3TYBA

Dihydropteroate synthase in complex with phba and dhp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
265
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Dihydropteroate synthase
total genus 93
structure length 265
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tybA00
1Q8AA 1Q7ZA 2H9AB 2YCLB 3V5OA 4CCZA 3TYCA 3TYZA 4DJFC 2Y0FA 5JQ9A 4S3BA 2E7FA 3H23A 2VEFA 4NL1A 4D9PA 4NHVA 2VEGA 4G9PA 4MWAC 4DB7A 1Q8JA 2DQWA 4S3DA 3K13A 4O1FA 4O0QA 1TWZA 4O1EA 3H26A 4S38A 3H2MA 1AJ2A 1Q85A 1AD4A 2H9AA 3TYDA 4DJDA 4DJDD 3MCMA 3H2AA 1TWWA 4MWAA 1F6YA 3MCNA 4S3CA 4PZVA 3TYBA 1AJZA 2Y5JA 1AD1A 4DJDC 3BOLA 4MWAE 1TX0A 2YCIX 4D8AA 4DJEA 3H2CA 4S23A 3TYUA 2BMBA 4DAFA 3H22A 1TWSA 3H2FA 2DZAA 1AJ0A 4S3EA 4S3FA 1Q7QA 2DZBA 4C1NA 4D8ZA 2YCJA 1Q7MA 1TX2A 4MWAB 3H24A 4DAIA 3H2OA 4DJFA 4MWAD 3NOYA 2VP8A 2OGYA 3TR9A 3H2EA 3H21A 3TZNA 4S39A 4NILA 2YCLA 3MCOA 4DJEC 4NIRA 1EYEA 3TZFA 4HB7A 4C1NB 3TYEA 4DJFD 4DJED 3TYAA 3BOFA 3H2NA 4S3AA 2YCKX 2Y5SA
chains in the Genus database with same CATH superfamily
3GH7A 3E5PA 4O13A 1WAWA 2WPBA 4AZ6A 1WDPA 2E1WA 4ZL1A 3UQNA 1R2RA 1QI4A 1UR2A 1HO4A 1BSLA 3IV3A 4GIYA 5C2XA 7ENLA 4IXXA 1UWQA 1E5JA 1K7XA 4YCPA 4C91A 2NX1A 3F4WA 4W86A 3GR4A 1UWTA 3DZ1A 1V5XA 2OU4A 5LIYX 2EBNA 4W7VA 2IQTA 1H7OA 5HANA 3VFLA 1JG9A 2DT2A 4AVFA 1RD5A 3NSMA 4FI4A 2X1TA 3MDWA 2VEIA 4PUUA 4CQ8A 2YDSA 1F7BA 3H2CA 2RKXA 4S23A 4AXNA 4LUYA 3SADA 2JIEA 4PBGA 1B4EA 3STFA 3O6CA 2D0HA 5DFAA 4GBDA 1W54A 4HCLA 3BZGA 1EH9A 1TIMA 5JBDA 3WFAA 2CHNA 3MP4A 2E68A 1EO7A 1W5NA 1H41A 4GJJA 4XUGA 1SJBA 5F2GA 5C9ZA 3W7DA 3O0FA 4QEEA 3GE7A 2CLOA 1XDLA 3L23A 3ZVHB 5AHLA 1VEMA 5K4XA 1XLJA 1V0KA 2YL9A 4DJFD 3R11A 3SJ3A 4ES4A 1T0OA 1WDWA 4BCEA 1PEZA 3ZJ7A 4L64A 3TONA 3HO8A 1P6WA 4BF5A 1M5WA 4F3HA 2FZNA 2DY3A 3EMCA 5KZDA 1C7TA 3MV01 5AC7A 3HV8A 3FJNA 3TU9A 1VYPX 2GFTA 1KFCA 2HMCA 1G7UA 2DQWA 3D3AA 3T0CA 1QNRA 3MI2A 1DKWA 1XF0A 2YB1A 3IIZA 4CCDA 3QLLA 4PUKA 4IQLA 1X6UA 3HM7A 1S2WA 3R58A 4AD0A 3NVTA 1K8YA 3VGDA 4A22A 3USZA 4N7QA 5DRIA 3CL8A 4OUIA 1N8IA 2OB3A 3W1QA 1GVFA 4J3ZA 3R13A 4RV3A 1SFSA 4YWSA 2Q8LA 4E4PA 1TJ1A 3T2QA 2ZRYA 2DZBA 4M6QA 4PB3A 5D9OA 4IMDA 4TR9A 1F4HA 3DHUA 1OT2A 1E1FA 1EEPA 1HFBA 4Q4MA 4ZOCA 4DN1A 1LL7A 1WZLA 1EO5A 4LXFA 5LA2A 3PHAA 4B5WA 3GNDA 1NELA 2CC0A 3AIBA 2FGBA 2PP0A 4IPIA 5EBAA 9XIMA 3GNXA 3FFSA 2OZ8A 2NX3A 3ZIZA 1V3MA 4RXGA 2WJEA 3L4TA 2WVTA 1CB2A 4E2OA 3EZ4A 2Z1SA 1EDQA 1V6UA 3OLIA 4DBSA 3W24A 4FNRA 2YXGA 1TZZA 1OCJA 2XFYA 1KQZA 1KFJA 2O7SA 1LCOA 3ZJKA 1IXNA 1PUDA 2IMRA 4B9ZA 1CXLA 4QE4A 1KM4A 1A5UA 5LIWX 4KKXA 4Q32A 3VD4A 3GTXA 2XWEA 3VZZA 4MAVA 2NXGA 3KTXA 1C3FA 3LZ5A 4RDVA 4AF0B 2J24A 3WNOA 3WY1A 1LWJA 1XIHA 5M1TA 1YQ2A 3QC3A 3V5FA 3IS4A 4K1GA 2BY2A 4DXXA 3BOLA 1JZ8A 2WAGA 3GDBA 1W9VA 1CI1A 2BOGX 4UTMA 3HBLA 1VC4A 3AICA 1KGUA 2ZX8A 3LPPA 3TC3A 2VDIA 1D9EA 2OMAA 3UCDA 3L4XA 3FLUA 4QDWA 3FJ6A 3REQB 1XYLA 3MVTA 3OVQA 1SR9A 3TC6A 1CGXA 4XISA 5H8PA 1ZAIA 3WQ6A 4JTHA 2HWGA 1A5LC 5HJYA 3VD5A 3VVGA 3L7RA 3BAJA 3STEA 4PSPA 1JDEA 3A3XA 2W5FA 5F4XA 4JTSA 4PCNA 5FSEC 3H2NA 1PTGA 1H0GA 1GKRA 4CN1A 2NT1A 3MS8A 1XUUA 4H04A 3EWXA 1I0DA 4AZBA 4GRSA 2OVLA 4GX8A 3MWCA 2JEQA 5I3IA 3CZKA 5DT7A 1J0JA 1CPUA 1GPWA 5DT5A 2R1KA 1EHNA 5AHMA 1E6XM 4ZTXA 4N9BA 2QIWA 3B0XA 3RRXA 1Y0EA 2ZZ1A 4PEKA 4V27A 3VABA 2WMJA 4O50A 2GQ8A 1IR2A 4AWTA 1SMDA 4GK8A 4IHCA 1FWSA 4AZIA 3HN3A 3GS6A 3G1VA 2YBTA 4O54A 2AQOA 1GQLA 2O7QA 1J5TA 4EF9A 1EF3A 3V4BA 2HPIA 1LYXA 4X0NA 4JOMA 1RR2A 1FH8A 4GC3A 1XQLA 2G41A 4UUIA 1ISVA 1XBVA 4OIFA 4B4FA 1D3CA 1SZGA 3TR9A 3CJPA 5A2BA 1IT0A 4O1CA 1XI3A 1HJXA 1JYXA 3KLKA 1G6CA 1NVMA 1QK2A 1EC9A 1JAKA 2CZVA 2WCGA 1EXBA 2A3AA 3WF1A 2RHGA 4D8LA 3ZR6A 4L1XA 1TTJA 3AUJA 1GHRA 2V3GA 1XICA 3N6QA 4J4KA 3VYLA 1E4NA 3DX5A 2P53A 1M01A 3DYPA 2AL2B 3T81A 4ATLA 1Q6QA 3NTYA 2DV0A 5JXQA 2V3FA 1M04A 5A8MA 2WQPA 4D2JA 2I7GA 2FTWA 3FXGA 1ISWA 1DL3A 3PFMA 3VXGA 1QI3A 2YA0A 3GK0A 4URIA 1P48A 2HPMA 3R25A 3EX6A 5CC6A 5KTLA 4MPKA 2E8ZA 4WDXA 1RLDA 3R0KA 3VKBA 1X96A 4ZODA 1V7AA 3FYOA 1UD4A 3CL6A 3E2RA 3QOMA 3RM4A 3UR5A 1XGZA 4KEZA 4EP8C 1UQYA 1UBPC 3F7JA 3W88A 3LMYA 4H3DA 1O12A 4HYVA 2CU0A 3GXFA 1WKDA 1PKMA 1OGSA 4R7JA 2PDBA 4RNFA 1NY1A 3L12A 3LBOA 3TQ0A 3CC1A 3K8LA 3UXKA 4NZ3A 3BG5A 4QX4A 1EKOA 3LMZA 2GSJA 3P62A 4NX0A 1JL8A 3O63A 2PODA 4MVAA 2DJLA 5BNKA 2A7RA 3HG5A 4DWSB 2UY2A 3TQVA 4XBKA 3P5YA 4QEHA 5AKQA 2WHLA 3IEBA 4P2VA 2BVTA 4F9DA 3M41A 5C9UA 3HB9A 1RK6A 3C3NA 3LD5A 1XC6A 4R53A 3KL3A 4HTYA 2WMIB 3VILA 3W83A 2ZXDA 5HPCA 1JUKA 1UASA 4XK2A 4JD4A 2P8BA 2PZNA 1X1ZA 5HPOA 2FFCA 1QJWA 3TC7A 1R85A 4IGHA 4P8WA 1V6WA 1JCJA 3MHFA 3PG9A 4P8XA 2VELA 4B3KA 1K8ZA 4Y8EA 4JTCA 3B0UX 4AZ7A 4H9TA 4D6FA 3TWBA 2PF8A 1XG4A 2D1ZA 3WQOA 3W02A 5CPOA 1UZDA 3ITOA 4IF2A 4AHQA 3FSUA 1EA0A 3W82A 3BW3A 3JU2A 2WWCA 1CENA 2FKPA 2J66A 3HFYA 1PSCA 4CNOA 4XAPA 5C9XA 1HKKA 3TMLA 1XDJA 3A4JA 3FW6A 4EVZA 1XSIA 4CD6A 2BY3A 5CG0A 1RZMA 4PRWA 4DBUA 1CLVA 1OD8A 2YBVA 4NYYA 2WB5A 3GHTA 3N1AA 1TMLA 4FF7A 4MB3A 1ZP4A 1JFHA 3FX4A 2J9YA 1ZJBA 1X7IA 2PD5A 4MSSA 5TD4A 2ATMA 1QDSA 5DELA 1SPQA 2IQ0A 3VA8A 1TJ0A 3B8TA 3RLVA 2EG6A 3DBPA 1E9IA 2IPWA 4H8UA 2AQVA 3HPZA 4Y2WA 3DDMA 3ZO9A 2VC5A 3TQPA 3NDZA 2VFDA 1Q8JA 1ZCOA 1V6VA 1G7VA 4MKNA 3M7WA 4YIWA 5LA1A 1YE4A 1V08A 1FWHC 3TLQA 2CXGA 1XIJA 4UQ9A 3KFTA 1TB3A 3MCNA 1FA2A 1X6LA 4YHEA 5FJJA 5HQLA 4NAFB 4D8AA 1UJQA 2RGMA 3F5LA 4HYWA 3G1AA 1VYRA 2AOSA 4XG1A 4V1XA 4J3TA 2BWGA 1ONEA 4GXPA 3KTCA 3NSXA 1EUAA 4GNVA 3WQCA 1BSIA 3E9AA 3NSNA 4TIMA 1VEOA 4DJFA 2VVNA 3KEHA 1L6GA 4GUHA 2PDWA 4HZ7A 5BWFA 3GG7A 8XIMA 1AL7A 2YSWA 3E2VA 3GM8A 1LBMA 2BLEA 4JYDA 3ZYZA 2P10A 1E73M 3LN3A 2JKEA 1TPUA 3AZRA 1V51A 3ZT5A 5BMXA 2YCKX 3N2TA 4ZB0A 4UNKA 4GIAA 3OVGA 4F8XA 1Q5MA 5I00A 4ERIA 1IEQA 4MJ2A 3N9SA 3C3UA 1RBOB 3GH5A 3MKCA 1S2UA 3ARRA 1IIGA 2I17A 1HGYA 1PS9A 1ITUA 2EPOA 3ZMRA 2HS6A 1B31A 1Z8AA 3IAPA 3SSJA 4PH6A 3UCCA 3KVLA 2FB3A 2O9TA 4MKSA 3N04A 1UP2A 5EFFA 2VO5A 1WB0A 3S5SA 3RR1A 3DC0A 2Z6JA 1W9XA 3FIGA 2PDCA 5FA5A 3UF9A 1E51A 2WJDA 1U5JA 4GGHA 3REQA 1JNEA 2OQLA 3GNRA 1RUSA 3NQ8A 4KERA 3WH6A 5AHEA 1LRNA 1F5ZA 4AIBA 3CB3A 3UVAA 4NY2A 2GOKA 1IEVA 1TX2A 1WA3A 3PUOA 1EOKA 1UBSA 2PLKA 3UGRA 1TO3A 3NQ2A 5DXYA 5M2FX 5H8MA 2NV2A 3WMCA 2VFEA 4XKYB 2ZA3A 1T8QA 4HJWA 3UG4A 3OBKA 1GYNA 1VZWA 1TV7A 2B7QA 3UWVA 2X1UA 1I6NA 2DVXA 2E09A 4Q4QA 2F6XA 3VDGA 4RXFA 3W1MA 1XHGA 1Q6EA 2HK0A 1NDVA 3AISA 2NLYA 1FDYA 3HG2A 2V2CA 2ISWA 2DH3A 3V5OA 4I9TA 1JDFA 1XC4A 4DLFA 3F4DA 3IJ8A 3ALFA 1UA7A 2TPSA 3ORWA 3NZGA 3GYCA 1LZOA 4E8CA 4KCWA 3DXIA 2E9MA 5TAOA 1FH9A 4DEFA 1GCYA 4WKAA 2NXHA 5DMMA 1JR1A 3B0VC 2QV5A 2GOUA 4HNVA 2GYIA 3TQKA 1EGZA 3M64A 2GJNA 2DZSA 1JD7A 1LOLA 1KRBC 1ADOA 2DIJA 3KL5A 4WOQA 4GZIA 3PG8A 1K8CA 1UUMA 4PMXA 3EPMA 2DVUA 3H54A 1ONWA 1SW0A 3CYVA 1XH2A 3P67A 1JQXA 1DTUA 3NG3A 1WYIA 4JIEA 4U31A 5F4SA 1WV2A 4DBWA 4OJYA 1CW2A 1MMFA 4US6A 4ZSUA 3L4UA 3PC0A 4I9AA 1TELA 1QCWA 1VLWA 3OODA 4JTFA 3RUBL 1UZ4A 1RH9A 1YDYA 3SRHA 3TW6A 4C5ZA 4LUSB 4H6KA 1YXCA 4A6GA 4XD3A 4PUMA 5JH1A 3KHJA 4LBSA 5FJUA 3HA1A 2QT3A 3QN3A 3LCHA 4H8NA 1VF8A 1KD0A 4NJHA 1SGJA 3BGAA 3RPTA 3AMLA 4IPLA 2BV9A 4A8LA 3HQOA 4ZQMA 1BG4A 4CCZA 1TV2A 3RU8X 3BXWA 4G1KA 1WDRA 5I02A 3R7MA 4QDPA 2V5CA 3WDPP 5CH9A 2HXUA 2VCBA 4K68A 1ZAJA 1UIOA 3W1LA 3B0YA 1OABA 4S2CA 1CTNA 4O1EA 1H51A 3MC5A 5E9AA 4CVUA 1QNPA 3QZAA 1R3QA 2WJFA 3VIPA 3LV5A 3TFXA 3P14A 3QZEA 5LZLA 4QGCA 1FWNA 5ENLA 3M07A 5FACA 1W5QA 2VL4A 1TVNA 3HQPA 3EWYA 3Q45A 3L67A 3CASA 3S4TA 3OO2A 4HA3A 2JKPA 2XSAA 1TREA 3KBVA 3C2FA 1EP3A 3GDKA 3WLNA 1RP9A 3GYEA 4LCQA 1JYNA 2OX4A 3N2CA 1O95A 4US5A 4KPLA 4OE7A 3WQ8A 3PULA 3GXNA 2CW6A 1K9EA 2VX4A 1NF0A 4MWAD 1R5YA 1X38A 1YIXA 4N9EA 5AECA 4HZ8A 3L2LA 4O52A 3KL0A 2X16A 4C6OA 1EC8A 1D8WA 2PEVA 4RW3A 3ABRA 1DJIA 3AIRA 5KMYA 1S2AA 1KBBA 2WZEA 2ZUVA 4A3YA 4OV4A 1H0IA 1DIOA 1O66A 2D0GA 4DZIA 1HNYA 5FSDC 4JZ5A 3SECA 2WV8A 3QSTA 3T6CA 4O14A 1ITXA 6TAAA 2HE5A 4MZYA 1R3TA 2TSYA 3W27A 3B8SA 1QOQA 2XVPA 3ALGA 2HCVA 3VOIA 2AQWA 2YDQA 2XGIA 3GNPA 1XYAA 3H4GA 1XIIA 5LA0A 2OEMA 1JXJA 1TKKA 3WUGA 3URBA 3VIOA 2GUYA 2MANA 1XBYA 3NZRA 6REQA 4Q4OA 5FKYA 3EOSA 6XIMA 1ECEA 1JF5A 4JTQA 2FTYA 3A23A 5C9RA 4ZO8A 4Z2GA 3P6LA 3THQA 4IT1A 1AG1O 1QNQA 2XUCA 3E0LA 4LANA 4CEUC 4WY0A 2DW7A 2H3DA 3AXKA 3NJ3A 1AQMA 4LW7A 3PZIA 1M1BA 4YS1A 2OX1A 3C2OA 2QCGA 4TVDA 3TJXA 3EA2A 1TYGA 1KFLA 1W3NA 4Y8FA 4IL2A 5CZJA 3S2CA 3KVKA 2QVHA 2E8YA 4PUNA 1ZFJA 2WZMA 4M8UA 4DJEC 1EJRC 4PRRA 4F0SA 5IXEA 3KRZA 5PTDA 2PLMA 1FXPA 3A12A 4LYRA 2H8ZA 4XSLA 2QDDA 2QJJA 3ZS4A 1FP8A 1QOXA 3NO5A 2OJPA 4NUWA 3UA3A 3SEPA 3QM3A 4IIEA 1OFPA 3G77A 5TQLA 4LSBA 3E96A 3IUDA 5HUOA 4GUGA 2D73A 4IQDA 4O0QA 5BOFA 4PCPA 1XSKA 1FWJC 2HE8A 3LHYA 2Z7GA 3OIXA 5EMJA 3TH6A 2ZX7A 2A85A 4YTRA 3AHTA 3WFZA 2JE8A 9CGTA 2J7FA 2J47A 4LALA 5G4HC 2W92A 1YXDA 3GHUA 2PWDA 3L5MA 3ITGA 4C6KA 1J18A 1GQJA 5KINA 3CNYA 3QPYA 1JF6A 1KGXA 1Q6FA 1ISXA 2FB2A 3UY7A 1GJWA 3W7HA 1IXQA 3I4EA 4YVPA 3WD2A 3RK8A 3MTWA 3ABXA 1KKOA 3NYZA 3NXLA 1TPB1 8TIMA 1KWKA 4X2PA 2VRKA 1FKWA 1QW9A 4KT2A 1U2YA 4S39A 3I3DA 3BG9A 1JVNA 3WELA 3Q37A 4FMVA 3B3DA 5D9MA 3U2CA 3ZWSA 3M0LA 3UGVA 2FH8A 3TSDA 2GGEA 5C55A 2QDGA 3BC9A 2PUZA 2DJXA 1E4LA 1EX1A 3ZR4A 7TAAA 3K1DA 1I2PA 3TXVA 1FQ0A 3P61A 4Z2LA 2CETA 3PNZA 3G2GA 2PRLA 1IWAA 4BHYA 1JPHA 4UTLA 4NU7A 5HWNA 4FSAA 1GUVA 4UOQA 5DXXA 4DB7A 1UG6A 1VPYA 1WZKA 3UZ5A 5A2CA 2EKCA 4JFVA 3GLCA 3DFOA 2PRHA 4XTDA 4IG2A 3AXIA 4UTIA 1FBAA 1XP3A 1BXNA 1UKPA 2QDHA 2NUWA 4Z08A 6CGTA 4I9MA 1F3EA 1EQPA 3K4AA 5DCEA 4ASTA 4RL3A 3S2JA 1NDYA 1K1DA 1I2NA 3G1XA 5CQ1A 2BXZA 1MW1A 4WXYA 4L9XA 2E1DA 3QYQA 1NOUA 4L4PA 3CO4A 2XG9A 3DFTA 4I5RA 2ZZ4A 3W6MA 4J3WA 1TWSA 1UPPA 1V3JA 1BYDA 1BKHA 2BHZA 2DGAA 3MHUA 1JZ4A 2HNEA 3PTQA 3W37A 4W93A 3H24A 3NGJA 4K8EA 3WH7A 3L0GA 4FNUA 2FVKA 3DUGA 4L65A 3PPGA 4GUIA 1K3UA 3IJIA 1AH3A 2H6RA 3CMGA 3N19B 3TAOA 1S46A 2WOQA 3LXCA 1DOSA 2YL8A 4QHRA 4ADUA 3WF2A 4R27A 1LTDA 3SW6A 2QUUA 2W27A 3CIXA 1XH1A 1EJXC 4Q6JA 2VDGA 5D30A 2D69A 3MZ2A 5AVHA 1QHOA 3NZPA 4YVXA 1JZ6A 3NPXA 1KKRA 4AYSA 4CNPA 4D6HA 1EJSC 3IJQA 3MUZ1 3OOQA 1YNPA 3FSTA 2V5LA 3B04A 3GRIA 2AL1A 3LLXA 1DJGA 5CC7A 3MVIA 1Q13A 2XZ9A 2WYSA 2ZC8A 3GG0A 2BB0A 1AVAA 1B30A 2WM0A 3K30A 1EL3A 3MQTA 1KA9F 3I4KA 2PDHA 4FXFA 1E6NA 5HJXA 1QT1A 3HGOA 4RR4A 1B57A 3MUAA 4FX6M 2YDAA 4LBRA 1XPYA 1TIWA 1XKYA 4JYEA 2PZ0A 3HZ3A 4S3EA 3VDHA 1PJ9A 4LUSA 5F2IA 3VI2A 3F1QA 1E4MM 3UR8A 1FWWA 4CQ9A 4BI6A 5CPQA 5B7YA 5A6SA 5FJOA 1XGEA 1EDGA 2ZUUA 2YFNA 1UUQA 3C86A 3WNKA 1UOKA 1FCBA 5HWMA 4IFRA 3W84A 3RG6A 5KZMA 3S1WA 2HVNA 4KH2A 1PIIA 4UTWC 4PRTA 1US0A 4XZ9A 1DYSA 5IBXC 1ZS2A 5J5RA 4S2BA 4JICA 2DQXA 4R3UA 5DMLA 3VX0A 2JFEX 3EDFA 4IOTA 4K37A 2Y7EA 3T0AA 2PDKA 2XH7A 4GCAA 1L6FA 2P3EA 2Y63A 4M81A 1EWEA 3BL3A 1BWVA 3K5XA 6A3HA 2GVJA 2PC8A 4MHBA 3G1DA 1KM0A 1W17A 2DPEA 1JPKA 1XIEA 3O6DA 4ZB5A 1L8PA 3DBNA 4KESA 2VC6A 2HNHA 4ERAA 2E9LA 5I78A 1WXJA 1OM0A 3PB2A 3VIJA 1A5AA 1DIEA 5CKSA 4O15A 1BRLB 3FV9A 3P8IA 3V7PA 3WMSA 4CLMA 1YRRA 3W85A 3GIPA 3NQEA 3VCCA 1H1NA 2J75A 2WWDA 4XZHA 5CC3A 3RU6A 5DEZA 3A9IA 3RHGA 2A3CA 3W86A 4HP5A 2EG8A 1Q7QA 3B9EA 3KCOA 3POCA 4O17A 1AUSL 4UR7A 4H7VA 2VZOA 2VUNA 1J10A 1WOAA 1OY0A 2PDUA 5A2AA 2A4AA 4UQBA 2R82A 1OIFA 4ORIA 3QTGA 1MNZA 4E38A 7PTDA 1GT8A 2NVCA 1R9YA 3MP3A 2TRSA 1T41A 1WQ5A 4J5NA 1F6KA 1EJ7L 3QGVA 3DAQA 2BODX 2PU1A 3WNMA 3SUWA 5CBIA 2PD9A 3QGKC 1T7LA 1UD2A 4BEUA 1A0CA 1D7KA 3F5JA 3DFYA 3O15A 2BZNA 1XBZA 4DUXA 3FA3A 4TX8A 4B2DA 3HPFA 3TJIA 5BRQA 5F2MA 2TODA 2RDWA 2CZDA 4H19A 3TROA 4MOZA 1NM9A 1DJYA 1XSJA 4BS0A 2V5BA 3VK5A 3WK1A 4RZBA 5HK4A 4BZYA 1OF6A 3U2EA 2XYLA 3UPBA 5CLTA 3FN9A 5TIMA 3WUBA 1AW2A 3NWRA 3AMCA 1ZRQA 1BYBA 2POTA 3TTEA 1LL6A 1FCVA 9RUBA 3QV9A 4MTVA 4INFA 1MDRA 1KCZA 1X1NA 2EO7A 1OD0A 2AKMA 3VNZA 4ALDA 1GVQA 3AYVA 1GJUA 4F2UA 4CU6A 3NURA 1P7TA 2V3EA 2ZWZA 3ARSA 1E1CA 1WXZA 3UJRA 3LCFA 1GVIA 1EYEA 3BICA 4FZIA 4XV0A 2YIHA 3PZNA 1HGWA 3UG5A 2BGQA 1H3GA 3SRDA 3H6OA 1E3ZA 4EANA 1DP0A 1B3ZA 4IMCA 4GIEA 2ZXQA 4MNMA 4RPPA 1O6IA 5BXPA 4DPQA 1A5MC 4V1YA 3E1F1 1CDGA 1UR4A 1GVYA 1MO0A 4KS0A 3CBWA 1CNVA 1UKTA 4XIMA 5F4WA 3QYSA 2E67A 1I75A 2YXXA 1JNDA 3NO3A 4NF7A 2GGHA 3M5VA 1JCNA 4M0XA 3SAZA 2R14A 3EWCA 3NVDA 1F6PA 4WKFA 4IIGA 4UMBA 3GZAA 1LT7A 2EJAA 3QSRA 1THFD 3SUUA 2A21A 1F73A 4ILSA 4IP7A 2CWXA 3ITVA 1QR7A 1UKSA 2A3HA 5GQBA 4ZO6A 3SCUA 3SN0A 3W7JA 1H7WA 1F3WA 4XVEA 4CNNA 5A6KA 5ABGA 1V0LA 4GQQA 2OZ0A 3VNIA 2V0TA 2GDQA 3A22A 4J3SA 4MWAB 3T2PA 4IL0A 4EWJA 3H7UA 4AG0A 1PYMA 4PMZA 5BRBA 4GZJA 1QBAA 4WDUA 1ZENA 3KRSA 4WGHA 5BZAA 4ICCX 1KV5A 1TA3B 1EOMA 2ZC1A 2VUYA 1UWIA 4RE2A 4HBKA 4QISA 3M0KA 3TMQA 3N2MA 4I6VA 2IKJA 1XWYA 3WLOA 4JIQA 4WSHA 1GORA 1YBQA 3LGGA 4NYUA 4FLSA 3O0KA 4BQ4A 4L56A 1T40A 3GUWA 1RP8A 1CGWA 2J7DA 3N15A 3N18A 1B54A 2PTYA 4A3HA 3W74A 3NL6A 1TMQA 4H9XA 4RX0A 2J13A 5CLWA 2ZADA 4AU0A 3PK7A 2C1GA 1ODUA 2ISSA 5IFPA 5LNVA 3VNMA 5EA9A 3U3HA 4TQTA 1IF2A 2PP3A 5DMYA 2PS2A 3T0TA 1YXYA 2H90A 4F0KA 1VFHA 3HMCA 1S1PA 1UCWA 1IGSA 3E0FA 2HK1A 3MDUA 2ON3A 4DM2A 4JKKA 2CPUA 2SFPA 1DWFM 5KZEA 4JQAA 1EC7A 3HMJG 1RY0A 4QS5A 3NR0A 4HU8A 1SSGA 1XLDA 3ARWA 4Y9PA 1NQ6A 1BTMA 1Q7MA 3KWXA 1OADA 4YTQA 1NOWA 4MFDA 1VFUA 3U48A 1DPMA 3LV6A 3U0HA 3ZJ8A 4ECLA 1JZ3A 4ICMA 2PDXA 3UP8A 1D3GA 3F4NA 3E12A 4PL1A 3W9ZA 3HF3A 3PUDA 5M3WA 5FJPA 1E6ZA 4GQBA 2G96A 3DG6A 3JW7A 1HX0A 1OC6A 2A7NA 4AX7A 2XDFA 1OK4A 2F61A 4JX6A 4QM1A 2HBXA 3S5NA 3A3WA 1NOFA 4IGNA 1NP0A 1AFSA 1HP4A 2JGYA 4GQGA 3MU7A 4Y7EA 5D2VA 2GDVA 3QMSA 1WUFA 1FDJA 5EKYA 4KEMA 4I6KA 4F66A 1UW9A 3FGCA 3N2BA 3NQDA 3UT0A 1VEPA 1DWJM 2WBKA 2ZXAA 4DZHA 2ZZ3A 1W8GA 3DH7A 1ZBWA 3LHWA 4WY0B 4ROQA 4K3ZA 5FJRA 4W84A 3BOXA 1ZBKA 1UIPA 3G1HA 4FX8A 2Q09A 1YKWA 1PYFA 4UZUA 3SO7A 2QCFA 3LI1A 4PGLA 1XYFA 3NQ7A 3RNDA 2PMQA 3CWNA 4F40A 1KTNA 3URNA 4AY8A 2I57A 2ZRVA 1TCDA 1Z6KA 1V6TA 1ZALA 2ZQ0A 1OSEA 4RZ5A 3QV7A 4B3ZA 2GJRA 1E9YB 3SM0A 1VPQA 4G2DA 1BF2A 1XCXA 2VD9A 3WBEA 4OECA 4Q4RA 4LVBA 3NO1A 2OO0A 1PB0A 4DBDA 1OQFA 2Y6ZA 2E6DA 3CIVA 4AZCB 3P81A 5LNUA 1U33A 3HJZA 3PBUA 2BNJA 3AIQA 3CUXA 4ML4A 3STCA 4B5XA 2INZA 2ZX5A 3GXIA 4XUYA 3LOTA 4EX4A 1UWUA 3L9CA 4Z0SA 1JYWA 1KM2A 1KXTA 4CUCA 1OFEA 3LCXA 1G94A 4DUVA 1OYAA 1KBKA 1AZ2A 1BRLA 2J25A 3EWUA 3CMJA 1QFEA 1HO1A 3EOLA 5HQEA 2VWSA 3SY5A 1W37A 2P3ZA 1IR1A 5G2WA 3T9PA 2QHAA 4Z1CA 4WCJA 2VX6A 3CUHA 3UYIA 3WQFA 4MKVA 3T8QA 3W07A 4HHLA 2BVWA 3R1ZA 4QDMA 3OZOA 1B4KA 4YJ5A 1L2UA 3FS2A 3LDVA 5IHSA 1NDZA 1F3TA 4WSKA 5CSSA 3EDDA 2AMXA 1H1ZA 5FF4A 3GXDA 2GK1A 1BD0A 3GTIA 3AS3A 2F2HA 4YMZA 1S2TA 2G37A 4YU1A 1Q6OA 3UBPC 2GJPA 5D37A 1J6PA 5FI8A 3BLIA 3TZNA 3T40A 1Q6GA 5TNVA 4ERGA 3BUVA 3W7CA 1VPXA 4K7VA 3T1GA 2Q3OA 3W7OA 4Z42C 2FPTA 2GSEA 4S3AA 1ME9A 1XLHA 1X97A 4X2RA 2VWTA 2WSYA 1J79A 1TE1A 3UPWA 4WXZA 3B8WA 3N6JA 2VEGA 5B80A 1DXEA 1FWRA 2I9EA 2NXIA 2D23A 4LNYA 4QJ4B 2BXVA 2B31A 4LCRA 1XX1A 3L0KA 3DGBA 3FDGA 3SGUA 4MLRA 3JUGA 1R9XA 4NP7A 2F84A 5I3KA 1TQJA 2VMFA 5I24A 5I06A 4N02A 1R30A 1BXCA 3CU2A 1R7AA 2PDIA 4S3JA 2PDFA 1QI0A 2C14A 1B1YA 1RHCA 2YCJA 3MJYA 4CN6A 1Y7VA 3WLMA 4IMAA 4EXBA 3NQVA 4A4AA 3WNNA 3BG3A 4YL2A 3W28A 3VUPA 3UU0A 5GNYA 5FF0A 2PTXA 2WNQA 1YEYA 2GQ9A 3V0SA 4GWEA 5CZTA 1FWIC 1KB3A 1BPLB 1OYCA 3VAVA 4C6FA 1S38A 1MRQA 1Z42A 4HU3A 4FNTA 1GOXA 5FD0A 5HMFA 3M1ZA 1DBTA 4PTXA 2PF0A 2F2KA 3SQLA 3NM3A 1XLAA 3SIZA 1R7OA 3CV1A 3ZLGA 4BQ5A 4MJ4A 2O0TA 3C4UA 1DIKA 3LLDA 4UXDA 3WFLA 4MF4A 2QJGA 3GHSA 4W9TA 1KBLA 3IACA 1V03A 4AHOA 4X60A 2V82A 1HW6A 2G3NA 3LNPA 1G4TA 1FWGC 2NWSA 3MCMA 3ARUA 2QDEA 4ZB2A 4JQ2A 3M44A 3GVWA 2VZVA 4JFWA 2WSRA 4PZVA 4I5UA 2VX7A 4V2XA 1FX6A 2PE4A 5FL0A 3IGHX 4G8TA 2DORA 3SGZA 3VD9A 1XRSA 3LQLA 4PMQA 4XZBA 3UEQA 2IS7A 1DJHA 4ZOEA 5T8GA 4DXKA 2OOFA 2P50A 1HL2A 1SZFA 2PTZA 4DY1A 7A3HA 3B9AA 2E25A 3B9NA 4PMJA 4MFEA 3VDAA 6ENLA 3MBDA 3V0TA 5CJ5A 2WZTA 4NIRA 4Z17A 4OVXA 4CU7A 2YW4A 3A21A 1WDQA 5BROA 3KZSA 1OVDA 1ZJHA 3WDRA 1F61A 2B0MA 4I8DA 3KWSA 1KFBA 4IISA 4GY0A 1TJRA 2D0FA 4N6EA 2PPGA 4BEQA 3U7VA 4HVXA 2R1LA 4UNLA 3W81A 3R0UA 4Q7NA 3BLOA 2J78A 2X40A 2YLLA 4OGZA 4J3VA 1MZHA 4NL1A 2BS9A 2Z24A 4JTIA 3UWQA 4TX6A 3WQWA 2BGSA 2QGHA 1VHCA 2PSNA 3TN4A 4MZ8A 3GTHA 4L6HA 4F4RA 1ONXA 4AIUA 3GQYA 2PDNA 5DY3A 3E0IA 3E74A 2ABAA 4F0HA 5AB3A 2OTDA 1H7NA 1OGBA 1DE6A 1FFQA 3GXPA 1ELSA 3GSMA 2V6AA 4HCDA 1LLWA 2QJHA 3TK7A 1WKFA 3MWAA 2X7VA 2OQHA 3CV2A 2G95A 4IQJA 4MWAE 2QAPA 5AC6A 1VAHA 2Y4SA 2IXUA 3GU9A 1HKMA 3H70A 1JGIA 1FY6A 5HJLA 4C1KA 5A69A 1QHZA 3W76A 2O55A 4AD3A 3ARPA 2CLKA 3IUHA 4HQVA 4X63A 3CH9A 2VYOA 1FHUA 4D6EA 5CBJA 1H62A 5ECVA 1NTHA 4JIPA 5XINA 2DUZA 3QY6A 1A3XA 4BF7A 1LRQA 2QIIA 3L2IA 3B8VA 1P5BA 3LCIA 3OHMB 1UYQA 1HJQA 3C0QA 5IDZA 4KW2A 3QEZA 4IPJA 4AY1A 3CPRA 4C6BA 4DF0A 3IVUA 4U2YA 4JTUA 3KW3A 4J1OA 2AMGA 4WR3A 2FZMA 4J2MA 2J9ZA 5K2ZA 3EB3A 4XTIA 2C8NA 4IPNB 5FEWA 4O0ZA 1T99A 2E28A 1RXOB 1TTQA 2H3BA 1GNXA 1UP3A 4M6PA 2RGLA 4GKLA 3UZZA 1Q63A 4JX4A 3N34A 1HJWA 4C90A 3EXRA 2UY4A 1ITQA 1XIDA 3MW7A 2XM2A 5LIKX 5I3FA 4U2ZA 5BU9A 1ZZMA 3D6NA 1IE7C 3WMLA 3RCMA 1QPNA 4LS0A 1ZCCA 3MSRA 1E71M 3TN5A 4IJCA 4KEUA 1OZQA 3W1XA 2R6OA 1Q2RA 5KITA 2DT3A 3ID7A 4AD1A 1W9DM 5FIPA 3VC5A 3JS3A 4WJXA 4EIVA 2NLIA 1P1XA 1AZ1A 1H7RA 2QVNA 5DF0A 1HL9A 2O9PA 4B5VA 3K4WA 3ZVIA 2VQTA 2AGKA 2NUYA 3QJAA 3IK2A 3UG8A 1TZ9A 3I6EA 3C56A 5LSMA 3PBVA 4TOQA 2R24A 2PAJA 1IZJA 3HU7A 1WCGA 4F79A 4GO9A 3AS2A 3W38A 1VFFA 5D2TA 4BQ3A 4UNIA 4JYFA 4R9XA 5CGTA 1WDDA 1GTHA 3KDOA 4LV4A 4AEOA 4CNUA 1K4HA 1IV8A 1Q3NA 1S3TC 1EA9C 3L4VA 2J62A 3HGRA 4XIAA 1W56A 4A8RA 4A2RA 2OELA 2V5DA 2B7NA 4CCCA 4DO4A 2QUVA 3UW6A 2C71A 2J7GA 3VKAA 1M6JA 4LF2A 4FF5A 3AUOA 4HMCA 4E2DA 5MKGB 4EAMA 4DJDC 4GHRA 3VIMA 3DC8A 5A6TC 2HJPA 4NJGA 1YDNA 1A3WA 2QAFA 3TJ4A 2R91A 4M80A 1W8SA 2CBJA 2PLJA 3CAKA 2Q02A 4GI4A 4GQ0A 1Z7AA 3CV6A 3QKEA 1WXYA 2REQB 5D02A 3LK6A 3QMRA 1VKFA 3WLQA 2JKAA 1QK0A 2BY1A 4GQRA 3O8AA 2G0WA 2C79A 4KIRA 2RJHA 2NQJA 5J8LA 1PDZA 2OR2A 2IW0A 3TUUA 4JEQA 4C1LA 4MNLA 4NI8A 1BWLA 5G2IA 4D6DA 1OC5A 1E55A 1UR0A 2Z28A 4NJJA 3L68A 2JQXA 3C0SA 4FEZA 2VEPA 3CHCA 1TPC1 1NFBA 1JAEA 4RE0A 1SYTA 1GYMA 4MG4A 4WOZA 1ICPA 5GNZA 3W7RA 3S42A 2O9OA 2W6RA 2CZFA 4GPNA 1RCQA 1X98A 1W6TA 1D7FA 2FH6A 2INEA 3OGVA 4IIHA 1OX6A 2OCZA 3A24A 1E3XA 1KV8A 1R3WA 1POJA 3PJWA 3CHVA 3LBMA 3LGDA 3MT1A 4KFPA 3PWGA 5D32A 1BGGA 4OBTA 1CEOA 1P7TB 1JRBA 3S5ZA 3CAQA 3AO0A 5C7VA 3FOKA 3B8IA 2GVLA 4ZQPA 3CK5A 4KCTA 1QATA 1MSSA 5HWJA 3MO7A 3GB6A 1FWEC 2P1FA 4UWMA 5EB8A 1T6MA 2PDGA 4KGJA 2PDPA 4Z0JA 4BI7A 1IIHA 2WM1A 4GFIA 2R94A 3E38A 1C8XA 2XFRA 1BHGA 2PBOA 4HOXA 4WRHA 4YLWA 4MMWA 5IHRA 2BGNE 3B4YA 3GO2A 3M4HA 3WH5A 1LWHA 3KVMA 3H8AA 1VIWA 3FYPA 1XW8A 5I09A 4GJIA 2FHCA 4GVFA 5CPNA 4W5UA 4WVXA 3JVAA 3G0SA 4LY8A 2A3BA 3TTYA 1JFXA 1T5AA 3AHZA 3QPEA 4NNBA 4PMNA 2DZVA 4LB4A 3IUIA 1J4EA 3UJSA 3AMGA 3MA8A 3VCRA 2ISVA 3WJYA 3PPFA 1XYMA 5CC5A 3GU1A 4IFKB 4R7OA 5AZ1A 3NL2A 3R4IA 2ZTKA 3B06A 3FNDA 3BLPX 2XISA 1OT1A 4RCXA 1J0KA 3V16A 1EP1A 3CV7A 1NSJA 2ZVIA 1RA5A 2GJXA 4PB4A 3T08A 4AEFA 4S3CA 3WDQA 2FHBA 3LTSA 4UCFA 1CWYA 3STPA 2OQYA 4P7QA 3CM4A 2Z2AA 4OWGA 3ZT6A 1DXFA 4AZ5A 2O4MA 1DV7A 5AC5A 1MXDA 3UWEA 1R87A 1EJWC 3TXZA 4EKJA 3ARZA 1GOIA 4WKHA 1VENA 2XIIA 3WMBA 1OCBA 4GVIA 3UJEA 1WKYA 2KAUC 4Q7BA 1K70A 1DJXA 1OFQA 1V3KA 5AFDA 4M6VA 1S2VA 2DZWA 4GC4A 2VP8A 5IOBA 5BU6A 3CXOA 3LHTA 1NDWA 3LPFA 4EF8A 1G4SA 2W3ZA 4B9YA 1JCTA 1NJJA 1XG3A 3A4XA 5RUBA 1US3A 3WQVA 2VQUA 1Z9AA 3GFZA 3OBAA 3GX9A 5E9XA 1LBLA 3U9IA 5LGXA 4HNLA 4XBSA 3NGFA 2G3JA 3V5CA 2OGJA 4OOUA 3TYEA 1JPIA 1JCLA 1XUZA 3JRKA 4ZFMA 3QLDA 3WBYA 3G6LA 1XFBA 3RMJA 1W9PA 2Z25A 4JQ3A 2PB1A 3EWZA 3AHVA 3KOWA 3BSHA 3S83A 5EMUA 3DG7A 2Y0FA 4GUJA 2X41A 1NU5A 1IHIA 1UB3A 2V9DA 4MB4A 4C7FA 1ZBCA 3IVSA 1C29A 4ZQRA 1W1VA 1M68A 4GINA 4DWSA 4W8LA 1Q66A 1CCWB 4OHQA 2X05A 2YBUA 4R5EA 3B40A 1VD6A 4QP0A 3IIOA 1E15A 5HMEA 3VKJA 3DEQA 3GC5A 4ROPA 1PZ3A 1IXOA 1E4IA 5D9PA 1UMYA 1FWBC 1TRIA 4AD4A 1TJ2A 2Q8ZA 1J2WA 5CGMA 3UWUA 4LUTA 3S6DA 3YPIA 3S1XA 3C6CA 2XJ7A 4TMBA 3F2CA 3EA1A 3G18A 3E6EA 1UH4A 2Y8VA 1R47A 4MAZA 5GVJA 4F0LA 3BAIA 1QUMA 1QPQA 2WMGA 1UD5A 5D4YA 1YDOA 3AIWA 1H63A 2RFGA 3GXMA 1Y5XA 4XO6A 1BVZA 4E3VA 2DUAA 3BW2A 3LPOA 4DVOA 1ZTVA 3T09A 1R8LA 4LC8A 1E0VA 3H12A 3CHFA 3BTNA 2CBUA 3H7RA 2QPUA 2FHFA 3RMEA 3XINA 4W7UA 1FHDA 3W7PA 4EXQA 3IIPA 4C6EA 2BDQA 3OG2A 2FQIA 6TIMA 4QSHA 2VGIA 1ZL1A 4LWWA 3W7LA 4ZOBA 3ITTA 3WLRA 3VGHA 2ACSA 5SWUA 4XZMX 1A5OC 3SN1A 1R3YA 1TWZA 3WIJA 5A8NA 4F48A 3H2MA 2CLHA 2GVEA 5REQA 5FCZA 2GL5A 5FEPA 2HXTA 4YHGA 1OGGA 3NZQA 1EX5A 3P2VA 3GFYA 4KMQA 1AJZA 3VFCA 3BLKA 4MUPA 3DYMA 4X9YA 4NNAA 4UTUA 3R5EA 2D20A 3ATYA 4J7RA 3PANA 5E6YA 5L9FA 4HHHA 4LCSA 4Z1YA 1TCMA 1O60A 2B7PA 1I2OA 1H11A 3C61A 4RDZA 4GNKB 3RR4A 3WK3A 2ODOA 2ISDA 1GVOA 8A3HA 4NAFA 2QJNA 3CQJA 2XHYA 3SJNA 2TYSA 1XM3A 2ZZ6A 4H6EA 3AYTA 4HZMA 4FPSA 3M5XA 4LVDA 3BSMA 3A3HA 4DJED 3R2GA 3T07A 2HVOA 4O53A 5CPLA 3ARQA 1QO5A 4Q8VA 3TYZA 2HTMA 3LXBA 3TE9A 5C8BB 5JQ9A 1LG2A 4WK9A 4JTJA 5D2YA 3OU8A 2NW0A 4HSOA 5AYBA 2C3ZA 3GC4A 2YL5A 2ZUTA 1ISYA 2ZKMX 3BCFA 5HNNA 3AU2A 3LXAA 1R6WA 4GYKA 4N42A 4JN8A 2VC9A 3A5VA 3TOYA 2OWWA 1XFCA 1UUOA 3WX7A 1E1EA 3NPWA 2PWVA 2ZX9A 2ESCA 4PSRA 1O5RA 2E5DA 3LSBA 4E8GA 2XIJA 1O4UA 1V6XA 5C9WA 1QXLA 2VFHA 4MLJA 1HKIA 4MYXA 1P0DA 2QPXA 3E0WA 3I65A 4B5UA 1AODA 2VDHA 2YA2A 3SUVA 1ZBVA 3BJFA 1L6WA 1WBJA 4IGMA 1W31A 1TPVA 2ZDRA 3HQ1A 3NM1A 2DEPA 2VJXA 4ZA0A 3BZJA 2CHRA 4MNJA 3S3GA 3RJXA 5T9CE 3POHA 3ARTA 5AHIA 2VM8A 5ABFA 3BH4A 4CQDA 4JFUA 1TFVA 4PB5A 1DWHM 4XZIA 3IAQA 1H09A 1DQXA 3W1PA 3EX3A 4GX9A 4FHAA 1K6AA 2WLYA 2VCAA 1UZHA 3B05A 4JQ4A 4XX6A 3PSVA 2PC4A 3TDFA 5AZ0A 3W0KA 3M0ZA 3N4AA 1S5NA 3GU2A 3TIMA 4MY8A 2BASA 1QI5A 1M7PA 3R8GA 1C9DA 3KOFA 2O9RA 4QCFA 4AQLA 4UOZA 3S6TA 3W7GA 2QLYA 3A13A 3PZVA 3PZTA 5IFTA 3HV9A 3PZQA 3H2AA 5LIXX 1AMYA 1FKXA 4N4QA 3WLJA 4NG3A 2PWGA 4M5PA 4HMEA 1CGUA 1KNWA 2Y5JA 1O1ZA 4Y90A 4O1AA 2A6LA 3MSYA 4O1BA 3EMQA 1ZP3A 4OT7A 3T05A 4U3CA 4F0RA 3W7QA 4N0RA 2ZUWA 1R2SA 4YPJA 1TWDA 1BVNP 2FMNA 1NFGA 5BXSA 1ECQA 3TNOA 3B9OA 3KP1A 4C60A 3BURA 5CJNA 2EPNA 3AYRA 2VOTA 1FOBA 2QPSA 3L66A 4J9JA 5HNTA 4QG9A 2D3LA 1EZ2A 3PM6A 4AIOA 5F1VA 2BVDA 1P0KA 1XIGA 1R86A 3P93A 4GISA 1B9ZA 4NSBA 1B0IA 3H55A 5KETA 1L6SA 1A5CA 1MEWA 3CTLA 2WSPA 5JU6A 4AW7A 1J8VA 3GXTA 4WDTA 1TR9A 1TPH1 2YR1A 3T7VA 4W4QA 1VBGA 2DH2A 4XZWA 4JKLA 4BWLA 4C6MA 3AZSA 2YKKA 3W70A 1YYAA 3SR7A 1Y65A 3WJSA 3I7QA 3C2EA 1C91A 3DECA 1EIBA 2XVGA 3HURA 1IEWA 2AL2A 2DVTA 5K9DA 1YPFA 2HV5A 5HUPA 2KX9A 1F6YA 3VNJA 2OT1A 3PZ9A 4US5D 3EKLA 3QY7A 2Z6IA 4G5DA 2D3NA 3BSGA 3P8JA 4XZLX 3M6YA 5EMLA 4AZHA 4ATDA 4DQWA 4FO4A 1EJVC 2QMJA 3NIYA 3W26A 1MW3A 4IUOA 5AYZA 2QYGA 1FP9A 4GKTA 3BAYA 3BMVA 4QE1A 3GIQA 2YX0A 3UWZA 1XQKA 3B4UA 3CQKA 3OVRA 3H2EA 3H21A 2WNZA 3ANUA 3O3RA 2ZTJA 2WCAA 2D2HA 2WKLA 1E9ZB 1QASA 2X0HA 1GVSA 3FAXA 3VMPA 4BQ2A 3B0PA 4ZQNA 4LYKA 3S1VA 3TN3A 1CXFA 4Y9MA 3C8FA 3RJYA 4GXMA 3FKRA 2CLLA 4O19A 4HHPA 3S9YA 4UTTA 1LLZA 4TVUA 4DUWA 3BWWA 1MRAA 1PE1A 1SQ7A 1JXKA 3G22A 4H7CA 3NQAA 2ADAA 4W87A 4LYPA 4EPDC 5AN7A 4LAZA 1WZAA 4DXVA 3K1GA 2I14A 3C2RA 2X2GA 4YVVA 1IYXA 4LAUA 3F03K 1PVNA 2EPKX 1FHVA 4IIDA 2P0IA 1R3SA 1EPVA 4C5YA 1P0NA 4JTDA 2XH0A 2FZ8A 3EKZA 3N12A 3FVDA 2NUXA 2DZXA 2QEZA 1H4PA 4KGLA 3K4DA 2VFGA 5FL1A 2REQA 3TCEA 3UXAA 3AAMA 4KQNA 1C8YA 4K38A 3PJXA 3CUFA 3F2DA 3HJEA 2X0YA 2J27A 4U3AA 4PTVA 4MPQA 3G1YA 2VRQA 1M9HA 3SCVA 5CZKA 1ICQA 3GNOA 3O9NA 2ZA2A 1IT7A 4N9DA 4UFLA 1XLIA 1U22A 3L65A 1OCNA 2OFJA 3KTSA 3ARXA 2XVKA 1JCYA 3QR3A 1DWAM 3SFKA 1OEPA 3ZR5A 2PWEA 3ITLA 4H4IA 4ACZA 1LQAA 1W0MA 3HOJA 5BOOA 1FUYA 2DU2A 4JCMA 6ALDA 2VGBA 1WUEA 4OBRA 1VJSA 3L4WA 5BXTA 4QROA 5H6HA 4O1DA 3B8DA 5DY2A 1S1RA 5CXPA 2Q71A 1OINA 1R3VA 1XLFA 4IICA 1AJ2A 3CIWA 1QWKA 3PTMA 4JHMA 4QNEA 5LXEA 3RX3A 3CO8A 1ONRA 1TV4A 2W66A 2IKHA 1KXVA 1J01A 3LTPA 4PMUA 2J8TA 1G1YA 2A79A 4AFYA 1MQRA 2YCEA 1LBFA 2J9XA 1HKVA 3BGJA 3VOHA 1XDMA 1UR3M 4Q8MA 4PA8A 4HSHA 2WVVA 3EYPA 2PRMA 1M53A 3ISIX 1ADSA 2WC4A 3RCYA 3W2NA 4XAGA 3VNYA 2PGWA 1Q65A 4NZ5A 4B3LA 1EIXA 1SO4A 2EKGA 3MYOA 2Q8XA 2ZZ5A 3QFEA 1GQKA 4OOZA 3TZFA 4KWVA 1JGMA 2C19A 4ADSA 4AC7C 2R8WA 4PMOA 3U57A 3PUEA 2ZRZA 1UJPA 3W3OA 3XISA 1Q7ZA 4UTJA 2WSQA 1AA1B 2PI6A 9XIAA 1OJXA 1C9WA 3OYXA 1NQKA 3GAYA 4J40A 3MMTA 1IWBA 2CWNA 3QR0A 3AIEA 3NAVA 2R9RA 3PP7A 1LF1A 3CT7A 3TTOA 3I7SA 2DIKA 3OZPA 4ZQCA 3KM8A 2Z2BA 4JNZA 4LGXA 1VFTA 2VR4A 3WQ5A 3V1PA 1E70M 4M19A 3E2SA 4TMCA 1AMKA 1TZ7A 1LOSA 3COTA 3PWAA 2GGIA 2GQ3A 1EHAA 1Z32X 4FLOA 5DCBA 3VMNA 1XISA 4AXKA 1QW7A 4HPJA 1R3RA 3WG6A 2FJKA 4P7NA 2Q01A 4YYCA 4HA1A 4E6MA 3M5ZA 3PUGA 3U4FA 3UJ2A 4AH7A 3C8NA 1TV8A 2WBGA 1DJQA 1D3HA 4LOCA 2NQ5A 1ZLPA 3W1TA 2WMHA 2GDUA 2QCMA 2X1IA 1JPMA 4WUIA 3RLUA 4IIFA 5DQPA 3EWWA 1HJVA 1TUFA 3MKVA 2EHHA 4GMEA 4OU1A 3LRMA 1XRVA 3V75A 3ZZ1A 3BDKA 2WNNA 3B97A 1MQPA 3G0UA 1LUCB 3TEVA 3SCRA 2V67A 4FR6A 1RLCL 2YOCA 4M1RA 3GKFA 4XAYA 2G5WA 1TPFA 4WEVX 3FCPA 2A3LA 3BK0A 3IIVA 3P74A 1VBHA 3GWQA 3NL3A 4H1ZA 1GOWA 4JDBA 4W7WA 3S0CA 1DEDA 8XIAA 2LLEA 3WEOA 3AXXA 2QMKA 5LIUX 4C7GA 4LF1A 1BLIA 4ORMA 1Z89A 3VUSA 4CD7A 5DRCA 2VGGA 4DJDD 1KCLA 3W72A 3STGA 4LUTB 5J5DA 3WQPA 4C6PA 1HJUA 3OBEA 3G1RA 3GW3A 2TAAA 1I2RA 4PFHA 1N55A 3MZNA 1R0MA 1AD1A 2R1PA 3VKKA 4MZ1A 1A5SA 7XIMA 1UP0A 2GPTA 4QLKA 1IEXA 2DZAA 2BY0A 4RJEA 3R12A 4XQ6A 2OLSA 2BX7A 1XPGA 2NX9A 5D09A 4QAIA 3O07A 2Y62A 4Q8QA 5EY5A 4KRZA 4IIBA 4ZBCA 1V8EA 3GY1A 3JR2A 3NQ6A 1U1JA 2Z0IA 2W0UA 4QJ5B 1TMHA 4HYRA 1GQNA 3SRFA 1G5AA 2NQZA 4RZ4A 2IPFA 1VJZA 1XYCA 1MYRA 1RCXB 3BLFA 3KCLA 1QU4A 4GJ1A 2ZYFA 3RFAA 3K8MA 3IIXA 5I0DA 3DFSA 4FK9A 2B4GA 3H23A 1C8QA 2JK2A 1UD3A 4NHVA 1HP5A 2GLKA 4QXIA 4D6IA 7ODCA 4FXSA 2QUTA 4LB3A 1DJZA 4LV9A 7REQB 3K13A 4LTSA 1LQ0A 1VLIA 5JIWA 3H26A 4UQAA 1O7AA 4M3PA 2BSLA 5CG7A 4HK7A 3AQUA 2EGZA 2H9AA 2HROA 4DJDA 1V79A 4ADTA 2J7CA 5A8OA 3WH8A 2BHYA 2WXDM 2PU0A 3G24A 1A5KC 3WNPA 4DYKA 3E5BA 4Y9NA 4DYEA 3BAXA 4CKQA 2BP1A 4CVWA 4B16A 2ASHA 2WC3A 3WEZA 4U33A 5HBFA 4R33A 1XIMA 5HOSA 3QVQA 4ZGYA 4GZ7A 2XFWA 2BXYA 3C2VA 1YTEA 3VIIA 1C92A 4BK9A 1QVBA 3APYA 1QO2A 1TJPA 1WPCA 3S2MA 2QR6A 3I68A 4HZ6A 3UNDA 4Z2HA 4WY0F 3OTRA 4HHMA 3PTDA 4LS2A 2V8ZA 1AH0A 1TQXA 2J8FA 4QAWA 1L2QA 5FF3A 1XD1A 5EYWA 4O10A 1LRTA 3CMFA 1UD6A 3QKZA 4M24A 4G6CA 4AWEA 5EGRA 1RBAA 2UWFA 2ZE0A 2C16A 1UH2A 3EWBX 4XBJA 4H00A 4R88A 1ZSXA 1O5XA 2QCCA 3WD4A 4H9VA 3W7IA 1E43A 1S5VA 2DSKA 4XO7A 1VHNA 4D9PA 3OEXA 3P60A 4PL2A 3G3DA 4HU0A 3WSUA 3DENA 1AQHA 4A05A 1XRTA 4S3DA 4PUJA 2ABBA 4PE8A 2BVYA 3MMWA 3GG8A 3AFBA 4ZCWA 5I2UA 1PHQA 2DFAA 4H8HA 1CB7B 1I45A 3CPGA 4WDWA 1CLKA 4M1BA 4W5ZA 1UWRA 1LT8A 4M7TA 2HDJA 4ZMGA 2PDQA 1G0CA 3RLGA 2C91A 4BFAA 5DCDA 3PBWA 2Y7GA 3K2GA 3K46A 3HPXA 2BMBA 5LHFA 2AKZA 3WJZA 1LWIA 1AW1A 1CT5A 2E5BA 2Y88A 1QMLA 2J7BA 2XPKA 1A53A 5A1AA 2RAGA 4AWSA 4WGXA 5HXMA 3UR7A 4P7RA 1HXJA 3E3HA 1WDSA 2Z1KA 4UFMA 1OYBA 3DFNA 3MPGA 4H83A 2FDSA 3PVFA 1K02A 3KHDA 5HQMA 3GVQA 2XIBA 5F1UA 1UKQA 3WENA 1SW7A 3MSDA 1V0MA 1Y5VA 1TPEA 4I8YA 2Z1XA 3W1UA 4YTSA 1ENUA 4GXWA 2XU2A 2GWNA 5A6BD 4JY8A 3DHPA 4J28A 2BOFX 3NFUA 1X8FA 1A5NC 1LM1A 2Y24A 3KDNA 4E5TA 3BPWA 4N4PA 5BYWA 2IXVA 2WQDA 3VOGA 1IXPA 4NRSA 3AS0A 3KOZA 1KO0A 4J35A 3UY8A 3S46A 2XZ7A 3NQMA 2VFFA 1JCXA 1KXQA 2E40A 1QTWA 2VZUA 4H9UA 1YTKA 4IPPA 3WDHA 3VPLA 4FALA 5E0CA 3LPGA 4V15A 4KCVA 1S5TA 1J96A 4FNPA 2CKSA 2ISFA 1UC5A 2QV4A 3VCNA 3CPUA 4P8VA 4EXAA 4ZEPA 2PTDA 3S5OA 1KR1A 5E6ZA 1IZKA 1AK5A 5AVNA 4JBRA 3TLLA 3RLHA 1JZ7A 3IGSA 1SJCA 4C1NA 1R38A 1K9TA 1UROA 3SN4A 2ZZ2A 3BLEA 3AXHA 2WANA 2V2DA 3PWIA 5C0QA 2VR2A 2PP1A 3CQHA 1V02E 3SB0A 2XGBA 4PULA 1X6NA 4PMVA 3AJ7A 3O16A 5DANA 5AYYA 1J2BA 2E3ZA 5DX7A 4ZE5A 3A64A 2OKTA 3MI3A 3MUXA 3W53A 3CQ0A 1UZ1A 2Z1VA 1MWOA 2GJXB 1TA3A 3ARVA 5H2ZA 1XH0A 3N2XA 3VINA 1CXIA 1YPIA 3P82A 1X39A 4G7FA 1EJUC 8RUCA 8CGTA 3TCSA 1O1HA 4U4MA 4Q33A 1QWGA 1QPRA 3AWNA 3RPDA 2E6AA 4HA0A 1C93A 3GH4A 2A5HA 4WSJA 5T91A 1TPDA 4B91A 1Q6RA 4H6RA 4V28A 2NQ9A 3IJ7A 2QKFA 4Q3MA 3TN6A 2FFIA 5KEZA 3EPOA 4GI8A 2IPJA 3TW7A 1MEIA 3ABZA 2PTWA 2X42A 3D5HA 1FHLA 4H2HA 1P0BA 4O12A 3PJUA 3GG1A 5LYRA 5M03A 3KCJA 4I5XA 4Q8OA 4Z1BA 3SURA 1JJKA 2OO6A 4L61A 5GJNA 3SFWA 3PFRA 5A6BA 3GDRA 1FXQA 2CNCA 3MYPA 1HN1A 4GABA 2OT0A 3N3MA 2OOGA 4P7OA 1GONA 3KBNA 4UR9A 5A8QA 4NZ1A 4AUBA 1JDDA 2X1RA 4CGTA 2FVLA 2ZX6A 5AC4A 2J79A 3M6DA 4HT3A 1KRCC 1K4GA 2F38A 3LCWA 3TTSA 2W63A 1HL8A 1Q6LA 4MUZA 1PCKA 1VCGA 3CGTA 2ZZ7A 4ZXLA 4G7EB 4HNCA 3EDKA 4U10A 3VDBA 3EXSA 2XINA 2PGEA 3M0IA 4LVAA 3AS1A 3NQFA 2ZE3A 5M5DA 4JAWA 4GGBA 3HQNA 2BBFA 3PAOA 3LNMA 4MY9A 1RA0A 4JHOA 3RIKA 2HQAA 2EG7A 3TYUA 1GPFA 3BMWA 2VVSA 2CEQA 4NAEB 2VEMA 4HNOA 3UYCA 5EPDA 1WP6A 4EOUA 1XGDA 3ZVHA 3DHDA 3M0VA 4NVTA 4W8BA 3MI6A 2NV9A 5FAJA 3M43A 5JH2A 4A2SA 1PZ2A 4CNTA 1BFNA 4B90A 3GTFA 3TX9A 6XIAA 3W2KA 2VEKA 4GG9A 1W1B1 3OA3A 5BOEA 4XZNX 1M3UA 1WX0A 3O6YX 1UHVA 4JIRA 1OX4B 2QCDB 1WBHA 4LEFA 4QR6A 4C6JA 1RQBA 4X0VA 5CAKA 1NEYA 3KXQA 4KRTA 3DESA 3ITXA 5HMSA 3FA4A 3CZEA 5KZ6A 3ZQ9A 3IJ9A 3GKAA 4GFSA 2PFHA 1NARA 3D46A 3BQ5A 1CXKA 4ZVJA 3BAKA 3PZMA 1JQVA 3W6LA 3ZSTA 1ITCA 1Q85A 4B5TA 3FY1A 4BJHA 4Y96A 3HPSA 4EACA 1TWWA 3KOYA 3TWAA 4UQCA 1CX9A 4K36A 1J12A 5E1QA 2E77A 4DRSA 5DMNA 1XYZA 1SFTA 3DU0A 2DZUA 1FWTA 1PWLA 1H5YA 1BF6A 5HMDA 1MVYA 2J6VA 4K7YA 3W22A 4D8ZA 4JDYA 5A3HA 1VFOA 4F2TA 3UETA 1BVWA 2CZ5A 3L4YA 3BCDA 3NNTA 4L4LA 3SUTA 3FEMA 3RCNA 4HMNA 4IUGA 3QRHA 2VR5A 4CU8A 4RUBA 4N6FA 4PBFA 4RK8A 1B9BA 5F7UA 3B8UA 5HINA 2VURA 1PX4A 4GBUA 2J8GA 3QPZA 4HKPA 1U83A 3RXZA 1QHPA 4PUEA 3ITCA 3AHYA 5FF2A 1BTCA 1OK6A 3F4VA 2Z2UA 3LYEA 3O1NA 1SJAA 3QFWA 4IMFA 4EPEC 4IMGA 1KBJA 4M7SA 3GW0A 2I5IA 3U6WA 2Y70A 3BVJA 5HR6A 2OLHA 3P0XA 3C52A 1UR1A 1M65A 3T44A 3TSMA 3G1SA 3SCNA 4NASA 5I3GA 2PWFA 3MHGA 2FJUB 2WNWA 4KIEA 5H91A 3FGCB 4GCXA 1ISZA 1VR6A 2VRJA 1I1XA 3W75A 4KBXA 2C15A 2Z4GA 1JD9A 2YFOA 2OYLA 3THCA 4XKMA 4Z1DA 4ONVA 4LX4A 1VBJA 1BGAA 5DO8A 2Z00A 1VCFA 5CCZA 3DI1A 1M7XA 3T2OA 2GVGA 3PR2A 4JEJA 1LQ2A 2ZUNA 2FZDA 2VHLA 2P8CA 2VD8A 1RCOB 4HTBA 1E72M 2G97A 2MNRA 1JUBA 2CERA 4JY9A 5U7SA 2X09A 1G9HA 4O28A 1HT6A 3GIYA 2XM1A 3RX4A 3THAA 2XN1A 3TAKA 3LUTA 5BXRA 4RE4A 3IK4A 4N9CA 5EMMA 3WLLA 4AZCA 2JF7A 1W3IA 2JALA 4AD5A 1U30A 3UWYA 4LFYA 3UZYA 3H4XA 4CD5A 3WD1A 4HA4A 1MUMA 3NYDA 3W2MA 1U5VA 5A94A 1ZJIA 3TOPA 3I10A 2P76A 2XIQA 3QF0A 2VT0A 3KS6A 2J7HA 2WC7A 3U4AA 4RDWA 3VIKA 1ALDA 1H7XA 1W3HA 3BAWA 1TV3A 3DFPA 5FJIA 1U1UA 4AVNA 2P88A 4HSNA 2Z1WA 3UFYA 4YN5A 3PTKA 3CUZA 1J0ZA 1V77A 4S3FA 4FIRA 3A47A 3AI0A 1I60A 5I77A 4ZR8A 3QHNA 3N29A 1REQB 4H7ZA 1MXSA 2XSBA 3L2MA 1B5TA 1QBBA 3LHZA 4RW5A 5E5CA 4DELA 2OSYA 4K1WA 4Q4SA 1CGTA 1A0EA 4AZGA 2JBMA 1QOPA 3A4WA 3VNLA 2OWCA 2A7PA 1W9UA 3AXMA 4HB7A 3V36A 1PKNA 1JULA 4FX7A 1K9FA 2OSXA 1DXIA 4JTTA 4JTEA 3N17A 2PURA 1M03A 2O4QA 4K39A 2Y8UA 1KTCA 3LA4A 2B7OA 4RZ6A 1SMAA 4L1WA 4DPPA 3OZMA 4B5NA 1RQEA 3S6OA 3DYOA 1ESWA 4NX5A 1JYVA 2VEFA 4UTHA 2ZIDA 1PXGA 2A0NA 4G9PA 3VNDA 1KCXA 4TTGA 1DORA 3LY0A 4KCUA 3VM5A 3BV4A 1SSDA 5H1WA 2XVNA 4B5SA 4E4UA 3W1RA 3PBMA 3WF0A 1MQQA 2WK2A 4S38A 4PUDA 1TTPA 5LHEA 1K7EA 2ZUSA 3WO8A 5BCAA 4XWUA 4E8DA 3TVAA 1W1A1 5CGQA 1GZ1A 4M56A 1J0HA 3NOEA 4I3GA 1PIFA 1K8XA 3W6YA 4GO8A 4QTGA 1O94A 4KWWA 5T9BG 3RX2A 4HU4A 5BWAA 3OVPA 2B81A 1PPIA 1JZ2A 2EEXA 4GZEA 2W9MA 1ZHAA 1OBAA 1F9CA 1W5OA 4DZAA 1KR0A 1PWMA 2XWDA 5LXXA 4MB5A 2VGFA 1FFRA 1PAMA 2E0PA 3W71A 3FHQA 2JEPA 4LRSA 3UVIA 3QHMA 5HATA 2OG9A 1IQ8A 1ML1A 3BE7A 4L7ZA 3T55A 4AMCA 5I7GA 1KM3A 4HMDA 2RDXA 4R9OA 1GOQA 4GACA 1GW1A 1KLYA 4QSFA 2WMKA 1B3VA 3BOFA 4O8AA 3A6OA 1FWAC 2WMIA 3QC0A 4CD4A 4JXCA 1Q8AA 1W3LA 3IJLA 5A6AA 3CH0A 5K9CA 2D24A 5C6MA 5HA7A 3WKZA 3EMZA 1K6WA 1TTIA 4ZXOA 3THDA 2ZUMA 1DTNA 2Q6ZA 1Z3NA 1UQZA 2CLFA 3VMOA 1MW0A 3LX9A 3B9DA 1P1MA 2QS8A 3D3FA 2FPYA 4UTKA 3TJLA 3O6AA 4RNJA 2DSUA 2D2OA 1W5PA 4LBUA 5BRPA 3EOEA 2QF8A 2YXOA 4QIUA 4O57A 4POCA 3GVVA 1DQUA 4HPHA 4H2CA 3W7EA 2NZLA 4L9ZA 4XAZA 3PAJA 4IH3A 4AB4A 3PY2A 1UA3A 1OFAA 4LU0A 2E5CA 3L0NA 3TTQA 1LL4A 3P7YA 2A3EA 1Q45A 5I3HA 1E6QM 2HEJA 4IJRA 2FVMA 3AYSA 4D71A 1OC7A 3U2ZA 4TUFA 1V7YA 1BWKA 1OX4A 5C54A 4OV9A 2V81A 2DDXA 1L0PA 4OZOA 2YYTA 1V4YA 1ZUAX 2O56A 4FLQA 1XLKA 3D0CA 3FYYA 1GW9A 4ZE4A 4E2BA 1Q4WA 2YJQA 3WLKX 4D6JA 1KQYA 1G01A 1YLVA 2QJMA 4GI6A 4Y6GA 4LPCA 2H9AB 2QGYA 1CGYA 4JN6A 4ZOAA 1B3YA 3NUKA 3ME3A 1BYAA 3OQ8A 3PBGA 4J3UA 1RVKA 3VZXA 3CUIA 5A6MA 2UV8G 3W2JA 2OZ3A 3N9RA 3PNUA 3WDIA 1XLBA 1ZY9A 1ICSA 2ZVRA 4B2DD 3QW3A 3WQ4A 3PSWA 2FZBA 3CEUA 2NT0A 1RV8A 4GUFA 2W67A 3E49A 3IV8A 1QPOA 3B03A 4OKDA 3VNKA 1S5WA 3QY8A 4YTTA 3EBVA 5E70A 1B90A 2XN2A 3IGUA 1VCVA 3EB2A 2EAWA 3CQIA 1WO2A 3F4CA 3NQCA 2GGGA 1FDZA 3LB0A 4KETA 2IQDA 3EB4A 3GAKA 4FXJA 3H22A 4LUIA 1GVRA 4Q8PA 1A50A 3ZLFA 3WK0A 2ALRA 2Z26A 3KBJA 4HNNA 4Q22A 1RD6A 1F05A 2D2GA 4DAIA 5JBFA 1V02A 4NZJA 3AZTA 3NDOA 3D47A 4H9YA 3NXFA 5A8GA 3M16A 5A5WA 5CSRA 4M82A 4H8VA 3MCOA 1PO9A 2XH2A 5FEZA 4AIEA 3M0MA 4NI3A 1XD0A 1W1ZA 5G2HA 3LU2A 4AWUA 4PFMA 3WLHA 1EQCA 2DP3A 2X0SA 4KWSA 1BEUA 1E9LA 3WCZA 4HJFA 3FHAA 3UA4A 2OZTA 4O18A 4NKCA 2QNEA 3N11A 1KC7A 2Y2WA 1P0EA 2Y7DA 4WD0A 1OFOA 2X30A 4UMCA 3W1NA 1S39A 1O5QA 5I5RA 1EFZA 3VTRA 1MW2A 3SDOA 1KXHA 2X7WA 2GUBA 1PV8A 3VDCA 1VS1A 3AHXA 4W89A 2ACRA 1LORA 1V0NA 1VYSX 1VRXA 3LM7A 4FA3A 1TWIA 3EXTA 4S3KA 3IRSA 5TBOA 1U1HA 1EDTA 4ZENA 1SM9A 3GFXA 1E0WA 3T4WA 2KZHA 4QLJA 2QUMA 1Q6CA 2Y1HA 4BR1A 3MSGA 1H49A 1PX8A 4TO8A 3RPMA 4R34A 5GNXA 1XLEA 3SZ8A 2WKGA 2EJ1A 2DT0A 2PGRA 2CXEA 2DUXA 1I4NA 4AHPA 3W01A 4WHBA 4B4HA 1W1IE 1OFBA 4KWOA 1EYWA 1AQFA 1NF7A 2GVYA 3BJTA 2W61A 2WVSA 3AALA 3F5KA 4B15A 2G3IA 2QUNA 2VZSA 3TKFA 3K8KA 3V35A 3S9IA 4I7VA 5AOUA 3QV6A 3GBDA 1FH7A 2GUUA 1SZEA 4X9SA 3PS7A 4QQUA 5LNWA 3TYAA 1V6YA 1E56A 2QXWA 3WDJA 5GJPA 4Q4PA 3GHRA 3M47A 1H1YA 2X1SA 2V63A 1D8CA 1GG0A 4F9JA 3CZLA 4JS3A 2QCNA 1RSCA 1F3XA 5H8UA 1TG7A 1Z41A 3OYZA 1LJYA 4X22A 1RPKA 5A6LA 4DHGA 3CAWA 1CZ1A 4NAEA 3LCLA 3RF9A 4HN8A 1LROA 2GZXA 4EPKA 5CSYA 3BMXA 1P6CA 1OG6A 1MXGA 4RLIA 3T4CA 3KBWA 5EFDA 3ENLA 1W2VA 3MUY1 2E6FA 2F9RA 4LAKA 5J04A 4RNHA 1AJ0A 2P5NA 2CBVA 3AJXA 2POZA 4TV6A 1VP5A 5MKGA 3GC2A 3ELFA 3HIJA 4GY1A 1UPMB 5JBEA 1HQTA 3TA9A 3WLIA 5JUVA 1BXBA 2ZBTA 2NWRA 1QRQA 2QCDA 4F0MA 1JUEA 3P80A 3H4WA 4TU1A 4V33A 4S1FA 4HIBA 4WX2A 4UFHA 3W2LA 1NIUA 3BLDA 1M7JA 1SR0A 4JTGA 1GTEA 3KE0A 1G67A 1RAKA 5ABHA 1OB0A 3O2LA 2Z29A 1NP2A 3BQ6A 3N25A 1W1PA 2G50A 3C5QA 3TYCA 5C2CA 3MMDA 3Q4DA 3PF3A 4NZ4A 1KLZA 6PTDA 3J7HA 4GVHA 1UR8A 4K2SA 1XIBA 3TYDA 4E0CA 4F2BA 1Y5WA 1LG1A 2C0HA 2HRWA 3LM3A 3RM9A 1GOOA 1A5BA 3SRKA 5JVLA 2ANUA 3NL5A 2G3FA 4NRRA 2WZHA 3EEZA 2XSXA 4Q8WA 4LC6A 4DAFA 3N13A 5HR7A 3VO0A 1FRBA 4QJ1A 1PL9A 1MDLA 5MHBA 2NVDA 2C7FA 5FEXA 2UZ9A 4J27A 3VM7A 1J9YA 4O4WA 1MZRA 1GEQA 5AHFA 1FTXA 2R1MA 3BJSA 3IVTA 1CGVA 1VFLA 2C0AA 3WNLA 1MEHA 1MFVA 1C8VA 5FOOA 3OGSA 3SQMA 1GZJA 1JEZA 1W5MA 4QS6A 3KX6A 2XVLA 3NCOA 2WHKA 3KAOA 4JTLA 3M46A 4QFUA 2EXOA 4Q8NA 4DBEA 5HULA 1ZGDA 3DERA 2E7FA 4G1NA 4I7WA 2OSWA 5I07A 3RDKA 3JZUA 6REQB 2Y61A 3RO6A 4LNCA 4C65A 4PTWA 2CITA 2VXNA 3S2NA 1WNOA 3N4EA 3QMTA 2QULA 3QZ6A 2WSKA 3GR7A 1HJSA 1XJBA 4JQ1A 2J74A 1T8XA 1AD4A 1POKA 3LEPA 2GWGA 1SO3A 2VTFA 3ABSA 1SFLA 3AC0A 3CLWA 3MKKA 3LLFA 1EZWA 3NDYA 3VIFA 3ZOAA 1W1TA 3M5YA 4GVGA 4MY1A 5U4NA 3WEMA 1QW8A 1SU5A 4MGGA 1FWFC 3KOXA 1LLOA 4KFNA 1OZMA 1YHTA 2C1IA 4LT9A 3CUGA 4RKAA 4DM1A 3G6MA 3GDMA 4CN4A 2IKIA 1Y8BA 2VKZG 5LNSA 1DVJA 3GR8A 4I7UA 3EGJA 2IPGA 4YXGA 4UMAA 3CUJA 1DWGM 3NOYA 4E4FA 2OGYA 1J6OA 1LDCA 2Y7FA 1ZU8A 4UZSA 2FLIA 1GYLA 3ANYA 1AH4A 3FDKA 5CSUA 3Q94A 4WZHA 2G4JA 1W3KA 1SZNA 4GH1A 5EL1A 2OEKA 5CZSA 1UWAA 1KFKA 3R94A 4D6GA 4LUJA 4MNKA 3SCPA 4LEQA 3VGBA 4FLRA 3WL0A 4UFIA 3M0JA 3UNTA 2XIOA 4YTUA 4PN2A 4ZO9A 2FPVA 2XFFA 2E6YA 3WQGA 4AMAA 2V2HA 2WHJA 3S1UA 1SVDA 4OBSA 2PA6A 3S47A 1GKPA 4QE5A 4TXEA 4A3UA 1KTBA 1KM1A 2RDUA 4DI9A 3AOFA 1EJTC 4TVCA 7CGTA 1VFMA 3W2UA 4UFKA 1TE6A 5T26A 2CLMA 2YYUA 3RRAA 1DQWA 1REQA 3HG4A 3LI0A 3Q2DA 1UOZA 3ATZA 1TVPA 1XXXA 4ZQOA 3LS9A 5KSWA 3H2FA 4HCHA 3HGJA 5FAGA 1A3HA 3AIUA 3T0BA 4FXRA 1O5KA 2WMFA 2CFFA 3VGEA 3V0UA 2EPLX 4ACYA 5CPMA 1HVQA 3N4FA 3LRLA 4OQVA 4QITA 1W3JA 3QH2A 3ONCA 4GLEA 4EE9A 2QW5A 1E0XA 2WVUA 2J7EA 1K03A 4W8AA 4NZFA 5D05A 5C71A 2OEJA 3TR2A 1IT8A 2P0OA 3M0XA 1K9DA 1ZAHA 1KM5A 2YZ5A 3LTYA 4L80A 3DN5A 3V1HA 2FMOA 3KVJA 3BGGA 4XB3A 3HPAA 3LQGA 3GDTA 4DWDA 3UPMA 1OX5A 3GVRA 4REQB 1MUWA 2DSWA 4UIOA 1VJIA 3DOPA 3Q65A 2A6NA 2VFIA 4CD8A 4PR4A 4ACZB 3SBFA 1UWSA 1TPWA 3PB0A 4IWWA 1QNSA 1XKJA 1BQGA 4LVFA 1JPDX 3ECQA 1ADDA 4LVGA 5K3VA 1YX1A 1ME8A 1VQTA 3MV11 4DX3A 1D2KA 2AAAA 2V3DA 3O05A 4DO5A 2J4GA 4CNSA 1XCWA 5DBUA 3AMKA 4JNMA 3E02A 1E1CB 1XLGA 1EF2A 3XIMA 4DF2A 3W29A 1PZ1A 3RAOA 2QZRA 1WAUA 3ABOA 3I3BA 3QQ1A 3NA8A 2Y5EA 2J88A 4GNJA 3WUEA 4CQAA 3M0HA 1QI2A 3MY9A 5IDIA 2WVVB 4JL2A 3N14A 4G7EA 3W7NA 1PTAA 4J3XA 5DBTA 1HKWA 4XD6A 5HNUA 5C5YA 2GJLA 3A5FA 4L1GA 1I9CB 2F8QA 4UBPC 4ZZ9A 2W4XA 4WF7A 4PBEA 1Z48A 5EBUA 3KRBA 4UB9A 4L5ZA 3W7MA 2YCLB 4D1IA 4NXKA 2Q3RA 4JKMA 5IM51 2XGZA 4PTNA 3R8RA 5D04C 2EQDA 4UFJA 2RJGA 3WF4A 1XLCA 1UMLA 4NXSA 1BKSA 1CECA 1C7SA 2HBVA 3EX1A 3A4AA 1OFRA 2Y85A 1NWSA 3VZYA 1H5VA 5HNRA 1J11A 4HN4A 1FWCC 4JGDA 2ONEA 1A49A 4H9ZA 4BA0A 3MANA 4FB7A 1IEIA 2W91A 5AC8A 4IFKA 5BMWA 5DLCA 5D33A 1UH3A 3R43A 2W62A 3MO4A 3ITYA 5ABTA 4O0KA 3SQSA 1AW5A 1CIUA 3DKJA 3L21A 4GYPA 3RITA 1RQHA 2HZGA 3VE7A 1PKLA 3EX2A 3AMDA 2V5JA 1T96A 5IBXA 1WE5A 5CAHA 1GG1A 4ZO7A 3OLDA 4WJ8A 1EUNA 5LNRA 3TV8A 1I1WA 1OIMA 4L9YA 1I2QA 3WQDA 4FAMA 3RILA 3OW1A 1GZGA 2PBGA 4DF1A 2FZ9A 2D2JA 4H9MA 1VRDA 5D2XA 2NVAA 2Z1BA 3CAVA 3CWOX 3FKKA 5A95A 1EXPA 2IUZA 1KFWA 3ABQA 3WL1A 1TVLA 3WZ0E 4WLCA 1GKQA 3EPNA 3II1A 1S3HA 2FDMA 4GOAA 4PYSA 3VOCA 4PTDA 1F8IA 4O4VA 4JNYA 4FOUA 3R10A 4OUEA 4DJFC 3UG3A 1OCQA 1YTDA 5ABFB 4MJMA 4Q8UA 2GQAA 2FIQA 4PODA 4MWAC 1RJPA 1KM6A 4R85A 4TX9A 4GYJA 2OLAA 4D1JA 3UZJA 5G1YA 2JIWA 3QOKA 1OF8A 4DUOA 1VFSA 4MIMA 3P5ZA 2G3MA 3EDEA 2EPMX 1J0YA 4MDPA 1H60A 2OPJA 1CLXA 3HFTA 2V30A 3GBEA 2ZICA 1ZJAA 2YB4A 3RYSA 1MFUA 5I23A 4JIIX 1RJRA 3VGFA 3FJLA 3NQGA 4LH8A 5M17A 3BCJA 5AYXA 1GHSA 3M9YA 3AROA 2W79A 5JMUA 1YNYA 4EPBC 1EGVA 4K8GA 4JHZA 1E0UA 2XN0A 3LHUA 4FOJA 1F74A 1FCUA 3PBYA 3OQEA 4YYFA 4TV5A 2DIEA 2YW3A 3T8LA 3ZT7A 5FJTA 2DW6A 2WKJA 3QHOA 3UXIA 3KBMA 4JX5A 4JTRA 3OJGA 1HTIA 4IQEA 1CXEA 4HOWA 2IKGA 3SGGA 4IP4A 3VD3A 4DLMA 3IANA 5K7JA 3U2OA 1GGOA 1RVGA 3OB8A 1FVPA 3V18A 3QTPA 2VI0A 2HS8A 2J6XA 2PGFA 4NQ1A 3KP0A 1RALA 1RBLA 1W32A 2PCEA 3PPCA 4UQDA 2YDRA 4ML9A 1RY8A 5A6JA 4HPXA 5FF7A 2ZRXA 1N8WA 4PCTA 2C1HA 3TNBA 3CEPA 3G8EA 2PDMA 4LRTA 3UESA 3AU6A 4DO7A 1VIZA 3S2LA 3EA3A 3WQEA 3P3BA 1BQCA 3BANA 2Y89A 1FWDC 3F2BA 4J2PA 1OFDA 3M0YA 2ZRWA 3N9KA 5C7HA 3ZFHA 5ABEA 4TTUA 4UR8A 4A3QA 1F8MA 1MUCA 1QPKA 5REQB 4DJEA 4C6LA 7REQA 2AGTA 1HKJA 3QXBA 4KF1A 3TP4A 3C2YA 3W23A 1K7FA 3FEQA 1OG0A 5K9XA 4PCSA 3Q58A 4NT0A 4DIAA 3GNNA 2ATSA 4FS9A 1W91A 3H2OA 2JGQA 4IZGA 4FOKA 2NSXA 3WN6A 5A8PA 4PUWA 5D8WA 3RM8A 1EBHA 3TW9A 1WZMA 2ALDA 3QW4B 4UQEA 4Z2KA 4IMEA 4L6OA 1E6PA 1DJNA 2ZXBA 3DKLA 4O8RA 1HIZA 3GVGA 1YADA 3HGSA 1R46A 1IGWA 4C6QA 4UCGA 1F4AA 1I8JA 2OYMA 4FIQA 2OODA 2FGZA 1G4PA 5C2GA 1G4EA 3TSBA 2CBIA 1EP2A 1CYGA 1AQ0A 3UXLA 4QJ3B 4I90A 3L5AA 1JZ5A 3MUCA 5EMKA 4AVOA 2PWUA 3SSZA 2YGYA 3DI0A 1H7PA 3I6RA 4IM4A 5AHNA 4L4OA 4UOJA 3U5UA 1L9WA 2V68A 1E6RA 1TUXA 3R79A 3VIGA 4CCEA 3OIHA 3G5EA 1CBGA 2VC7A 3UCQA 3ICJA 2GK1B 1ODZA 3KRUA 2PWHA 4GYPC 4QCEA 4HPNA 1HF6A 4W85A 1XLMA 3SCSA 7TIMA 4NJIA 2RDTA 3BARA 3C0LA 4IX0A 1ZB5A 2WLZA 1EWDA 1K77A 3WBAA 3RN6A 5HAOA 3SCTA 1FCQA 4LAMA 3WK2A 2A1YA 1UR9A 2QQ6A 3DG3A 3LHVA 4BY3A 3PZUA 2ACQA 1DIDA 4HOZA 4UTFA 1P6BA 1YBQB 4LAOA 1OWQA 3LCGA 2Y8KA 1GVEA 3SCWA 3AIVA 3GDLA 4LQ1A 3NPVA 4R7WA 1J5SA 1XYBA 3LBCA 1XIFA 4HNTA 1H61A 3FXYA 4QLLA 2QJIA 1SFJA 1JI1A 5D38A 4AISA 2X8RA 1KRAC 4JL1A 3H53A 3LERA 4MADA 5GJMA 4AYGA 3ZLHA 1RK5A 3R6IA 4AAJA 3QV8A 3OP2A 3IWPA 1V93A 3W7KA 1E0TA 1S2CA 2QCLA 4MJZA 3I3EA 3LSCA 3U8GA 1GEHA 1UKOA 3H7VA 2PLCA 4M6UA 3MB9A 2CYGA 3FJ4A 1KWGA 2RUSA 3WD3A 1WOBA 4XD4A 3A9BA 1XR2A 5XIAA 3EEGA 2HSAA 4Z2JA 2GSHA 2MUCA 4E3TA 4O16A 1F07A 3PPHA 3CL7A 3T78A 4DO6A 1DHPA 4FR1A 4DWSC 1R9ZA 4WJEA 2YPIA 3C0JA 4GD0A 4A29A 3ES8A 3ANVA 2ZA1A 4Y9OA 3E0VA 1XINA 2ZDSA 2VNCA 4DNMA 2CLEA 3L5LA 1TSIA 4NJKA 4D6CA 1Q2SA 1A47A 3N2OA 3TA6A 1B3XA 5XIMA 1XCFA 2YCLA 1VBRA 5CEWA 3N3TA 4CQCA 3INPA 4JR5A 4GA8A 1W9BM 3SUSA 2XIMA 1X8CA 1XL9A 3IJ6A 5BW6A 4C1NB 3BW4A 1I0BA 1RPXA 5CPSA 4JCLA 2C13A 2Y5SA 3FA5A 4H41A 3URAA 1GQIA 5TF0A 4K8HA 2JF6A 4HGXA 2G8ZA 3IARA 3R0DA 1QNVA 5I03A 1X1OA 4S3BA 4RNIA 4PTMA 1UD8A 1QNOA 4IXHA 4NZCA 3WJXA 2YA1A 3UWWA 2I56A 3T0DA 3KUMA 1A0DA 3EWDA 3VGGA 4FP1A 1YE6A 4P8UA 5G1TA 4RPQA 4C6DA 2CZEA 1E5NA 2F6KA 5G1MA