3TYGH

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt128 in complex with a glycosylated engineered gp120 outer domain with miniv3 (eodmv3)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
234
Chain Sequence
EPQLQESGPTLVEASETLSLTCAVSGDSTAACNSFWGWVRQPPGKGLEWVGSLSHCASYWNRGWTYHNPSLKSRLTLALDTPKNLVFLKLNSVTAADTATYYCARFGGEVLRYTDWPKPAWVDLWGRGTLVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, viral protein
molecule keywords Envelope glycoprotein gp160
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 32
structure length 234
sequence length 236
ec nomenclature
pdb deposition date 2011-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH01
3HG1A 5KSAC 3EZ8A 2EE6A 1QFWL 1MRFL 1RJCA 3LKPB 1X4ZA 4JZOB 1ZLSH 2YZ1A 3W9EB 1YQVL 1WF5A 5JOFB 1IQDA 2EIEA 2AJYL 1MCOH 2NY2C 5C08A 3QNXB 5TF1L 2VZSA 1UZ8A 3VGDA 2GK0A 3VFRB 4JKLA 3V6OC 5D6DA 5I66A 5GGTH 3KPPB 2K3TA 3DROB 2FZ3B 3ILQC 4JN1H 3HUJE 2YHGA 2IANE 2ADFL 2I9TB 4LRNH 2BNQE 1O7SA 1FZOB 1VGEL 1FFOB 3ZTNH 4ZFOA 3VDAA 3OXRA 3P9MA 5E5UB 1CDYA 5C7XL 4WU7B 1QO3B 3S36L 2BSSA 4GBXA 1FVEB 3AMKA 2Q86B 4HGKC 1A4JB 2VXUH 3DUSB 5HI4C 4G6ML 4J7RA 1EEYA 5C6PB 1I3RA 3DX7B 2FHFA 5DUMH 4XAWL 4KJQD 4U1LA 3EO1A 1FDLH 3HLAB 3QEQD 3RGVB 1GZQA 3MRPB 1J8KA 5B3NA 1I9IH 2DQHH 1VFMA 5J13C 1P9MC 2PYEE 1FN4B 1G7MA 1HDMB 4X98A 3NZHH 4N1HB 1K6QL 1D9KB 4HGWA 3MRDA 1MIMH 3S9DB 3MOAH 2QR0A 4QCIA 3AVEA 3HKFA 3EHBD 4O58H 1M6OB 1TITA 1VEOA 3FO1A 5DJZA 3QUXA 2Q76B 5CMAA 4M1CC 5ENWB 2BY2A 3X3FH 3CX5K 5KSBA 3KYAA 3MMEA 4WUKL 3PP3K 4QRPB 4LRIC 4OZGE 4JG1L 3IYLW 3VGAC 3TBYA 3FMGH 3RVUC 4OV5A 2ZOLB 3OJDB 1A7QH 4DVBB 1TPXC 2VE6B 3RJDA 2F8VA 4V1DE 4P2RB 4XNUH 1IQWL 3KXFD 1U6AH 4JPWH 2UUDH 4HIIB 4S0TD 4XPTL 1HH9B 2VDOL 1CLOH 5GS0C 1HZHH 2OK0H 3TZVC 1EDQA 3U9PH 3QDJE 5HJ3A 1IAIL 4PJIF 1DL7L 3MPCA 4MYWB 2CO7B 32C2A 4HUKB 1ZT1A 4GUPB 3V9FA 4NOBA 1KB5L 2XQBL 5MP6L 3DYPA 3FO0H 3IVKB 3TN0B 4KKLD 3BP4A 4QTIL 1ZK9A 4XC1L 1B4RA 3CK0L 3BD4A 1WC7B 2CIIA 4LCWE 1FIGL 3O6LL 2AK1H 4NP4L 5GRVL 1KNOB 5IFAH 4FQ2H 1YEHL 4UDUA 4AQOA 4OI9A 3O3DA 1A3LL 2XTJC 2EKSA 3TJHD 3RWJB 1T21A 4ACPA 3ARYA 2QBWA 4ELKA 4G6JH 5DR5L 1EMTL 3FONB 2CLVA 3AAZA 3CH1B 1N8ZB 1YN7B 3O4LD 4WJ5A 5LWYL 3EYVA 2XACC 3RDTD 4P2CG 2BVTA 4JANA 4M8QA 4JQXA 3B5HA 4QXUL 5KAQF 1BVKB 2V17H 4X9GA 2WBJB 1WAAF 4XWOC 5HPOA 4IS6A 3WNKA 3LB6D 5LQBL 3B8YA 1A5FL 1BFTA 3QEHA 1CVSC 1OW0A 1NKRA 4EDWL 3F7VB 3PWPE 5DD5L 4JM4L 3QJHA 4TPRL 3FRUB 3TNMA 1IM9D 3BQUC 3GFUA 2VZ1A 5GGQL 1OF2A 5C07B 3CFDA 1WWBX 4JRYD 3VFSA 2GEEA 1ACYL 2QL1A 1BWMA 1UADC 3UBXG 5ID1B 5J1AB 1VEPA 5E2VH 4ODWB 1U0QA 3WS6A 1P1ZB 4Q9RL 4M6ML 1ETZA 1MCBA 3WFEL 1Z0NA 3BIBX 1ZV5A 5ESVA 4Q58C 4PJ9D 3CXHJ 4PRHB 1KTLB 4GOSA 2F74B 3PP3H 1OTTC 2P5WD 4IMKC 4HXBH 4JJ5B 4YGAB 4TTDD 4X4MA 1VCAA 5GRUL 1CWVA 4YC2B 3LIZH 5SWZA 3UP1A 3QDGE 3VW3H 4K71B 2VLLA 3MUGB 2JJTC 1KC5H 1QP1A 4PJAA 1DP0A 1RPQA 5ITBH 1FNGA 3FQXB 3MV7A 2CKBB 3L5JA 5M7QA 1RJZB 2A83A 5CGYC 1MH5A 4OZHA 2R1XB 3CU7A 5FF6A 3Q3GB 1NMCC 2R1YA 3VCLA 1IM3B 5ILTH 3BAEH 3NGBB 2OS7A 5JPNB 1G9NL 3HZVB 1P7HL 4UOW1 1WBYA 2QSVA 5SWQB 4JGMA 2J6EA 3MGOA 1F13A 4X7SL 5TE7L 2OMBA 3D2UA 5E9DB 4NO0B 5HTSA 1NC4B 5IJKA 1KLUA 2ZCKH 5HYSG 1A22B 4KJWD 2APVA 4LLAA 3JWOL 4WFHE 5C0JB 2DTMH 3OG6B 2A77L 2OL3H 4DZBB 3OR7B 3KAAA 2G2RB 2LQRA 3GMRB 4ZO8A 4AEHL 4AZ8A 5D7IF 5SX4H 4PJ5B 2NQCA 3EYSL 3GKWL 1OSZA 3ESUF 3UJIL 2BP3A 5FIEA 1FGVH 1KCSH 1CIUA 1WIPA 3MV01 4I48B 5D1XC 4JFFA 4LKXB 4IMLB 4KVCH 4X4YA 2GFBA 1YUHA 4ZPTA 4NKDB 3FRPG 1Q9LA 4LLMB 5DJ0A 1ZVSA 2JIXD 3DO7A 1CL7H 2PTTA 3OX8A 5I75B 3QH3A 4HFUL 3GSXA 3MZTA 3FFCD 2LVEA 4N0UA 1T20B 4KMQA 4P4KC 1W0WA 1OTSD 4HUXA 3RTQD 1EHAA 2B20A 4LHJB 4LSSL 1EERB 2OZ4L 5AWNL 1N5YL 1Z9OA 3GSWA 4Y5VA 5IB2A 5DC9B 3HG1E 3UTTB 4ORZC 5JXEA 3OAYK 4HWUA 4DFHA 3HI5H 2K7PA 4KH2A 4NQEA 3ARFA 4LVOC 4ZXBA 1I7ZB 3K80A 3KPNA 1NUDA 3MLYH 5LGHL 1JWSA 4PJIB 4WEBH 2Q8AH 1QPXA 3BRFA 1DQDL 5ISZD 3REWB 1RULH 4R3SB 1YMHB 4W6XB 1E4KC 2LFGA 3V4PL 5CJXA 1T66C 2R8SH 4IM8A 5TDNA 1FC1A 1MI5A 3AB0B 4LF3B 4ZO9A 5KANG 5J12B 1MCHA 2B1HL 1GPOH 4OUOA 4CU7A 2KZWA 1JPST 3C08H 4FXKA 5CEXB 5E94A 2PW2A 5HHPB 1A4KA 5C0AB 1BVLB 3EIFA 5I8KH 4QYOB 3QEGL 3FQTA 4YZFF 1EJ6A 3KYKL 3RGHA 5DJCB 5EC2A 3MLTA 4HLJA 4Z7QF 5IHBA 1QLFA 1XCTA 1KUMA 1I3GH 1DQLH 1QQDA 2WLZA 4RDQF 3IDIA 2EICA 3IXAA 4QRRA 4W4OC 5AG9A 1CU4L 1I7TB 3K8LA 3BP7B 2NY5L 4G7YL 1R5WB 1PFCA 5C0GB 3FQNA 3O6MH 1PEWA 4WI9A 4QHLB 1IC1A 1RZJC 4KKAD 4DK3A 4I18B 3KYMA 3DMMD 3DBXA 4HJGB 1Q9OA 3QQ3A 5IB3B 1OT2A 4NBXB 2LVCA 5EU7C 2AXJA 5KSBE 3NFSH 1UCBH 4HWBA 3F7YB 5IUSA 1W72B 2ZUUA 4QRSA 4K55A 4M93C 4H1LA 4C83B 2VB5A 3KPMA 3P40A 4HUNB 4OTXH 1GH7A 4PJCF 3SN6N 1F3DH 1KTDA 5HDQH 4LDEB 1FYHB 4R6UA 3OAYH 5B3JF 2YPLA 3RGVD 4LIQE 4I0PB 1W0YT 2ORBL 4PRPD 2W60B 1LDPH 2C1OA 4A6YA 5D4QA 3OKOA 4ELMF 3QUZC 1SMOA 2IH1A 4G43B 5D2NB 3KPQB 1AC6A 3DRTB 4Z8FL 3PV6A 4JG0H 1ZHBB 4J3XA 1Z6JT 5D6CB 2NW2B 3QNZB 4XNXH 4HIXL 1AGEA 3BGAA 4DK6A 4HKBB 4KJPD 4PUBL 3BPOC 2Q3AA 1RAMA 2HN7A 1G9MH 4JRXA 3BZEB 3GMPA 5E1AB 5GGUA 1IILE 4CVXB 3QO1B 4M03A 3ZT5A 2BVYA 4O2CA 3PWVB 1KEML 1NGPL 3NIDF 4MLIA 4OM0L 3I3BA 1HSBA 1KJMA 4P23C 4TUKL 4V2BA 4CUCA 4Z6AT 3V6FA 2V9TA 3RUGE 3KPRA 4MA7H 2XWTA 3A67L 3GEWB 1NDGA 2CR3A 4P2RD 4XBEL 5C0RH 5C0NC 1CT8A 1BIIB 1F8TH 4BFIA 3MR9A 1OAKL 4HJ0C 5D7IB 3C6SA 4GW5B 3CSYA 4AJ0A 1T1YB 2WANA 1A2YA 1NUNB 3FN9A 5JLZA 3VH8G 5EZIH 5TQ0H 3VI4E 4BFEA 1BBJB 4UOJA 2FD6H 2NLJA 1CDHA 1XCQB 4X7TB 3IFOB 2VLKA 1RIUL 2V7HB 3U0WL 4XNYL 3QIBB 4P5KA 2GSGA 3TN0D 3VXTB 2H3NB 5L9DH 1QYGL 1KJ2H 2EZ0C 5EU3A 3ALWA 2HVJA 1YNLL 3DECA 5FFLA 3ZE1E 5AZ2L 2XN9A 1WIUA 1QSEB 2WAHA 2DM3A 3S4SA 2QQLH 4K3EL 4U6XB 3ARQA 3EOTH 4L3CA 4MB4A 4HBCH 4KQ4H 4X8XA 1UKQA 4YX2L 1MY7A 4X4ME 3IDGA 2A6DA 5D93B 5SWZE 4AT6B 3WHE0 2OX5A 1CD8A 4OZGF 3FOLB 4HUMB 1IGFL 3H7BA 4P2QB 1HNGA 3OZ9H 2YXFA 1N59A 3MNVB 5I6XB 5D7SH 2E7BA 5DJAB 4BZ2H 4OZHE 4QHKI 1DJSA 3VWJB 4HC1A 3OF6D 3O6FA 4Z9KB 5HDOA 3GKZA 5T5FH 4ODTH 3GB7B 4GJTB 4Y8AA 2Z35B 1U95A 5EIIA 1EGJL 5DVLA 4MA1C 2NY7L 4DKAA 3RAJL 3VXRA 2NTSP 4TSAH 1CFNB 2JTDA 3QBTB 4ALAL 4ONGH 4QRQA 1YEDB 2OMNA 3RU8H 5IW6A 3PGCB 4MXWL 3P30H 5DHXB 3ARGA 4N0CC 3BFOA 4U7KA 2X41A 1BAFH 3WJLA 4L1HA 4PRHD 4M6OL 1QSVA 1Q0XL 2LU3A 2YD7A 1U3HB 3RNQA 4YHOH 2W65A 4LCIL 3L7EA 3SDCC 4MVBD 1OGAA 4KV5E 5I1JH 2XA8L 1F11A 4E0RA 1W2KT 2D7QA 1HHIB 3OMZA 3PGFH 43C9B 4JAMA 4JFFE 3GMLB 4NNPH 5I1KL 3TBTA 2VZUA 3U1SL 4QGTA 2CH8A 1N2RB 4OGYH 3E6HA 5B38A 3U6RB 4U1GB 3MLVH 1UM4L 3G08A 3HAEG 1T3FA 3BKYL 3LRSB 1BZ7B 1RJYA 4M43H 3SPVA 4IIQA 1KYOJ 4JFPB 2YXMA 1SJXA 1R5IB 1YEEH 5CIPH 3OBAA 2J88L 4P2OC 1AJ7L 3HNTL 3P0YL 5DJDB 4NUGH 5J6GB 4BZYA 5J06A 1Q9KB 2Z8VC 1CFTB 2ARJQ 5C0EB 2OI9B 4Y4FD 1QFWH 5E9DD 5I76A 3N9GH 5DO2C 5ERWB 4CADA 1NC4D 4LLUB 4NQEE 4PJ8D 4LHUA 4M7LT 1IJ9A 1YQVH 4PJCB 4JDZA 1A1NB 2VO5A 2MQ0A 4YE4L 3F58L 1A9EA 3EDDA 1IGTA 5BJTA 5TF1H 4PJ5D 3EJYD 2ZUXA 1F90L 1LDSA 1I8IB 1RUML 4BSWB 3K46A 4DEPB 2QV2A 4GKSA 5DLML 2X89D 1GC1C 4G6FB 3WS3A 1P5UA 2D0GA 4ELMB 1GXEA 2ADFH 4PRID 4K7PY 3T08A 2IADB 1VGEH 3QIUC 1JTOA 3I6LD 5I1CH 1F4WH 4ODSL 5C7XH 1K4DB 3DX6B 1MHCA 3WV0A 1KPUA 3KYOB 3ZKXB 3MSPA 3DJ9A 1NAMH 1IEAB 4PRBB 4GLRH 3D3VE 4KDWA 4GSDL 1OOAA 5C70A 2BNQB 5DSCB 1WVZA 3MREB 4P57B 4XHJD 5TGBA 2AVGA 3UTTD 5IOPA 3MQIA 3DGGB 2YC1A 3O45B 4R7DA 5DQDH 3WHXB 4X7EC 1DR9A 4GT7A 5L8LB 4QRRE 1LHZA 3TO4A 3MLSL 5I74B 4UQ2B 1VADA 1LO2L 3RWHB 1K6QH 3PXJA 4M5ZL 1LO4H 3G5XB 5INCB 1ITBB 4GRWE 1JGVH 1JHLL 2NY4B 3H3PH 1A7OL 4RWYH 5E8OB 4RFNB 1FAIL 4X6CF 3WUWB 4LLDB 4R8WL 3GSNA 4RFOL 3TYGH 4XCNA 5FYLD 1CXKA 1ZLVK 1U8JB 3WXVL 3G9VA 4LASH 5A16B 4I4WA 4LLQB 5ADPH 2Y5EA 3FQRB 4JREB 3ALPA 4HK0A 4PY7A 2DLEA 3P77B 3U0TA 4MJ6B 1UZ6E 1XGRB 5C0AD 2C3GA 1OTUC 3GSOA 1MUJA 1IQWH 1QNZH 5EH1A 4WTZA 3GMQB 3KPSB 3AU1B 1FCCA 4XPTH 4ZTOH 4D9RE 3NN8A 3TIDA 2EDQA 5ADOH 3RY5A 3IJYB 4U1IB 2YPLE 1MJ8H 1KF9B 1RZGB 2DL2A 4P3WA 4OZGB 5FYJE 4C58B 1OHQA 2WBWB 4KMLB 2IQAA 3NIGE 1M7IA 1KB5H 4N9OB 4V1DB 5MP6H 3VGBA 4PTUA 3DXAE 2JJSA 1UG9A 2E7MA 3X14B 5MHSD 5TPWL 2IGFL 4Y8DC 3SJVA 2YUVA 1ORQA 2CLZA 2HJLA 1G7LB 4WV1C 1E4XI 4TQEL 3ZYZA 4NP4H 3HRZB 4HH9B 3SGJC 2IBBA 4JRXE 1YEHH 3QI9C 4Z0BH 2NY1B 4JHAL 5TQ2L 1W72L 1U8HA 5E2JA 5IVXA 4P4RA 4LLVA 3SKMB 1FZJB 2A6KA 4LQ1A 4Y4KA 3RPKA 3DUUA 3AS0A 3VWKA 2Q3ZA 5FYKD 3T4AB 4OCYH 5L2KD 5GGTA 3KPRE 2HT3D 5LBSL 5IEKA 5IBUB 4ODBD 4LCWB 1G7IA 1CK0L 1JGUL 4PPTA 5HI3C 4EVNA 4QXUH 4P49A 1NCNA 5CEZE 5CKAA 3RL2B 1PG7X 1EAPA 4MLSA 1I8KA 5IVNA 3A6OA 1UQSB 5CBAB 5DEGB 1NBYB 4XVUC 4YBQD 3SE3C 1IFHL 3N0PB 1LK2A 4BUGA 1BBDL 2HFTA 3STBA 3QXAA 5DD1L 4JM4H 4R97B 4NKQB 2VLKE 4ONFL 4EBQL 4TPRH 5T3ZL 5JR1L 1HKLL 4MSWA 1OB1A 5CLWA 2LAGB 3FKUS 5IESH 3CC5A 3T3PF 2C3VB 5T3ZD 1ACYH 5JUEL 5FUCC 5JDJA 4MAUL 3K74B 3U7WL 4M6MH 4PJHF 3VMOA 5DYOA 1CGWA 5B39B 3WFEH 4HZAA 4PJFA 5FO9B 1U8IB 1V7NH 1JIBA 1ZEAH 3REVA 1HQ4A 3UYRH 4KUCF 2NZ9D 2VITA 4AM0B 5FA3B 3BKML 2IALB 4I2XB 1MVUB 3FQUA 4GRMA 4RQQA 4NBZB 3RWIB 4U6YA 4R4BB 1JPGA 2PYFB 3GMMA 3QDAA 4FFZH 3ME0A 5FKPA 4HUWB 2H6PA 4P9HC 4NZUL 5LXGL 2D7TH 4PJXA 5FEBA 1T89C 1YEJL 2ZCHL 3HE7C 1C5BL 1O7VA 3QQ4B 3QDGB 3UTQB 1MJ7L 2CUMA 1NCDH 5DJ2A 3U7YH 3VRIA 1FL5B 4POYA 3TH3T 3DHJA 1MFCH 1PGRB 2FX8H 5DJYA 1G9NH 1U93A 4P3DB 4NC1E 4YHKL 3VE0B 4K9EL 1MPAL 3RWGA 4I13B 4EI5B 2FO4A 4Y1AA 1L6XA 4XBPB 4XMPH 3M1BA 4OQ1A 5TE7H 1IZKA 1QSED 2H2PD 3ZKMD 1CGVA 2CJUH 3TBWA 2DAVA 2H2SD 4WHDA 5HHQB 3MRHA 3KDMA 1P7KA 1CXLA 5DRXB 4LCYA 1I1AB 3TGXA 1J1PL 1OGAE 4OFPA 5JZ7C 4MGXA 1OW0C 3GKWH 1X6NA 1WFUA 4P2QD 3UJIH 3JV6B 2R2HA 2XG5A 3CX2A 1LO0L 1FLRL 1DQJB 2DLGA 1RIHL 4BH8A 2XZAL 5EBWA 3O9WA 5HGHA 1RFDL 5HHXL 1S7QB 4KRPB 1AE6H 1S5IL 3WL9B 1WZMA 1CFSA 3WKML 5DGRA 1F3JB 3GIZL 2BNRA 4Z7VE 2F53E 2B5IB 4P46C 1RU9L 1JF1B 2BOBA 1T0MA 2OZ4H 3OKDA 2G75B 5AWNH 3V0WL 2F15A 1KB9K 5HHMB 1I1FB 4GQPH 5IW3A 1OAYL 4S10A 1T1WB 5CP3A 1ULVA 4E41A 4IJ3C 3B9EA 3KYNA 3VI3F 4CNIA 5AAMA 4NN5B 4MDJA 1KBGL 2PR4H 4FQXA 1DCLA 1I8MA 2YD5A 5D1ZB 3JVGC 4ZD3L 2X42A 1U3HD 4Z95L 4UINH 1BQHA 5LGHH 3RVTD 1WCBA 3LN5A 2ZSWA 3UXFA 4IDJH 4XPGL 3MRGA 3V4PH 3WDJA 5J89A 1B0WA 3QUMB 4XZUB 1Q1JH 3V8OA 2MWCA 1PZ5A 1CE6A 4MAYC 4PJAF 4OLVH 3DPBA 5C08B 1A6UH 1G6RB 1A3RH 3H9SE 4AY0A 2GK0B 5CJOH 1DE4A 1FNFA 2A6JA 5I66B 2YPVL 2EYTA 4FZEH 1RD6A 2WP3T 2Q6WA 4TTGA 4LBEA 3HE6A 4DGYH 3I85A 5IWLA 4LPXA 5GGRY 3QEGH 4ZFOB 1NGXB 1BZ9A 4M1GH 3CXDH 1ZKAA 3OXRB 3P9MB 5IEHA 2HKHL 3U83A 3P73A 2I60L 4LVNC 1SY6H 1ND0A 2BSSB 4WDIB 4GBXB 4Y89A 1FJ1A 5AZEH 4NQCD 5EBGA 3MX0A 4LNRB 3SDAA 2C9AA 1DBAL 1MEXL 5BZWA 2YRLA 3HI1A 4F9PC 1FVCA 4ZOCA 4U1LB 3EO1B 4Y16D 1GZQB 3R1GL 4Z7NF 4G6FD 4I3SL 4XNQA 5T1DL 2Z31B 2X05A 4X98B 3VXPA 5EZOH 2ADIA 4HGWB 2WW8A 4D3CL 3D85A 2QR0B 4PJHB 3NABL 4NRXB 2AK4A 2PCPA 4FZ8L 2IQ9L 3ZL4H 1WISA 4WIQA 4FNLH 4P5TA 3FO1B 5DJZB 4BELD 5D7KE 4DVRH 1MRCL 2X9XA 5C3LD 2X70B 2ATPA 3I6GA 3GBLA 1MRDL 1I9JL 3TBYB 3DTXA 4OV5B 2NXZB 3KNBB 2ORBH 4G42A 1A6PA 5E2UL 1JE6A 4X9BA 3PHOA 2BVPA 4MJ4A 3IFPA 4IRSA 3C5ZD 4RIRA 5T33H 5IHLB 3BPNC 3SJVE 3MBXL 1ROWA 1ZHNB 1RUQL 4FXGB 1OAXL 4XPFH 2VAAA 4Z8FH 4OI8A 1EO8L 2NY4D 1MNUH 4HIXH 5HJ3B 2GJ6A 4PUBH 1AHWA 2BVEA 32C2B 1T0PB 1ZT1B 2YRZA 2WINA 4GAYA 3MRMA 1AFVL 2EDDA 1BQSA 2G9HB 2X9WA 3KWWA 1NGPH 4I5BA 3BP4B 2HLFD 4RGOL 4KJYB 2PO6D 4FQCL 3TT1L 4TUKH 4OF6A 2GUOA 2X1OA 2C1PA 2IFGA 3A67H 5F7EL 1OP3H 4WGVB 2HJFA 5DMIL 4UDUB 1DLHA 4XBEH 3RL1A 3O3DB 3KPSD 3N1QC 2FX9H 4KVNH 4Y2DA 2EKSB 5DRZA 1T21B 2X40A 1Z9SA 1OCWL 1NUGA 2X4UB 3ARDC 4ELKB 4PGEB 2CLVB 1DEEB 5F7DA 5L88H 1FZMA 1VACA 3EYVB 2YR3A 4G9FA 2VISA 1NFKA 4JANB 4M8QB 1TVHA 2BHUA 3WIIH 5JW4R 1EBAA 1A6WH 3U0WH 1RIUH 4R96A 5C6TH 5E99L 3CPLA 5FM5M 1MFEL 1QYGH 5JPMB 4L9LC 2C7UA 1YNLH 3QEHB 3ZYOA 2BJMH 1IC5L 5HGBA 4YBLB 5AZ2H 1EXUA 3TA3B 25C8L 4ZFGH 2NY1D 4GS7B 4K3EH 4UTAL 2HJKA 3TNMB 1T4KA 2WMPA 2A0LC 4KUZH 4NWUL 3UX9B 3CFDB 4LP4A 3ESVF 1FNSH 4X99B 4NGHL 4EUPA 1JWMA 2RHEA 1IGFH 2BERA 5E56A 5ESVB 2ZG1A 3L3IB 3VDCA 4XCCH 4MQTB 1GCFA 5I73C 3S88L 1T1ZB 3CCHA 3GJFK 1A7RL 5SWZB 2DLFL 2VLLB 4C56B 5MEPA 5T3XL 3K81A 4PJAB 3V0AC 3DWTA 1FNGB 3O8XC 2NY7H 2ED8A 3MV7B 3NIGF 2HWZL 4L3EB 4JFDA 4KWUA 5T3XD 4XNZB 1SBBA 2A83B 2Z4QA 1MH5B 3VFUA 4Y1AE 5FF6B 1H8SA 3CFKA 5J57B 1P2CA 2R1YB 4HUUA 1FYTD 4GFTB 3SGEI 4MNQA 4O51A 3VCLB 3OGCA 2DLIA 1XIWB 1EFXB 4FFVC 5JIIA 2OSLA 3UEZA 2OTWA 4WEMB 1HCFX 3D25B 4M6OH 3EO0A 1UWXK 5HYIA 5I15L 1Z3GL 3Q5TA 3U4EA 2LE9A 5EA0L 1K85A 3L1OH 4KU1A 3JTSA 3GSQA 2VQ1B 2QHRL 2CKBH 1I1YA 1GOGA 5EOCJ 5FGCB 4AEEA 1B2WL 5C2BH 5I1KH 1H5BA 1KLUB 2DD8L 1GRWA 1AP2A 3MACH 4ZOEA 1HHKA 3TEUA 1TIUA 1DDHA 4HKXA 4URTB 4KTDL 4A2LA 2BNRE 4H88L 5DD0L 1M1SA 1NBZA 2CGRL 3IKKA 3U79A 4A2MA 2IAMC 2R23A 2VKWA 5GZND 4AENA 1CBVL 2GFBB 4ZPTB 3N85L 2BVQA 1Q9LB 1JBJA 4LGRB 1Q38A 3DO7B 2PTTB 4E41E 4EI5D 1IAIM 1QFUH 3EYUL 1U92A 3HNTH 3P0YH 2WWKT 3OX8B 1BHGA 3QH3B 2FR4A 3JSSA 2QSQA 3GSXB 4AL8H 5JOPE 3BE1L 4J3SA 4N0UB 4HUXB 1ADQL 3UTZA 1CGTA 3ZDXF 3W0WA 4MXVE 43CAA 4DKFH 3JUZA 4K3GA 3WCYA 4K2UL 1I1AD 1UC6A 3F58H 4YE4H 3EFDH 3RBSA 1KJ2A 3GSWB 4Y5VB 1G0XA 1DBKH 3IAQA 1INEL 4NDMB 2HP4A 2D7MA 1RUMH 4HJJL 1UVQB 2APWA 4NQEB 5F1NA 3ARFB 2PTVA 4IDLA 2GJJA 3WN5A 5BV7C 3X11A 3O3EB 4KRPD 3HN3A 3KPNB 2GTZA 3MNWA 1YDPB 1KEGL 1AR1C 4ODSH 1F2QA 3D48R 1DBBL 3O81A 5JHLH 3WFZA 5FGBA 1QBLL 4OM1L 4OZ4B 4PREA 4GSDH 5HHMD 2QQQA 5KSAB 4L29B 3H6JA 2DRUA 4WFFD 15C8L 4HS8L 1XT5A 1MI5B 2E9JA 4FG6D 3E8UH 3V6ZA 5MEOA 3RI5K 3MJ6A 1HWGB 4WI3A 1TJIH 2OCFD 4HKZA 2GAZA 4FXKB 4I1NB 3OAZK 1KCLA 3K2MC 3MLSH 5E94B 1YNKH 1BD2B 5C9JA 4NQXA 3FJTA 1NMBL 5F93C 3I50H 4K23L 4M5ZH 3QUML 5EC2B 2ZOKA 3MLTB 3RWEA 2FBJL 1HHJB 1XCTB 1JHLH 4JPKL 1NKOA 1A7OH 5F21B 3NA9H 5K9QG 1YN6A 3IDIB 5FYLH 3BDXA 4ODXA 3Q1SL 1HEZA 2LTQC 5TF0A 1TNNA 3OB0H 4BSJA 5ICXA 3ILPB 5C08D 1V3MA 3U46A 5DD3L 1J1OH 4YHZL 4WI6A 3PUCA 2I07A 1J05A 3WXVH 5TDPB 3QIWB 1C5CL 4GXUM 2AK4E 2NY6C 3T0EC 4ZFOL 4L4VA 3MRJA 3KYMB 1BOGA 3MCKB 1N5AA 3DBXB 1Q9OB 3QQ3B 2XY1A 1JK8A 5E5MA 2KPNA 1RUPL 1EJOL 2EEAA 4ZAKC 3GNML 4ZS6C 3MODL 5FAAA 2FWOA 5JHDA 1T2QH 4I0CC 1FFNA 4GBXD 1N7MH 4RAVA 2VRAA 3DYOA 1FSKC 4HX1A 5CIPA 1KCKA 1T22A 1NDMA 3UCRA 1KTDB 3GBNL 1UKTA 1U8KA 2IGFH 3PE9A 4TSBL 4UNUA 5KVEL 3EO9L 3GIVA 3V8CA 4PR5A 2OP4L 4L8DA 2GJ6E 4X5XA 2Z91A 2Z31D 1FPTL 2ZUSA 5I1HH 3VD9A 3BO8A 4Z7OE 5CD5C 1W72H 4A6YB 5FYKH 4JFQA 3OKOB 5EZJA 4U1NA 3NCYS 4YHNA 2D7OA 2IH1B 5T1KD 1AD9A 1TVBB 5DK2A 4AEIL 4AQ1B 3ULVF 1A0QL 3VGGA 4GH7B 1JPFA 1CK0H 1JGUH 2VLME 1TTUA 3FB7A 4J6RL 2BSRA 5FM8A 4RA0C 4U4BA 4KUCD 3GMPB 3MOBL 4O2CB 1UWGL 4MDIA 4ZYKA 1HSBB 1KJMB 5MI0C 4LPCA 1XF4B 3OAZH 3V6FB 4WUUA 2NXZD 4YWGL 2OJEA 4G9FE 1HKFA 1NAMA 5GS3A 4UZGA 4EBQH 2BFVL 5T3ZH 1Z2KA 5JR1H 3QEQA 1CFVL 2W9EL 1CT8B 4CW1A 4JM2A 4BFIB 3MR9B 1VGKA 3TLRA 4OF0A 3RPIB 3C6SB 4RMTA 1LE5A 2CXKA 4LFHD 1NGQL 3SE9L 4MAUH 1HHGA 1TCMA 4JO1L 5E24E 4X7CC 5JLZB 1MFAL 1Q9WA 3SY0A 5LVEA 2NLJB 1T7XA 2VLKB 5EOQL 5A2KH 1TZIA 4XWGL 1MJUL 4P5KB 3EJZD 2W91A 5EU3B 1BJ8A 2HVJB 1DANT 4F57H 3PDOA 2XN9B 2A73A 3F7QA 4Q0XL 2VSDA 1K8IA 3S4SB 4LSUL 4U7MA 4B5EA 2MHAA 1QVOA 1ED3B 5ELIA 4L3CB 1T5WB 2UY7A 4TVPL 1FLTX 5LXGH 4XVTH 1A9BB 3IDGB 1YYML 4OCWH 2A6DB 1C5BH 1DVFA 4TVPD 3BQUB 1TDQA 5I0DA 1X7QA 1AGFA 3H7BB 1MJ7H 2APTA 3JWDH 3LS4H 4OGAC 2JKXA 2P46B 2VDLL 3QG6A 2EH7H 5AD0B 1TCRB 4YHKH 3NCMA 5A40E 2HKFH 4YXKH 2AV7A 3C5SA 4RAUB 1OM3H 1JNJA 3O6FB 4RRPA 3TA3D 4LP5A 1U95B 1WITA 3QPXL 5EIIB 1KB5A 2YUZA 4X6BB 3HCVB 3VXRB 2ICCA 4Z5RA 4R26L 3PL6D 1TZGL 5IVXF 5JIKA 1FG9C 4FQJL 5SX4I 3V4VH 4QRQB 2AERT 3O3AB 5I8EA 4UBDC 5IW6B 2VAJA 1R3KB 1RZ8B 3W11C 1E27A 3C60C 1LO0H 3ARGB 1FLRH 3O4LA 1QA9A 4NO2A 3W2DL 3ARBD 1CL7I 1RFDH 5HHXH 2WUCL 5IB1A 4Y5YC 4M6NL 3MGAA 1S5IH 4JZJA 3L7EB 3WKMH 4NKOB 1F11B 4C56D 3D69B 1JZ7A 2YRPA 1SVZA 3VXUE 2F19L 4HIHB 1BREA 4GMSH 2B1AL 2E7LC 1WT5C 2UYLA 3V0WH 4L3ED 4FFYL 1D6VH 1MHHA 3SE4A 3O41A 5KG9B 1RJLA 4POZC 5B38B 2J8HA 5L2JB 4YPGA 1OAYH 4OIBA 3BUYA 3G08B 4OSUL 1D5ZA 1UYWL 4KMTL 1T3FB 1KBGH 4L8CA 4LSRH 4DAGL 5JW3H 1E0OB 1RJYB 2PTUA 1XIWD 1EFXD 4JRYA 1UEMA 2J6EL 3F6IA 1N3NB 2EC9U 3W0WE 4ZD3H 2F5AL 5BW7A 2ZUVA 4PP2A 4PJFF 2JJUA 1ZOXA 2XQYG 3S35X 1VPOL 5E8DL 3ARUA 5FOBA 4PJ9A 1NQBA 4CU6A 1A3QA 3GI9L 2DLTA 4CADB 4X5LA 1BLNB 2E27L 4LHUB 4MS8D 5EFIB 5INDA 5KVFL 4JDZB 5T5NG 3WSQL 3S36X 5L0QB 2J8OA 3WFCL 1A9EB 5BJTB 5CD3A 3V5KA 4LMQE 5I18L 1R0AL 1YEKL 1RHHA 3FL7A 2JK5B 5K33A 5IB4A 3QSKB 4WFEE 4PJXF 4TULH 2YPVH 3VFOB 4GKSB 4HKJA 3WS3B 4XXDA 3FT4B 5E0QA 3VFPB 4MCZA 1WGOA 1R6VA 5F3BA 3CX5J 3TT3L 3BP6A 1PAMA 3MA7A 2R1WA 5E1HB 3UJTH 1MHCB 1KPUB 4K7PX 3HZKA 4I8DA 2E6QA 5KVDL 3QWQB 5EUKA 1DQQA 4PP1D 4KTYA 3WFDL 4V2CB 4Q2ZB 2R4RH 5IOPB 3K4ZA 4R7DB 3IF1A 1RZKC 4DTGL 5ESAB 4F2MA 4I3SH 4H0GA 1TQBB 4PY8I 2ICWA 5T1DH 3TO4B 2R2EA 1A1MA 4JFED 3OKNB 4D3CH 2QSCL 2SEBA 3L3DA 3NABH 2HVKA 35C8L 2F8OA 1JHKL 3U30C 2QADD 2JIXA 4NSKA 1LP9F 5KSAD 5EU5B 3MRIB 3QQ9C 4QHNB 4OJFH 2PW1A 3FFCA 2D9CA 2YA2A 3Q6GL 4M7KH 4PTTB 2H1PH 4I4WB 1RUKH 3PDGA 5EBMA 5JHDE 3SDXA 3SKNA 4PY7B 4J3VA 3B9KA 3RKPA 1Y6KR 3ROLA 1BD2D 1W0VA 3BH8A 3RIFK 2OZ4A 1MREL 1YC7A 3ULUF 2BRRL 1MUJB 3CSPA 2YD2A 4PJ7E 1IGML 3NN8B 3TIDB 2ADJA 2ICEA 4AH2A 4F7CB 3VFTA 3IDNA 3TH2T 5D7JC 1QUNA 5FYKU 2ZUQC 1CLCA 1KIRA 4M6AA 5DF0A 4F7MA 2IQAB 3HE6C 1PBYA 2W0FA 2VERN 3BZ4B 1BMGA 4MQSB 5ISZA 2W38A 2EDNA 2EO9A 1H3VA 3O3UN 3QIWD 5KTEL 2UZYB 1ORQB 5GRVK 5HI4D 4FQCH 2CK2A 3S35H 5IFHL 1KG0A 3MV9B 1CXIA 5IKCB 4NQVA 5F7EH 4YR6B 2JB5H 5F9JB 1F45A 5DMIH 1HILA 1QBBA 4M62H 1U8HB 1ZLUH 4P4RB 4LLVB 5E03A 3QPQC 5IVXB 2A6KB 1DUYB 1OCWH 2VUYA 1LE9A 3VWKB 4H25B 4WEUD 9CGTA 3S5LA 5IEKB 2R15A 4EVNB 5FO8B 5F6IB 5ACZB 2P45B 4LVEA 3QEQE 2EXWC 1EAPB 4JZOA 5H35B 1MFEH 3W9EA 5JO5A 3MLPA 3EOYG 4A6YL 1IGIH 1SY6A 4M1CD 1M7DA 5IBTL 1P7QD 5KSUA 1LK2B 25C8H 2VLJD 3VFRA 4P59L 4UTAH 4F80A 1YJDL 2W59A 3KPPA 2ESVB 1JGLL 3DROA 4QWWC 3RVUD 2FZ3A 3VFNB 3DMMA 2YPKA 4G6KL 1FVDB 1FZOA 3VXSA 1FFOA 3CFEB 2E6JA 3UJJH 4FN0A 2XIDA 3CUPA 4NGHH 5GS0D 5IF0B 2JF1A 3TZVD 5DYOB 4PLKD 3KJ6H 4WU7A 1QO3A 4PJFB 5EB9A 7CGTA 4X80L 1AO7B 1UFUA 4IRSC 1HQ4B 2BHZA 1IC7L 1DN2A 2VITB 1QKZL 1X6LA 1KIUA 4Z0XB 4M7JH 3KXFE 4HT1L 1B0RA 5CEZL 4E5XA 3NH7L 2ARWA 3GHBL 3FQUB 4GRMB 2DLHA 2MPAL 4U6YB 5T3XH 3GMMB 1KN4H 1NUFA 2VDKL 4MNGB 2VUOA 4PJBA 5TDOA 4PY8J 1HIMH 4PRPA 1WWCA 4PJXB 4LSVL 5A2JH 2UY6A 2WQRA 3LMJL 3VRIB 4BM7A 4UT6L 4MD0B 3DVIA 4Y0GA 5DJYB 4OKVA 1U93B 5IQ7H 1PYWA 4JQVC 5C71A 1KCRL 3RWGB 2FO4B 4CU8A 1F3DJ 5ENWA 3THMH 3LQAL 5D5MF 2XZCL 2XN9D 4XWOD 3FN3A 3TBWB 1NMAL 4GXVL 3P11H 3LY6A 2DD8H 3O4LE 4RMUA 2ZOLA 2ZKHH 4JO3H 5DTFA 2DF3A 3OJDA 4LCYB 2Y07H 4EJ1C 5GS1A 3MJ8A 1NFDA 4KTDH 4H88H 1HH9A 3BQUD 4MA1B 4WI4A 2CGRH 2VNCA 1L0XA 2R2HB 2E5EA 1D5MB 2N7AA 3N1PC 3MRLB 2CO6B 1QLEL 2AJXL 4OUUA 4BH8B 3O9WB 2FL5A 5HGHB 1U8NB 4MQXD 4GW1B 4U0RC 1CFSB 2BNRB 4O2EB 1ORSB 2NCMA 3UBXA 2HFGL 1OTTD 3FZUC 2CDGA 3BE1H 4PV9B 5DI8A 3CFCL 5EOCL 3B2UC 1MIEL 1CG9A 2YMXH 1BJ1H 1ADQH 1RMFH 2BOBB 3VXRD 1WC7A 1X5FA 4WY7H 4K2UH 1KNOA 1YY9C 2BXZA 4ESKA 4HF5H 1XAUA 1ZSDB 4Y4HB 1PKQA 3AXLA 1EZVY 1F4YH 4JJHA 1INEH 3KYNB 4CNIB 1VFAA 2K9UA 5DT1H 4MDJB 3LSOB 5K59E 2P5WE 3G5YA 4FQXB 3FONA 4KZEL 3QWOA 2WUBL 1U3YA 3CH1A 1I8MB 1YN7A 5IMOA 1BQHB 4UT9L 3MXWL 1Y18A 2L4OA 3CZFA 3LN5B 2ZSWB 3VXQB 3GHEH 1CLZH 1TENA 4WW1B 3MRGB 1DBBH 3MC0A 3KLDA 2X5PA 5EO1A 4GLRI 4OM1H 1NFIB 1CE6B 2MTPA 2COQA 5C09B 1F3RB 2DQEH 1K5NA 1EUTA 4DOHB 1DE4B 4OD1H 1U2CA 3UDWA 1BP3B 5GRWA 4DGVL 5H8DA 1G9MC 2R9HC 3E0GA 4KROC 5F7WC 4LBEB 2Q6WB 1II4E 1P1ZA 1GGBL 4AMKL 5HYSA 2BC4A 1BZ9B 3DETC 3QUMH 5C8JB 4OZFH 5D1XD 4S1QL 3LKNB 5IEHB 4JPKH 4HLZH 4PRHA 1KTLA 2F74A 2BY3A 2Y72A 3X17A 3MA9H 1G6RH 1FJ1B 3BPLC 2CUIA 2DQJH 1XMWA 5D72H 3QYCA 3SDAB 4J3OC 2YS4A 3MUGA 5DD3H 4YHZH 1FVCB 4P4KD 4S0SD 3FRPA 4OV6F 3B3IB 2CKBA 1NCBH 1E6OL 1WEJH 2EIZB 4G80A 3T4YB 4U6VL 3IFLL 4XNQB 3UPAA 3ULVL 2WBKA 1XGPB 5B22A 2EE3A 3AREB 3N1GC 4NCC1 3Q3GA 1RUPH 3FFCE 3VD3A 3ZE2F 1KV3A 4K3JH 1IM3A 2ADIB 3MLZH 3ULVD 3DSNA 1HWHB 2GTWB 1EJOH 1FE8H 1Z5LB 2XZZA 3NAAL 4R7NB 4XAKD 3GNMH 3MODH 4NC0B 4M61A 2J12B 4QT5B 3HZVA 5SWQA 3QHFL 2IPKA 3VDBA 1C7TA 3O11B 1R3LA 1ZLWK 3WN5C 3BRGC 4Y4FA 5E9DA 3WE6A 2B39A 1IKNA 1NC4A 4PJ8A 1T66D 5KVEH 4TSBH 2ATPB 5F9WB 5DGQA 3NCJH 4PD4K 4DZBA 5FGBC 3OR7A 1FPTH 2EECA 4GMTL 4KZDL 4LQFH 5DJ8A 5ISZE 3BEWB 5FUZL 2NY0B 1PY9A 1QBML 1JUFA 1AXIB 3IFPB 5FK9A 4I48A 4L8SA 2X89A 1X5YA 5JIPA 2VAAB 1XZ0B 4IMLA 4PRIA 3SCMC 4MA8L 3MLWL 4NKDA 3HTLX 4HZLA 2GJ6B 3ULSA 1WQVT 1AHWB 2XOTA 4J8RA 4KC3B 4FHBD 5E7FA 2B8OT 5GGVL 2WINB 4K8RL 3MOBH 3MRMB 5I0ZA 1NC2D 1XFPA 4Z76B 3GJFA 1UWGH 3KWWB 4ZFZB 1J5OL 4EKXA 4K8RD 4OLZL 2XZQL 2R0ZL 4ZUTB 4B7LA 2Y4SA 2C1PB 4YWGH 1QOKA 2NXYB 3UTTA 2H45A 2HJFB 1JFQH 5E4EB 4J3WA 4Y88A 5KOMC 2BFVH 1JNHB 4XCFL 3RL1B 4LSPH 3EYFA 4JPVH 5J3HC 5FB8A 3ZT6A 4MJIA 4M9OA 3QI9B 1NGQH 3TV3L 3LAFA 2NX5D 3QCUL 4YFDB 3M07A 5F7DB 1FZMB 1VACB 4JO1H 1I7UA 4ZPVA 4N5ED 4JFYB 1MFAH 4PJIA 2VISB 3BEVA 1XGUA 2DMCA 1I75A 1TVHB 3BZFA 3REWA 5C0BD 1YMHA 1DUZA 4R96B 3O6KL 1LK3H 1MJUH 3CPLB 3ZHDA 5HYJA 5C6WH 4AIOA 2V2WB 1MCOL 3MV9D 4XXCC 4OFYD 4LF3A 4NJAH 5K9KA 3SGKA 5HGBB 1EXUB 1IBGL 3CIQA 1JNLH 1A7NL 2HJKB 4JN1L 5CEXA 4TVPH 3WFHA 3VWKD 4O02L 3T0VA 1YYMH 2BK8A 3ZTNL 5DJCA 4ZG1A 1QEWA 4EUPB 1JWMB 4X7FC 2VDLH 1H8OA 1ZTXH 1PG7W 3BD5A 3BP7A 2VXUL 1WAAA 2EDXA 5I1IL 2QLVB 3CCHB 2QQKL 5C0GA 5DUML 1ZHKA 5D70L 2ICWI 4N90E 3N50A 5MEPB 1FDLL 3QPXH 1ZGLA 4QHLA 4P23D 2ESVD 4WW2C 1I9IL 2QTEA 1TETL 2DQHL 4JFDB 1TZGH 4FQJH 2C4FU 1U91B 4QKXB 3SDDC 5C0ND 4BYHA 1P2CB 4OCMC 3VFMA 1GGYA 1DSFH 4R0LC 1OAZL 4MNQB 2XT1B 3MOAL 4JKMA 5L2KA 1AO7D 2OSLB 2OTWB 1CDCA 3HE7B 3SHSA 3EO0B 1GAFL 4O58L 3W2DH 4PS4H 1MCNA 3U4EB 4P2RE 1ZWIB 2A74A 3D18B 1K4CA 5DVKA 3JTSB 3MRKA 1L0QA 4PG9B 2V6HA 3UC0L 2B1AH 4RBPK 1H5BB 5GIRA 3TCXA 1CDBA 1AP2B 1NL0L 1HHKB 3EHBC 1A7QL 1DDHB 1HYSC 4JM2F 3S98A 3JZ7A 4JPWL 1Z9LA 3MV8A 2JJVA 4G43A 2X1XR 4OSUH 4EN3C 3KPQA 4KMTH 1CLOL 4BFBD 2GQHA 4DAGH 1ZHBA 5GRZA 3SKJH 3VD4A 4ZO6A 2NW2A 1VFUA 2DQDL 4ZSOA 3T3ME 1XEDA 4AENB 5C0FA 4F37K 2BVQB 4QLRA 1PKQE 3BZEA 1WTGT 5GGSB 3IFNH 5FM5O 4J1UA 5KSVA 1U8PA 4DUVA 1VPOH 3FO0L 4C55A 2FR4B 2MCG1 3GI9H 2HT4D 3UTZB 5KVFH 43CAB 3QUYA 2MCPL 3MLUH 1E28A 1URLA 5IFAL 1JNNL 5M95B 1YEKH 1MCFA 2EDJA 3SEPA 1EV2E 4XP9H 1BF8A 3H7LA 4G6JL 3BPCA 4KKLC 4JKKA 4NNXB 3RZCC 1T1YA 4YDIH 5F1NB 3LEYL 4IJ3B 5TFSL 3O9WD 4ENEC 1BBJA 1J0JA 1GHFL 1XCQA 3CLEL 1WLHA 4G8FA 4LVHC 3TT3H 4N0CD 3IFOA 3MNWB 2V7HA 5F7FA 1KFAH 5A3IC 2GIYA 5T1MB 1CIDA 2RCSH 5ID0A 4PGBA 3R4DA 2AABH 2Q20A 3SDCD 4MHHI 4KGLA 5KVDH 1I7RB 1RZIB 3SQOL 3VD7A 3RDTC 1A8JH 4Y4HD 4RGMC 3ULUL 4JZJC 3ZDYE 4NKMB 3V6ZB 1DQTA 4MAYB 4PRHE 2R0LL 2ZCLL 2BY1A 1S7VA 1Y6MR 3ULUD 3FT3B 2XWJB 2DTSA 3KG5A 3VRLF 2NR6C 3G6DL 4X5WA 1TLKA 4NQXB 5C9JB 5E2VL 4BQ9A 2YN3A 4P2QA 3E1F1 4GRLA 4WI7A 1I8LA 1V7ML 2QSCH 5HSFA 1EVUA 2E6PA 5C0CA 4YQXL 35C8H 1YYLL 1JHKH 4HG4J 4XT1C 1YN6B 3O2VH 4HXBL 4NO3A 4ODXB 4P2OD 4NWTH 4D8PB 3LIZL 3VW3L 5C09D 4NN6B 5DO2D 3STLB 3Q6GH 2ICWJ 5CJ5A 2X7LA 2I24N 1J05B 3OXSA 5ITBL 3LCYA 4PRDB 3G5ZA 3EYQD 1IAOA 1VERA 4L4VB 1BOGB 1OQXA 1N5AB 4XP6H 4TTDC 1JK8B 3NCFB 1S9YA 2BRRH 4Q6IB 5E5MB 5E9DE 2RJMA 1IGMH 4LSQH 2MKLC 2VMFA 2W9LA 4EXKA 1ZVYA 2FWOB 5I1GL 4J12A 2BMKA 5JHDB 4XPAL 1G0YR 3QIUD 1U3HA 1FFNB 2LU4A 5B21A 5F1IA 2L7UA 2APXA 1WJ3A 4KK5C 1SEQH 4RAVB 4PJ5E 4KY1H 4ZODA 3MJ7A 4HX1B 5CIPB 4LNVA 43C9A 4JR9L 1NDMB 3GMLA 1U8KB 2Q87A 5KTEH 4LK4A 3GIVB 1FL3A 1AXSB 3L7FB 4PR5B 2CR6A 4X5XB 3U6RA 3I6LE 3FB6A 2Z91B 4NT6A 4NQDB 3ARED 3BO8B 1G9NC 4JFQB 5EZJB 1FGVL 4HS6B 1MLBB 2VL5A 1J87A 1AD9B 4RFEA 3O4OB 2ED7A 4KVCL 5K9JL 3UBXI 3UTTE 4OLUH 1JPFB 3FCTA 5DJDA 3BOVA 4XP5H 1ITCA 1A6AB 2BSRB 2F58H 2XICA 3JWOC 4LKCA 2BSTB 5ERWA 2CIKB 3DIFA 3PV7A 5HYFA 4MDIB 4PJCA 4NQCA 1D5BA 1LEIA 2CRYA 5IBTH 4WUUB 1V5JA 5EPMB 4KAQH 1AXTH 4W6YB 5MENA 1NAMB 4PJIE 5L6YH 2XQYK 4L4TB 5CWSA 1IT9H 3HHRB 1YJDH 2NY0D 4QRUB 3HI5L 4UDTA 4Y16A 4BSWA 4CW1B 4JM2B 5GS0H 4ELMA 5J9PA 1OTSC 3RTQC 3FQWB 1I85C 1OTUD 5SWSD 1V8HA 2EDHA 5FYLE 2YD8A 3FAXA 3MRQB 4HHAB 3L3GB 4IRJC 5E00A 4G8EA 1IARB 1Q9WB 3SY0B 1DTUA 4KDVA 3UROR 5F44A 3FTGB 3DX6A 3QQNA 2DI7A 1RULL 1UJ3C 4X80H 2IFFH 4ZNEA 4PRBA 5C0AE 2E9WA 1ZT4A 3FB8B 3U48A 1BGXH 2NXYD 3PDOB 4YK4B 3SDXF 3TPKA 2FGZA 2W92A 3FFDA 2A73B 4XPHH 4F7TB 2Z92B 2DDQL 3WEXB 5IVZB 3S97C 4YAQB 3WHXA 2MHAB 1QVOB 1P4BH 3PIQB 3B2VL 1X5ZA 2X4SA 3IDXL 2XTLA 1WAAE 3QI9D 4UQ2A 5I8KL 3RWHA 4LSVH 1XF2A 1DVFB 3G5XA 4Z78A 4LCCC 3C5ZA 1X7QB 1AGFB 4WO4A 3WMSA 2Y5TB 2CMRH 3CXHK 1DQLL 4U6TA 4CMHB 4UT6H 4ISVB 5E8OA 3DV4B 1MCWM 4LLDA 3VG9B 4IHOA 5HI3D 1MCLA 1KCRH 1JF6A 2B0SH 3C5SB 5IQ9A 3UTPD 2VLRD 3PWJA 1DN0B 2XZCH 3MJ9A 5A16A 1J8HB 2J4WL 3O6ML 4HGMA 1NMAH 2VC2L 4GXVH 5FYKE 2PO6A 3B43A 5L2KE 2XXCB 4Z5RB 5BVJB 5C1MB 1XGRA 3TM6A 3KPOA 5DS8A 2IBZY 1HOCA 3K4AA 3KPSA 2RBLA 3MXVH 5I8EB 1R3HA 2FNBA 1O0VA 3IJYA 2Y7QA 2NY5C 1E27B 4AG4H 4OT1L 1Q94A 5KW9L 4LLYB 4XB8A 1MWAA 1Z0MA 3F65A 2AJXH 2YBRB 5ACMA 3TVMC 2BVOA 5TH2B 4YFEA 5D2NE 4H1LG 3X14A 5IM7B 2HFGH 2VR4A 3CFCH 1G7LA 1MIEH 5T3ZE 2F54A 3CDCA 1G0DA 2XKUA 4MB5A 1MHHB 5GXBB 3HRZA 3F8UB 3VXNA 1LDPL 1KPVA 3HR6A 3DRQA 5IFJA 4M02A 4WWKC 4O2FA 1FZJA 4ORGA 4CDHA 4L8CB 4MCYB 4U1KA 2WUBH 3GGWA 3T4AA 2VN7A 4JRYB 4D0BA 4XNXL 4JQIL 3RGVC 3HE7D 3RHWK 1AR2A 2FEDC 4XMLL 3LOWA 3MXWH 4UT9H 5I1DA 1U8OB 4LPTA 3AY4C 3RL2A 2FHCA 2JB6A 2A9NL 1D9KC 3RIAK 5FOBB 3G6JF 4PJ9B 5D7IE 5EIVA 3QJFB 1FNLA 5CBAA 5DEGA 5INDB 4ZQKA 5DURB 1KIQB 3BD3A 2C3WA 4UB0L 1N64L 3V5KB 4PJBF 1RHHB 5C0RL 1F8TL 2KUTA 5IB4B 3GO1H 2FIRT 2Z0BA 2DQCL 4XXDB 2HTLD 5EU4A 5JZ7D 4Y5XB 5EZIL 1QSEE 5TQ0L 4MCZB 4AMKH 1FYTA 2MKWA 3B6SB 5B39A 5F3BB 5EORL 1JI1A 1U8IA 4S1QH 2EC9T 3MA7B 4ZNCD 1KULA 5L9DL 2N7BA 4AM0A 2IC2A 5E7BA 4I2XA 3HA0A 5ESQA 5F9DC 1MVUA 1G7JA 1CD0A 1DQQB 2NMSA 4P2QE 2DB8A 1U3ZA 5EUKB 4S2SA 4JFZL 3RWIA 3MLXL 4Y19D 2LAAA 4P46D 2PYFA 2QQLL 5DMJB 4WNQA 2ADGA 4HBCL 3TN0C 5IR1A 3GMNA 1NFDF 4F2MB 3P0VL 4U6VH 3IFLH 2ICWB 3ULVH 5CKGA 2XV6B 4JB9L 2YUXA 3QQ4A 3UTQA 3V5DA 2YN5A 1FL5A 4KKCC 1X5GA 3NAAH 4WHCA 5EO0A 1ZANL 5EZLA 1KLFA 4P0DA 2SEBB 3ZZ1A 5H2BB 3L3DB 4P3DA 3CFJB 2HVKB 4PJGF 5D7SL 4PG2C 2GT9A 4BZ2L 3QHFH 5DD6A 3L5XL 4EI5A 2EE2A 2Y06H 1FNAA 2M1KA 1SMAA 1CDIA 2WV3A 5T5FL 4ODTL 2PW1B 3NCCB 4YZFE 4LPUA 5HHQA 5L7XL 4MAYD 5EBMB 2WBJC 3SDXB 3SKNB 4Z7QE 4TSAL 1S9VB 2R2CA 3B9KB 3QEUB 4WHTA 1W0VB 4KZDH 3RU8L 5FUZH 2DMBA 4KXZH 1QBMH 5F3HA 3FO2A 3T0EB 2ADJB 2WWMD 3I3DA 4U3XA 2ICEB 3VFTB 4C4KO 3MLWH 3IDNB 2W9DH 4HPOH 1S7QA 4MJ5B 1X44A 4YHOL 2X4TB 1PW3A 4ZAKB 1CICB 2W0FB 4X6CA 1F3JA 5GGVH 5I1JL 2ZG2A 4K8RH 3BKJL 3BJ91 5ISZB 4FRWA 4M1DH 4F15C 4KDTC 3PGFL 2IMMA 1RURL 1B6UA 3DVGB 4N0RA 2G75A 4OLZH 1HI6B 2DM2A 4OGYL 2XZQH 2R0ZH 4L4VD 4LSDA 1RZJH 1KG0B 1BX2B 3W9DA 5JQHC 3MLVL 4NQVB 4YC2C 1KOAA 2H8PA 3D87B 4J3UA 1AGCB 4MVBC 1FFRA 3QDMD 4OCXH 4XCFH 4M43L 5DZOA 4BSVA 2EKJA 5I2IA 5I17B 5DUBA 3AM8A 1E6JL 1ONQA 4PJCE 4ODVH 4NQCE 5A2IH 4LPVA 1BECA 1JZ4A 2V9QA 3RWCA 3TV3H 3QCUH 4X4XB 2M8XA 5B3JE 2R4SH 1U2HA 2W0LA 4NUGL 2OR7A 1NPUA 1ZVHA 3N9GL 4YUEL 4L1DA 3O6KH 3QUMA 4XZUA 4OZFA 5CGTA 4ELME 4I3RL 1PY4A 5GSVA 3NGBC 1CDJA 5JO5B 5HDBF 3GK8L 4M4RA 4LHUG 1M7DB 1G6RA 5IG7A 4NQDD 3QHTC 3AS3A 5KSUB 1IBGH 1YMMA 1IGCL 1A7NH 1S7XA 3O2DL 4ZOAA 3K1DA 3BKCL 2Q8BL 3HB3C 4ONHA 4ZNEE 3DMMB 2YPKB 4O02H 1L7TL 3NIDE 3VXSB 2D9QB 2JLLA 1NGXA 1UENA 4X6DF 3CUPB 5I1CL 1F4WL 1J0HA 2X4RB 3EJYC 1QD0A 3FB5B 3MCLH 5SX5H 4WDIA 1DQMH 2ARJA 2EDEA 3E2HB 2G5BB 1AQDA 3FHAA 1NAML 1YEFL 4HFWB 3G6JB 4JCLA 3D3VD 2UV3A 3RWDA 1FC2D 4LNRA 1P4LA 5I1IH 4WUUD 1B0RB 4HMEA 4E5XB 2QQKH 4CBPA 2Z8RA 4L4TD 3O2WH 5D70H 1CQYA 5I75C 5DQDL 1HN1A 3B9AA 1QLRA 1LGVA 4JM2D 1UB6B 1I3VA 4PJBB 2VWEE 3SBWC 5TDOB 1TETH 1EHLL 2Z31A 4PRPB 4TYUA 1MCCA 4OCLC 5E4IA 3MUJA 1LO4L 1KXQE 5T1KA 1OAZH 2J8UA 4CN6A 1JGVL 2HLAB 4JDTH 3T0WA 1JYNA 5E95B 4PJHA 3H3PL 4NRXA 4RWYL 5DZLA 1AGBA 1C08A 1G6VK 1RK0A 1GAFH 4OKVB 1PYWB 3K1KC 5KBNC 4HEPG 1J10A 3QO0A 3TYGL 3KPSE 4ZTPL 5KJRH 4HEME 2EYRB 2X70A 4LASL 5ADPL 4OI7A 1JHTA 3UC0H 1OQOA 2OBGA 4JKPH 1X5IA 3LV3B 3KNBA 1NL0H 1MQ8A 3OJ2C 5DTFB 5D7LB 5GS1B 2H41A 3MJ8B 3NIFF 1QR1A 5F1KC 1JPSH 1QNZL 1NFDB 4W68A 2GJZB 3LS5H 1DVFD 3ZKSD 4ZTOL 2A0LD 3ROOA 1FFPB 5J12C 2ITCB 1ZHNA 5ADOL 4FXGA 5GHWH 3NOIA 5B4MD 3RWFB 2AJUL 1MJ8L 2DQDH 2ZNWA 4HK3N 1LO3L 5FYJD 5A43C 1CXEA 4OUUB 1NBVH 3C2AL 2FL5B 5BRZD 1JYWA 5JIHA 1A14H 4PJGB 2BVUA 2G9HA 1CE1H 1BPVA 1UJTA 1J8HD 1XGYL 3KLHC 3UBXB 2CDGB 5DI8B 3WYRA 4KJYA 3MNZA 4HBQA 1CG9B 1XGQB 4OLWL 4G8GD 3C9NA 2MCPH 3WNPA 1S9KC 1JNNH 1PKQB 3AXLB 5CUSL 4Z0BL 4YJZL 5E6IC 4NM4H 1VFAB 3R0MA 3O8XD 1KYOK 1DBJL 2X4UA 4PGEA 3G5YB 1E4WH 5DFVD 3QWOB 5GGRA 5DWUH 4OCYL 5C2UB 1DEEA 2P47B 3LEYH 1R24A 4I18C 2OTPA 5TFSH 1EZVX 5IMOB 1GHFH 1B6DA 2DICA 1Y18B 3CLEH 1EH9A 2P24A 4TRPL 3CZFB 4FFVD 2CPCA 5FGRA 4TNWK 4HPYH 1MAKA 5T3XE 5JPMA 4WI8A 5EO1B 3QXDB 5CP3H 3QAZB 4HK3J 3SQOH 4XNMA 4OD3H 3TA3A 1FYTE 2ZSVA 3ULUH 1K5NB 2DBLH 1NSNH 4OBSA 1H3WM 3AS2A 5GSRA 2R0LH 2ZCLH 4NBYB 1D5IH 5IESL 1LMKA 3FN0L 1WZKA 3PL6A 4I0PC 3G6DH 3GI8L 3ELAT 4I2XE 5C86A 4YBQC 4X99A 2BY0A 5HYSB 2BC4B 4YH6A 3GJEA 2IAMD 2K7QA 1V7MH 1V7NL 5D2NC 3L3IA 1ZEAL 3UYRL 4YQXH 1YYLH 5E8EB 3ARBA 4XRCA 4U1MA 5DURD 3CDGA 1T1ZA 4N1EA 2FGWH 5F88B 5F8QC 4ODHL 1CLYL 4C56A 4M7ZC 3RI5F 1D5XB 3OKMB 4FFZL 2HTKD 1OPGH 4L3EA 3BXNA 5CZVL 2D7TL 4G80B 4D0DA 1GC1H 2PXYA 5I1AA 3KVQA 5J4MA 3U7YL 1A02N 1NCDL 1F6LL 3ETBF 3WJJA 4AIZB 2YUWA 1XIWA 1EFXA 1MFCL 3JV4A 3M45A 5JDSB 1VESA 4X6DB 4M61B 3D25A 2FX8L 5I1GH 1PX4A 4XPAH 4HUVB 1QPPA 2IPKB 1AR1D 4XMPL 3CFBB 2VQ1A 4NRYA 1R3LB 1IEHA 4Y4FB 3WE6B 2CJUL 4JR9H 4PJ8B 2CSPA 4GKNA 3QIBC 5E6YA 4OF3A 4ZUVB 2DQIL 5IMLB 3IGAB 4X6CE 5IMMA 1X9QA 4E9LA 5DJ8B 2H2PC 4K9EC 1JUFB 3ZKMC 5FK9B 4L8SB 3CSGA 2H2SC 3BWAA 4Q6YA 5HHME 4PRIB 5K9JH 3MGTB 5IP4A 4WFFE 4HZLB 2AI0L 3ULSB 2XG4A 1AE6L 5D93C 4J8RB 3RY6A 5B8CB 1QSFD 2F53D 3WXWH 4P3CL 3GJFB 3OGOE 4JY6B 2D4DA 1FNEA 3B9KD 1PG7L 4NDMA 3VWJC 3GRWA 3L3HA 2ERJB 2PR4L 3BGFB 3T0ED 1UVQA 3RVVD 3EYFB 5FB8B 4MJIB 2FRGP 2IEPA 1QSZA 4JFEA 3F5WA 5C08E 3O3EA 4UINL 5I19L 4UIMA 4ZPVB 1I7UB 5EBLA 4ZAKD 1CICD 1YDPA 4YHYB 4U05A 3BEVB 1XGUB 4MMXC 1BQHG 4IDJL 3BZFB 4B53A 3I9GL 4MD5A 1DUZB 1Q1JL 5H37H 4JO2H 3UO1H 4OZ4A 1B0GA 3BVNB 5HYJB 3LD8B 5KSAA 4L29A 4OLVL 1UXWB 1A6UL 1NCCH 3IJSA 1A3RL 3Q2CA 3S34L 4DCQB 5K9KB 3P4LA 3RVTC 2GY7B 1ZS8B 3HS0A 2Z8SA 2DDQH 5CJOL 4RZCA 1T03H 4GAGH 1SBSH 3B2VH 1E4JA 2N1KA 1YECL 4FZEL 4MJ2A 3HFML 3WFHB 4DGYL 3IDXH 1BD2A 4YPJA 5CD5D 2FJFB 1RZFH 2NTFA 3I02A 4M1GL 3OB8A 1QEWB 2J2ZA 3CXDL 2R0WL 4U1GC 4YHMH 5FA4A 1HHJA 5FM4A 2R0KH 1SY6L 4Z7WA 2PUQT 4Q74A 5AZEL 1OSPL 2VKXA 3EDKA 2JJWA 1HSAB 2DL9A 5IGXL 3ILPA 4I3GA 2NZIA 4FP8L 3T3PE 1NLDL 1B4JH 2RQ8A 4PRNA 5TDPA 4ETQB 1ZHKB 2J4WH 3HPLA 3QIWA 2DQFB 2VC2H 2OI9C 4PJHE 1ZGLB 2BX5A 4EZMA 3NACL 3MCKA 1EA9C 4EUPH 4TNVK 3IDJB 3VXSD 5EZOL 4ERSL 3VFMB 1J0YA 3PGDB 4OT1H 4FMKA 1P9MA 4FQ1L 5L2KB 3NPSB 4DEPC 2GITB 5KW9H 5AG8A 2DJUA 3ZL4L 3RY4A 3UAJD 1GGIL 3TIEA 4FNLL 4JCMA 3RBGA 2A74B 1K4CB 4OKDA 2M2DA 1CF8L 4LIQH 1CTOA 4YLQT 4DVRL 4JLRB 3MRKB 4WCYL 3OKKB 3ZMRA 1EHXA 2DWDA 4RWHA 3U36B 5GIRB 3ZKXC 1P7QA 5FHAL 4APQB 4P9HH 5T1LA 4OIAA 4PB0L 2VLJA 4OB5H 3QCVH 4LRIA 1T0NA 3MV8B 2PETA 4PJEA 5T33L 1TVBA 4XPFL 4OAWA 2ZZUT 1MNUL 4P5MA 4JQIH 3BDBA 4ZSOB 3G5VA 5C0FB 3CFIC 5CSZB 2IWGA 4XMLH 5C0DA 4F9LC 3TZVA 2QSTA 4QEGA 1BFSA 4OGAD 4J1UB 3HR5A 5KSVB 2A9NH 1U8PB 3S37X 4HMCA 3HZYA 5JW4Q 5EUOA 2NY4C 3EYOB 3ZE0E 4MX7A 1XF4A 4RFNC 4YDLC 4TVPE 3QUYB 4UB0H 2VWEC 5D7LD 4S1SL 1N64H 1E28B 4ZDHA 5J11B 2D7PA 4KVNL 2FX9L 3RPIA 1AD0A 2DQCH 3BPCB 3KR3H 2HLFC 2UZIH 4JREC 1KIPA 3P2TA 2D31B 3DOSA 4J4PC 4U33A 5L88L 4G8IB 4RGNB 3W11D 4HV8A 4POUB 1WK0A 3ECBA 3H8NA 5EORH 3WIIL 2GHWB 4G8FB 1A6WL 3QXUA 4UU9A 5C6TL 4OZIA 3VI3E 1T6WA 5HVGB 5ID0B 2E3VA 4WTWA 1HXMA 3STZA 1U8QB 4PGBB 2WK2A 2BJML 4LPWA 2VABA 1IZJA 4ZFGL 4JFZH 3MLXH 5DMGC 1S5HA 3VXMD 4F3FA 3DX9B 1ED3A 3W5NA 4CL7A 1T5WA 5JXAH 3M8OL 4KUZL 4POZD 1S7VB 3P0VH 1INQB 4WW2F 2X44D 1A9BA 2IF7A 4YEEA 4WHYH 2WIMA 4X5WB 4DWHA 1U3JA 4JB9H 4FFWD 1FNSL 2R29H 2XI9A 3BQUA 3B9DA 4W81A 4C56E 4IRZH 4PJAE 4GRLB 4MD4B 3S96A 3HPJA 4U3CA 1ZANH 4KROB 3MV7E 3OSKA 4L3EE 1WFNA 5AD0A 4XCCL 5C0CB 1TCRA 4OGXH 2GYSA 2E9IA 3HAEB 4NO3B 3L5XH 4RAUA 1FO0H 3ZO0A 2O93L 3BJLA 2P42B 1WWAX 4R9HA 5KS9F 1L9NA 4IMKA 2X7LB 1IRAY 1IAMA 5EU6B 1M4KA 1Q72H 1U8MA 3OXSB 5D9SA 5DRWB 4X6BA 4BQCA 4GXUN 5L7XH 3HCVA 3G5ZB 1IAOB 2FO1A 2JJTA 5FDWA 4BK4A 3QZWG 5I8OL 3NFNB 3O3AA 4JVWA 4NZTL 1S9YB 1R3KA 1RZ8A 2IBGA 5FGCE 2VZVA 1BIHA 4R97C 1UH2A 2BMKB 4OQTH 2VDRH 2A9MH 1C5DB 1U41A 2FECI 5F1IB 3JTTA 3L1OL 1INDL 4Z7NE 5EDXA 4NKOA 1XF5A 2CKBL 3MJ7B 3BKJH 2KL6A 3D69A 3GUTA 5HHOD 3T8XB 3T0AA 1T83A 4HIHA 4IOFC 1BJ1J 1RURH 4DN3L 5C2BL 2OR9H 3D39B 3ARTA 4EQ3A 1FL3B 3ZT7A 3MACL 5KG9A 2E8ZA 2VSCA 5L2JA 3KJ4C 3QCTH 2V5MA 2GCYB 3FB6B 4NT6B 3RIFF 3MUHL 4KRMB 2UWEF 4N0UE 4CJ0A 3MFFA 2VL5B 4RFEB 1E6JH 1N3NA 4XVSL 1K2DA 1N0XH 4DKEL 3WO3B 2J7LA 5HHVH 1N4XH 1QFUL 3I84A 3FCTB 5D1XA 4LKCB 1KXVC 4OGZA 5E2TL 4AL8L 3LN4A 1MFBH 3D1MC 2XYCA 4YUEH 4YHIB 3IKCA 1BLNA 3DIFB 5EFIA 4I3RH 5HY9B 1F02I 5CEYA 3GK8H 4NQCB 2FDBP 4HMDA 4DKFL 1D5BB 4JFEE 2FIKA 1LEIB 3EFDL 1OGTA 4JFHE 1DBKL 2YA0A 5MENB 4P4KA 5CWSB 2JK5A 2AEPL 1IGCH 3O2DH 4PJDF 1UACL 3BKCH 2Q8BH 4UDTB 4Y16B 3VFOA 1T1XA 3RKDC 8FABB 4Z7UA 3FT4A 1L7TH 5J9PB 3VFPA 4QNPE 4N8VG 2HRPH 1MI5E 5KOVC 1I1AC 5BS0B 3T77A 1KELL 1EEUA 2FLBT 5EOTA 3PQYA 5E00B 4G8EB 3UTSD 5CBEA 2E9BA 5D7JD 5JHLL 1YEFH 1BD2E 4EI6B 1LQSR 5ETUA 1ZT4B 1OWRM 1E4KA 1LNUB 4Q2ZA 3E8UL 3C09C 2OJZL 3FFDB 4TUOA 3T0XA 1TJIL 2B5IC 1JRHI 5ESAA 2AXHA 1IAKA 1XR8A 4NZJA 2DWEA 5TE4L 2X4SB 1EHLH 4MJID 1YNKL 3HMXA 2XPGA 4XI5D 3QRFM 5IV2B 1X5HA 1BJMA 3I50L 3OKNA 1XF2B 4Z78B 3V6BR 3C5ZB 3LEXB 4FG6C 5IJVA 4WO4B 3NA9L 1PLGH 5FYLL 4JHZA 3AM8C 4QHKJ 5D1ZC 5HYJD 4IHOB 1WZ1H 5EU5A 3MRIA 2YEZA 4QHNA 5IQ9B 2EXWD 4YBHA 4ZTPH 1J1OL 3PWJB 1NC2A 4PTTA 2V5TA 4W4OA 2F9BT 3KGRA 2PO6B 1T2XA 2BZDA 3BIKA 1DFBH 1UM5L 3PWNA 3KPOB 5DS8B 1HOCB 3DO3A 4NN7B 4WU5B 5FYJH 4QWWD 4YDKH 1R3HB 2AJUH 2Y7QB 3MTRA 4F7CA 3BT2H 1CR9H 1T2QL 5D6DC 1LO3H 1Q94B 2IBZX 2NX5A 3ARPA 1MWAB 1N7ML 3C2AH 2VLJE 2JELH 2BVOB 3BZ4A 5TE6H 5F7MC 5C0BA 1XGYH 2DQTL 1MCDA 3L95A 2F54B 2O26U 4OLWH 3HI6L 1S9WB 5KS9B 3MV9A 4GBXC 4O4YH 4OFYA 3IAPA 3WHE1 5D1QB 5IKCA 3H2WA 5I1HL 4YR6A 4CRPA 5F9JA 3VXNB 2BDNH 1KPVB 5CUSH 3DRQB 5FYKL 5IFJB 2IPTH 4O2FB 1DUYA 4ORGB 1DBJH 4U1KB 2L0DA 3GGWB 3QFJD 4H25A 1C7SA 4D0BB 3FO9A 7FABL 5CFHA 1TTFA 1VB9A 4YDJB 5HYEA 3WO4B 5FO8A 3VFVB 5ACZA 5I1DB 1NEZG 4Z18A 4TRPH 1CGXA 2JB6B 1N26A 4N8PA 5H35A 2P49B 5K9QI 3KLSA 4ZQKB 4UAOB 4ZUUA 4WI2A 4APQD 2I27N 3CD4A 2F5BH 1PD6A 1YEIL 4L8BB 3QUXC 4P23A 3MV8D 2ESVA 3VFNA 4LGPB 4OZIE 3FN0H 1FVDA 2UWEB 1MY5A 2E8YA 3CFEA 1VFOA 3GI8H 5EU4B 2J8UF 4JO4H 2XN9E 4LOUC 3RQ3A 3ZDXE 5IF0A 1OVZA 1FYTB 5HD8C 4O00A 3NA4A 1ZLVH 1AO7A 3RX8A 4FA8A 2D2OA 3X3GL 4BKLB 3V79C 3TESA 4Z0XA 2OYPA 1ES0B 4R4NC 3QUYD 1P84J 2H9GB 5ESQB 4F57L 5CP7A 2R2BA 5HVWA 4GKZB 1G7JB 4ODHH 1CLYH 4S2SB 1MCPL 1FFQA 5F96H 1G1YA 4XGZA 3B2UD 1GSMA 1SEBB 5C9KA 5K9OB 4MNGA 5ANMB 4WNQB 2ADGB 5IR1B 3GMNB 1YY9D 5CZVH 2BOCA 5C92A 4PJDB 4XVTL 2ZUWA 4OCWL 4RGMB 2HFEB 3RJQB 3HC3H 4RGND 5DA4A 3V5DB 4CGTA 3LS4L 3JWDL 1TFHA 3O0RL 1D7FA 4MD0A 5EO0B 4KQ3L 2NYYD 5EZLB 2EH7L 3VXRE 3VMPA 1CXHA 1GGTA 2GT9B 3ZLQC 3PF2A 2HKFL 5ALCL 4YXKL 5DD6B 1A6TA 4CVUA 1OM3L 2C4XA 3A6BH 4JE4B 4JQXC 4JN2B 4RRPG 3TFKC 4TUJA 3MRFA 4DJMA 4ZMAT 2DQIH 4JGJA 4WHTB 3ARWA 5DJ6A 3U0PB 3V4VL 2Y6SC 2Q7YB 5ECJE 4YBLC 5K93A 3TA3C 3ZE0F 1TTGA 4GRLD 5F3HB 3FO2B 4YXLL 5EG6C 1D5MA 2R9HD 4KROD 3MRLA 1DEDA 5C0CD 2VXSL 1JYVA 2AI0H 3DETD 1U8NA 3WLWC 1DLFL 1A6ZA 4OFDA 4UTBH 4GG6F 4GW1A 4Q7DA 4X6CB 4O2EA 1ORSA 3WS6C 3Q6FB 1LP9A 4P3CH 1FH5L 4PV9A 3P4MA 5EU6D 3VXUD 5JOEA 3LH2H 4GMSL 1TZHA 1G1CA 3SDCA 4QRTA 4KK8D 1OAUH 1D6VL 1PG7H 1ZSDA 4Y4HA 3K0WA 3W9DB 4NYLA 2H8PB 2FX7L 3ORJA 2UVFA 3LSOA 4LSRL 1YY8A 3U2SA 5JW3L 3CVIL 4BSVB 5I2IB 3ES6B 4L4JA 1BOYA 5DUBB 1REIA 1ONQB 2AEQL 3PWLA 2K1MA 1OP5K 3RWCB 2YSSA 4XNZC 5I19H 1VFBA 3VXQA 2CKNA 3L6FB 1LEKA 4WW1A 3I9GH 1AY1L 1CN4A 3EGSB 2YD3A 4OZFB 4P2OA 1NFIA 2YK1L 3D39D 4Z7UE 5GSVB 4RISH 2GY5A 2FB4L 5C09A 3IDMA 3EOBA 3S34H 4CVZA 5IG7B 3ULVE 4KI5F 3WNOA 2AJVL 2B7DT 3B5TA 4NO5A 1YMMB 1S7XB 4S1DC 4TULL 4DQOH 4N9GA 4ONHB 1YECH 5IJKC 1EHNA 3HFMH 1JV5B 5EWIH 3WD5L 1SJEB 5C8JA 2R0WH 2HG5A 1JP5A 3LKNA 4DW2H 1GVIA 8CGTA 3WNMA 3VGEA 1M71A 3UJTL 3QIUA 2ARJB 4RNRB 5CHNA 1U8LA 1I1CA 1OSPH 1AQDB 3BESR 4JVPA 5KN5A 1LO5A 4K3DH 1X5LA 3RWDB 3UZEA 5IGXH 1P4LB 3L3JA 4FP8H 4D9LL 4F58L 1NLDH 3IJHB 3OJVC 5MEND 2R4RL 3B3IA 1ZGLP 3NZ8A 3N1FC 1QLRB 5ABDE 2IH3A 3VXOB 4I77L 3NACH 5I9QB 2EIZA 3T4YA 4HS3A 2L7JA 1FORL 1EK3A 1XGPA 3AREA 2XXMB 5BS0D 1OD7A 4PP1C 4ERSH 4Y5VC 1LWRA 2GTWA 1Z5LA 5T1KB 4R7NA 2FJHB 2J8UB 4L3AA 5J3HD 4QT5A 5JXEC 5CSGA 4FQ1H 3OKLA 4GG8B 1AGBB 2ZP0T 3MBEB 1C08B 1RK0B 5FYJU 4D0CB 3ARFC 4ZXBC 1GGIH 3QO0B 4OF7A 3O11A 2ICES 2CRZA 3RRQA 4UILH 4OJFL 1CF8H 4M7KL 4MQ7A 4WCYH 2H1PL 5I71B 1RUKL 3MRRA 1QR4A 1JHTB 1J88A 3BN3B 1GYAA 2BNUB 2NX5E 2IG2H 4FQIH 2HT2C 5CJXC 5FHAH 2UUDK 4PB0H 4HH8A 1OP5H 1QR1B 1MOEA 2AV1A 3BEWA 2EYSA 4LARL 5C0BE 5J0BA 2Y36L 3ROOB 5HDLA 4WO4D 1XZ0A 1T04B 4BJLA 5SWSA 3IB4A 3MV9E 2BHYA 4UOW0 4LDLB 3MJ9L 1DBML 1G84A 3JV0A 4OD2A 5IVXE 4LDOB 5JMOC 3H9ZA 4Z76A 5GZOC 2W1NA 4ZFZA 4QNPF 3NFPA 4NQTA 5D5MA 3MNZB 3TVMB 4O5LL 4ZUTA 3S35L 3C9NB 3CZJA 4DGIH 4S1SH 3GSRA 2JB5L 4M62L 4NJ9H 1V05A 1JNHA 4WV1A 3QXVA 1XR9B 4ODUA 5BOPA 1MWAL 1LEGB 4LLWA 1KJVB 1L4IA 1OT1A 3SGJA 3QIWC 5GGRB 3QI9A 2N4IA 5E2WL 3SDDD 4F37F 1OLLA 1R24B 4WWKB 4JFYA 4H8WL 4Z7WF 3MRNA 1FBIL 3S5LG 3T2NL 2P24B 3JUYA 2ESVE 3PDDA 4HDIB 4GG6B 2C3HA 3EFFB 5HPMA 1QFWM 2IJ0C 2F54D 2VOTA 2V2WA 1IGIL 2J5LB 1A47A 2XRAL 2VLRA 5D1QD 1X5AA 4XNMB 4RX4A 4K7PL 2ZSVB 4OBRA 5LCVL 4PJFE 1AO7E 1UM6H 2JCCF 5GSRB 3IDYC 3SE3A 3M8OH 1T7ZA 4MHHG 3PL6B 1KCUL 1HYSD 1YPZF 4K94L 3UJJL 1FGNH 4FQHB 3LKSA 4M3KB 4EN3D 1P5VA 3MLRH 1CDGA 1FRGL 5C3TA 3GJEB 12E8H 3EOAB 3KJ6L 3ALXA 4MNGE 3OHXA 2P43B 3C8HA 1C16B 1EPFA 4U31A 4LAQL 1CD1A 3UZVB 3LRHA 5DJXA 3ARBB 4XRCB 3WUZA 2GSIB 4PRAA 4PJXE 1YJDC 3CDGB 4U1MB 4M7JL 3TWCH 3WNNA 4LEXH 3SO3B 3V95A 1QHOA 5EC1A 4PLKC 3VA6A 1KENH 1TJGL 1KN4L 1B9ZA 2ZPKL 3D0VA 1JYXA 3WDIA 1HE7A 1HIML 3LHPH 3BXNB 3LDBB 4PJEF 4D0DB 1U91A 4X4ZA 1MHPH 5I8OH 2PXYB 5J1TC 4KXZI 4NZTH 4WENB 5D2LF 5I1AB 1PDKA 3HZMA 3RZCD 3WIHA 1GGCH 3JV4B 5DQ9A 5BVPH 1T89A 2VIRB 3HE7A 3O3BA 5IQ7L 2B4CL 1ZAGA 4ENED 1ZWIA 3D18A 4OCRL 4FABL 1INDH 1WBXA 3THML 1A21A 5DHYB 4NRYB 5EUOF 4WGWB 5A3ID 1S8DA 4HCRH 3UPCA 2QEJA 4PG9A 1BFVH 3BHBB 3P11L 4DN3H 4B50A 2EDBA 4GKNB 3SE8L 3I3EA 2ZKHL 1RZKH 4JO3L 3RUGA 2OTUB 2Y07L 3QA3B 5DQJA 5DHVA 4GAJL 3OKEB 3MCG1 5ICYA 5IMMB 3EDEA 1LP9E 2X4PB 2DYPD 3C6LB 3V0VA 3WBDA 1IL1A 4XH2A 1M05A 2W07A 3AGVA 2NR6D 1U58A 5GS2D 3BWAB 3LQAC 4XVSH 3HMWL 4DKEH 1IMHC 1A7BA 3M17B 5DDHB 3IDUA 5GGSA 4OZIF 3ZDZF 5E2TH 5EIQA 2H32A 3QRGH 3P0GB 1OARL 2WP3O 3ULUE 1U9KA 2KH2B 2YMXL 4JFOB 1RMFL 4O9HL 1FNEB 4WY7L 3F12A 4HF5L 1BQUA 4Y19A 4F15B 1F4YL 4NNYB 4P46A 5TJWK 5JW4M 4MQXC 3O6FC 5DT1L 2AEPH 3L3HB 1UACH 1WFOA 4NNXA 1N6VA 4EDXA 3MYZA 1FIEA 5C09E 2Y23A 4JFEB 3F5WB 2AJSH 4NC1C 4UIMB 1KELH 5EBLB 3TP4A 3GJFH 4F8TA 4FTVB 4DOHE 3LKRB 3GHEL 1CLZL 5F7HA 3JVGA 1CFBA 4MD5B 1F58L 5FDYA 5T1MA 2WNGA 1QRNB 1EAJA 2QADB 3ARGC 4KK5D 1KLGB 1B0GB 1I7RA 3WJLC 4BQ8A 1RZIA 1EO7A 4G5ZH 2DQEL 3LEVL 3IJSB 4CKVX 1FO0A 3C5JB 4NKMA 2OJZH 4X0KA 3HS0B 4MAYA 4OD1L 4QXGL 1NCAH 4RZCB 4J2XA 3FT3A 1T83C 2XWJA 2NY2B 5TE4H 3MRBA 2VQTA 3K8MA 4PV8A 5T5NF 1UWXH 2HA1A 3L3KA 2QQNH 2NTFB 3I02B 3G04A 4M3JA 5D8JH 5FA4B 1S7WB 5FXCH 4QOKB 3V52H 4YXHL 4Z7WB 3OTTA 2I9LA 3MA9L 1G6RL 3V2AR 4IIQC 5IIEA 4UV4H 2DQJL 5D72L 4D8PA 4OQTA 2CQVA 3STLA 1X4YA 1HINL 4K7FB 1HH6A 4PRNB 2Y9RT 4NOFA 4PRDA 1YMMD 1T2JA 1GIGH 3HPLB 4OCNC 3INUH 1NCBL 1WEJL 3BN9C 1UM5H 4F9PA 1AH1A 2JCCB 1T5XB 5L0QC 4Q6IA 5MERB 3QDMA 4K3JL 4WFGD 3MLZL 1YPZB 3VRJA 1FE8L 5BOZG 4X8JA 3G6AA 1OLZA 5J13B 4D9QD 4F8QA 2ID5A 4LSTH 3RVXC 3UPRA 4IRJD 4UNVA 5H94A 3I75A 3TIEB 1EFQA 1NAKL 5IHUH 1MQKH 5JW5B 1MCEA 3ULVC 1AGDA 2AKRA 3KLAA 2DQTH 1K3ZA 1MJJA 1AXSA 3L7FA 5SWSE 2DWDB 3HI6H 1SYSB 3NCJL 3G9AB 4PGZA 4XPBL 3RA7H 5F7UA 2HH0L 3R0NA 4GO6B 4ZUSB 1P7QB 4NQDA 5T1LB 2ENSA 1FL6B 2FATH 3B4NA 5DC0A 1VSCA 2VLJB 4LQFL 3TO2B 3VGAB 1T0NB 4Z7UF 4PJEB 4HS6A 1MLBA 3ZSSA 2CXGA 5D5ME 2Z9TA 4OAWB 1TPXB 3O2DA 5D2LB 3E6FB 4P5MB 3MBED 7FABH 3ZKND 3G5VB 2YOCA 1TQBC 3KPTA 3TO4C 2FECL 5C0DB 1A6AA 2AGJH 3TZVB 3H0TB 2BSTA 3BUTA 3R06B 3HR5B 2CIKA 3OPZH 3TBVA 3VJ6B 4HULB 2EDLA 3HZYB 4JKWA 1P4IH 5EUOB 2V2TB 3D3VA 4MX7B 5EPMA 5DZNA 1EEZB 4L4TA 4NKIL 4ZDHB 1JFQL 5HBBA 1YEIH 3W81A 2OLDA 1RZ7H 4QRUA 4RMRA 4HW6A 4LSPL 1JN6A 1M7XA 2P5EB 5DUPH 4JPVL 1AD0B 3K7UA 3QISA 3FQWA 1PEZA 4K8RC 3F62A 1KIPB 3UTOA 3UTPE 2VLRE 3MRQA 4HHAA 1S7SB 5E6IB 1BQLL 2XTJB 3L3GA 3RHWF 5CAYB 4B7IA 4HV8B 3ARDA 3ARRA 3BMWA 1H3PH 3ECBB 3FTGA 4UU9B 3RIAF 5DVMA 4F7EA 2WM0A 1LK3L 1K8DB 4OZIB 3TVMD 3X3GH 3T0DA 3CVHH 1FCGA 3STZB 1HXMB 3RVWC 1V3JA 3FB8A 2VABB 1KJ3L 4NJAL 4N5EC 3FOMA 4F7TA 1MCPH 2Z92A 5ITFB