ZA 3ZFHA 4NJGA 5CGQA 4WXZA 1GJPA 3W1NA 3MUXA 4K8HA 2FB2A 3HJZA 4CCEA 2A4AA 2I9EA 3UWYA 5FEXA 4AHOA 4FXRA 3KRUA 4QAIA 4N9CA 5K4ZA 1B9BA 1L6YA 1JCLA 1TTJA 4GRSA 1FWSA 4XBSA 5LHEA 3PUEA 3QZEA 1FCVA 1F76A 3W2JA 5GVJA 3IGXA 1LBFA 3B4UA 3KAOA 3C52A 1YXYA 2BZNA 2FQIA 3SGZA 1LBLA 3LX9A 2Q8LA 3DU0A 3THAA 3W73A 1MEIA 1X8FA 2A7NA 1OJXA 4ALDA 3HIJA 3BGGA 2YSWA 3PSWA 5FF3A 1UBSA 3KHJA 5LZLA 2ZRYA 3I7QA 1A5BA 4MZ8A 2J9XA 4HPXA 3TK7A 3W1MA 1G67A 3DFQA 4NNCA 1LBMA 3SECA 2R94A 1BTMA 4KFOA 3PR2A 1RQHA 3PBWA 3R12A 5BMWA 5CPNA 4DPQA 1SW3A 3LHYA 1THFD 1HO4A 1M6JA 3L5LA 2ZZ2A 5CPOA 2R91A 1QCWA 4Q32A 2X16A 4GFSA 1WBJA 3B0UX 5HR7A 1QMLA 2H8ZA 5CSRA 5KINA 4O12A 2IQTA 2OZ0A 4FF7A 1G69A 1TYGA 4E0CA 3CIWA 5EBUA 1CI1A 4GJ1A 2ZRWA 5FF4A 1VQTA 2VELA 2YW3A 4CCDA 1LM1A 4JX4A 4Q4KA 2C19A 1GG1A 1OX6A 1QDSA 4RZ5A 4FX7A 5EL1A 1JJKA 2VKZG 3F1QA 3W2LA 1T0OA 1B3OA 4M6VA 3TMQA 1PCKA 1O5XA 2QCDB 3GDMA 3BG9A 2FJKA 3NO5A 3TC7A 4ZQNA 3LM7A 1JVNA 4K38A 2CLKA 7TIMA 1TMHA 2YX0A 2P10A 3AJXA 1R47A 3S5YA 3HG4A 1KLZA 1LYXA 3UWZA 2A85A 1V7YA 3S8HA 2JKEA 2R8WA 2Y85A 3A5FA 3NPUA 4JTHA 5FEPA 3N9SA 2QF7A 4GWEA 4QNEA 1HG3A 3LRMA 4O52A 1JRCA 4K39A 2B7QA 3O8AA 2W6RA 4RK8A 4N2YA 1WXJA 2H3DA 1B4EA 1DVJA 2V30A 4XUGA 3LBCA 5CG7A 2NX3A 4P61A 3TFXA 2WO5A 3TX9A 4PA8A 4I7WA 2ATMA 2ZTJA 1FUYA 2V2HA 1K7XA 3KFTA 4NXSA 4O14A 4XBKA 3W1PA 1KLYA 2VOMA 4NUWA 4JTIA 2OT1A 2PC4A 4YMZA 2VEPA 1TPB1 5G4WA 2ZA1A 1LOQA 4UIOA 1BEUA 3DXIA 3B8DA 3BLEA 5IBXC 1UB3A 3W7EA 2QDHA 2QUTA 4PL2A 2DZWA 4YXGA 4PTNA 2PRMA 1YPIA 4YWIA 3LHZA 4Z0SA 3DGRA 4JN6A 1ME8A 3DFPA 3G0XA 3EXTA 5DCBA 1G7UA 2QCLA 2VFEA 1B4KA 3L67A 1X1OA 1K3UA 3TC6A 4IPJA 1BKSA 4H3DA 1N8FA 1TTIA 2O7QA 3FEMA 4CNPA 3NQEA 4UNLA 1PV8A 3NA8A 5E0KA 1VHNA 3EX6A 4LVGA 4IXXA 2Y7GA 2QJGA 1TPEA 1SU5A 3LHUA 2C14A 4NZJA 3W74A 3PS7A 3PY2A 1JR1A 5BOOA 4BWLC 2YFNA 1FDYA 2VEIA 1EB3A 3MO7A 1H62A 1WDWA 3NPXA 2X30A 3NZ1A 3LHWA 4GUHA 3IIXA 1K02A 4MIMA 4CQ9A 1TQJA 3CB8A 1TREA 5DY3A 2ZA2A 3S1WA 3Q58A 2X1RA 3GNDA 4HNNA 4A2SA 3U2OA 2V0TA 3ELFA 2RH9A 1AW5A 5K7JA 2ZQ0A 1YDNA 4N6FA 1T8XA 3EB2A 3MI3A 2YFOA 1GVOA 4R34A 3R2GA 5BRBA 1OABA 1TB3A 1ZALA 3W23A 2ZRXA 3C0JA 3WFAA 2CZFA 1GOXA 1LTDA 3M9YA 4IX0A 4LS2A 1QPQA 3PM6A 4RLIA 2NV1A 3W7DA 1RD5A 5A8GA 3QPZA 5IBXA 3KX6A 2HTMA 4MPQA 3TKFA 3MWAA 2CU0A 2GPTA 5HWNA 2ZRUA 3W7PA 3NQMA 3UXAA 4AF0A 2ZRVA 4N4PA 4FB7A 1TRDA 3UY8A 1J5TA 2VFDA 2GOUA 4LUJA 1H5YA 3L68A 3W7NA 1S5WA 1WAUA 5AHMA 3LOTA 1KM3A 2RHGA 5FF2A 3QMSA 5HWJA 4PL1A 3M44A 1LOLA 1OHLA 2HSAA 1FWNA 3HQ1A 3LRLA 4WQ6A 3BV4A 1JCMP 4BWLA 2RKXA 3N34A 5AHNA 3W72A 4CLMA 2C18A 4IXHA 3C6CA 2GUUA 3G1AA 1NVMA 2V2CA 3JS3A 1YXDA 2X1UA 4PODA 1XL9A 3D0CA 3A21A 1P0KA 2QCDA 2GVLA 4DBDA 5D32A 1MO0A 3PBYA 5K9XA 5AYYA 2QCHA 1Q45A 5EMUA 4DF0A 3L0NA 1VJIA 1ICQA 5HQEA 1RV8A 1EIXA 2QCNA 4IGHA 4JDBA 4UTTC 3CEPA 4O4WA 4RCXA 1YDOA 5LGZA 2A7PA 3WK2A 1LCOA 3C3NA 3GLCA 1DJQA 3MHUA 1HL2A 4R7JA 2FPVA 1WQ5A 3W2MA 1WX0A 2OT0A 5D38A 5HJLA 3L65A 5C55A 4OU1A 4C1LA 4HNUA 4NZFA 1AMKA 4UC5A 5T26A 1A53A 5G2IA 3E0IA 5L6UA 2QR6A 1TPDA 1SQ7A 1X7FA 3SFKA 5CPMA 4UTLA 1XUUA 2WSQA 1H7OA 2Q3OA 1K03A 1G7VA 3GDRA 1OX5A 4WOZA 2ATSA 3S5ZA 1VYSX 2F84A 1IXNA 1W1ZA 3EX1A 2WJZA 4ZQCA 1IXPA 3CQ0A 3M1ZA 3BGJA 1P1XA 4LT9A 1OFBA 1MXSA 1KM5A 1KM0A 2QCEA 3MP4A 1ME7A 4LC8A 5G1TA 1JCYA 3LLDA 4UMAA 3P67A 3W07A 4KWWA 4KKXA 4TIMA 2B4GA 3DBPA 2XN1A 2VFIA 4M6PA 4OWGA 4MLJA 1F5ZA 3UPWA 1Q6QA 1UUMA 3DFNA 5F4XA 1DOSA 2TYSA 4WUIA 3WJZA 1FXPA 3WK3A 4U28A 4JS3A 4ZQPA 3LCWA 4O18A 3STCA 4AHQA 4FX8A 4OBTA 3RK8A 3TCEA 3TR2A 2DZXA 4WXYA 2A6NA 1LOSA 3RF9A 3T7VA 3BG5A 2A1YA 3PBUA 4UTTA 4FO4A 3DAQA 3NQ7A 3S9YA 4O16A 1XC4A 5LKYA 1XM3A 3PWAA 3W7GA 1YPFA 1KTCA 3R5EA 4JD4A 2LLEA 1K8ZA 5FF0A 3C2FA 5LHFA 1FCQA 1SFJA 5I3GA 1MEHA 3R8RA 3NVTA 3GIYA 3NGJA 1NEYA 2TSYA 3G1VA 5FEWA 4QJ1A 4WZHA 2BTMA 1G4SA 3R89A 2E5DA 3QYQA 3W9ZA 3TAKA 1L2UA 4CQAA 3O07A 4E2BA 2YW4A 2DP3A 1F7BA 5DELA 2GQ8A 4E2DA 2ISSA 3SGUA 4BI5A 4K7VA 2NZLA 3I7SA 1KV8A 3TE9A 1S5TA 2WSYA 1GEQA 4JX5A 3B04A 3UD6A 2PRHA 3P62A 2VEMA 3PVFA 4LV4A 4HNTA 4WD0A 4AHPA 4Q33A 2NXHA 3EWXA 1A5SA 1K7EA 3W7HA 1MZHA 3SI9A 2BSLA 1SUXA 3TFCA 4PEKA 4HPJA 3WJXA 2H90A 4DO5A 1LORA 3RLUA 4R33A 5KTLA 1W3NA 5DXXA 2FIQA 3N2MA 1A5AA 4UTWA 2YYTA 3SY5A 2QAPA 3HGRA 3AO0A 4L4LA 1Z42A 3MI6A 1BWLA 1YADA 2Y70A 5KMYA 2AGKA 4IMEA 4UFHA 1FDJA 5D2TA 4YCOA 1C9DA 1PHQA 3GAKA 2CLIA 2B0MA 3PC0A 1SZEA 2J9YA 1H7RA 1ME9A 2TPSA 4POCA 5AC6A 1KW1A 4UFIA 4XKYA 1GTHA 4TO8A 4AWTA 3K30A 4AWSA 3G0SA 3P84A 4O19A 2GQ9A 2YYUA 1W56A 5C54A 4EF9A 5E93A 1LRQA 3EWZA 4Z08A 1FQ0A 3TH6A 4LU0A 1W5QA 4BI6A 4WY0B 1F73A 4MZ1A 4K36A 1QNVA 3QMTA 4OQVA 3R13A 1D9EA 1OG0A 3TSDA 3T44A 3KOFA 2W0UA 3ZS4A 2CLEA 4UFMA 4MZYA 2RDTA 1TPUA 4O57A 1QR7A 3S1XA 3W7MA 1UASA 1R46A 3GKAA 2YR1A 3UYCA 2A5HA 2EHHA 1KFCA 3LCIA 3QRHA 4NX5A 4YL2A 4O13A 1P4CA 3EWWA 4ADSA 2P0OA 4LC6A 4QISA 5DN1A 2EKCA 5HINA 3P7YA 1O95A 4ADTA 3C4UA 5DBTA 3RNDA 3W7KA 4RJEA 2V2DA 1M5WA 3W88A 1KFLA 3NQFA 2JKPA 3O6YX 4BF9A 1WOBA 1RZMA 2DZTA 3L5MA 2QCCA 4HN4A 3NR0A 3SIZA 3MMTA 5F2IA 3KRSA 4KFNA 2NV2A 3B0PA 1MEWA 2V8ZA 4RXGA 5HUPA 5MHBA 1XDLA 3W71A 3W1XA 3U6WA 3ZWSA 3GVGA 3O63A 4UTJA 3W86A 5CZ0A 5FI8A 3NYZA 1VH7A 1F2JA 1R2RA 3G1DA 3NQDA 3TROA 4JIPA 1VLWA 4I9AA 1IIGA 3ABOA 4CNNA 3OBKA 4TX9A 2TMDA 4RZ4A 3M47A 1FY6A 4OHQA 3C2OA 3O6DA 3BPWA 2ZZ6A 2G95A 1OFEA 3W75A 2BLEA 3FJ6A 3BVJA 1KFBA 2CLHA 3LCGA 5DCDA 3QH2A 3B05A 2DZUA 3HB9A 2NX1A 4GBUA 1QPOA 1RR2A 3NL6A 3RU6A 2WNZA 3B06A 3P81A 3GNNA 5HNRA 3EWYA 3VFLA 1DV7A 1U5JA 4JGDA 3TU9A 1OYBA 1XUZA 1FX6A 3FJLA 3KXQA 3S5OA 1YDVA 1T96A 4FNPA 1G4PA 3NM1A 1HO1A 3NOEA 2Z6JA 4NJKA 4G1KA 3W84A 4UTUA 3BARA 4S1FA 1Q6OA 2ZZ4A 3S1UA 4ZL1A 4AEOA 4XZ9A 4IX2A 3NL2A 1Q3NA 2WV8A 1K7FA 5CZJA 1FBAA 4LUIA 1TQXA 4LVFA 3NPVA 3GYEA 2ZDRA 4DEFA 5LNUA 2HS8A 1ZAJA 2C0AA 4O53A 3W1TA 4FNTA 1VLIA 4EOUA 4HSOA 4Z1CA 4N9DA 2PE4A 4O10A 1SSDA 2I1OA 5DCEA 1OFQA 5D2VA 3GK0A 1ZY9A 3HG3A 3TQKA 3IIPA 1QWGA 2P1FA 2UV8G 5AC8A 1OX4B 2J24A 3G8RA 5FF7A 1GVFA 3DHDA 3W87A 3FYPA 3NXFA 1OFOA 1W5PA 4UFJA 2TRSA 3OVQA 4GUFA 4XTIA 4N02A 5H91A 2EF9A 1FWWA 2ABBA 1TTPA 3CWOX 3WK0A 1FXQA 3KVLA 1EP1A 2CLMA 1JRBA 2QDGA 2ZZ1A 3GR8A 4NX0A 3S6DA 4MUZA 4O0KA 4YLWA
chains in the Genus database with same CATH superfamily
1XLKA 2C16A 5AECA 4XZNX 4JTUA 3W7JA 4Q8MA 3WENA 4Y96A 3WBEA 2XJ7A 3FFSA 1FHDA 3AU2A 4GI9A 4QG8A 4BHYA 2OJPA 4WY0A 3MQTA 4S2BA 4RE4A 3URBA 1QRQA 1R9ZA 4HOXA 4DJDA 4DUWA 3NAVA 5GPRA 1GGOA 3HMJG 3TW7A 2BMBA 3PJXA 1BYAA 1U5HA 4GCAA 3OQEA 3LLXA 5T8GA 4DY1A 2Z7GA 3ARYA 2V63A 5E70A 3BSHA 4HVXA 1UWAA 3C0SA 3VGFA 3AXMA 3C0QA 3TN5A 4UQEA 4JPGA 1KBLA 2JEPA 1H7XA 3APGA 3VDBA 2BVTA 3LXAA 3VIPA 2C3ZA 1P0EA 4LAKA 4Z17A 3STFA 4NJIA 3MW7A 2OQYA 5XIAA 1DHPA 4KIRA 1R3WA 1MFVA 3TW9A 5AOUA 2E28A 3QY7A 5HATA 3Q94A 1Z8AA 5FJJA 1BG9A 5D2WA 3S2MA 2PWHA 4PFHA 4W84A 3K4DA 4BEQA 3VC6A 1BVWA 4MUPA 4Q4SA 3GKFA 1K4GA 4YTUA 2Y89A 4A6GA 4F66A 4QS5A 2BWGA 4I9MA 1DWGM 3KM8A 3UJSA 2ISDA 3WDHA 1VF8A 3N73A 2Q3RA 3FGCA 1YTKA 3CHVA 1AL8A 3EZ4A 1XG4A 1G9HA 3IVUA 5FSDC 2Z24A 1GT8A 2QCFA 3GG1A 2HROA 3EOLA 3CLMA 3ZR5A 4C1KA 2OKOA 2ZRZA 2Y6ZA 1HKIA 1NAL1 1LT7A 2V5BA 4KQNA 2WSRA 1MRQA 3UVAA 3BC9A 1XFCA 2IQ0A 1D7FA 2Y4SA 3GXTA 3T2QA 1VCGA 5HMDA 5I3KA 1XIHA 1B2YA 1W8SA 4UXDA 1QO5A 3D5HA 3ALGA 1ML1A 2E77A 2D3NA 2EPMX 4FEZA 3W6YA 3KL0A 2P8BA 2YXXA 2Y63A 5CG0A 4L1XA 1DJZA 2BY0A 1C91A 1WB0A 2VCBA 2RAGA 5A8QA 4X61A 2CYGA 4JTTA 1QNSA 1MQPA 3FCPA 2I14A 2VX4A 4YPJA 3BZJA 1YTEA 3W00A 3LTPA 2ZKMX 4ZXOA 3VMNA 3T4CA 3MO4A 4HSNA 4JYFA 1JNEA 1I0BA 1K9TA 1ZFJA 4PCTA 3NSXA 3M6YA 3HPZA 3ME3A 5D4YA 1UR4A 2VENA 2F9RA 4UTWC 2ZX7A 5AHEA 2ZIDA 3WLHA 5DY2A 4BI7A 5D30A 2ZFAA 3P61A 1Z48A 4J3UA 3THQA 4JYEA 2YLAA 1MQRA 3NDOA 1Q6FA 3CIXA 3UW6A 1O7AA 4LQ1A 4RDVA 1FHUA 1A50A 1YEYA 4UCFA 1W3JA 1M7JA 3UXDA 3SDOA 1Y5VA 2HNEA 4XZWA 4QLKA 1DHKA 3OLGA 5FJUA 5A69A 3I3BA 4AWEA 1AA1B 4MY9A 1XYMA 4KEMA 4HD5A 2PGRA 2C1GA 4DBSA 3LQGA 4EPDC 3IAPA 2IKJA 3UWUA 1QI3A 1AMYA 4DJEA 1IT0A 4PUKA 1W3KA 3I6EA 2NUYA 2E4TA 3N2XA 4L6DA 1JQXA 2ABAA 2VYOA 4GHRA 3W7IA 4AFYA 1OCQA 2WHMA 1ZLPA 3W1RA 3N3MA 3RX3A 4LUYA 3GX9A 4XD5A 1MUMA 4OE7A 3ICJA 3EA1A 4F0RA 3EDFA 3A23A 3VYLA 1H09A 2CWNA 3FXYA 3CQIA 1RAKA 1J0IA 4MWAD 1R3QA 1KM6A 3E02A 3QGAC 4X22A 4W8AA 4Y8FA 3PAJA 4NAEA 5D03A 2I7GA 4AZIA 3T55A 1MNZA 3AUJA 2B7PA 5EPDA 3GHTA 1P43A 1UP0A 1SO4A 3WD1A 4XSLA 4ZQRA 3GIPA 2FPYA 3LV5A 3H55A 2ZDSA 4M81A 1ITUA 1YBQA 3MB9A 3UJFA 2Q8ZA 1EJRC 2DGAA 4LSBA 3IV3A 3K13A 3BSMA 4ZQOA 2RDUA 4DQWA 4JY8A 3F2DA 1XDJA 2R1PA 4W89A 1L9WA 2XISA 2J8TA 1QI5A 1GYNA 3VGEA 3L4XA 3TJIA 1R3SA 1MUWA 3FV9A 4KCVA 3NQ8A 4LV9A 1KGWA 1UZ1A 1BTCA 3MANA 1F05A 3MKKA 2DSZA 3KTSA 1VBRA 1ZGDA 1I2NA 3KS6A 1F74A 1TX2A 1CYGA 1JGMA 4CU7A 5JMUA 1Z6KA 4HOWA 1TSIA 3IVTA 4BFAA 3ZLFA 4WR3A 4GNVA 2PLKA 3W70A 3LLFA 1TRIA 4IIEA 2OOFA 3C5QA 4K7YA 4QROA 4WY0F 1KKRA 2NT1A 1FKWA 5E0FA 5KITA 4JTDA 5A94A 1LZOA 2W63A 3ONCA 4O28A 1JZ2A 4O1AA 3CZ8A 2PUZA 4XUYA 3ZR6A 4US5D 4S3DA 3H53A 5D9MA 3H23A 3TVAA 3N19B 4DF1A 2JF6A 2VGIA 1BXBA 5D9PA 2BNJA 3RAOA 4QQ3A 3L21A 4OBSA 4EAMA 4HHLA 1BYCA 2R9RA 1MRAA 4S3EA 1V0MA 3VKKA 1W54A 2PDJA 2JKAA 4PR4A 5AC5A 3VNIA 5J5DA 5CJMA 3PG8A 1XIMA 4IFKA 4UTIA 4D6EA 1VFMA 1LJYA 5I03A 3HPAA 3WO8A 3T78A 4RUBA 2QVHA 4FMVA 1NTHA 5F2MA 1PEZA 3IIVA 1MFUA 1Q4WA 1IF2A 4D9PA 3MJYA 2H6RA 3LCXA 4FZIA 2PTXA 5BW6A 4CD5A 3MKVA 4J4KA 5I3DA 4DJDC 4Q7IA 2XIJA 1XBVA 3P0XA 4XVEA 5CZKA 1NIUA 4P8WA 4UQ9A 2A79A 4AY8A 4AIOA 4UR8A 2JIEA 1TV3A 4PMYA 5I3FA 4K68A 5LNWA 3TCSA 1QNRA 3BG3A 2OWXA 1DJNA 1EUAA 1DQWA 1QWKA 3NQ6A 2VGFA 3QFEA 4QEEA 5D8WA 1XBYA 5KZEA 4GY0A 1C8XA 3CAQA 4OV9A 3OYXA 4C6DA 3O6AA 1E5NA 2HE8A 1HP5A 4A21A 1DJIA 2QW5A 3GZ3A 4DYJA 1KGUA 4GZJA 4W9TA 1HVXA 1TPVA 3LG3A 3FKRA 2CERA 3MI2A 6ALDA 4HYRA 3RUBL 3VNDA 4GCXA 1GYMA 3W1QA 3WQ5A 1VFSA 2DSKA 4ZBCA 4UUIA 1FWGC 3DH7A 4N9EA 4J2MA 2YL9A 1NF0A 4FXSA 3ANVA 3IJ6A 2HXTA 2G3JA 4XSMA 1KQZA 3TEVA 4ZO8A 2X09A 1M41A 1GPWA 5CLTA 5BRPA 3MSDA 2VHLA 3MP3A 3V0TA 1IWBA 1J79A 4TU1A 1ONRA 1TCMA 2WBKA 5EMKA 1EOKA 1A4MA 4FNQA 3IUHA 1B90A 3KZSA 4GZEA 1IIHA 2VX7A 3LXBA 3OHMB 2IKIA 2PZ0A 1KQYA 1WZAA 1UG6A 3PZTA 4AD1A 3QOKA 5LNVA 4AXKA 2YZ5A 1PVNA 1Q4NX 4LTSA 1SR9A 1KBIA 1W37A 3USBA 3W7CA 5I77A 2EJ1A 4GABA 2XIQA 3AUOA 1EYWA 5K9DA 4ZFCA 3GR4A 4DELA 1J2WA 2YA2A 4EIVA 4BR1A 3B8UA 3II1A 4IMFA 4AH7A 3AXKA 1DWIM 1NWRA 2J7GA 3PTKA 4WJ8A 3LTSA 4NASA 1HNYA 3HPXA 4HMCA 3TYEA 3U0HA 3H2OA 4CNOA 3ZSTA 4XD4A 3V1HA 3WLMA 4DZHA 1TVLA 1KTNA 3E12A 2CZEA 2V3EA 1ZAIA 2AAMA 2J62A 5D05A 4LPCA 1F61A 4AVFA 3LCFA 3MYPA 4DXVA 2ZTKA 3G1SA 1US3A 3N3TA 1F3EA 3ZSSA 4X2PA 3FAWA 3TNOA 1EX1A 3GNPA 3CZKA 1VC4A 4U4MA 3RO6A 4IJBA 4L61A 1CBGA 5HMSA 2PDMA 4GFIA 5FCZA 1BLIA 4PCFA 1H51A 2ZX5A 5AYIA 4NAFB 3MJMA 1AZ2A 2E6YA 1W5MA 4UMBA 3CT2A 1BQCA 1QOPA 3W02A 1KM4A 4FNUA 3RR4A 5JVLA 3CH0A 3VIFA 3QMRA 1AD4A 4O4VA 3UZYA 2QIIA 1XLLA 4B16A 5EA9A 4L5ZA 1OVDA 4TVCA 4ZMGA 1TE6A 1V08A 2INFA 1G0CA 1G4EA 1FWCC 1RSCA 2YCKX 5G2WA 2FJUB 3MUIA 1TPFA 5CPQA 2ZXDA 2IKHA 1T5AA 1CXLA 3TN6A 3DC0A 1WDPA 4GQ0A 1QNPA 4J3TA 3E9AA 2J6XA 1TV7A 2IPFA 1OSEA 2DZPA 3FA3A 3HZ3A 4DJFC 4ORIA 1SO6A 1TIWA 4UNKA 5D37A 3LI1A 2OZ3A 8TIMA 4X63A 1OX4A 2VFFA 3WJYA 4Z1AA 2GSEA 2W66A 4ROPA 1EO5A 3QC3A 4Q8WA 1W8GA 5FL0A 4B5UA 4DBWA 3GC4A 5A8PA 2UY2A 1FHVA 1H2JA 1SZFA 2XDFA 1WZMA 3VIHA 1ISXA 3RG6A 4E2VA 4IF2A 4NRRA 3OLEA 1H11A 4MJ4A 3MV11 1TR9A 1GQIA 1PDZA 1UUQA 2C71A 3FS2A 1IZJA 1R3TA 2EPNA 3W1UA 4C60A 5DLCA 3LBOA 5CH9A 5E9AA 3G18A 3EEZA 4Z0JA 3IVSA 3BJTA 2HMCA 1O1ZA 2YL8A 3WLKX 1EIBA 4HB7A 3KS5A 2Y24A 3M0ZA 2D1ZA 3MSGA 5DBUA 3H22A 5TQLA 1VYRA 4MWAA 1OWQA 2IQDA 3C8FA 5GNZA 3OGRA 4JIIX 4HT3A 2QAFA 3B0VC 1PL9A 2J27A 4FLSA 1PZ1A 1VJZA 3C2VA 1VFFA 1W5NA 5FOOA 1Q6GA 4PUMA 5CPLA 5CC3A 5JH1A 1C8YA 4JFSA 3DG3A 1XFBA 3HOJA 1PIFA 4V33A 5KZ6A 1VS1A 4P8VA 4YYFA 6CGTA 5CZSA 4JX6A 3TV8A 1TIMA 2BVWA 3BCFA 2QF8A 4YN5A 2ACUA 2VX5A 3JRKA 3UZJA 4FXFA 2XIOA 2GVJA 1E5JA 2OPJA 1EZ2A 2E68A 4EWND 4FHAA 4QDPA 3E6EA 4ICNA 1F6KA 4B5TA 3RDKA 4A29A 4A8IA 3K2GA 4H4IA 2WZIA 3G3DA 1DORA 4FOKA 2E5CA 5T9CE 1SFLA 1YHTA 4LAZA 1UA7A 1VJSA 1A5OC 3G8EA 2B81A 2F2KA 2OOGA 2PDYA 1P1MA 3AHYA 3EX3A 1ZENA 1U83A 1Q65A 4US5A 1X6LA 1W3HA 2DUXA 1EWEA 1VGAA 2POTA 2G50A 3O0KA 1V5XA 5I0DA 4WOQA 3PSVA 2C1HA 4O15A 4RV8A 3AISA 2Z00A 3IS4A 3WSUA 4S3JA 3WQWA 3DIPA 3CV2A 4D8AA 1GJPA 2WWCA 1ISZA 2I9EA 4GA8A 4QAIA 1R7AA 2Y8UA 1JCLA 2VEGA 2E9LA 1TTJA 2FZ9A 4XBSA 1EQCA 3P0WA 5LHEA 3PUEA 1FCVA 3MSYA 4WDTA 2YOCA 4GIYA 4L6HA 2ZWZA 2BZNA 2FQIA 2X0SA 4YTRA 3THAA 4ACZB 1O5RA 2NVDA 3TYCA 1CGYA 4P7NA 4QFUA 2PDFA 2EPOA 3BGGA 4H8HA 1YRRA 1DTUA 1MYRA 1IT8A 3PSWA 4YIWA 3ARUA 3KHJA 3RX2A 2DIKA 4NZ4A 1A5BA 2I5GA 3WFZA 4V2XA 3PJWA 3VNMA 4NNCA 3AIEA 4JZ5A 5EGRA 8CGTA 4F8XA 3SECA 1E9ZB 2VCCA 1TUFA 2DY3A 3PBWA 2F8QA 4DPQA 1THFD 2QPXA 3OG2A 4PCSA 4H00A 2R91A 5CPOA 4DYKA 1EEXA 4OJYA 4GFSA 3B0UX 5HR7A 2H8ZA 1GK8A 4W8LA 4O12A 2OZ0A 1G69A 1NFGA 1TYGA 4E0CA 2B31A 4GJ1A 2ZRWA 3MZ2A 1VQTA 2VELA 4BS0A 1LM1A 4JX4A 4HZ8A 2D0FA 1UYQA 1GG1A 1OX6A 4RW3A 3IV8A 2J13A 2HK1A 1IEQA 1UKTA 2VKZG 2MANA 4GIAA 1Q8JA 4HK7A 2J7BA 1B3OA 3GXIA 3GDMA 3QBUA 2BXYA 3A6OA 3NO5A 1A49A 1TMHA 4Z2KA 3ARPA 1LYXA 3S8HA 2BVDA 2JKEA 2D69A 1XISA 1UR2A 1JYVA 3N9SA 2XSAA 5A6KA 4QNEA 1POKA 1RP8A 1JRCA 4O52A 2AL2B 1RUSA 1K6WA 4RK8A 2HEJA 5I78A 3ITLA 2CNCA 1DVJA 2I5IA 4XUGA 3S5SA 1FP9A 1EJWC 5CSYA 4Q4QA 2E9MA 1TZ9A 4I7WA 2RGLA 2ZTJA 3KBWA 1LG1A 2V2HA 3KFTA 4NXSA 2GJRA 4GVFA 3NSMA 4XBKA 1V3JA 2OQHA 4NUWA 3LNMA 2PC4A 4YMZA 1ZRQA 2VEPA 3W0KA 2HVNA 1CXIA 3B8DA 3BLEA 3WELA 1B3VA 4S23A 4YWIA 4Z0SA 3WLJA 3KTCA 2Z25A 3DFPA 4J5NA 3NFUA 3KBJA 4IJRA 5DCBA 8XIMA 3LMYA 2YCLB 1VFTA 2PODA 1CXHA 3L67A 1QNOA 5EU9A 2A3AA 1BKSA 3AMLA 1TWWA 3NQEA 1KCXA 1PV8A 7ENLA 1EJVC 3E1F1 4I9JA 2QJJA 3FA4A 3LHUA 2C14A 4JN8A 3W74A 3PY2A 2PF8A 2P8CA 2YFNA 1FWEC 1EB3A 1WDWA 3NPXA 4L9XA 5I07A 3WG6A 3M07A 3NZ1A 3LHWA 3HMCA 4GUHA 3VUPA 5G4HC 1S2AA 4MIMA 1EBHA 3WLSA 3B8VA 2FZNA 1TREA 5DY3A 1P0DA 2ZA2A 1Z32X 4B9YA 2CKRA 3QV6A 1LUCB 1AQHA 4GYPA 4IQEA 4HNNA 1M7XA 2DQWA 5ABFA 1ZS2A 1Y7VA 2RH9A 1X8CA 1WCGA 3C8NA 3MI3A 1M3UA 1TB3A 3BAKA 3IJQA 2PU1A 4FR6A 4CN6A 3VNKA 2O9RA 2CZFA 1LTDA 2YCIX 4IX0A 3PM6A 4RLIA 5C9XA 3DN5A 4W88A 3OZMA 2YKKA 1A0CA 1RCOB 2BGSA 3TKFA 3QTPA 2FVKA 4IIBA 3PZUA 3S83A 3OLIA 3A4XA 3B8WA 2ZRVA 1CZ1A 1H49A 4DB7A 5BOEA 1IGWA 1J5TA 2WSKA 1H5YA 4IFRA 1R9XA 3GHSA 3LOTA 3VIMA 5DO8A 3QMSA 4PL1A 2ZADA 4G9PA 1HJUA 2HXUA 3H4WA 3GUWA 3LRLA 4WQ6A 4GZIA 3R4IA 3EB4A 1JCMP 2RKXA 3N34A 3EYPA 2XIBA 2GUUA 3LMZA 5C2CA 1NVMA 2X1UA 4PODA 5F7UA 3I3EA 3SIMA 1S2VA 5D32A 4UQBA 3FDGA 5K9XA 3SCUA 2QCHA 2W67A 1XRTA 2D24A 1BG4A 1UKOA 4MWAC 4Z2GA 3VD4A 1R6WA 5LGZA 4XO6A 1LCOA 2X8RA 1YE6A 3U7VA 1EXPA 4C6QA 1BXCA 3G6LA 1Z9AA 1NH6A 3L12A 3GNXA 5D38A 5HJLA 3H12A 3TYAA 4RE0A 4LAMA 4REQB 2OXNA 1OT2A 5T26A 2INZA 1WO2A 2WCGA 3E0IA 5L6UA 1H41A 3WH7A 2CXEA 1X7FA 4UTLA 2Q3OA 3T0TA 1SJDA 1G7VA 2ATSA 1A0DA 2J7CA 4BQ5A 2OQLA 4KERA 1N8IA 3H70A 1W1ZA 4HZ6A 3UGVA 3M1ZA 4C91A 3LY0A 4F4RA 3BGJA 4HMEA 1OFBA 1MXSA 1OY0A 3NZPA 3GVQA 5A6SA 1KM5A 1KM0A 5IRPA 1E6NA 2GFTA 1JCYA 3QHMA 3IUIA 3W07A 2EJAA 3N6HA 1X97A 5LIUX 4PTDA 5G1MA 2B4GA 2PSNA 4H8UA 2FKPA 2XN1A 3MTWA 4M6PA 1XLEA 4OWGA 1OQFA 2VUNA 1UUMA 4ZB0A 1DOSA 3WJZA 1TE1A 2WMIB 1FWJC 4JS3A 4KWSA 4KIEA 3RK8A 2I17A 5E0CA 4WXYA 3QY8A 2A6NA 1R7OA 4C1NB 1Y8BA 3OZPA 4AXNA 3R7MA 3PP7A 3DAQA 4O16A 4KWUA 3G6MA 1IEWA 3SN1A 1B9ZA 1B1YA 4AZHA 2J78A 3CL6A 3O3RA 1DE5A 2QGHA 2VDIA 3OB8A 1A5MC 3ZLGA 1VFOA 4EANA 4UWMA 3VIOA 4WZHA 1CB2A 1G4SA 2I16A 3H2EA 1EJTC 2E5DA 3TAKA 4CQAA 1F7BA 3E2QA 3WD3A 4Q7BA 3N1AA 1ZJAA 2PBGA 1JPKA 4KCTA 2UBPC 3IPWA 1AJZA 4I5UA 3B04A 3N9KA 3VABA 2PWEA 3PVFA 3BLLA 4AHPA 3UJEA 2HDJA 4FXJA 2OYLA 1DTNA 1OINA 3MV01 3AYSA 1A5SA 1GORA 3BAIA 1KCKA 4FA3A 3UP8A 4R85A 1LORA 3RLUA 1J6OA 3GO2A 3KBMA 5KTLA 2PEVA 4PCNA 4TVUA 2P3EA 2GWNA 2ZC1A 3DOPA 3N2MA 3RRAA 4UOJA 4M6UA 2QAPA 2REQA 1Q85A 3HGRA 4EX4A 3OOQA 4JKKA 4EWJA 4G7EA 2AGKA 1PXGA 1FDJA 1XRVA 2XVGA 3XIMA 4H2HA 2VVNA 3LSCA 2J9YA 1J93A 1C7SA 1KWGA 2VOTA 1G94A 4XKYA 4A35A 3WQGA 1ITQA 4TO8A 4AWTA 3P84A 1KFWA 1V7AA 2YYUA 1W56A 4PUNA 5E93A 5BWAA 1FQ0A 4LU0A 4WY0B 5AZ1A 4K36A 1QNVA 1D9EA 1I9CB 3TSDA 3A64A 3T44A 3KOFA 1E6PA 1IEVA 2CLEA 4HQVA 1IEXA 3NEHA 1TPUA 2JIWA 4O57A 3QV8A 5CJNA 5CGTA 1SJCA 3GKAA 2IXVA 2YBTA 4IISA 2YR1A 2A5HA 3GTXA 4NX5A 1P4CA 4QISA 2E9BA 4LC6A 5DN1A 2E1WA 5CPSA 3WQOA 3T2OA 3CPGA 3TYUA 1A3HA 3RXZA 1A5UA 3EMCA 4AC1X 3W88A 1KFLA 4G7FA 3S4TA 2HK0A 2WZHA 4GACA 1LQAA 2ADAA 4HN4A 4NG3A 3JW7A 3KRSA 5JU6A 2BFGA 4HZMA 1UD3A 4AD2A 3B0PA 1MEWA 2V8ZA 4LYRA 3EPOA 1FA2A 3UA4A 5ABHA 3W1XA 3U6WA 3ZWSA 1P48A 3UERA 5CZ0A 1R2RA 1NELA 3N6QA 4CNNA 3OBKA 4TX9A 4RZ4A 3SN0A 4Y7EA 4GXPA 3IUDA 2G95A 1ITCA 3T0AA 3STPA 4DAFA 1XCWA 3K5XA 3PZOA 1PBGA 1WAWA 3B05A 1RA5A 1RBOB 1RR2A 3NL6A 2BHUA 2WNZA 5XINA 4DN1A 3TU9A 3OA5A 3R25A 3FGCB 3S5OA 1YDVA 3QC0A 1E6SM 2QS8A 1OIFA 3I4EA 4NJKA 4H1ZA 1WUEA 3UESA 2ZZ4A 4ZL1A 4HNLA 4AEOA 3NL2A 1KBBA 1K7FA 5DRCA 4GYPC 1FBAA 4LUIA 1XLIA 4LUTB 3MSRA 4D6JA 5JXQA 1ZAJA 2CKSA 3ARSA 2QHAA 3W1TA 2ZXBA 3GG0A 2FMOA 3BTNA 1H3GA 2WCSA 5I7GA 2ACSA 3WX7A 2CEQA 1XD0A 5FF7A 1GVFA 4MB1A 3FYPA 5BWFA 3UYIA 1M65A 1YMYA 3ARXA 1Q5MA 3BOLA 4XTIA 2EF9A 6XIMA 1S5MA 3VKDA 1TTPA 3KVLA 1JZ4A 1JRBA 2ZZ1A 3TTEA 3HURA 2PP1A 4MUZA 4OFCA 3PBGA 1FH9A 4WHBA 4M24A 1JZ5A 1QHZA 3WDPP 3BLIA 1B3YA 3L23A 3AROA 3MP5A 1AG1O 4B5SA 4JICA 1JZ3A 2G3NA 4N0RA 1YQ2A 1NDWA 4ZOEA 3OYZA 2OZ8A 2WPBA 3SCQA 3G1FA 3S9ZA 2W62A 3QFWA 2C1IA 4XIMA 1Z7AA 3T42A 2PDUA 3ALFA 3BL3A 1B57A 2NUWA 3CYJA 1UQZA 3PULA 1SFTA 5C71A 3TW6A 1ONWA 4FNSA 4O1EA 1IE7C 2VZOA 2Z1VA 3A9BA 3UFYA 3QM3A 4WCJA 1W31A 4JEJA 2NLIA 1DJGA 4LVAA 1OM0A 2Y61A 3ZJ7A 4QJ3B 1GKRA 1LRTA 3VGDA 3P60A 1JCJA 3RGTA 2YIHA 3UPMA 3REQB 4A22A 4C6CA 4JOMA 3UQNA 3SRKA 3GB6A 1XLBA 1I1XA 3V1PA 1XICA 3EMQA 3W26A 4B4HA 4IFOA 2VVSA 3K8LA 2OLSA 4MKNA 5M17A 4F9DA 5RUBA 3OODA 1IXOA 2E0PA 2QQ6A 3KDNA 2FH8A 4GNKB 1OCJA 2GLKA 4DWSD 3FW6A 1PKMA 3SQSA 2GGEA 4EXAA 6A3HA 4KCUA 1W9BM 2QIWA 3CTTA 3CWNA 4XQ6A 1EL3A 4O17A 3SB0A 3AS2A 3L0GA 1SZNA 3PPHA 5C9RA 3CPRA 4LWWA 1QO2A 3ID7A 5LA1A 1QK0A 1IHIA 1Q6LA 4WKAA 3S2LA 3QXBA 4ORMA 5F1VA 2GQAA 3BMXA 3M0XA 4NZ5A 5CSUA 3I68A 4CKQA 4QCEA 2C13A 3NZQA 3LHVA 4A2RA 2C0HA 1ALDA 3GW0A 1YBQB 1ZNNA 1RLDA 4MNLA 1E71M 2VFHA 3QQ1A 1X38A 4Y8EA 3LGDA 1C9WA 5LSMA 4B2DA 1WOAA 2WZMA 3ZJ6A 1QAPA 1N2VA 1SPQA 3ZZ1A 3I7RA 9CGTA 4FOUA 1UD2A 2XFYA 3N18A 2R1KA 3OG3A 1QBAA 4MWAE 4FNRA 4RNHA 2F6UA 4ZTXA 3L2MA 1E1CA 4UOQA 5ENLA 3VNJA 4JQ3A 4US6A 3SURA 1DJYA 1FKXA 2H8XA 4RV3A 3INPA 1GG0A 3UR7A 3WNNA 1OFAA 2OO6A 2W92A 1CEOA 2ZUVA 2EG6A 3NSNA 3LPGA 1HX0A 3OQ8A 1KFKA 1NWTA 3EWBX 2VD9A 4UR9A 1S1RA 3FVMA 4INFA 3L66A 2DVUA 4Q8OA 5CQ1A 3U9IA 2FHCA 4O0ZA 1XPYA 1I6NA 2NSXA 3B0XA 4IPIA 3OO2A 1ISYA 4N6EA 4W7UA 4JFWA 3CT7A 4U5IA 3KW3A 2ISFA 3FA5A 1N55A 3AALA 1OGSA 3ISIX 1PKNA 2Z1WA 1OC6A 3LDVA 3T0CA 1CGTA 4JHZA 1VPQA 2DVXA 4JL2A 1EP2A 4GQGA 4IFKB 4MADA 1MSSA 4JCMA 1NFPA 1JFXA 1XIBA 4X2RA 4LYKA 1DL3A 5DT7A 2VR2A 1H1YA 4PB4A 2D23A 4G56A 3M5ZA 3OVGA 1UA3A 2ZXAA 5G5IA 3KZPA 3LBMA 3LYEA 1EUNA 3P8IA 3I3DA 3W22A 2YPIA 3GS6A 2XN2A 1X6UA 1PS9A 1TPWA 1IZKA 3E0WA 3SUTA 2J7EA 4L4OA 5A6LA 1UWIA 5DMNA 2FDSA 4O1CA 2Z26A 3GR7A 5EKYA 3CV6A 3P74A 1HGYA 1G6CA 5C70A 4IGSA 3O05A 1XLMA 3NL5A 1F6YA 4HIBA 3F2BA 3STGA 5L9FA 1SW0A 2XTKA 4H6QA 1QK2A 3A24A 3EDEA 3BW3A 4F0HA 2QNEA 3IJ7A 3W29A 1UR1A 5F2LA 4MVAA 3FKKA 4R5EA 3FSUA 3W6LA 3N12A 2XFRA 4JEQA 2TAAA 4Q8UA 2WNNA 1XYCA 3KRZA 2IMRA 4GX9A 3CGTA 2AGTA 2ZCGA 4BQ4A 4NVTA 1JUKA 3MMWA 3QKZA 3R6IA 1VYPX 4I7UA 4V28A 1JQVA 1EEPA 3TYZA 4Q4OA 3BLOA 4LCRA 1ISWA 4NQ1A 3PPGA 1GQLA 5DMYA 3NZRA 5HNUA 1B3ZA 4QM1A 3N04A 4H6KA 2FTWA 4HNVA 5AFDA 4ENLA 2DSWA 3UVIA 3VXGA 4U3CA 5F2GA 3UZXA 5LA0A 2Z4GA 3U7BA 1SR0A 5ABEA 3EKGA 5AYXA 1QASA 2ZZ3A 3BLPX 3NG3A 3JZUA 3MZNA 3ENLA 3CAWA 4W8BA 4RE3A 2Y7EA 1W5OA 3PJUA 1H1ZA 1GKPA 1H63A 2F61A 4M8UA 1XCFA 4FI4A 1TCDA 1Q13A 3EDKA 4D2JA 3E38A 4IQDA 3CK5A 3UT0A 1RA0A 2PU0A 4AIEA 3MC5A 3AWNA 3CH9A 3BK0A 3LGEA 5A6TC 2G0WA 3T4WA 3T1GA 5G1YA 2ZZ5A 4P2VA 4JBRA 1E70M 3M0MA 2CFFA 1E56A 1K1DA 3LK6A 5G2HA 3PK7A 3N6JA 3D46A 2GYIA 4GY7A 4DVOA 1JZ6A 5SWUA 1A5NC 1YXCA 4ZO7A 1M1BA 2B7OA 3KDOA 3ERPA 1HL8A 4NZ1A 1UC4A 4A3HA 3F2CA 2VZSA 5KZDA 2A0NA 1AL7A 1VPYA 3WKZA 3M46A 4M7TA 3O1NA 3W81A 2XGIA 1E43A 4M56A 1ZQ5A 1EJSC 4GYKA 1DP0A 3CUJA 1ZPTA 1BF2A 2JBMA 2GDQA 2WVVA 4UCGA 4GX8A 3T05A 4U2ZA 1QI0A 2ZUTA 2FB3A 4GNJA 1JUEA 4PBEA 2X0HA 3W3OA 1X1NA 4TUFA 1K9FA 5I06A 5XIMA 1E0XA 1BRLB 4J40A 3DENA 3T07A 2A6LA 2JEQA 1E9YB 1UMLA 2PLMA 3SR7A 4AQLA 1XGDA 3P8JA 3VKJA 3HM7A 4QAWA 5CXPA 3TAOA 2FPTA 1IXQA 1W3TA 5E1QA 1XQLA 2X05A 1HFBA 5GJPA 1H61A 1RP9A 3B03A 1GOIA 2GWGA 4UFLA 5FA5A 3W7LA 3V7PA 4LJ3A 3LNPA 5HJYA 4AYSA 3DGBA 4NKCA 4IWWA 4ZZ9A 1VR6A 2OEJA 4C65A 3KCLA 1O5KA 3W85A 3S42A 3WQ8A 3CM4A 4B9ZA 4EPEC 4DM2A 1K8CA 3O06A 4L65A 1UWTA 3VGGA 2G3FA 2HISA 4ONVA 3QPYA 3KLLA 4AY7A 3BGAA 1OC5A 4XTDA 1I8JA 5DXYA 4MM1A 4PB3A 1VBHA 3G22A 4PC8A 3BLFA 1D3GA 3WFLA 5E09A 3KTXA 3TIMA 1TJRA 1T41A 3CV7A 4PSPA 3TQVA 3C86A 5BNKA 4IPLA 3F4NA 3R0KA 4WDUA 4JTKA 3WCZA 1TMQA 3MYOA 2J77A 4J7RA 5C0QA 1GHRA 5C6MA 2WCAA 3ITCA 1KTBA 4BQ2A 3E96A 3ARQA 4QDMA 1I45A 3GDTA 4DWSA 3C56A 1CX9A 4RX0A 4Y90A 3NQBA 3EOEA 3MUY1 3ZMRA 3MU7A 1Q8AA 4MWAB 4V1XA 2YBVA 2H9AB 2Y1HA 4X60A 1GHSA 2XHYA 3UJRA 1P0NA 4MY8A 2EBNA 1DBTA 3EKZA 1WKFA 5D2YA 2AMGA 2X0YA 4V1YA 3GNRA 1VKFA 3CAKA 1JDDA 4UTKA 4D8ZA 4Q4PA 1ZHAA 3OLDA 1REQA 3WH9A 2ZYFA 3BUVA 2AOSA 4HK5A 3UWVA 1OADA 3UCQA 1QVBA 1J5SA 3VOFA 4EPKA 3QZAA 4AUBA 1KFJA 3NQ2A 2OCZA 3PF3A 5LYRA 1WE5A 3CHEA 1KD0A 1VEPA 7XIMA 3R43A 2NWSA 2EQDA 3RLVA 1H5VA 3LPPA 3RLHA 1GOMA 1E4MM 4ZOBA 3SSJA 1KBJA 3CHFA 4PSRA 3SO7A 3KBNA 4PRRA 3VD9A 1E40A 1QOQA 4LRSA 5REQB 1Q6EA 3FSTA 5H2ZA 4MF4A 1POJA 4Q7NA 5I02A 3CLWA 2VQTA 1R3VA 2OEMA 2OYMA 3E2SA 3ZOAA 4F0LA 4LALA 3IJIA 3E5PA 4AC7C 3TLQA 2VR4A 5BXTA 1VCVA 3HGJA 4F9JA 1TJPA 3LGGA 3C2RA 3SUSA 3PUDA 2WW5A 1S2CA 1QTWA 1E1FA 3GD6A 4JNZA 1UIOA 4O1DA 3F5KA 1WKEA 3SQLA 5DFAA 1AQMA 1F8MA 2WSPA 4I7VA 3S2NA 3WQ6A 3NWRA 4OGZA 3R8HA 5FEZA 1US0A 2QMJA 2JK2A 1GOKA 4YYCA 4DO6A 3SADA 2DSVA 2E5BA 1FP8A 3PUGA 3WLIA 1I2QA 3ZR4A 5H6HA 1V3HA 3IANA 4IIFA 2XFFA 2W27A 3ABSA 4MFDA 4PMNA 5I24A 1C8VA 1OK6A 1Q66A 3EWDA 3WLOA 3OP2A 1RHCA 3KVJA 3NOYA 2XU2A 2OWWA 3TQ0A 1Q7MA 1HN1A 4NNAA 1EXBA 1E51A 4LS0A 1JAEA 1ZJIA 1EH9A 4GE8A 5CZTA 2CLFA 1YX1A 2HQAA 3MDUA 3TTOA 3VGHA 1XPGA 1IEIA 2XWDA 3L4WA 1TELA 1PZ0A 3AMGA 5U4NA 1CXFA 2OFJA 4IMCA 4EAYA 2OLAA 3R79A 1QT1A 1C29A 4GH3A 2RDWA 4HNOA 3W1LA 4PUWA 1FCUA 1M9HA 3SCWA 1JXKA 3G2GA 2NX9A 3BICA 3PPCA 3WQFA 2OGJA 4K2SA 4I6KA 1E72M 1BVZA 1YLVA 4M19A 1PCWA 2J79A 1BSIA 4YCPA 2XSBA 4XWUA 4WLCA 4OUIA 3GTIA 3SCNA 1PSCA 5B7YA 1W1TA 2EO7A 4XZMX 3GVVA 2HS6A 3L9CA 3SN4A 2XM2A 5LXXA 3RM8A 2WBGA 1EQPA 4GJIA 2W9MA 4AMAA 1PTGA 4GVIA 1EBGA 1U1UA 3WH8A 4E4PA 3MKCA 3VIJA 4KRTA 1RD6A 2E1DA 3V75A 1UD6A 2VC6A 4Z42C 3GXMA 1FWRA 1JD7A 3FX4A 2XIIA 4ZSUA 2QEZA 2VQUA 3B4YA 4TX8A 4H8NA 2EAWA 1TMLA 4LW7A 3ZWTA 2CHRA 4R7WA 1XSJA 3GG8A 4HMNA 4JFVA 3NXLA 3QQ0A 2GVGA 4JNYA 1SSGA 3PG9A 1RY0A 4IGMA 2WKGA 5FAGA 3JU2A 2EXOA 2PDCA 2WHJA 3SJ3A 3CZJA 4Z1BA 3DHFA 4CU6A 2FTPA 4F48A 2J4GA 4CGTA 4IQLA 2PTDA 4IP5A 4N9BA 3PTDA 6ENLA 5KZMA 4QBXA 5CBBA 4QNWA 4P5UA 2A2IA 3ZJKA 4NJGA 1E9LA 4QE5A 4WXZA 2J7FA 5E6YA 3WEOA 3EPNA 3HJZA 3RIKA 3AHZA 3CL8A 2G3MA 2A4AA 4AHOA 2WMHA 4FXRA 1JYXA 1UP3A 1B9BA 1PYFA 1OD0A 1GVIA 3QZEA 2GGHA 4W7WA 1F76A 3W2JA 1Y5WA 4MB3A 1LBFA 1JD9A 3NURA 3EDDA 1JIBA 5ABFB 1LBLA 3LX9A 1EGMA 1MEIA 1X8FA 1PX8A 1AFSA 1NM9A 4Q8PA 1OB0A 1R86A 4RW5A 2YSWA 3G5EA 1TZZA 1V3LA 4CNUA 4GKLA 2DVTA 1XLCA 5LZLA 4HCHA 4FLQA 1SMAA 3E2VA 4MG4A 4XAGA 1ZU8A 1NQKA 1XIGA 1WNOA 1PB0A 1BTMA 3VK5A 1TX0A 3R58A 1RQHA 3R12A 4C6PA 3LHYA 2R1NA 3KP1A 1HO4A 3LZ3A 3VZXA 3KBSA 1E6XM 3GBEA 2OX4A 1WBJA 2QLYA 3VFCA 4HZ7A 1V8EA 1XP3A 1FRBA 1EOMA 1J9YA 4CNTA 5EBUA 1YDYA 4LB4A 2YW3A 4DBUA 4S3KA 1T8QA 4HTBA 3AIQA 2PDXA 3WNKA 2E8YA 4JIRA 3CZLA 1Q6CA 4C6NA 1FH7A 4OZOA 4LYPA 3AAMA 3RN6A 1U1HA 4ZQNA 4DWSC 2VTFA 4K38A 2CLKA 2YX0A 2P10A 3S5YA 1XYLA 4S3CA 4HTYA 1V7YA 3B9NA 3A5FA 1VBJA 3NPUA 3B3DA 4JTHA 7REQB 4IT1A 1JDAA 5FEPA 3RLGA 1IWPA 2QF7A 3LU2A 5FSEC 3JUGA 4GWEA 1A0EA 4J3XA 3VD3A 2BHZA 4K39A 3FK4A 2B7QA 1XYBA 3AIVA 1UH3A 1V79A 3IRSA 2V30A 3B9DA 3T09A 1N8WA 2WC4A 4GYFA 2ATMA 3NUKA 1FUYA 2WXDM 5JUVA 3UZWA 4XD3A 2OGYA 2G41A 2OT1A 3WF4A 1V6TA 1TPB1 1VP5A 5G4WA 2ZA1A 1LOQA 1BEUA 4A3QA 5IBXC 2XVKA 1OEPA 2QDHA 2QUTA 4WJXA 2DZWA 5JBFA 1FVPA 3UF9A 1YPIA 3LHZA 3RJYA 3DGRA 1V3IA 2A3HA 3KL3A 4QCFA 3EXTA 2ON3A 1QI2A 2QCLA 2VFEA 1X1OA 3WNPA 4GYJA 1N8FA 2O7QA 4UNLA 1VHNA 1LQ2A 4IXXA 4ZO9A 4IIGA 4NZJA 3PS7A 4H6RA 4BWLC 1K9DA 3V0SA 1FDYA 1JCTA 1H62A 4L64A 4M1BA 4UQDA 2DT3A 1EDTA 4U2YA 2ZUWA 3LA4A 1BSLA 2YCJA 2O9OA 1E0UA 5HK4A 2XZ9A 5LIWX 4G5DA 2Y8VA 2R1LA 3Q58A 1JL8A 4R9XA 4IJCA 3FVDA 1B31A 4RPPA 4A2SA 1T7LA 4BJHA 3ELFA 3MWCA 3WNLA 2ZQ0A 4N6FA 1T8XA 3EB2A 2YFOA 4R34A 2HWGA 2BGQA 3W23A 3H21A 3WFAA 1VBUA 2WVSA 4LNCA 2VI0A 3QOMA 5GQBA 2VMFA 4OVXA 2NV1A 3MCNA 3W38A 1RD5A 3QPZA 4MPQA 3AZSA 3H2FA 3DC8A 3MWAA 4B5VA 2CU0A 3NQMA 4N4PA 4FB7A 2ANUA 4AIBA 4MTVA 1O66A 3OZYA 3QN3A 5LA2A 1S5WA 1WAUA 4NSBA 5EBAA 1JAKA 2X1IA 1KM3A 5HWJA 1ZL1A 2HSAA 2ZWYA 4H9VA 1FWNA 3SEPA 3N2CA 4M29A 5AHNA 5AZ0A 3W72A 4CLMA 2C18A 3LSBA 1MZRA 3C6CA 2V2CA 1M68A 2ZX6A 3DUGA 4W85A 3S2CA 1XL9A 2GGGA 3M0KA 3D0CA 1BAGA 3A21A 2ICSA 2QCDA 2RDXA 2GVLA 4DBDA 1NQ6A 2W5FA 4C7DA 5EMUA 4DF0A 1ICQA 1EGZA 3SUUA 4JDBA 4O4WA 1FWIC 1YDOA 3C3NA 1DJQA 3PNUA 3QGKC 3LM3A 3VAVA 4R7JA 3QR0A 2FPVA 4L9YA 1WQ5A 4PMUA 4HYVA 1WX0A 3CIVA 4H2CA 1HQTA 1DXFA 5C55A 3MVTA 1D8CA 4HNUA 4NZFA 1A53A 3VNLA 3AIBA 1TPDA 2G4JA 3J7HA 4GIEA 4DZAA 1EJ7L 1MUCA 1XUUA 3NGFA 3CUGA 1OX5A 4WOZA 4QQUA 1VYSX 2UY3A 3H2MA 5IHRA 3I6TA 2DT2A 1IXPA 1AH0A 4NI8A 3FDKA 4E8CA 2OZTA 3PNZA 1ONEA 3W24A 3WNOA 3P67A 4AVNA 3R1ZA 2W3ZA 4KWWA 4WRHA 4KKXA 2CIPA 2NLYA 4MAZA 2DDXA 1IWAA 4MLJA 3DFNA 5BXPA 2TYSA 1FXPA 5HPOA 3FAXA 4ZQPA 3STCA 4ES4A 3W6MA 3TR2A 1UOKA 3RF9A 3GHRA 5IHSA 1FH8A 1S5NA 4UTTA 4ACYA 3SRHA 3W25A 1UKQA 2GZXA 3ZO9A 3PWAA 3W7GA 3R5EA 2R6OA 4JD4A 3B97A 1XGZA 4OECA 1K8ZA 2WM1A 3VX1A 1FCQA 1SJBA 1TWIA 4B3ZA 3NVTA 2Y5SA 1OIMA 1NEYA 2TSYA 3DERA 1HKVA 1WDQA 5FEWA 4ICMA 2UY4A 2WJEA 3NDZA 3R89A 3DFHA 3AYVA 3W9ZA 1E73M 1L2UA 3RJXA 2YW4A 4G1NA 1PYMA 3SGUA 3OBAA 3IWPA 4K7VA 3KL5A 1S5TA 1GW9A 4R27A 3RCMA 3WMLA 4K1WA 2QDDA 4LV4A 3TOYA 4WD0A 4BQ3A 3OW1A 5E6ZA 4BA0A 3W7HA 1MZHA 3SI9A 2BSLA 3CZGA 3M7SA 4ZB5A 4NAFA 2H90A 4DO5A 2OEKA 4R33A 3ZJ8A 5JH2A 2V6AA 1W3NA 5DXXA 5HJXA 4A8LA 3GFYA 3OPSA 1BWLA 4GJJA 3SGGA 1DJHA 4IQJA 5KMYA 4UFHA 4YCOA 1PHQA 2CLIA 2B0MA 1SZEA 3WEMA 1ME9A 4W87A 1KW1A 2PC8A 1CWYA 4RE2A 1DIDA 2AQVA 4EPBC 1NOFA 4AWSA 2GVEA 1CENA 1LG2A 3TH6A 1W5QA 4BI6A 4RNFA 2WM0A 4OQVA 1OG0A 1CXKA 2W0UA 4PZVA 3MCOA 4B15A 4MZYA 2RDTA 4AEFA 4HU3A 1QR7A 3S1XA 1KRBC 2AMXA 4PUDA 4GXWA 2W4XA 3KOZA 1LT8A 1ZBCA 5LIYX 1KFCA 1L2QA 3LCIA 4DI9A 4YL2A 4ADSA 2EKCA 2BOFX 2WZTA 3C4UA 3AHTA 2WHLA 4HPNA 3GXDA 2WZEA 3MMUA 2P53A 2JKPA 3O6YX 5C9ZA 1CXEA 2OVLA 2QCCA 4J3ZA 4J28A 3SIZA 3IACA 3PFRA 2PTZA 5F2IA 4PUJA 4KFNA 4J3VA 2NV2A 1B30A 4F40A 4H8VA 1HJVA 4RXGA 5HUPA 3UCCA 1JG9A 1E55A 3CUXA 3GVGA 3O63A 3F7JA 4UTJA 3LPOA 9XIMA 1NWUA 3TROA 4JIPA 1LWJA 3ZQ9A 4Q4MA 1CNVA 4RNIA 4AZ6A 4KRZA 2TMDA 1BF6A 1FY6A 1VRXA 3C2OA 4MDPA 3BPWA 4FP1A 2BLEA 2YA0A 2CLHA 3V0UA 3TC3A 2NX1A 5BU6A 4GBUA 3DCPA 4MHBA 1V02A 5IFTA 3B06A 2PA6A 2DT1A 5HNRA 2BHYA 3EWYA 1DV7A 1PIGA 3GUGA 1OYBA 1R5YA 3WNMA 1XUZA 4X9YA 1FX6A 2Q01A 3FJLA 7ODCA 2X7WA 4ECLA 1T96A 3TYBA 1KRAC 1G4PA 1O6IA 1KCZA 2EKGA 3BANA 1Q6OA 4AZ5A 1B54A 7PTDA 4IUGA 3TOPA 5DX7A 4E8GA 3WDRA 5CAHA 4XZIA 2V68A 3NJ3A 2PWUA 1S38A 5CZJA 1TQXA 1HKMA 4I3GA 3VIKA 4DEFA 5LNUA 2HS8A 5B80A 5FAJA 2C0AA 4Z2JA 1A3XA 4EOUA 4N9DA 3UR5A 5BZAA 1JDCA 2WLYA 3SM0A 4AZ7A 1S39A 2I1OA 5DCEA 4PEEA 3GK0A 1E1CB 3F5JA 3VA8A 1ZY9A 1TJ0A 3TQKA 2XSXA 2UV8G 1XLDA 3HV8A 1O68A 1OFOA 3G77A 3R0DA 1WUFA 4AEEA 4TTUA 2TRSA 3OVQA 1HJXA 1FWWA 3E0LA 4W4QA 3EDJA 1I0DA 1C3FA 2FDMA 3E5BA 3EOSA 3C3UA 2PDIA 3P14A 4QG6A 2WK2A 3GFXA 1ADOA 5HQLA 4HHMA 2A7RA 3VO0A 2QT3A 4JTRA 3LB0A 5K4XA 3RPDA 4AW7A 1S2WA 3ZVHB 3QW3A 2CBJA 1RK6A 3S9IA 4PMQA 4LB3A 3OEXA 1WBHA 4PMRA 3TA9A 5LNRA 5E5CA 3VKAA 2G5WA 2XVNA 3UCDA 4CU8A 1KA9F 3V4BA 1GUVA 3UGRA 3W37A 2CESA 4PULA 4I5RA 5A5WA 4GY1A 3OIXA 1EJUC 2PDBA 5AC7A 1D3HA 1HUVA 4IPNB 1VIZA 1IZCA 3SCOA 1NOUA 3H2NA 1MQQA 4B5NA 2BY1A 1M7OA 1UWRA 1OG6A 3MHGA 2FMNA 4IHCA 4JTSA 5AYZA 2Z6IA 2ZX9A 1L6WA 3GZAA 4QIUA 3RFAA 3QY6A 1P6CA 4UZUA 4MSSA 4PMJA 1H7WA 1U30A 3EOOA 1BWKA 3P5YA 5A6JA 1DQXA 4JNMA 3P6LA 5TBOA 3QPEA 2BX7A 3L5AA 5CC7A 4DHGA 3ECQA 3T08A 3DFTA 4CVUA 3CEUA 3WLQA 1O5QA 4LRTA 4GINA 4OIFA 1E6RA 3YPIA 4FLOA 4WX2A 3SW6A 3L2IA 2QPUA 4UNIA 1EPXA 1E6ZA 3C2EA 1W1IE 4ROQA 1MMFA 4BF5A 1EC9A 3EMZA 4TTGA 4NU7A 3CYVA 4D6HA 2UZ9A 4PB5A 3RYSA 2WQDA 3VMOA 3UNDA 1GCYA 1JFHA 1HW6A 3KLKA 1JYNA 3PBVA 1LRNA 4PMDA 4DAIA 1L6GA 1E9IA 1CW2A 2YZRA 2VCAA 3HG5A 2CCRA 3HBLA 3WF1A 4MJZA 2VT0A 1M7PA 4UTHA 4ZE5A 1XLHA 1TPC1 4KFPA 4IUOA 4G8TA 4UFKA 4GUIA 2XG9A 4JQ2A 3ABQA 1JEZA 2BDQA 3MCMA 2VEKA 5ECVA 1QW7A 2O55A 2Z29A 3KE0A 2G97A 2Z27A 4B4FA 2YB4A 3TXZA 1TKKA 1GVQA 3SY8A 4PTMA 1CDGA 3QGVA 2FGBA 3W2UA 2J8GA 3IEBA 1UD5A 1KM1A 3TWAA 4DJEC 3TUUA 3H6OA 1V77A 4JFTA 2GUYA 3NO3A 3RCYA 3K46A 4ZXLA 2PCEA 2YCLA 4A8RA 5U7SA 4EK7A 2E09A 4C7FA 3BLKA 1O60A 1HKWA 2CLLA 1W2VA 2P5NA 2J25A 2NUXA 3NQAA 4JDYA 1MW3A 2GUBA 1JI2A 4FOJA 1CLKA 4P7OA 1M03A 4RZ6A 3AHXA 2DFAA 2WOQA 3UWQA 4XK2A 1F6PA 5CBJA 3DFOA 2DV0A 2XVLA 4C6IA 3VD5A 3V35A 3CZEA 5FL1A 4ZGYA 5GJMA 4AMCA 3PTMA 5I3HA 2V82A 2ZUUA 1FWBC 1US2A 1RY8A 2WVVB 1ZJHA 4MNKA 2PDPA 3DFSA 3WLRA 1UPMB 4WDWA 4ZE4A 3CS2A 3NIYA 2PBOA 1AK5A 4B90A 4FK9A 1EHNA 2QUNA 1J96A 1KXQA 3L2LA 2Z2UA 1J6PA 1KRMA 2CZVA 5HNNA 3BV7A 2BASA 1U2YA 3SCVA 5H8PA 1KV5A 2QJHA 3TLLA 2ALDA 1L0PA 4MDOA 1OFPA 3IIZA 3NPWA 4XZBA 4S3GA 2PDGA 2V69A 4M80A 3ITGA 3VE9A 1XBZA 2VGBA 5EMYA 3QF0A 3CPUA 3GAYA 3OU8A 4X3ZA 3COTA 1IR2A 3H4XA 4N42A 4M7SA 1SO5A 3PB2A 4NHVA 1ICPA 1QNQA 2X1SA 3VIGA 2QULA 1S5VA 3SCTA 5K9CA 1K9EA 2OU4A 2J74A 4JFUA 1UR3M 2OWCA 1BYBA 5HNTA 2TODA 2A3BA 2PGEA 1I2OA 3NNTA 3F4WA 4DX3A 1H60A 4Q6XA 4OOZA 2WWDA 1O94A 4DXXA 1RBLA 4DF2A 4H7ZA 1DXIA 1W91A 2V9DA 1AH4A 3W7RA 3BO9A 4GC3A 3OA3A 5ABTA 5M03A 5CSSA 3GNOA 4Y6GA 3L7RA 3AHVA 1UPPA 3ARVA 3IJ8A 3SCRA 3NL3A 1I2PA 4L7ZA 3TA6A 4A4AA 1BVNP 4XVDA 4DWSB 2A21A 4H9XA 3FLUA 3NQCA 3GU9A 4GKTA 1VIWA 4J2PA 3ZLHA 1SO3A 3W82A 4J9JA 2ZZ7A 1F3WA 2WC3A 2ACRA 3WDQA 3AU6A 3QV9A 3LHTA 1V6WA 3EBVA 3W2KA 3AJ7A 2C15A 2X2YA 4EVZA 5HR6A 2JGYA 3LD5A 3VI2A 3TSMA 2PB1A 3PB0A 4NYUA 2PLCA 1WKDA 4QSHA 2E25A 4PTVA 2WB5A 1S3HA 1GZJA 2W79A 3CTLA 2E6AA 2XPKA 3THDA 2WMIA 5E9XA 3P80A 2D73A 3CWHA 1BQGA 1GONA 4MKVA 3I10A 3ABRA 3BLDA 4GVHA 4C1NA 2FHFA 4W93A 2EG8A 2CLPA 1VD6A 4AF0B 1C90A 3FHQA 1XCXA 1KC7A 3ARTA 3O15A 4ZOCA 4LOCA 4DWDA 3WQCA 1OFDA 3ATZA 3C61A 2FFIA 4DBEA 3B0YA 2G37A 3CQJA 1VHCA 3WMBA 5J5RA 2PF0A 4HHHA 1XLFA 2V5KA 3WN6A 4AZCB 3VUSA 1GYLA 3QTGA 4O11A 2BGNE 3S47A 1WP6A 4JTJA 3W01A 1TJ1A 4O50A 5K2ZA 3IRDA 3TSBA 3M7WA 1RJQA 4GC4A 3O7UA 3WF3A 2GJLA 4O54A 2DSUA 3GQYA 1RPXA 2CZDA 5H8MA 2Y62A 3W7OA 3A12A 5GNYA 2X40A 4GUGA 5C2XA 3DI0A 4JTLA 3BE7A 3BW4A 1KXHA 2NQLA 3PTQA 1TWDA 4JTFA 3M16A 4E8DA 2P50A 3G1YA 5AY7A 5EB8A 2PURA 1UBPC 3FYOA 5DEZA 1SYTA 4QR6A 1KXTA 2D2HA 1A3WA 1G1YA 3QW4B 2Z1KA 3AMCA 2ZUMA 3KCOA 1OF8A 1VCFA 4IIHA 1ICSA 4MLRA 2W61A 4O8RA 3AXHA 3LCLA 3A22A 1I2RA 2V5DA 4AD0A 3ARRA 1YTDA 3PFMA 2VR5A 3L4UA 4DO4A 2PD9A 4E5TA 4YS1A 4F0SA 1DIKA 5C9WA 1BKHA 5JIPA 3UXIA 3GC2A 3VMPA 5T9BG 4K8EA 4JR5A 2RJHA 2R82A 3THCA 2VZTA 2DIJA 1GEHA 1LL4A 2BXVA 1AW2A 2GK1A 3EKLA 3B9EA 3CUIA 4NZCA 4WDXA 2E6DA 2EPHA 1R3RA 4GXMA 4IP7A 3CV1A 5H1WA 1QPRA 2GDUA 6PTDA 5DQPA 3ZYZA 4C90A 1W32A 4HKPA 4FS9A 1N7KA 4PE8A 2QXWA 1QPNA 2CBIA 3S46A 4P7LA 4TMCA 1W1YA 1GOQA 1JI1A 3ZXWA 4F0KA 5M2FX 4PN2A 1FWTA 4A3UA 3P93A 4LY8A 5ECUA 4LCQA 5LGXA 1E15A 3S5NA 2NWRA 1OC7A 4ERAA 3P82A 3M5VA 1EP3A 2FVLA 4CD7A 2GSJA 3G0UA 3U5YA 1XIDA 2O56A 1EFZA 3BCDA 2FLIA 3WEZA 1GW1A 4WVXA 2NQHA 3OVPA 3A5VA 1JNDA 3BCJA 1EWDA 2PI6A 4UZSA 2VRQA 3PHAA 2Z1XA 4JQAA 3RX4A 5CCZA 3DECA 2YCEA 4LAOA 3W7QA 4GISA 2XUCA 2I9UA 2ZVRA 2D3LA 2XN0A 4TQTA 3LUTA 1HF6A 4KWVA 4QE1A 1Z41A 4AYGA 1SMDA 1R2TA 3N2OA 1QATA 3ITTA 3L0KA 2ISVA 4PBGA 3P2VA 1R2SA 4ADUA 2VWTA 1RVKA 2CITA 3IGUA 1KWKA 4AVOA 4MYXA 5C5YA 1NP2A 4CEXC 3N29A 2Y7FA 2OODA 4JL1A 4GUJA 6REQA 3T40A 1RALA 1TG7A 3USZA 4LUTA 2E6FA 2BP1A 1PAMA 4QDWA 2V5LA 4JXCA 3U2CA 4TV5A 4LNYA 4ATDA 4Z2IA 2FGZA 3UETA 1GVRA 2B7NA 3PBMA 3WF2A 5AVHA 2PDHA 2WHKA 1V51A 3FXGA 1IQ8A 1F07A 1XHGA 4ZQMA 4LH8A 3ZT5A 3PJTA 4K6AA 1ZCOA 1IGSA 1T99A 1Y65A 1XLAA 3WBAA 1UQYA 1CGUA 2YGYA 4K37A 3POHA 2JFEX 5KSWA 1ZAHA 2PPGA 4OT7A 4LANA 3ITYA 2J88A 2NXIA 4A3RA 1XBXA 1EC7A 3SCSA 1CGXA 1UWQA 2Y88A 4GH1A 3E49A 4LF2A 1TTQA 1YIXA 2WVUA 1MDLA 4X9SA 1YKWA 2QCGA 4Y2WA 2OELA 2OR2A 4H04A 3QLLA 1D3CA 5D8ZA 4PRWA 1RH9A 3DKJA 3LV6A 4B3KA 4M6QA 1O12A 5HANA