3TYBA

Dihydropteroate synthase in complex with phba and dhp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
265
Chain Sequence
b'MKWDYDLRCGEYTLNLNEKTLIMGILNVTPSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 93
structure length 265
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tybA00
3H2FA 3TYDA 3NOYA 1F6YA 4C1NA 4DJEC 4DB7A 4S3EA 3V5OA 3TZFA 3TYCA 1Q85A 1AD4A 2YCLB 4NL1A 2YCIX 2H9AB 3TR9A 4DJDC 2DZAA 3H26A 2BMBA 1Q7ZA 3TYZA 4D8ZA 2YCLA 3MCMA 4DJFC 3BOLA 2OGYA 2H9AA 1AJZA 4G9PA 4S38A 4MWAD 3MCOA 4O1FA 4MWAB 1Q7QA 3TYEA 4S3CA 4S39A 1TWWA 4DAFA 2YCKX 3H24A 2VP8A 4MWAA 3H2EA 1AJ0A 4O1EA 1TX0A 2VEFA 3H2CA 2DQWA 1TWZA 1TWSA 4HB7A 2Y0FA 1AJ2A 3H22A 4D9PA 1Q8AA 4NILA 3H2MA 4S3AA 2Y5JA 4CCZA 4PZVA 4S3BA 4S23A 3TYAA 2DZBA 3TZNA 3K13A 1AD1A 2Y5SA 4NHVA 4DJDA 4S3FA 4DJED 1Q8JA 5JQ9A 3TYBA 3H2AA 1TX2A 2E7FA 4O0QA 3TYUA 4DJFA 1Q7MA 4MWAC 3H21A 3MCNA 3H23A 4MWAE 2VEGA 4DAIA 4DJEA 2YCJA 1EYEA 3H2NA 4DJDD 4C1NB 3H2OA 4S3DA 3BOFA 4NIRA 4DJFD 4D8AA
chains in the Genus database with same CATH superfamily
1PBGA 3NAVA 1B1YA 3BICA 5IFTA 3DERA 1LT8A 2C13A 2QCEA 1TIWA 5REQB 1D7FA 3S2JA 4AIOA 4QAWA 2ALDA 1KXHA 2E6AA 2PTWA 5DXYA 4LYKA 1ONEA 4QROA 1UG6A 2VL4A 3R58A 3UR5A 3PJTA 4GG9A 4DF0A 4XUGA 3SDOA 2UY4A 3B8SA 4XG1A 2HZGA 4FSAA 5BROA 1C29A 1Y65A 1W2PA 1Y5VA 3PUOA 4PUMA 3G0UA 3U2CA 1XLMA 4INFA 3S2MA 4GBUA 3SQSA 4WQ6A 2VR2A 3MS8A 1KTBA 2YDAA 3WK3A 1ZSXA 4NJJA 1BTCA 3WQCA 3L2MA 5F1VA 2ISSA 1K7XA 3I3DA 3A4AA 3BLPX 1M5WA 3P8IA 3NQ2A 3NG3A 1P6CA 2F38A 3VAVA 3AMCA 3WCZA 2HVOA 3AALA 4YU1A 4HZ7A 3F03K 2Y70A 1DOSA 2PTZA 1M7JA 3OVQA 2CLFA 1DIKA 1P4CA 1PKMA 1HP4A 3R8HA 4TXEA 4UQBA 2EPHA 4AF0A 3TW6A 3H6OA 3NOYA 3QTPA 1XLHA 3H55A 3C3UA 4QE4A 4G7FA 2WMFA 3HPXA 3V16A 1A5LC 3CC1A 2VGIA 3G6MA 1LF1A 1EJ7L 5JUVA 1NF7A 1JCYA 3N14A 2OT1A 2QXWA 1QUMA 1K02A 1TWDA 3AIEA 1ELSA 3GDTA 4RW5A 3QKZA 5A6BD 4AZ6A 3PPCA 2QF7A 3R8GA 1NARA 4RPPA 2V0TA 2E0PA 2XZ7A 3VINA 5E6ZA 3BQ5A 1QOPA 1I2OA 2A79A 1QCWA 5BOFA 1DJIA 2J79A 1F6PA 3S2NA 1E1CB 4C5YA 1FFQA 5G2HA 4JTQA 1R7OA 2IQ0A 4YVVA 4PMRA 2Q02A 5H91A 3H7VA 2FVLA 3CUGA 3WUFA 5AC4A 3TR2A 2EG7A 4F40A 1XDMA 5HK4A 3WNKA 2OLSA 1LUCB 3OLGA 4ADSA 3VILA 1WNOA 3CHEA 1GYLA 1TPDA 3N1AA 4UCGA 1GYMA 1XPGA 5T91A 4UB9A 4WZHA 2WNNA 2PZ0A 4KEVA 5FL0A 3WDQA 1TCMA 4Y9NA 1R3WA 4FXRA 1OC5A 1UD2A 1ISWA 3RGTA 1K6WA 1EP2A 1SZFA 1V02E 2EPOA 2BVTA 2OZ8A 3T40A 4AZ5A 1J5SA 3TU9A 2MNRA 1OT2A 3UESA 5EL1A 2Q09A 1LL7A 3TZFA 2QQ6A 1O4UA 3LMZA 1TPUA 2TPSA 1JYWA 4IPPA 4AG0A 3PBVA 4QS6A 2W9MA 3L0GA 4RE4A 5B80A 3MP4A 2ZKMX 1WKYA 1ZJBA 1A5BA 1XM3A 2J4GA 2VENA 1VRXA 4EWND 3TSDA 3P82A 3WMBA 3BG9A 3QGKC 1EKOA 2E9LA 1EZ2A 3IUHA 4O1BA 1KFLA 3GR7A 5CLWA 2PDJA 5CGTA 2H90A 3DHUA 4WXYA 4IGSA 4N7QA 3VIMA 4DPPA 4G8TA 1HXJA 4RX0A 1UWIA 1UWAA 3SGGA 4H00A 3JUGA 5EKYA 2PLKA 1YE4A 3GR8A 1AL7A 1UROA 2YJQA 4DQWA 1ZFJA 4I8YA 1IZJA 2FDSA 2E7FA 3VKBA 5AKQA 3USBA 2VZTA 3W9ZA 3VDGA 3KP0A 3W7EA 1F7BA 1XYBA 4MWAC 3REQA 3L5MA 3WQGA 4JIIX 1U2YA 1JYVA 3W1NA 1GUVA 2GQAA 2ZXQA 2DVXA 3RX4A 3TV8A 2C1IA 5HR7A 1C3FA 1M3UA 4GLEA 3CXOA 3G5EA 1SR0A 3T0TA 2AL2A 3FAWA 4GD0A 5CG7A 3LZ5A 4RV8A 5FJJA 5MKGB 2IXUA 3L23A 3R6IA 1QBAA 2XTKA 1L2QA 2F2KA 1QHZA 2VMFA 4NJKA 3I4KA 3VYLA 3GTIA 2C7FA 3TTEA 1ZBVA 5BWAA 1CNVA 1RY8A 4CN1A 1JFXA 2EJAA 4DF2A 2HNHA 4IXHA 3TQ0A 1IWBA 4S3CA 1TPC1 3ANUA 3W22A 2VD9A 3G1YA 3N11A 3VE7A 1JGMA 3MU7A 4IMAA 3WJSA 1H3GA 3GFXA 3HGOA 2I9UA 3PZOA 4QE5A 3MMWA 3DFHA 4F3HA 2O55A 3H2MA 1T5AA 3N2CA 2VEIA 4DRSA 1VFUA 1NWRA 1RH9A 1FDYA 2BGNE 4NAFB 4ADTA 4ATLA 1MQPA 2VDIA 4Q8MA 3GXIA 3WQ5A 2QCGA 2OG9A 4AAJA 3PWIA 2WB5A 3CIVA 2QF8A 1EJXC 3WF3A 1KRAC 4UUIA 1EIXA 3SCQA 7ODCA 2R1MA 4KWWA 4POCA 3BAIA 3TSMA 3LRKA 3LNMA 1TVPA 2GGJA 4JIPA 5CSYA 5HA7A 3RU6A 1O95A 4YTSA 1YX1A 4LS0A 1TPWA 1O7AA 1H7XA 1LRTA 4NQ1A 1GWJA 4H6EA 5CJMA 4GPNA 1S1RA 3BDKA 1Z7AA 3A3WA 3GHTA 4AD0A 1UR0A 1IV8A 3BTNA 1YRRA 1RPKA 2UY2A 1BPLB 5FJRA 1EHAA 3D3FA 3H54A 4G6CA 3G8EA 1OK6A 2Z6JA 4B5SA 2GGIA 3WFLA 2BHUA 3ARRA 3CZLA 1J0HA 3TSBA 3AMDA 1CEOA 3H2EA 3ISIX 4A3UA 4MZYA 5GPRA 4O11A 5TBOA 4FXSA 3AJXA 4JN8A 1C91A 2EKGA 3VIKA 1P0NA 3GU1A 3VNIA 3M41A 2G8ZA 6TIMA 1TV5A 3VCNA 3HV9A 3TNOA 3PBMA 1NEYA 3MWCA 3H7RA 7REQB 1XH2A 1W8GA 2RHGA 3B05A 3GB6A 9RUBA 2WMKA 4RXGA 3VKCA 1SW3A 2QUVA 4H83A 1RVGA 1Q45A 4S3FA 5EMUA 3H2AA 1LP6A 3KCJA 3HQNA 4DY1A 1UKQA 3B9OA 4LRTA 1ZJHA 3ZLFA 3W1QA 2OOFA 4H9XA 4L7ZA 2PTYA 1V77A 2P10A 2WANA 3QFWA 4DLMA 2BY1A 4OHQA 3OHMB 3NA8A 1R9XA 3STFA 3WDJA 1EXPA 1WDSA 4AUBA 1B9ZA 3TUUA 1A4LA 4GC4A 4E3VA 5I2UA 3IUDA 2VURA 4Y2WA 4CN6A 3WNNA 1DJZA 4PUDA 2RDTA 3GVWA 4J3TA 3WJZA 3W1RA 3WQFA 4MF4A 3W7DA 3FA4A 3UD6A 4PRRA 5AYYA 2GPTA 2W5FA 4AFYA 3BLOA 4JIRA 1QPOA 5FOOA 2F6XA 3VZYA 2DVTA 4NZCA 5A8MA 4DAFA 3WDPP 3BLFA 4Q3MA 5HMSA 3QGVA 2OSXA 2ZVIA 3WLQA 2DQWA 3B0XA 5LHFA 4XX6A 4AZGA 3M5VA 4IPLA 2VZVA 1AH0A 4KT2A 4NXKA 5F4XA 1E1CA 3R79A 5IDIA 3AXHA 5I77A 1PEZA 4DO6A 3CQKA 3DC8A 4F9JA 3I65A 2EG6A 3MSRA 5XIAA 3LGDA 1LDCA 3RLHA 3BJTA 1YDYA 2E25A 4H4IA 1GKPA 1FXQA 4A35A 2YZRA 1YIXA 1LUCA 3AWNA 2G0WA 1OADA 2PP3A 1C7TA 1UZ1A 2ZX8A 3LYEA 4M56A 3CZJA 1GZ1A 2ZRXA 4PUJA 5HXMA 1LQAA 3MT1A 4DBSA 4GH3A 1F8IA 3BE7A 3UYCA 5A8GA 4ERIA 1A3XA 1E3ZA 2BY3A 5C2XA 3RR4A 4ADUA 1H62A 4Q4KA 1ZB5A 1A3WA 4HGXA 4K37A 3VKDA 4CCDA 1VLWA 3ECQA 4HNLA 5DMMA 3DN5A 2BWGA 3EWYA 4W7WA 5HULA 4P8UA 2YR1A 4EF8A 2GK1B 5DBUA 2IUZA 1I4NA 2DSZA 2VWTA 3PSWA 2X0YA 1VJIA 3EGJA 2FJUB 2YLAA 4MKSA 3NVTA 2GOUA 4JTRA 4B92A 3BAJA 1M9HA 4DELA 3R2GA 3NZRA 1TX0A 3CU2A 3TVAA 2PDYA 4B9ZA 5ABFB 4C6LA 3ZR5A 3C61A 4WJEA 4WHBA 2ASHA 2Z2BA 4MJMA 1O66A 3VOIA 1ZCCA 1AMYA 3W25A 1V6WA 2YB4A 1DWHM 1V0NA 5LIWX 1FKXA 3IJIA 1LWJA 2X1UA 3L0NA 4Q8OA 4L6HA 2DIEA 1RLCL 1G0CA 3VE9A 3APYA 3CV1A 1QNPA 3AIWA 5K3VA 1E73M 2CU0A 3BL3A 1UKSA 2JIWA 2L5HA 3UCDA 2BS9A 2Y7FA 1BXNA 3A3XA 4Y8EA 4DWSC 1BWKA 4JTAA 3SSJA 4FF5A 1H5VA 1MDLA 3SI9A 2I17A 1PIFA 2OX1A 4BKNA 1QVBA 4H8VA 3KBVA 1TPB1 3IGHX 4W5ZA 1POJA 3FKRA 5MKGA 4Z1BA 3A4WA 4L6OA 1Q2SA 4Q6XA 1AQFA 4AQLA 1NWTA 5CJNA 2ZC1A 3HGSA 3I6TA 1RJRA 1Q6FA 1NOFA 2O9RA 4OGZA 4ZOEA 3B8VA 4WDWA 3DFSA 3IEBA 3COTA 1VGAA 3VU2A 3WKZA 4K68A 4GJJA 3TQKA 3O9NA 1V7AA 4LH8A 3EOSA 4GVHA 2DSWA 4ZQPA 5EYWA 1E0XA 2UV8G 4QQUA 3S83A 2OODA 4TVDA 3TMQA 4QM1A 3JZEA 1ME7A 1T0OA 4H01A 4IMFA 3ZOAA 4F0KA 4QCFA 4JL1A 3MVIA 1E72M 4GUHA 4Z1YA 1ITXA 3VOCA 4L1WA 3M44A 4PSRA 5H1WA 1V6VA 3LOTA 5A6AA 4NAFA 3AHXA 4ZQRA 2W92A 1UASA 4P7QA 5F1UA 4X9YA 4LGXA 5A5WA 1IWAA 3MO7A 1F3XA 4EPBC 1XLCA 4FR1A 3E12A 4G56A 4Z2LA 4JTGA 2YXXA 4C1NB 2FJKA 3LRMA 4PULA 5ABHA 4YTTA 3TTSA 5U7SA 3PZUA 3EB4A 1OCBA 4HVXA 3TJ4A 5AHMA 3O05A 3T7VA 4L4LA 1UKPA 2YSWA 3P74A 1SM9A 2R8WA 1ZLPA 1O5QA 7A3HA 4ZODA 3VGBA 3OEXA 3UWWA 1XW8A 5FJPA 1KXQA 1ZU8A 4E5TA 3CBWA 2OEJA 1GHRA 1OFQA 4A3HA 1PE1A 1H61A 3ZSSA 3GFZA 3NSMA 3SCPA 4DZ5A 1YPXA 2BGSA 2QJHA 3LBCA 1RD5A 3VD4A 1WX0A 4B91A 3FJ6A 1B3WA 3QQWA 4RL3A 3GYEA 1UW9A 3QYQA 3CJPA 1PIGA 4JGDA 2HDJA 7REQA 3CAVA 1I1XA 3L2IA 3IS4A 4IICA 2G3MA 3RU8X 3NPWA 1MVYA 1IR2A 2E5BA 4ICCX 2QJMA 4LB3A 3ME3A 4AVNA 1PSCA 3GYCA 5TIMA 3H23A 3GM8A 1W9BM 4MLJA 2ADAA 2CWNA 5M5DA 4M7SA 2D0FA 4I5XA 1KR1A 2POZA 3VGGA 3VGFA 2FTYA 1J6OA 3UGVA 3H4WA 5JIWA 2HNEA 3QJAA 2OPJA 4UOQA 4RNFA 3AS2A 3ZZ1A 3D5HA 2E9MA 2PF0A 3W81A 3V0UA 4IG2B 3NTYA 3NEVA 1D8CA 1HO1A 5GNYA 2O56A 4NU7A 4BHYA 3G8RA 3G1XA 1B3VA 3HFYA 1EC7A 1R5YA 3HV8A 2RJHA 1I0DA 1VFFA 3RM8A 1F9CA 3B9DA 2OKOA 3T4CA 1XIMA 2SFPA 3BCFA 3P61A 4W8AA 3AUJA 5AVHA 3DI1A 3UWZA 3WY1A 3N29A 2I14A 2PU0A 3I4EA 3TN6A 1Z44A 3WLMA 3PBUA 2WMJA 7ENLA 2FHBA 4AIEA 1VYPX 5J04A 1SYTA 2CZDA 3U7BA 1VLIA 4NUWA 3WQVA 1P1XA 1PTDA 3VNKA 2AQVA 2ACSA 5E5CA 3P3BA 5T9CE 4QTGA 3CQHA 4PCPA 2ZICA 4ZO8A 1ZAHA 1UBSA 3BV7A 1IEVA 1W54A 1MUCA 3AYRA 3IIPA 1S5MA 1H1YA 4AMAA 3TC6A 5BOOA 3GDRA 2AQWA 3BO9A 1AW5A 3QY7A 4X0VA 1XV8A 1EO5A 2XGIA 3M5ZA 4ZB2A 4NT0A 3GXDA 3LI0A 1M01A 4LCRA 4C6NA 3AAMA 1IXOA 3OVPA 4X3ZA 3C52A 4G1NA 1RVKA 4UXDA 5C2CA 1UB3A 4TUFA 2BY0A 1VYRA 1K1DA 2WSPA 4ZMGA 1K3UA 1D3GA 2IMRA 3NYDA 4GY1A 4GYPA 3QC3A 2OR2A 1RK5A 1VCFA 2FB2A 2VEPA 2GK1A 3OA3A 2YGYA 3O06A 3SUWA 1PX3A 4S3JA 1GHSA 2C15A 2ZADA 5XINA 1XSIA 1QW7A 2DJLA 4K6AA 1A0DA 5IHRA 2EGZA 4IMGA 3O1NA 2UWFA 4MMWA 3UR8A 1FKWA 2I57A 1AJ2A 1MUMA 4LYQA 3URNA 5ABFA 2VWSA 4JD4A 5AHNA 1LQ2A 2YLLA 2IKIA 3CUZA 3WLPA 1FWJC 5J8LA 5IBXC 5DRCA 3VABA 1US2A 3QOKA 1N82A 4DXVA 4HZMA 1J0JA 3UEQA 4B3ZA 3DUGA 1GZGA 4RR4A 5D8ZA 4YTQA 5JVLA 1NU5A 2WZIA 2J8TA 1BHGA 4Q7IA 5HJYA 3FKKA 1KR0A 4Y9PA 1H7PA 5D2YA 3PJXA 5JBDA 2AKZA 3CPRA 5JBFA 2X1SA 3UWEA 4IQLA 1XCXA 1HG3A 2Y4SA 1RCQA 1V6XA 4KPLA 3IPWA 5A2AA 3UJFA 4DN1A 1T6MA 2V2DA 4WSHA 1Q65A 3EDEA 3N15A 4JDYA 3PY2A 4MJZA 3N2XA 4OQVA 2D2HA 3D6NA 1VBJA 2Z28A 3ABOA 5I3HA 5AB3A 3CEUA 3C3NA 2RDUA 2DU2A 4AY1A 1ZALA 3LLFA 3KZSA 3MCMA 3DFOA 1W37A 1GJUA 3PHAA 4BI7A 4V33A 3H70A 4QJ1A 1CB7B 3ARUA 3AS0A 4JX4A 2ZRVA 2EJ1A 1B3XA 2X0HA 3MHUA 4RLIA 3TIMA 2A0NA 4BI6A 1MEWA 3OLDA 3VNJA 3F1QA 1EL3A 4IIEA 4B3LA 3STCA 2Q8ZA 1JL8A 3E5PA 4KFPA 1R2SA 2A5HA 4FHAA 4UFIA 3PBGA 1WO2A 1FX6A 4ASTA 4N4QA 3UZWA 1V79A 4NILA 2XIOA 1CYGA 1ZGDA 2GGEA 1E40A 4GZIA 2XISA 1UWUA 4KBXA 4M1BA 4B2DA 2V6AA 4B5UA 1FWFC 1LL6A 1GG1A 2ZVRA 1JVNA 3BK0A 4ZTYA 5BXRA 5H8UA 4AEEA 3P84A 2ONEA 4WX2A 1I6NA 4JFUA 3CZKA 3U7VA 4RJEA 3DZ1A 3R25A 2XFFA 4N6EA 3GIQA 8CGTA 4UWMA 2E5CA 2TSYA 2GOKA 4QP0A 5CZKA 3BARA 1FY6A 3PM6A 1X1ZA 3NNTA 4YS1A 3L5LA 4C1NA 3RYSA 2GFTA 2R1PA 1E4NA 4UTUA 1XICA 3HG3A 4XD6A 2NWSA 4A22A 4FNTA 3HQ1A 3LLXA 1BF2A 1VFTA 4MDOA 2OYLA 5EFFA 1R38A 1E0WA 4GKLA 4X2PA 1NM9A 3W26A 1TVLA 1F05A 1NJJA 1P5BA 5IFPA 4B4FA 3HURA 5D37A 4R7OA 1W5PA 5D2WA 4RNIA 3C0JA 3LCLA 4MWAB 2XH7A 2HQAA 4KFOA 1WZMA 2VCAA 4NP7A 4HNUA 3KS5A 4H2HA 4F8XA 2ZQ0A 3H2CA 1DVJA 1IHIA 3M43A 4HIBA 2VFEA 2G3FA 5JXQA 3CAQA 5CPNA 4F79A 3QLDA 1MZHA 1JULA 3KE0A 1YMYA 4S3BA 3TQVA 3K1GA 1ZPTA 4GQGA 2PDQA 3O8AA 1GVQA 3AICA 1ISYA 3U2OA 1E6QM 5HQEA 1PZ2A 1HKJA 2E1DA 2EPLX 2DH3A 3KVMA 4PEEA 3CMGA 3TYBA 1WXYA 2OOGA 1TO3A 3UR7A 3WEZA 1GOMA 3T0AA 1AQMA 4KGLA 1BKSA 4XAZA 3KHJA 1OD0A 2J9YA 3GRIA 2Y24A 5D9NA 2DIKA 2DUZA 4OTKA 1C8XA 1S5TA 4HNOA 3PNZA 3LZ3A 5G1YA 3E96A 3BVJA 4AC1X 3RITA 5DCBA 3GXMA 3NQGA 5D2XA 4MTVA 1BLIA 2XWDA 1W5NA 2UZ9A 1YE6A 4MJ2A 1GOXA 1UZ4A 4AISA 3T42A 4IG2A 1IT8A 2ZUVA 4HHMA 2Z29A 2AOSA 3RMJA 3AIVA 6XIMA 3AI0A 4B5TA 4UTWA 2YL9A 1XXXA 2CZEA 1E1FA 2VVSA 5K7JA 1US0A 3N6HA 3QV9A 3MBFA 4E4PA 2JKEA 4BY3A 1K8CA 4J40A 4BR1A 3W75A 2HK1A 1G7VA 3KBJA 4NRSA 3NYZA 1M03A 1P7TB 5CAKA 3W2KA 3FIGA 1I2PA 2YXGA 1VFLA 2ACQA 2V9DA 4JX5A 4U2YA 4C6OA 3JZUA 2VUNA 4J3XA 3FA3A 3NPVA 1ZP4A 1JF6A 2I7GA 2VRJA 1KD0A 3LLDA 1QPNA 4TX8A 4JTLA 2ODOA 2E6YA 4XIAA 3WF0A 1VF8A 2NV2A 3TN4A 3W7JA 3W88A 4REQB 1W8SA 3SCUA 5AHLA 3VVGA 4GHRA 2NLIA 2CHNA 1JZ4A 4EF9A 1RLDA 1JCTA 2BB0A 4M6UA 2I56A 3UZYA 4QEHA 3KLKA 3WLOA 2CZFA 3BPWA 3RO6A 2BOFX 4QHRA 4E8CA 5I3FA 5C9RA 3SY5A 2Y7DA 4C65A 1E6NA 2NQJA 1GW9A 1E6PA 4YVXA 1EO7A 3QRHA 1HW6A 5HNTA 4HYVA 2PE4A 4MB5A 2XINA 2E77A 4UTFA 3S1UA 3EAUA 3FNDA 3KX6A 1JNDA 1TWIA 1MNSA 1WV2A 3VI2A 2H8XA 2XIQA 2NXGA 3L0KA 2HWGA 2VR4A 3W6YA 2PU1A 2DT0A 3ITCA 4OV4A 3TOPA 4BWLC 4RDWA 4XZBA 4PUWA 4JDBA 1R9YA 4P5UA 4HU4A 5FKYA 3W7CA 5BW6A 4O19A 4QXIA 5E1QA 4GJ1A 2QS8A 2QPXA 4PMQA 4IIHA 4UTTA 3KWXA 1E5JA 4PB4A 4QDMA 5C7VA 3WN6A 1J12A 1CPUA 4O28A 1O60A 1VFMA 3WBXA 2Y85A 2IXVA 2IPWA 1KKOA 3EKZA 2VZSA 3VGEA 4NZ4A 1LG1A 1WAUA 4AYSA 2RGMA 1BYAA 4US5A 3KVLA 3QH2A 1KCXA 3OODA 2GUUA 2FPVA 1V03A 4GI4A 4IP7A 2GJRA 1QAPA 2JF6A 3SN1A 3LUTA 4Q8WA 4WOQA 4FIQA 2FZ9A 3N12A 1VPYA 1H7OA 1WKEA 3N4AA 4DNHA 2PWUA 3ABRA 5M1TA 3OJGA 3KTCA 5C55A 3FDGA 6REQB 1LG2A 1Q7ZA 3R13A 4U5KA 5KEZA 3QPEA 4BS0A 1JDAA 4Q4OA 4OT7A 1NDVA 4QLKA 1F4AA 5EMLA 4J3SA 2QJJA 4I8DA 4RW3A 2HV5A 1XDLA 1UR3M 1CGVA 4B3KA 1UR9A 2QEZA 5LNRA 3DYPA 1G01A 3WNLA 1CLVA 1PS9A 1YDVA 3S42A 1TV3A 2OWXA 4HB7A 1JZ2A 3G3MA 2NVDA 2G41A 4LVFA 3IGXA 1H2JA 4GNKB 1E51A 2PURA 2W91A 5I3IA 5CBJA 3W00A 1XI3A 1QBBA 1Q6RA 4KIEA 1XINA 3E5BA 4DJED 1Q8JA 2PLMA 1L6WA 4A05A 1DQWA 5DMYA 3AZSA 3WF1A 2NZLA 3BOXA 2BBFA 4E3TA 1YXYA 4XVEA 3H8AA 3TFXA 4LBUA 2GVJA 2W27A 2OWWA 5D05A 2W0UA 1GOKA 3EZ4A 3S8HA 1UMLA 3VC5A 5DEZA 5M03A 5DELA 1QK2A 3HN3A 3V5OA 1BGGA 3HO8A 4Q8TA 3QPYA 2CKRA 5HOSA 4AW7A 3LPGA 3DHPA 1V3JA 4HMCA 4YMZA 3TXVA 1AW2A 4BQ5A 2ZE3A 3CQJA 4MWAA 1ICSA 2X05A 5HMEA 3IJQA 3W7GA 4LC6A 4WRHA 4DWSB 3PPGA 2REQB 1TTIA 1NFBA 1UD6A 5H6HA 3ARWA 1IEQA 3EWXA 3EXTA 4DM1A 3T9PA 2WM1A 1DJXA 4QAIA 1HNYA 1A49A 3SZ8A 4CNNA 3KXQA 4KWUA 1LBFA 2V8ZA 1M7OA 3GFYA 4HCLA 2HK0A 3T78A 1GVEA 1QPKA 1EX1A 1ALDA 1XPYA 3BMWA 2ACRA 5EMKA 2F9RA 1QT1A 3HPZA 5KZDA 1UH4A 3CHFA 3GVRA 2Q01A 4YIWA 4BJHA 3MI3A 2QR6A 4Q4SA 1GGOA 4TTUA 2PLJA 4LXFA 4LRSA 4S2BA 2J8GA 4MKNA 4DUWA 1DEDA 3B0UX 1WE5A 4O4WA 2E6DA 2WHMA 1B9BA 2XH2A 1BWLA 1UP0A 3TK7A 3WLIA 1HVXA 3EX4A 4LS2A 3EXSA 1J96A 1PL9A 3NO5A 1FXPA 1PAMA 2KAUC 1JPHA 3KOZA 4ZQCA 4GIRA 1VAHA 2YL5A 5FAJA 4QGCA 3KW3A 1XLBA 5E93A 3UPMA 4XB3A 4LQ1A 4MY8A 3MCOA 2ZZ2A 1QDSA 1SZRA 4J27A 4L80A 2YCKX 2CLKA 2AGTA 3MZ2A 4KW2A 2VKZG 1KQZA 2QUMA 3ALFA 1E9LA 3B03A 5FEPA 4DPQA 4NJIA 2WNZA 4CD7A 1IEWA 4CNPA 4K8GA 1DWFM 4I9TA 1LL4A 4JY9A 4IM4A 3D47A 3UVIA 3MMDA 4P61A 3C86A 1P7TA 1UHVA 1TJ2A 1WP6A 3P5ZA 1GVSA 2ZX5A 4LS1A 1IF2A 4DO7A 3ZLGA 4HNCA 5D2VA 3KLLA 3NWRA 3NDZA 2XGZA 2GWNA 1CXFA 4PCNA 3A4JA 3RF9A 1UOZA 5LNUA 4GQRA 3SURA 3E2RA 1UC5A 3AROA 1W9UA 4MYAA 4REQA 2ZUUA 3S5SA 2BLEA 2XHYA 1EGZA 2JK2A 2ZC8A 3SCRA 3OA5A 3UGRA 4OWGA 3XIMA 3EPOA 4RZ5A 5BRQA 3A22A 3PUDA 5BMXA 2J8FA 4ZA0A 1W3NA 3EX3A 3CWNA 1X6LA 3BOLA 2JIEA 2YBTA 4JHOA 1AJZA 4FA3A 1JCNA 5HWNA 4YTRA 2NUXA 4HNNA 4EE9A 2C91A 1HJWA 2XFWA 1V08A 4MZ8A 1E4IA 2FQIA 1X1OA 1O6IA 2ZX7A 4U31A 3N17A 4TX6A 4YL2A 2CPUA 2FGLA 5AC5A 3QOMA 3KDNA 3WLHA 2P1FA 4LC8A 4MY1A 5AC6A 4JZ5A 1NIUA 3WUGA 4Y90A 2B7NA 5EU9A 1AD1A 1K77A 3NQ8A 4GQBA 1KLZA 4LAKA 2ZXDA 4YN5A 2OO6A 1I1WA 3VTRA 2NUYA 1HN1A 1ZJIA 1V6YA 3SRKA 4WGHA 1OCJA 2C14A 1A5OC 4P2VA 4DBEA 1O68A 3H2OA 1H63A 2CYGA 1EJUC 3TLQA 3SFKA 2WZMA 4JYEA 3HMJG 1EB3A 2E67A 4M24A 3VMOA 2XSXA 3L2LA 4QQ3A 5FEXA 4F2BA 4ENLA 5LA1A 4PUEA 4XAGA 5DRIA 5DF0A 1NH6A 4DJDC 1XGEA 4ZGYA 3DGRA 3MSDA 3SR7A 5D09A 2LLEA 3TA6A 4IUGA 3PC0A 3SJ3A 3OGSA 2INFA 4GO8A 6REQA 3DI0A 3KAOA 5IHSA 4FOKA 4O8AA 4MFEA 4MSSA 3WLSA 1WAWA 3N18A 1H4PA 2CWXA 2YCEA 1CGUA 1F3WA 1ME9A 2V5JA 1IZCA 4XZ9A 3L65A 4Q7BA 4CEXC 3OZMA 4FK9A 2HSAA 2PDUA 1YPIA 2VEMA 3NL6A 2V63A 4Z0SA 1SR9A 3MP5A 4X61A 1UMYA 1KFCA 4XZWA 4CLMA 1YTKA 5FJTA 3W7LA 5HR6A 3W2MA 4UOZA 3BG3A 1QNSA 2CCRA 4DO4A 3FJLA 4LCQA 4IIBA 3APTA 3HG4A 1QWGA 2B4GA 1KLYA 3SIMA 4LUIA 1DXFA 3ES8A 2WNWA 3GXNA 2W3ZA 3VMNA 4Q8PA 1PHWA 1E0VA 2ALRA 3QFEA 5H8MA 2XN1A 3GNXA 4CD5A 1HFBA 5LNSA 4O18A 3TN5A 2BV9A 4B16A 4H9UA 3PZIA 3D46A 1XRFA 2BODX 5A6TC 2GGHA 3KEHA 2WKJA 4A3YA 5D9PA 5EPDA 1LOLA 2X1IA 5LNVA 3NZPA 3M5XA 3EX6A 1FWDC 1TUFA 4OVXA 1VRDA 3GTFA 4OE7A 4B5XA 2PDGA 1DWAM 4L4MA 3T05A 3HPAA 1SU5A 3T09A 3LTSA 2PDWA 4PFMA 4GI6A 3H53A 4DWSA 1JYNA 1SZEA 1OD8A 1A5NC 5D30A 3LK6A 1ZAIA 2REQA 5K9CA 4PUKA 4X0NA 1DIDA 4GMEA 2ACUA 1PKYA 1OY0A 2XFRA 1TQXA 3NQAA 4GINA 1F76A 1RV8A 1I2RA 2Q3RA 2D1ZA 3ZT7A 1JCJA 3ARYA 4BQ2A 2X41A 1L2UA 2YL8A 3TDFA 4JTJA 1DL3A 1S2UA 4J3WA 3PBWA 4UTKA 3B97A 4C91A 2QIWA 4KETA 1HKVA 3GHUA 1XRVA 1JD7A 3CWOX 4UQEA 4FNRA 1S39A 2IPFA 3IANA 3CNYA 4ACZB 3UT0A 7TIMA 1MFUA 4Q6JA 3N3MA 2VRKA 5HMDA 5I07A 4UC5A 2Y61A 3H26A 4RKAA 2E8ZA 3R7MA 4N4PA 4MOZA 4PH6A 4Q32A 1GONA 2OXNA 1K9FA 4RK8A 4RDZA 1YADA 1D7KA 3TYEA 4GYJA 1TWWA 1JD9A 3ABXA 4AHPA 5I23A 4BEUA 4NXSA 4KH2A 2E3ZA 4YCOA 1E6SM 4I6KA 1MYRA 2DQXA 1EF2A 4JY8A 2DW6A 1W9VA 2RDWA 3QZAA 5D32A 2JGQA 1CGTA 1DJGA 7CGTA 3KWSA 4XBKA 2Y7EA 4NKCA 1BF6A 1CWYA 4IIGA 3RCYA 1TIMA 3WQOA 1TX2A 1HX0A 3RDKA 4GZEA 3GO2A 4UR8A 5I78A 1J10A 3FVMA 1R3RA 5G2WA 1Z89A 3SADA 2O7SA 4F0RA 4NAEB 1XLFA 4YWIA 1H1NA 2V3EA 7XIMA 6A3HA 2PDBA 5DQPA 1QR7A 3SQMA 3LPOA 2WKLA 1KA9F 2FH6A 1BVWA 1XBZA 3LB0A 2YZ5A 1PHQA 3LV5A 1UIPA 1ZRQA 3E38A 3STPA 4GUGA 4YJ5A 1KRMA 4PODA 3QXBA 1RJQA 3POCA 5C9XA 4O15A 1CGXA 2VOTA 2C6QA 2CXEA 2YDSA 4U10A 3IUIA 5KITA 3PAJA 4E4UA 2GVEA 1E55A 2OU4A 3GXPA 4L1GA 3UCQA 3PPFA 1ITQA 1EC8A 4AC7C 4O16A 3CWHA 4HYRA 3CK5A 2PGRA 3TP4A 1FBAA 2JE8A 4JHMA 4BEQA 3STGA 1W9XA 3QSRA 4JICA 3H4XA 2PDMA 4K8EA 2A3AA 1ECQA 3QV8A 1SQ7A 1SO3A 2FVKA 1G7UA 1OG6A 1E5NA 5CC5A 4QBXA 5LKYA 2J7CA 1RBAA 4FX7A 2J7EA 1OT1A 5RUBA 3WD4A 1LRNA 2A3BA 5I3KA 4ICMA 3RILA 3EKGA 2MUCA 3ZT5A 3VNMA 5A8PA 4K38A 4HMDA 2XG9A 4OOZA 2XVPA 2P76A 3LY0A 3WELA 4KERA 1R30A 4NX0A 4O14A 2POTA 2HXUA 1ZP3A 3BLEA 3WO8A 1EJTC 3ZFHA 6ENLA 3W23A 4EXAA 4OUEA 2ZWZA 4JNZA 1VYSX 3S5OA 3MUY1 3R0DA 3W76A 3PR2A 3ENLA 3NQMA 5HINA 4HHPA 3M0IA 1MFVA 2Q6ZA 5BCAA 5I02A 4FAMA 1AL8A 4LF1A 4QG8A 4K39A 1M7PA 3C4UA 1J5TA 3BAWA 3AXMA 2V2HA 3JRKA 1BWVA 3GW0A 3VKAA 1EXBA 1DTNA 1LLWA 4O54A 3P93A 1UR4A 2FFCA 3VUPA 1GNXA 1HTIA 2FZMA 3FN9A 2ESCA 5FAGA 4O53A 4ZXOA 1R6WA 4GIEA 1J8VA 1KFBA 4RE3A 3GX9A 1G9HA 4MVAA 1ZBCA 1TRDA 2RFGA 4CD6A 4J9JA 4DNMA 2DSKA 3WLLA 1FA2A 2NLYA 4S23A 2ZUWA 3PTDA 2J77A 3AU2A 3GHRA 4I90A 5LXEA 2FMNA 3V5FA 1U30A 3DFYA 4H3DA 3DH7A 2RKXA 3OIXA 2NSXA 2Q8LA 1Z3NA 3IK2A 5I0DA 1B90A 1GKRA 2VT0A 4GCAA 4KGJA 4L61A 3S5NA 3AFBA 3Q45A 2WSKA 4HN4A 5JBEA 5E0KA 2OEMA 1JZ5A 4GUFA 4NIRA 1BTMA 4XISA 3G24A 3VDHA 4WD0A 3UZ5A 1KW1A 3WK0A 1OBAA 2ISVA 2YB1A 3THUA 3AMGA 4O1DA 2PRHA 3MPGA 2Z0IA 1FCQA 3VDCA 5TQLA 3L4WA 3G1SA 4V2XA 3SEPA 1UZHA 4PA8A 3AYSA 4KRTA 5IBXA 1FH9A 3GQYA 1Q4WA 4PRWA 4HOZA 1ZBWA 3TCSA 3QC0A 2YA0A 4H7CA 1Q13A 4LF2A 1VJSA 1L6FA 3SCNA 1L8NA 3DENA 4N42A 5CQ1A 1OFRA 4ACYA 4PBGA 4XAPA 3VNZA 1T99A 4E8GA 4CGTA 2HVMA 4D1IA 4JBRA 2WSYA 4W7UA 2WSRA 1EZWA 1OF6A 2HPIA 1PDYA 3TNBA 4Q8VA 1T96A 1MWOA 3NEHA 3U9IA 1GVRA 1ZNNA 2Y1HA 1U22A 3NL3A 4HTBA 2VJXA 3NQVA 1LORA 1QNQA 4X60A 3OP2A 4AD1A 1D3CA 3NM1A 5CAHA 4AVOA 3W86A 1Z9AA 3DIPA 3BGJA 3WENA 1W6TA 3BQ6A 4W93A 3CV6A 4L9XA 4GX9A 3SSZA 3UG4A 3ZJ6A 2QDGA 2CHOA 4IWWA 4EAYA 3BCDA 1UYQA 1DTUA 5ABEA 3M0ZA 4LY8A 5AYXA 1Q63A 4ACZA 1KCZA 3VGDA 5GQBA 3CTLA 3WQ8A 1OYBA 4AY8A 3UZZA 1EJSC 1FWTA 3W7PA 1OZQA 4ES4A 3TJXA 4GXMA 1KM3A 2R82A 3VOFA 4F2TA 4GVGA 2XIJA 3VOJA 2ABBA 1O1HA 5CPTA 2CESA 3C8NA 4DO5A 3B9AA 3WLRA 3RCMA 1EGVA 3TXZA 5AHEA 1XDJA 1UR1A 4W7VA 1C8YA 3WL0A 3AS1A 3OQEA 4I9MA 1YPFA 3T81A 1WDDA 3W53A 1P6BA 4HPNA 1LRQA 2Y5JA 3L5AA 3E0IA 1HJUA 2CZ5A 4A4AA 3MUCA 1Q2RA 5HATA 3GUWA 5A8NA 2QCLA 2GUYA 3K8LA 4F9DA 3RJXA 4HP5A 2UBPC 3I6EA 3UBPC 3M16A 3LMYA 4GQ0A 4IIFA 4ZO7A 3WLTA 3H7UA 1C93A 1EA0A 3WLKX 3VXGA 3CUIA 4LVBA 4XD4A 1CW2A 2JQXA 2R1KA 2D22A 2XVKA 1SO4A 2BVYA 2OEKA 4MNMA 2VGBA 4NAEA 4KCUA 4C7FA 5T9BG 3RK8A 5FF0A 4MAZA 1CECA 1T40A 3A12A 2QYGA 4GRSA 5J5RA 1IXQA 4CQDA 1LQ0A 3ANYA 5JMUA 1MUWA 2A3CA 4GI9A 4LV4A 4J3ZA 3GH5A 2C19A 4LEQA 3TC3A 1JEZA 2D2JA 4S38A 3UY8A 1GVOA 4UQ9A 3AISA 1W3TA 3LERA 3P5YA 5FJOA 1R3SA 3CMJA 4I5RA 3AXIA 3I10A 3TQPA 4JX6A 3MP3A 4I7WA 4W89A 3UG8A 3OG2A 3C2RA 4UTWC 1XIBA 4XD5A 4ZSUA 4HBKA 5C6MA 3W7RA 1S38A 1UH3A 1VPXA 1W1IE 5FI8A 4AEOA 3VIHA 2WVUA 1Q3NA 3B8UA 5A6SA 2O4QA 1NVMA 2XGBA 2YA1A 3AIRA 3BC9A 3NL5A 4BK9A 3L68A 4ORIA 2ZBTA 4CEUC 1FDJA 3GNOA 3R89A 1CLXA 5I00A 1UC4A 2QIIA 3QR1A 4WKHA 3RNDA 4GO9A 3TWBA 3TW7A 4FP1A 4A2RA 1H50A 5HNUA 1XF0A 1R2TA 3SCWA 2VUYA 1EUNA 4U3CA 1MDRA 3LHZA 3ZR4A 4EX4A 2DH2A 3GKFA 2VNCA 1IR1A 1A5AA 3LGGA 3PANA 4M6PA 7PTDA 4JTIA 3RXZA 2WCAA 3K4WA 4K7VA 2XU2A 1EOKA 1RHCA 4PMYA 1W2VA 3CEPA 1EDQA 2YKKA 4JL2A 2DIJA 3MJMA 3MVTA 5I6SA 4ZQNA 2QUTA 3IIVA 1XYCA 3TFCA 4BZYA 2OZTA 4G5DA 3QW3A 3ZYZA 3R0KA 2Y8KA 1KGXA 4O1AA 2CLHA 4HYWA 2FZDA 4C6QA 4RE2A 1FQ0A 1L6SA 3N34A 4EWJA 3UQNA 5EY5A 2QJNA 4TTGA 5C71A 3ZVIA 2VD8A 4HK7A 4ZXLA 3NXLA 3QEZA 1BG9A 1P0BA 1J2BA 2E68A 1H41A 3TX9A 1UD4A 4CQBA 2ANUA 1KXVA 2O9TA 2R1NA 3FHQA 1KBBA 2G50A 3U5UA 2A7RA 3ZQ9A 1ZUAX 3PNUA 4UTTC 1UWTA 3ARSA 3CZEA 4ZENA 3EDFA 1FWCC 2Z1BA 4L1XA 4RV3A 2XYLA 5HQLA 3H21A 3MI2A 3ZJ8A 4NSBA 4AWSA 2Q71A 2C3ZA 2QCNA 3THDA 4QRNA 2P8BA 3LA4A 3VD3A 1QFEA 1Q6CA 3TYDA 5CZ0A 4BWLA 3VD9A 1XLLA 3UCCA 3I7SA 2PS2A 1DWJM 4JTFA 1LROA 3EWDA 3LCFA 3W37A 2H9AB 1LLZA 1J18A 1O5RA 4UTHA 2GJXB 2QDHA 3NQCA 2CETA 4V1XA 3T2QA 3M07A 1PYMA 2X42A 1TTQA 4J3VA 1FWHC 1LCOA 4UQDA 4C6JA 5C8BB 3PJUA 1TZ9A 1XC6A 4JTEA 3MDUA 1OX5A 3CYVA 2WWDA 2WVVB 4TV6A 2J9XA 3MMTA 3TEVA 1TJ1A 4YLWA 3IJ6A 4XBJA 4PUNA 4A8NA 1EFZA 3PTMA 3T07A 4XK2A 2G37A 3PP7A 2Y63A 8XIMA 4OV9A 4A21A 1CGYA 5F2GA 4HNTA 3CHCA 4H6RA 4WY0F 1T41A 4IJCA 5CXPA 5DBTA 1R8LA 2VQUA 3FEQA 4CU8A 3WG6A 3RCNA 2P0OA 4E4FA 1TUXA 4DBWA 2PCEA 1YW1A 1AQHA 4E2OA 1VBRA 1G6CA 4O12A 2I5GA 1UWQA 4IL2A 3W83A 3FSTA 2DUXA 3IRDA 2B7QA 2VVNA 4QIUA 4CNUA 4W8BA 2AKMA 3M0LA 4I7UA 3W87A 1NSJA 5HWJA 1JRBA 4B4HA 1XSKA 3GNDA 1S2VA 2X16A 4JCLA 2ZOXA 3GU9A 3P0WA 2XVLA 3NSNA 3ABZA 3RPTA 4IT1A 1VFHA 2VCCA 4XQ6A 3M5YA 1SSGA 1JCLA 3A47A 3KCLA 4FOUA 5GJPA 2ISDA 3EPNA 2ZIDA 2DSVA 5HANA 3NL2A 3THCA 1ZTVA 3N19B 3HF3A 3RFAA 4D8LA 3VIIA 1FDZA 7TAAA 2WZEA 4R27A 1IEIA 3CQIA 5EBAA 4R3UA 1NY1A 3PZGA 3UFYA 2Y62A 2NT0A 3K5XA 2FB3A 1Q6DA 4LYPA 3WQ6A 2ABAA 1OGGA 3BWWA 1YXCA 4JYDA 4PEKA 3QMTA 1GVYA 2E8YA 1QI3A 4MHBA 3ZWTA 5JH2A 4DXKA 3B0PA 4IJBA 1NELA 4ZOCA 6XIAA 1W9PA 4JHZA 5I09A 3K8KA 4Z1DA 1W5QA 4FX6M 5JQ9A 2YW4A 1I0BA 4LUTB 1X8CA 1QATA 3AYVA 4P8XA 2V38A 1VENA 1G4SA 1EHNA 2A7PA 3B9EA 3ATZA 1KQYA 5AYZA 3PZMA 3SRDA 5F2IA 3WD2A 1OGBA 3CL8A 4QE1A 3EB2A 1KBIA 4S3KA 3CQ0A 3VZXA 1SO6A 4R88A 4S3EA 3NGFA 4GX8A 2WBKA 4Q4MA 1G94A 1QW8A 3BH4A 3MQTA 3S6DA 3M4HA 5FA5A 2OSWA 4NYUA 4S2CA 1MI3A 4PTNA 4HPJA 1Q6QA 2P3ZA 1MSSA 5B7YA 2VZOA 3TAOA 4UOJA 3VC6A 1PXGA 4IMCA 3L21A 4JQ3A 1W3LA 2TAAA 3EEZA 2ZZ4A 3L4TA 3OG3A 3UPWA 3W2NA 4IQEA 1G1YA 4GA8A 3UETA 2QGHA 1B31A 1HP5A 1W1ZA 1TB3A 1X1NA 3TAKA 4KCWA 4X22A 5T26A 3WQ4A 3WD1A 3W29A 3EDJA 3R43A 1DE5A 4YTUA 1ONWA 2B0MA 2ZTKA 3F7JA 1HKMA 1OYAA 2XH0A 2BXVA 4ZTXA 1QW9A 4A2SA 5FCZA 1C8QA 4E38A 4MB3A 1TFVA 2WNQA 4PTMA 4HOWA 3SECA 1I9CB 4XKYB 1NDWA 2Z1KA 1U1UA 2OFJA 1SJCA 3QMRA 2A21A 2R24A 4TOQA 2GQ3A 3LENA 4YXGA 5CH9A 5REQA 3L12A 2PDFA 4V27A 1JF5A 1GEQA 3AZTA 2GUBA 1JR1A 3UPBA 4ALDA 4DB7A 4KS0A 1DKWA 3NO3A 2NX9A 5A6JA 3L4ZA 3UXAA 4XZHA 2I16A 3HGJA 1ZCOA 4FX8A 2OLHA 4L5ZA 2OQYA 3BMVA 4PL1A 2IKHA 5E09A 1M68A 2GDQA 5A8OA 3NDYA 1CCWB 3I3EA 3OO2A 1FP8A 4FNUA 3WK1A 3V0SA 1F8MA 3W73A 4P8WA 3CZ8A 3QQ0A 4PCFA 2DORA 2IKJA 1A0EA 3UXLA 2PDIA 3VFLA 5EMMA 4LVAA 3VUSA 4M51A 2Y89A 1XIIA 2FPTA 2VX4A 1KM0A 4Z17A 5BU9A 4IFOA 5D03A 1CBGA 4LUSB 2PTDA 4FS9A 4RNHA 3V7PA 4EAMA 3UNTA 4WF7A 3A23A 2BHYA 1VIZA 3MKVA 4FALA 1E0UA 3S5ZA 2J27A 1NDZA 1U5VA 4E8DA 2PLCA 3CTTA 4DAIA 3A9BA 1EYEA 1VKFA 5PTDA 2YYTA 4WSJA 1PKLA 3FSUA 1HT6A 2G3JA 4FNPA 3EPMA 4US6A 4PCTA 1UJPA 2O4MA 3ITXA 3ARPA 3NM3A 1H7NA 3B0YA 1A5KC 4XZLX 4IGMA 4F48A 4Q33A 2NSOA 1KNWA 5J5DA 3CAKA 1VHCA 3K4DA 3NDOA 3AMKA 1Z42A 2OLAA 4IH3A 3RN6A 2PTXA 4A29A 1W31A 1KFWA 1EGMA 2OGYA 4KRUA 4ONVA 2H9AA 3B8DA 3NCOA 2GJXA 4GCXA 2HTMA 4HA1A 2FHFA 2OMAA 1QMLA 3U8GA 4R7WA 2GGGA 4RDVA 3VX0A 4KIRA 2FIQA 2VQTA 5G4HC 5CLTA 1AUSL 2VGFA 3O6DA 2J62A 4C1KA 2PRMA 2WVVA 1JDEA 4QNWA 3OOQA 3W7HA 1XIFA 3ICJA 2FYMA 3G1VA 4CCEA 3RM9A 1RBOB 2PF8A 1POKA 3PB2A 3W24A 1QI2A 2PWVA 1G4PA 1E15A 3CO8A 2DZSA 4IX0A 1KV5A 2P8CA 3KRSA 1XKJA 3E3HA 4H9TA 4DJDA 3JVAA 4V28A 3S3GA 3EA1A 2Z00A 1QJWA 5CPMA 3LQLA 1J0ZA 3T08A 1UH2A 3OVRA 1NF0A 1XYMA 3W2LA 3QHOA 4ML4A 3L4VA 3RO8A 5HPCA 3L7RA 1XRSA 3WFZA 4KCVA 1R3VA 4DBUA 4OOUA 4ZE4A 4JS3A 2ISWA 3PUGA 2XM2A 3N4FA 3KRZA 1R9ZA 3VCCA 3CUJA 1EWDA 1W1A1 1KBLA 5DMNA 4M8UA 5DT5A 1G4EA 4JN7A 3C2YA 5I5RA 3EMZA 3B8IA 3RLUA 3S1XA 3ZO9A 4H7ZA 4DJFC 5CCZA 1RJPA 4JIEA 4FZIA 1J01A 3EMCA 4WSKA 5F2LA 4UFMA 3WQEA 3F5LA 3U5YA 3OU8A 3KOYA 3B40A 1H11A 4NZ5A 3W7IA 5D9OA 2E6FA 3WNMA 3JR2A 3H4GA 3WH5A 3C56A 3KUMA 2OO0A 1E9YB 4TQTA 3T55A 2IPJA 1Q6EA 1YYAA 1V02A 1WBHA 4D72A 4JNMA 3DDMA 4FEZA 3OBKA 3W1TA 2A6NA 1B54A 4AZCB 2Z24A 3LM7A 1A5UA 2CLOA 4A8LA 1MXGA 2OQHA 1S2WA 2OGJA 1OFAA 1ML1A 1OC7A 4QDWA 4B90A 4UFHA 5LIYX 3VDBA 1ICPA 2OTDA 4WEVX 3U6WA 1GPFA 4KEMA 1DJNA 1IE7C 4YWSA 1OGSA 2AAMA 3TTQA 3UZJA 4LUTA 3UF9A 3DBPA 5CC6A 4AVFA 1GK8A 2P5NA 4L56A 3LNPA 2A3HA 1XYLA 4D8AA 3MV01 1H09A 3NOEA 2AMXA 4QJ5B 2PWDA 1IGWA 3BZGA 1HJSA 3IRSA 4PC8A 1O1ZA 3TYCA 2YCIX 3EWWA 5C54A 2PODA 1EJVC 2J7GA 4K1GA 3P81A 4UTIA 4UCFA 5D33A 1CI1A 1XISA 2PUZA 3W1AA 2ATMA 1JYXA 5F4WA 2W66A 5LIXX 2OCZA 1SPQA 3ANVA 2VFDA 2VI0A 4HSHA 5AZ0A 1GORA 3GTXA 3F4NA 3ID7A 1Q6OA 1GPWA 5E6YA 4GZJA 4H9YA 3KOXA 4RE0A 5DANA 3A5FA 3KP1A 1JGIA 3U0HA 4PMOA 1JDCA 4JFWA 1P0KA 2J7FA 3GDBA 1GT8A 1T8XA 4HZ8A 1JZ8A 3WZ0E 2HPMA 4F0LA 1O5XA 3LXBA 1E6RA 2BOEX 3KCOA 2QZRA 2JKAA 1AMKA 3AZRA 3S2LA 4HPXA 4WJ8A 5EMJA 2NV1A 4O4VA 4UR7A 1JAKA 1ICQA 1EYWA 3PBYA 3LCXA 3QF0A 3TCEA 5BNKA 2QCCA 4W87A 3GXTA 1BXCA 4NRRA 4ROQA 4A8IA 3ONBA 4M29A 3FS2A 4UNLA 2WHLA 4L65A 3MA8A 2Z4GA 2WZHA 1A3HA 3DU0A 2B31A 1Q4NX 5XIMA 4N0RA 1TR1A 3F4DA 3M0HA 4H6QA 3GBEA 5GNZA 3A6OA 1OZMA 1PJ9A 2YXOA 3H12A 3TR9A 2IQTA 3C2VA 4DF1A 1AZ2A 4GFIA 5IM51 3S2CA 4IIDA 1RALA 4MB4A 1VC4A 5HNNA 3W72A 1SMDA 5FEZA 4C1LA 3KBSA 4JTKA 1ESWA 1K6AA 2FDMA 4AZBA 3BJSA 2F2HA 2JKPA 1XC4A 5DLCA 2NW0A 2VDGA 3KFTA 4AD3A 3O3RA 1BXBA 1W5MA 5CZSA 4KWSA 2VOMA 4QISA 1HUVA 5C2GA 5LIKX 1UKTA 4CCCA 1SZGA 2QV5A 1JCXA 2ZE0A 1LBLA 5KZMA 4IGHA 3WH8A 1TJPA 4JFTA 2NT1A 1GG0A 3THQA 4EANA 1PPIA 3SO7A 3F2BA 4DXXA 1VP5A 2VC6A 4LUSA 3K4AA 1SJDA 3HBLA 2VEGA 4M3PA 2YCJA 4ZB0A 3GG0A 3PWAA 1O5KA 2P0IA 3GVGA 3GXFA 1K8ZA 4WVXA 1JDFA 2QGYA 1J0IA 3CL7A 3RUBL 2V69A 5FEWA 2E40A 3WBWA 4NASA 2GQ8A 3FJ4A 3SB0A 1IWPA 4RXFA 2PDPA 2YCLB 4HOXA 2XSAA 5FJUA 2FLIA 2WMHA 2RJGA 2AL2B 5DY3A 3LSBA 2BMBA 3AJ7A 1TA3B 2V30A 4GACA 3E6EA 3F5KA 1FHVA 3MKCA 3KL5A 3KRBA 3MSGA 3TMLA 2YFOA 3QGAC 1OX4B 4JOMA 4IOTA 2WC7A 8TIMA 4P7RA 2X7VA 4WKAA 4O1EA 3I3BA 4O17A 4CUCA 4QCEA 3WDHA 3PZNA 1BEUA 1X39A 2J6VA 4JTUA 1K4HA 3MANA 3UA4A 6CGTA 3L66A 2CBJA 1FHDA 2WBGA 4FB7A 2D73A 2UY3A 3K13A 3BGGA 1YDNA 4F4RA 3RAOA 2FVMA 1LLOA 1VEOA 4DLFA 3LCWA 3RMEA 4MKVA 4MM1A 3LCHA 3GZ3A 2V5KA 1XQLA 1OF8A 3W1UA 1KRCC 2YX0A 3K1DA 1BSLA 4IFRA 2QCHA 2PDNA 1H5YA 4AIUA 4HMNA 2FH8A 3BGAA 4PMNA 2A2IA 3WDRA 4AEFA 4D6FA 3VKJA 2Y2WA 1YDOA 3FVDA 3ZWSA 1WUFA 1JPMA 4WY0B 4FF7A 3TONA 1SO5A 2ISFA 4Z2GA 2XM1A 3II1A 3HPSA 3CLMA 2WJDA 2ZZ7A 2ZFAA 2GVYA 2C8NA 4Y7EA 4GYKA 1FWGC 4EVZA 4L9ZA 3QHNA 1NP2A 3WMSA 2V5CA 1NQKA 1VZWA 3P8JA 3UJRA 2VXNA 2NVAA 2XVGA 2G4JA 1ECEA 2GSEA 2TMDA 1BQCA 3VD5A 5GJMA 2VFGA 4GY0A 3W6LA 3W7OA 1XYZA 3NFUA 1Y5XA 1S2TA 4AZCA 1WA3A 3FYYA 1EH9A 2ZZ5A 4CNSA 4MNKA 1X6UA 3CH0A 3CIXA 1ITCA 1CGWA 4JEQA 4XTIA 1EDGA 4OECA 4WOZA 3EOLA 4NJGA 3GTHA 1B4EA 1LYXA 5KETA 3CGTA 3M7SA 4YNGA 1FCBA 1DBTA 4MDPA 5AFDA 4MGGA 4ATDA 3BSHA 4F2UA 3VZZA 4AX6A 4EPEC 1IQ8A 1VEMA 1PV8A 1OFBA 3AOFA 1XLDA 3N9SA 4LPCA 4A3QA 1PCKA 4QSFA 4GK8A 4OKDA 2ZA1A 1KTCA 4Z42C 2WO5A 1DQUA 1XUZA 2PDXA 4OBRA 3LV6A 3EX1A 4FXJA 3KTXA 3ZJ7A 3H24A 1QO5A 3WBYA 3G0SA 3QQ1A 5DFAA 1B0IA 2PGEA 3Q4DA 1V3HA 2W79A 4DZIA 3OW1A 5G4EA 4FIRA 1TJRA 1UQZA 1QI4A 3U48A 2XN2A 1TRIA 3B8WA 5HQMA 1F07A 3ITYA 3UXIA 4MG4A 3WQWA 1NWUA 2F6KA 2QT3A 1ZQ5A 1RQEA 1Z32X 1M41A 1SFSA 2AL1A 4R33A 2W63A 4DHGA 3DFPA 1AA1B 5D9MA 4IL0A 1JUKA 4AZIA 4C6PA 3IIXA 3WNOA 2J6XA 4NZ3A 3GLCA 4R9XA 5A1AA 2X40A 3SAZA 1RCXB 1TTPA 3W71A 3WJYA 2O9PA 3TLLA 1K70A 3QSTA 4PTVA 4JTCA 1AZ1A 4BFAA 2HBVA 3RPMA 1A5SA 1E0TA 1TQJA 4KCTA 4Z2KA 4AIBA 2Z6IA 3I68A 4PCSA 1Q6LA 1UD3A 4PMJA 3QYSA 3F4CA 4PMXA 2GWGA 1GTEA 2P3EA 5CPQA 2EF9A 4A6GA 1UD8A 1EDTA 3C0QA 4CVWA 4EKJA 1NTHA 3SCSA 2CHRA 4KWOA 1OJXA 5FIPA 4WK9A 3B06A 1YBQB 1KM2A 3W0KA 3AYTA 1P43A 2X0SA 4PGLA 1EP1A 4DUOA 2NXIA 1W9DM 4HHHA 3EA3A 1JG9A 2YIHA 3MY9A 3Q65A 3B04A 4ZL1A 1DJWA 2CZVA 1KM5A 2EXOA 2X30A 1S5NA 1TV7A 3KOWA 3CV2A 1XGZA 2WV8A 1Q66A 4QR6A 2CLIA 3PB0A 3V5CA 3ERPA 3WJXA 6PTDA 1ITUA 1J6PA 5LSMA 4BQ4A 2WMGA 2J7DA 4AB4A 4PN2A 1TJ0A 5CBBA 3W07A 3FOKA 5BXPA 3T2OA 1FWSA 4C7DA 2WW5A 1DIEA 5DMLA 5TAOA 4AHQA 5CZJA 2B7PA 1GJWA 4U33A 4DJEA 2DT1A 3GNPA 1RP9A 1V6UA 5AC7A 3AHYA 1W3JA 1OEPA 3HJEA 3S5YA 3MYPA 4KESA 3A5VA 1FCVA 4UZSA 3OBAA 4H1ZA 4ZOAA 5ABGA 2D2OA 1QK0A 1Q85A 3CUHA 3BW2A 2Y8VA 1HJXA 3PF3A 3P6LA 1XIHA 1JQXA 2YCLA 4QLJA 1JXJA 3WEMA 2V82A 3N9RA 1TA3A 3QM3A 1W1B1 4U5IA 5CSUA 3EWCA 3W6MA 1K8XA 3KBNA 1JZ7A 5FL1A 2J78A 1D9EA 3W02A 1OX4A 1XYFA 2J13A 2H8ZA 5CPOA 4UFJA 4KRZA 4LAZA 4QG9A 4ZQMA 1FWRA 3BJFA 5GNXA 3M0YA 3TW9A 2PAJA 1N7KA 1TVNA 1MO0A 1IT0A 1M53A 2CIPA 3WH9A 5EGRA 4K2SA 3QZ6A 2C1GA 3TZNA 4LYRA 2ZA3A 3MHGA 4JQAA 2HROA 1KBJA 1E70M 2GQ9A 2FTWA 1RY0A 4H6KA 4IP4A 2OELA 3N9KA 4NNAA 1KO0A 4PRTA 5L9FA 2W6RA 1FP9A 3PG8A 1R85A 1BKHA 1EEPA 1HZYA 4O10A 1UPPA 1NOUA 2XZ9A 3C0LA 3V1PA 1PZ0A 1SSDA 1H51A 2RH9A 2Z25A 1RSCA 1XLGA 5A6KA 4N9BA 1OFEA 4DUXA 3DXIA 1AK5A 2QUUA 1S5WA 1LOSA 3STEA 4WY0A 1W1YA 4Z2JA 5IRPA 4P7LA 3MO4A 1IEXA 3G18A 4WJXA 1EWEA 2WQDA 4Y8FA 2V3GA 2DV0A 4IISA 3GDMA 1UZDA 3ORWA 4C90A 2PB1A 1R86A 1UR8A 1KM6A 3B4UA 2XIBA 3ITTA 4FLOA 1JXKA 1R7AA 1WZKA 3LEPA 3BAYA 2JBMA 2QJIA 3VA8A 2PRLA 3W1XA 3UWQA 1Z41A 3FYPA 4MUZA 4IPIA 5AHIA 4AWUA 4MNLA 2DZUA 1DHPA 3XINA 3TYAA 1XGDA 3W4RA 1WYIA 2PBOA 4H9VA 3PG9A 4MYXA 5FJIA 4JNYA 4W5UA 2CLEA 1BRLB 4O0QA 4CNOA 3PTQA 2Z1VA 3S6TA 3SCVA 4HU8A 2O9OA 3DAQA 5EMYA 3G3DA 4UIOA 2FGZA 3GKAA 1S5VA 3IWPA 4TVCA 1SFLA 1ODZA 1HL8A 1K03A 2WVTA 3GC2A 3OHIA 4I5UA 3WMLA 3AIQA 3CPGA 5TF0A 1AVAA 5DT7A 2GJNA 3VFCA 4DUVA 4RZBA 1F2JA 5A2CA 2TRSA 4CQ9A 2WMIB 3IV3A 2QNEA 2DZWA 3GDKA 4F0HA 3S1GA 4IXXA 2A4AA 3FGCB 4XVDA 4JIHA 3M6YA 3KL0A 4V15A 4GXPA 4M80A 3RR1A 4B15A 4LU0A 4PYSA 2VM8A 4AU0A 4XSMA 4AZHA 1LT7A 1E6ZA 1AJ0A 5DN1A 1F74A 3FYOA 1TTJA 1OC6A 1KC7A 4PB5A 3QMSA 2Y0FA 3SN0A 3MZNA 1JRCA 2YW3A 3FJNA 3PS7A 3ZMRA 3BXWA 1RQBA 4ORMA 4EPDC 1S2AA 3GG1A 2BVDA 2Y5SA 3SW6A 4Q4QA 1W5OA 3VNDA 1UUOA 3SUSA 3LTPA 1XYAA 1R87A 2PPGA 2D3NA 3CIWA 2JEPA 4RZ4A 4H8UA 1C7SA 1F3TA 1TR9A 3LI1A 2D0HA 4NI3A 3R4IA 5AOUA 2YL6A 3TA9A 2NXHA 4GIYA 4DX3A 3SFWA 2A6LA 3LCGA 1ODUA 1HO4A 3NQEA 2IS7A 4HCHA 5CPSA 1TE1A 3JS3A 1ZJAA 3QV6A 3GDLA 4GABA 3KM8A 4ZQOA 3UY7A 3PFRA 2EAWA 1NDYA 3IJ7A 2NUWA 2QCFA 3CS2A 1FHUA 3GS6A 3HTWA 3LBOA 4Q8QA 3Q2DA 1J2WA 5C5YA 1WOBA 4U3AA 3S9ZA 3W38A 4D6IA 2ZXAA 1TKKA 3O15A 3O63A 4S39A 5FF4A 2X2YA 1GOOA 3WLNA 4XIMA 1YBQA 3AC0A 1D2KA 2J74A 2QMKA 4LEFA 3DX5A 3CB8A 1AODA 2PFHA 4EXQA 1W3KA 4GQQA 1OIMA 1QHPA 5KTLA 2ZDSA 1V0MA 2J9ZA 4XV0A 3Q67A 4PMUA 1US3A 5FF3A 4N9EA 3C2OA 1A80A 1OG0A 2VHLA 1EX5A 1KM4A 2G3NA 4C6IA 1ZS2A 2YA2A 2YDQA 4R85A 1QNOA 4GJIA 3NGJA 3QR0A 5AECA 5JU6A 1Z6KA 2XIIA 4DM2A 3UNDA 3Q37A 2EPKX 1XBVA 5E9AA 4DWDA 3LD5A 1VBUA 3JU2A 3F2CA 4R53A 1UUMA 1OCQA 2F7FA 2PC8A 3GH7A 2YPIA 2WAGA 4J1OA 3K2GA 3EBVA 3TN3A 1L0PA 1QTWA 2VFHA 3CPUA 5HBFA 3G6LA 2EG8A 4AWTA 4PTWA 2OZ0A 3SUTA 2I1OA 2GSHA 2Z7KA 1HJQA 1XD1A 4HSNA 3U3HA 4L4OA 1A50A 5AYBA 1PIIA 1WZLA 1E4LA 2Y88A 4N6FA 3GAKA 4URIA 4TVUA 4JN6A 2C1HA 1XFCA 4D6GA 1XSJA 1Q5MA 1SFJA 1FWAC 3VO0A 2G96A 3CYJA 4LUYA 2BY2A 3U4FA 1PX4A 2X8RA 1OFDA 2VFIA 2BOGX 2CW6A 4CN4A 4UBPC 1VBHA 3ABSA 3PZVA 4R9OA 3E74A 2VDHA 3N4EA 3NQFA 2NWRA 3IIZA 2ZRUA 4LOCA 1G69A 2VC9A 3KVKA 3BLLA 2W62A 1BQGA 5CSRA 4Z1CA 4FMVA 1AG1O 1ZY9A 3BURA 1A4MA 1ZBKA 2B81A 3EDKA 4K8HA 1DPMA 1KKRA 1W32A 3SCTA 1X8FA 2WHJA 4ZCWA 3IACA 4ZO6A 4LBSA 4K1WA 3TC7A 1XKYA 4HMEA 2DP3A 1XH0A 2ICSA 4IZGA 3U2ZA 1NOWA 4NX5A 3SUUA 1RPXA 1DHKA 3UG3A 3NPXA 4HA0A 3EA2A 3D3AA 3CL6A 1JJKA 4JAWA 1OCNA 1AFSA 4Q4RA 4OFCA 3DG7A 3WYZA 1XP3A 3KTSA 1TPFA 2FHCA 1BD0A 1FHLA 2Z2AA 4QG6A 3TTOA 1FWWA 1GQNA 1XS2A 5E70A 1K7EA 4E2DA 1UUQA 2GSJA 3LG3A 3V3WA 1EBHA 2IQDA 2KX9A 3ITVA 4F0MA 4LAOA 2GDVA 4HJWA 3UWYA 1O12A 2BFGA 1W91A 4Q7NA 4WDTA 3QV7A 5CJ5A 2PDKA 4E6MA 3VIFA 4OUIA 3UJ2A 3UWVA 4TU1A 4XZMX 1OHLA 2OYKA 3DG3A 3WBEA 3DBNA 3NVDA 4HA3A 1M04A 2Z1XA 2HJPA 2QHAA 1Y0EA 1JPKA 1ZZMA 5ENLA 3V75A 4F0SA 1VB9A 4MJ4A 4G2DA 3DESA 1FVPA 4RCXA 4GUJA 3UU0A 1BRLA 4DJDD 3MI6A 1YHTA 3LRLA 1L6YA 4GGBA 5BYWA 1E3XA 2PP0A 2XDFA 5DX7A 1RAKA 3U4AA 3E2QA 3NO1A 1HF6A 3GIYA 3SM0A 1PB0A 4B5NA 1V3LA 3M0MA 3MUAA 2CERA 2Z26A 4NL1A 3LPPA 4X9SA 2TYSA 3T1GA 1KTNA 2Q3OA 3S0CA 1HIZA 1XHGA 4DZAA 5HMFA 2WMIA 3TWAA 4MUPA 1W1PA 1XL9A 1JNEA 2JFEX 4O1FA 3FGCA 5D04C 3W2UA 3N6JA 1EJWC 4TX9A 4WDXA 3E02A 3NJ3A 2DJXA 1TWZA 1UP3A 3A9IA 2PEVA 1XFBA 1WOAA 4H41A 5KZ6A 3PN8A 1UIOA 1FWEC 2IPGA 1TZZA 1TV4A 4DBDA 4WUIA 3GSMA 4GKTA 2WJEA 4M7TA 3WJWA 2DVUA 4HCDA 4KF1A 3SGUA 5BZAA 1L6GA 3GVVA 3W74A 1PUDA 1XLEA 2F84A 4LVGA 4RPQA 1KGWA 3AXKA 5EFDA 3O6YX 1I2QA 3N3TA 4DJFA 3IAPA 1KM1A 4OBTA 4TV5A 1HL2A 4XZIA 3LHWA 3UWUA 1G4TA 1N8IA 4UTJA 4OZOA 2JF7A 2C18A 1PYFA 3SY8A 3QY6A 4QJ3B 4J3UA 2DPEA 2R6OA 2IW0A 3VDAA 4A8RA 3LCIA 4GBDA 3RLVA 3G1AA 1KBKA 5A95A 4NZJA 3B0VC 4ZSTA 4GY7A 4XZNX 4KFNA 3V1HA 1TG7A 5JIPA 4HN8A 2A7NA 1DXEA 4AD2A 4UFLA 2QAPA 4FR6A 2ZX6A 4S1FA 3IVTA 1ENUA 5I3JA 3PZ9A 3NQBA 4F66A 3NSXA 1XUUA 1H1ZA 2WWCA 2J88A 4LW7A 2D2GA 1WCGA 3ZT6A 4BA0A 1WXZA 2OVLA 1XX1A 3SRHA 3ARZA 4M82A 2HE8A 1QU4A 4AY7A 5A6MA 3EOUA 3PK7A 1E4MM 1PTGA 3E0WA 3T6CA 3KOFA 3BSGA 1NWSA 1QI0A 3ZJKA 5HUOA 4V1YA 1Z48A 2V5BA 1XLKA 2DZXA 1PO9A 2G4FA 4XAYA 1OFPA 3QPZA 1S46A 1OX6A 1P0DA 4QX4A 1M6JA 4LTSA 1W1VA 3ZXWA 3HQOA 1GVFA 1CZ1A 5DCDA 4GIAA 3EEGA 4GE8A 1V7YA 1IGSA 1XJBA 4LANA 5BOEA 2O7QA 4GGHA 2YDRA 3N25A 1WDPA 3NZGA 3W85A 3SCOA 1AD4A 4C6BA 3O2LA 3MUXA 3M0VA 3BAXA 4XD3A 4ZZ9A 1ZL1A 3PSVA 3TJIA 6ALDA 1JI2A 4JIQA 2I5IA 8RUCA 4GNJA 4JTHA 5A8QA 4K7YA 5HDRA 3TKFA 2WPGA 3HMCA 3M7WA 2QLYA 3EX2A 1C90A 4YVPA 4CQAA 2CBIA 1NP0A 3AU6A 3BLKA 1S3HA 1IIGA 1G5AA 4ZR8A 1MW0A 4XAFA 3RIKA 4XBSA 3HA1A 3OLEA 2MANA 3IJ8A 5LGZA 1NQ6A 3GG8A 1C8VA 1K4GA 4HHLA 4HKPA 5BWFA 2X7WA 3LM3A 5CSSA 4XWUA 3T0BA 4HA4A 4M19A 3EB3A 2YOCA 5CEWA 3S47A 1L9WA 2CC0A 4QNEA 4L6DA 5FSEC 1MEIA 1GYNA 2WOQA 4FNSA 2ZA2A 1V5XA 5BRBA 4MWAE 4NYYA 3ZSTA 1SMAA 4GYFA 4LWWA 5CZTA 1U1HA 1GOQA 4E2BA 2E1WA 3G2GA 4Q8UA 4IX2A 2XFYA 4MFDA 2AAAA 3S9YA 3PVFA 2EEXA 3VD7A 4D1JA 4HPHA 2PZNA 5AVNA 3DHDA 4PB3A 3FY1A 3IGUA 2GDUA 3P67A 2V5LA 1ISXA 3GU2A 4ZFMA 2G95A 5M17A 1V0LA 4D8ZA 3RX3A 4L9YA 2QCMA 3C6CA 1BYCA 3EOEA 2AMGA 4PL2A 3ITGA 2J25A 3OZOA 1CDGA 3R10A 3GK0A 1EP3A 4NZ1A 3KBMA 4OBSA 2A1YA 1C9WA 1RBLA 4LY4A 3P62A 4CQCA 4J7RA 2VEFA 4R5EA 4WDUA 2PA6A 3FX4A 3A21A 3MC5A 3F4VA 3LHVA 3LHTA 1A5MC 2VX7A 1VFSA 3T8QA 4P7OA 4ML9A 2B7OA 3M64A 2PDHA 4HU0A 1B5TA 1FCUA 1RQHA 4B5VA 3W84A 4IMEA 1U83A 4MY9A 1H7RA 1GKQA 2XIMA 1PZ1A 3URAA 3WLJA 4J4KA 5E0FA 1JI1A 2DFAA 2C79A 3OZYA 4TR9A 4HK6A 4TMCA 1RR2A 4W9TA 3TYUA 2R1LA 4FLRA 1ADDA 3KS6A 1CX9A 2QV4A 3QTGA 1PDZA 5D2TA 3JW7A 3IAQA 3L4YA 1N8WA 2YBUA 4HSOA 1OVDA 1XQKA 3K46A 4GUIA 5CPLA 2R94A 1FUYA 5EBUA 1JZ6A 5JH1A 3E0VA 3GR4A 1RA0A 1X98A 3DC0A 3MTWA 3WEOA 4ERGA 5KMYA 5GJNA 1FRBA 3EWUA 4O57A 4D6HA 3GC4A 3WUEA 2W4XA 3QN3A 1ISVA 3MDWA 3L67A 4MPQA 3SN4A 2VP8A 3GIPA 2FZNA 4JQ2A 4FLQA 4C7GA 3LTYA 4ZBCA 2KZHA 1M65A 1B4KA 1UP2A 2CEQA 1TV8A 1ZAJA 1XIDA 4AX7A 1TREA 3H22A 4Q22A 3W2JA 5LHEA 5U4NA 3KHDA 1MNZA 4NG3A 2DZVA 1E6XM 2YYUA 3P14A 3QW4B 3CLWA 2JALA 3T44A 4LX4A 3WD3A 1JAEA 1SJAA 2BG5A 5G4WA 4WGXA 2NQZA 9XIMA 2CLLA 4PUUA 3R12A 1GQKA 5KZEA 4AD4A 1GEHA 1BVZA 1KWKA 4GOAA 3BOFA 1YKWA 1XLJA 1F4HA 8XIAA 2HXTA 1QHOA 1BYBA 2IKGA 3M46A 1I75A 3KBWA 2PWEA 4Z2IA 2OT0A 5CC3A 1AW1A 2BX7A 2HVNA 3M47A 3CHVA 1X7IA 3TE9A 4AYGA 5G1MA 4EACA 5ECUA 3I6RA 3RG6A 2JGYA 3PZTA 1I45A 3G22A 2Z1SA 1PZ3A 3IVSA 1P1MA 4LSBA 1IT7A 3V4BA 4JFVA 3W7KA 3AO0A 1A53A 1VHNA 3UR2A 3WX7A 1Z69A 1FWIC 1GQJA 4QLLA 1W3HA 1X7FA 4KKXA 2FZBA 3M0JA 4NF7A 2EO7A 1IXNA 4GXWA 4B2DD 4Y9OA 4ZOBA 4PBEA 5HJXA 1I2NA 3NPUA 4IJRA 1R47A 1QXLA 4WXZA 2VEKA 3SBFA 1UPMB 4N02A 3ARQA 3MUZ1 1DWIM 2QAFA 4FO4A 3M0XA 5D8WA 2FTPA 5CG0A 4G7EB 2X1TA 1VCGA 1K9DA 4KQNA 1TPH1 5GVJA 1H60A 3O16A 2UY5A 1XR2A 1NAL1 3Q94A 3ONCA 5E0CA 4J35A 3LDVA 5K4ZA 4LCSA 4C6DA 2FGBA 5A6BA 2P88A 4Z1AA 2ZRYA 4HT3A 3HB9A 3J7HA 4O8RA 4JKMA 2WC4A 4GNVA 3PFMA 3LBMA 3I7QA 1E9IA 2A3EA 4GZ7A 2PSNA 1RZMA 4D6EA 5H8PA 2WSQA 4JTDA 1CXHA 1W56A 3T0CA 3DEQA 4IPNB 4UNIA 3S1VA 2QJGA 1J11A 1NFPA 1G67A 1KFEA 3CUXA 3CUFA 4LBRA 4FLSA 2VR5A 1TWSA 2ZTJA 3OB8A 3DYMA 3N2TA 4N2YA 1IXPA 2GJLA 1F6KA 3LSCA 3UG5A 2C0AA 4S3AA 1TPEA 2C0HA 5I06A 3ITOA 5CBIA 3U57A 4I9JA 1VD6A 3MJYA 5TD4A 2ZYFA 1DJHA 1WQ5A 5FD0A 3IJDA 2QMJA 2H6RA 3N6QA 3HIJA 1HKIA 3NR0A 3HJZA 3ZLHA 4ATWA 3MV11 4IFKB 2J24A 1ME8A 3GBDA 3SY1A 1KB3A 3MYOA 2YBVA 4W4QA 4LT9A 3TJLA 2PC4A 3IJLA 1GZJA 3R5EA 3G1HA 3KRUA 1GTHA 3UA3A 3W1PA 4J5NA 2WPBA 1BG4A 4ZEPA 3TROA 5C7HA 3G1FA 3SQLA 4DJEC 5HWMA 4J2PA 3W82A 1RD6A 4J28A 3RRXA 2GYIA 3M1ZA 4H9ZA 3PZQA 2BVWA 2J47A 1BSIA 1UQYA 1GQLA 3RPDA 1GW1A 4IF2A 3D0CA 1DP0A 1KCLA 1B3ZA 4U28A 1VJZA 3MKKA 5K4XA 2NX1A 1HL9A 3GAYA 1N8FA 3URQA 1GCYA 2ZZ1A 3V35A 2GVLA 3PJWA 1VS1A 1UR2A 1XIEA 5DY2A 3P7YA 1XH1A 4FI4A 2E09A 2ON3A 2VYOA 3BCJA 4O0ZA 2PMQA 2PWGA 4Z0JA 1RA5A 3IVUA 2D20A 1K8YA 2VFFA 4C6EA 5HJLA 1CIUA 1FWBC 3DHFA 2G5WA 3GW3A 1J93A 4CCZA 4PZVA 2HE5A 1WZAA 1MW3A 2DZTA 1Y5WA 1V93A 1TSIA 4LUJA 1T7LA 3LPFA 3WMCA 1UA3A 4ZFCA 1JDDA 4KEZA 4EP8C 3FXGA 3S9IA 3IGSA 3FAXA 3VIGA 1XRTA 3OPSA 3GZAA 4UMBA 2P50A 4H7VA 1WKFA 3P80A 1RXOB 3DECA 3RRAA 5CC7A 1F73A 1EQPA 1A47A 2CITA 4CU6A 3WFAA 3C5QA 3ZR6A 1X97A 3F5JA 1UJQA 3OQ8A 1QNRA 3EYPA 4HZ6A 2XWEA 4X63A 1EEXA 1R0MA 3BUVA 1XG3A 1RUSA 5AN7A 3VOHA 4ZO9A 4N9CA 4H04A 3N2MA 1KV8A 3QBUA 4IUOA 1RCOB 3S1WA 1JCMP 2OX4A 5FACA 3E0FA 4LJ3A 2QW5A 5K9DA 4G1KA 4JR5A 4NNBA 5C9WA 2ZWYA 3M9YA 3AUOA 2PI6A 1EQCA 4HJFA 3TOYA 4FNQA 4EIVA 3DCPA 2QPSA 1FFRA 1Q8AA 4MB1A 4JFSA 1U5JA 2QKFA 1H0GA 3MW7A 1EOMA 4UQAA 3VIPA 3WSUA 4QSHA 5LXXA 1MRQA 1WXJA 4M0XA 5IOBA 1J79A 2WLZA 1MXDA 1YQ2A 1R3QA 5H2ZA 3P2VA 1SZNA 2RGLA 2DY3A 3UJEA 4TIMA 2VO5A 1J4EA 4US5D 5I3GA 4D6DA 1Q7MA 1CLKA 4C6MA 1FH8A 4TMBA 1QRQA 4QDPA 3DGBA 2NVCA 3KZPA 2Z1WA 3ARVA 2HEJA 1UBPC 4ZE5A 1GJPA 5K9XA 1ONRA 4JTTA 3S46A 1WDWA 2CBUA 2Y8UA 4XSLA 4M6VA 2Y5EA 3ARTA 4DIAA 3T4WA 2BP1A 4BF9A 3HGRA 1CXKA 3POHA 1ZENA 3W1MA 1OINA 3BW4A 1EPXA 2CLPA 5A94A 2EPNA 4PMDA 3CHDA 4L4PA 1B57A 1VCVA 1TMLA 5BXTA 3DFTA 1KGUA 3BLIA 4HD5A 1CENA 2NV9A 2QCDB 1SJBA 3QR3A 4XTDA 1SVDA 4IPJA 4S3GA 1GOWA 4XO6A 4HQVA 2EQDA 5IXEA 3MMUA 3DYOA 5LA2A 3PAOA 1V8EA 3B3DA 1EUAA 1R46A 3OLIA 1X6NA 2ZZ3A 3AIBA 5BRPA 4D2JA 3BANA 5F4SA 4EXBA 4UQCA 3BV4A 4D6CA 1R3YA 3WIJA 5TNVA 1WBJA 4FOJA 4MLRA 1DWGM 2WCSA 4M81A 4W86A 2WZTA 4DYKA 2HS6A 4PE8A 4DEFA 3O07A 2CBVA 4AHOA 1X96A 3ALGA 1UA7A 2VC7A 2J75A 4H19A 1DQXA 1EF3A 4OU1A 1YTEA 2DT3A 2VGGA 4WLCA 3WF4A 3O6AA 5BU6A 4L64A 2BASA 3A24A 4GISA 3WQDA 2PD9A 3DKJA 4Z08A 3WH7A 1UWRA 3FLUA 4PBFA 1BAGA 5KINA 3LHUA 4G7EA 1F6YA 3HG5A 4BF5A 2ATSA 3UYIA 2EBNA 4PMZA 4MNJA 3W28A 3UXKA 2CLMA 4QJ4B 4C6FA 1JPIA 4E2VA 2PP1A 3RLGA 3MUIA 2W61A 2DZAA 2I9EA 3VOGA 3DFNA 3W7QA 4HK5A 3TYZA 3R0UA 4BF7A 3L4UA 4JKLA 3CT2A 1SFTA 1BVNP 3GWQA 4ZVJA 3U2EA 4MWAD 3WF2A 1OQFA 2EHHA 5G2IA 1FWNA 2HRWA 3EWBX 2OWCA 4Q4PA 4O1CA 4C6KA 1W1TA 1DE6A 1EJRC 1IIHA 1MEHA 3LS9A 3ZIZA 2X1RA 1B30A 4LVDA 3O0FA 1EBGA 1OIFA 2PDCA 2V68A 1VBGA 1J0KA 4XKMA 1HVQA 9XIAA 3FW6A 4IHCA 5I3DA 1MW1A 1I8JA 2WYSA 2XVNA 3L4XA 2DUAA 4EK7A 1V3IA 4WR3A 2GLKA 5LYRA 2DT2A 3SGZA 3FK4A 2OJPA 3FV9A 3N2BA 3UERA 3A13A 4MAVA 5HUPA 1FTXA 3E1F1 1OYCA 3EWZA 1VR6A 1WUEA 4NHVA 5KSWA 5E9XA 1BGAA 1P48A 3IJ9A 3QLLA 4NZFA 3OGRA 3VK5A 3AHTA 3DFQA 3TTYA 3KDOA 4JTSA 4IFKA 2A85A 1BYDA 3MWAA 1V4YA 3PTKA 2QDDA 3MHFA 4CKQA 3FHAA 4AXNA 5T8GA 4LNYA 2D69A 1DJYA 2F61A 4U2ZA 1EC9A 1E43A 3INPA 3N2OA 3WL1A 3W27A 4I7VA 3GTNA 3K8MA 2GJPA 2ZRZA 3CT7A 3OTRA 3PUEA 5A3HA 3AXXA 2DGAA 3WBAA 2DZPA 1QASA 3FFSA 5ABTA 1AH3A 2AGKA 3GNRA 4W84A 3ARXA 4J2MA 3CB3A 4A3RA 1TELA 2OZ3A 3BSMA 3FXYA 3E9AA 3NQ6A 1YNYA 3GUGA 2ZUTA 4DVOA 4I9AA 3SIZA 2E28A 2RAGA 1U1JA 2VC5A 4D6JA 2ZX9A 1Y7VA 2P53A 3GVQA 2VX6A 4W88A 4IP5A 5IDZA 2V5DA 5MHBA 3NURA 2V3DA 3ITLA 4NJHA 3T2PA 5I03A 4O52A 5DCEA 5D02A 2OSYA 2PDLA 3GHSA 4GFSA 1N55A 3RX2A 1CXLA 1FOBA 4ICNA 2R9RA 5M3WA 2OB3A 5L6UA 5D38A 3RHGA 5I24A 1REQB 2HMCA 4Y96A 1GQIA 1MXSA 2Y7GA 3V18A 2Q8XA 5G5IA 2QPUA 2OYMA 3SRFA 2WCGA 4B9YA 4AZ7A 2VELA 5SWUA 3NZQA 3ELFA 4UFKA 4WCJA 1KFKA 3VGHA 2NQ5A 5LA0A 2CNCA 4GC3A 3AHVA 2DW7A 5I79A 3QKEA 2QULA 5I7GA 2ZXBA 4KMQA 3UZXA 2H3BA 1DORA 1OK4A 1QWKA 3WNPA 4IQJA 1VQTA 3HOJA 3K30A 3BG5A 3WDIA 2PBGA 3HG2A 2X2GA 3W7NA 2PD5A 1LBMA 1PTAA 1QPRA 3DG6A 4LNCA 4AMCA 5LZLA 2FKPA 2QVNA 2WVSA 3WD0A 1Q6GA 4YHGA 3LHYA 3RJYA 3VNLA 2E9BA 4PMVA 5F7UA 3B8TA 3E2SA 3R8RA 4UTMA 1YEYA 1MZRA 2BSLA 5C0QA 3C8FA 1MMFA 2XH4A 2GL5A 2JEQA 1Q7QA 1OM0A 3ATYA 3C2FA 3TH6A 1LWHA 1JPDX 4M1RA 3W3OA 2CXGA 2Z27A 2TODA 3FA5A 1B3YA 1DIOA 1EPVA 1XD0A 1CXEA 2NX3A 3VM5A 3V36A 4RNJA 1H49A 1HQTA 3ZVHB 1PWLA 2D24A 2ZRWA 3A3HA 3HPFA 1M7XA 1WDQA 1TE6A 4W8LA 2GZXA 2WLYA 4YYFA 1TMQA 1K7FA 1VIWA 4ROPA 3AQUA 4O0KA 3SJNA 1DV7A 3RM4A 4BI5A 1UD5A 4M5PA 4GVIA 2BGQA 3P0XA 4IGNA