3TYGH

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt128 in complex with a glycosylated engineered gp120 outer domain with miniv3 (eodmv3)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
234
Chain Sequence
EPQLQESGPTLVEASETLSLTCAVSGDSTAACNSFWGWVRQPPGKGLEWVGSLSHCASYWNRGWTYHNPSLKSRLTLALDTPKNLVFLKLNSVTAADTATYYCARFGGEVLRYTDWPKPAWVDLWGRGTLVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system, viral protein
total genus 32
structure length 234
sequence length 236
ec nomenclature
pdb deposition date 2011-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH01
3PGDA 5T1LB 3LKRA 4LK4A 3C2AL 4HJJL 1EFXB 3MLWH 5DA0B 1AXSB 2C1OB 1E28B 1FFOB 3DUUB 2VIRA 5HHXL 1P84J 4CUCA 1B4RA 2R2BA 1G7QA 1GGCL 1QEWB 1T20B 4LVOC 4CW1A 1FL5A 5BVPH 3C87A 5DUBB 4BFEA 3O8XA 2HLFC 3MUJA 4YHNA 1GHFL 4FFYL 4MJ6B 4HUWB 4PTTA 3EFFA 4UNTA 4LCIL 2YD4A 4MNQA 4QOKA 1FIEA 5ICXA 3K1KC 2A0LC 2HJKA 4PRAA 3SKNB 4NZRL 2E7MA 4PREA 3QEGL 5EB9A 5B39B 4JFOA 4LLQB 1JGEB 3LKOB 2AAVA 2VLKB 3EOAA 4Y5YA 4U7SA 3K8LA 2QADC 4MSWA 4YE4L 1TZIB 2ZOLA 5L8JB 1FORL 4HUMB 4RGNC 1OW0C 1RK1B 1TPXB 1T7ZA 5CEXA 1RUAL 1KLGA 2EICA 5IIEA 4YXKL 5T3ZH 3VWKD 1SMAA 2EH7L 4P2OA 1NCBH 2P8LB 3ROLA 3OBAA 1KTDB 5HGDA 4NFCA 5FO9A 5F9WB 5BVJA 5KJRH 3PWJB 5HYJE 1PKQB 3D18B 4MQ7A 1R24A 4XTRD 1CI5A 2O61B 4M9PA 1J7VR 2IMNA 2H3NB 5DK0B 3CZFB 5DYOB 3OG4B 4PGDA 2NY1B 3ZDZE 1MSPA 2NY0C 2VDLH 3FJTA 3QIBC 2MKLC 4LLUB 2XI9A 3WKMH 3E8UH 2B39A 3BRGC 3SKJL 4IOFC 1SEBA 3BGFC 3LV3A 4P9HC 4OV5A 5IQ7L 3VCLA 4BK4A 1I8LA 2PYFB 3P4NB 1B0RA 2HP4A 2DQCH 2XTJE 4B41A 1TZGH 4JRWA 3VI3E 1RK0A 4N5EC 5B38A 4OKDA 3KPQB 1RZKH 2Z31B 2YMXL 3VFUB 3K8MA 1ZVYA 4X4MA 5D2LA 3FQRA 1INQA 1HDMA 4WI8A 5JA8B 3REVB 3UZQA 2FYYA 4KV5F 2AQ1A 1C5DB 1FNAA 5IVXA 5KZCD 1BHGA 4MA3B 4PRBB 1U3ZA 4NRYB 2M1KA 3QUYB 4LARH 3CFCH 4JFDB 4WFFE 2SEBB 4TSBH 3RUGF 3BKCL 4FTVD 3TBYA 3DV4B 4AMKH 1MCHA 2DAVA 2QEJA 1SY6H 3D39A 3QIWB 4NQDE 1G7LB 4ZTOH 2AV7A 1A6AA 5DVLA 3LKNB 3MV8A 1RU9H 4NO2A 1EMTH 2VAAB 5JLZA 2CR6A 4UT7H 1JE6A 5IVZB 4GQ9L 4I0CC 4WY7L 2PR4L 4NBZB 3RWCB 5ACZA 1ZT4B 3SE9L 4AYFA 1DBBH 5KVGH 3V79C 1A1MA 4EBQL 4RBPK 5DI8B 1HI6A 3BGAA 1FN4B 4HH9A 3PG2A 4LPCA 4JRXA 1OWWA 1FDLH 1V7NH 1NC2B 2CKBB 3MGOB 1IC1A 1SJHB 1IEAA 5IOPB 4DK3A 1YNKH 2EKSA 5EOCL 2ESVE 3HMWL 5ICYB 4XBEL 2APBA 1QTYT 2FO1A 2DS4A 2DJSA 4PRPD 3UTTA 1FC2D 1KB5B 2XRAL 2JJTC 4P46C 5DD0L 3MO1A 2JB5H 2WBJA 3QI9B 3WIHH 2NXYC 1U42A 2QQQA 3RVTD 3BSZH 4DUXA 4Z0BL 2NX5B 1QRNE 1FNEB 3HRZA 3NCBB 1ZHLA 4H20L 4KVNH 5E6ID 4WO4A 1IAIH 2IANA 1Q38A 2HKHL 4I4WA 4V2BA 2WQ8A 3P4OA 1HQ4B 2PW2B 3S35L 4UZGA 5JDSB 3A6OA 2F8XC 4JM2B 2DDQL 4KKAD 1QP1A 3MROA 5TE7H 5DK2B 3AS3A 5C07D 3QNZB 1VKXB 4M7LL 4KVCH 4F7EB 2ZUTA 1RULH 2FSEA 1H5BC 3W9EA 2Z4QB 3C2AH 4X6FB 4HJJH 3HR5A 5HHXH 2OTWA 1GGCH 1CFTA 3BE1L 4NRXA 1LE9B 4APQC 1GHFH 1X4ZA 4FFYH 4GLRI 2BSRB 2CMRL 4LCIH 3U7YL 2CLZA 1HSAA 4XC3L 5I18L 3ET9F 4R97C 1FYHB 4NZRH 3QEGH 1NUGA 3IVKA 4LNRB 3L3GB 2RGSA 5FA3B 3G04B 4YE4H 4KKLD 4Y19A 5EZOL 1FORH 3X17A 1NDMB 4OD2B 2IBGA 5GZNC 1I85C 4KK5C 1IC5L 5HGAA 4GRLB 3QXAB 5TDNB 5KS9E 1RUAH 4YXKH 5FO7A 2EH7H 1Z0MA 1ZT1B 3VFMB 3HE7B 1U8MA 1NMCC 1CL7I 5GRYA 2ZNWA 2GT9A 1WF5A 1VADB 3MRQA 2VL5A 1HH6A 1JIBA 3QWOA 4OKVA 3HPLA 2JIXD 3RVWD 3NIFE 3LS4L 1U8QA 5K59F 2FRGP 4N9OB 4XAKD 1MRDL 4L3AA 4U3HA 4HF5L 1UZ6F 3L3JB 4RMUA 3BO8A 5JW4M 3U6RA 5JOFA 4S0SD 1FHGA 2V6HA 1TVBB 1HXYA 3SKJH 1U36A 5D5MF 5B4MD 2J8HA 4RMRA 4FQXA 5H37H 5IQ7H 5I6XC 3VG9B 4UDUA 1GZPB 1R6VA 2P42B 4GO6B 2WMPA 2NY2B 2HVKB 5C08D 4GQPH 3HE6C 2NPLX 2ATKB 2BOBA 2ITCB 2XYCA 3DVGA 1JPGA 4RCAA 2YMXH 3U9UB 3WKNA 4LKCB 2P7TB 4RBPH 3KGRA 4HWZA 4DJMA 1JPST 4MD4B 4BFBD 3NVQA 3O3BA 4KAQL 3TO4D 5ID1B 4NQVA 3BKCH 4MB3A 3EO1A 4O2CA 5CGTA 2ZUVA 2RR3A 3NCEB 3OXRB 1G6RA 4YBQC 3L6FA 4QGTA 2PCPB 3FT3B 2Q6WA 3MTRA 3QXUA 2EDHA 1UWEL 4GQ9H 4WY7H 2PR4H 4LGRB 3SE9H 1X4XA 5EC2B 4Z7OE 5GGTA 4EBQH 5C07A 3T4AA 3JVGC 5FGCB 1NAMB 1OF2B 3RUGA 3VD9A 4U05A 3LMJL 3ES6A 5B21A 5DZNA 5IB2B 3RZWA 1P9MA 4W6XB 4L4TE 2ZUSA 2WP3T 5EOCH 3HMWH 4ZAKA 4XBEH 3NCYS 2FECL 5JW4R 4XNZC 4WUUE 2XRAH 1A6PA 5DD0H 5M7QA 1CICB 4QO1A 2P8MB 4FQJL 1ZWIA 3PL6D 5BZWB 4TVPD 3SGKA 1MHCB 3HB3D 2KUTA 4Z0BH 2GJ6B 3WE6B 1S7VA 1T83C 3G5XA 4H20H 5CEZD 2HKHH 4JFEE 5J57B 2I9TA 5AD0B 3VE0B 3DUSB 3VXRB 5C6WH 3U4AA 3S35H 3BESR 3OV6A 3KPRE 3QCVL 3V5DA 4X5WB 3TPUB 2DDQH 3ZDYE 5E7FA 1I7UA 3FO1A 1FP5A 4M7LH 3TA3C 4U1GB 1JPFB 2JJSA 5GGRY 4L3EB 5DEFA 2X1QA 3O3AB 3B3IA 5JZ7D 1WCBA 4WI4A 3BE1H 5E1HB 1Z9SA 2YOCA 4RRPA 5HPMB 3LPGA 3DROA 2CMRH 3U7YH 5DRWB 2GCYA 1FNFA 4ZSOB 4XC3H 5I18H 3BZ4B 3ILPA 4PJEB 3REWB 3X12B 1Z6JT 3HG1A 3P30L 2XNAA 2GJZB 3G08B 2R1WB 1DQML 1YMMB 4FQ2L 4MXWL 1N4XL 4MA1B 1IGTB 4WEMB 5EZOH 1CXEA 4NNYA 2O26U 4X7FC 4JZNA 1TVDA 3TM6A 4HUUB 3T2NL 1IC5H 4GKNA 2X4TA 4JY4A 4EI6A 4F9LA 1HINL 2C7UB 4ODWB 4ZUSA 1J8KA 3OAZH 3MRNB 5EU5B 3BZFA 4R4BA 1MHEB 2OSLA 3ETBF 2Y7QA 2C3XA 3LS4H 1XT5A 5FYLD 1RZKC 1MRDH 3VGGA 1MFBL 4HF5H 3ULVF 4PRHB 1CVSC 5D9SB 3RGVC 1QSEA 1S7SA 1OAZL 4BSVA 1T0MB 2VDPL 3LKQB 5HI5D 1AY1H 1I75A 5EOQL 2A1WL 1A14L 5CHNA 4ORGA 1EZVY 5GGRB 1JGLL 3VXUA 3ZYIA 1IM9D 4XP1L 1JVKA 1F4XL 3QUKA 4G9FB 5L2JA 1LE5A 2V7HA 1NUFA 2DM2A 5I66B 2E7CA 5C2BL 3DURA 5JO5B 1C8PA 3CLFL 4JKMA 5DJXA 4LCYB 5FYKE 3MRPB 3WDHA 3KYNA 5IJKC 4FG6C 1P1ZA 2EDJA 5JPNA 4RWYL 4PR5A 3VXMB 2A6IB 4KAQH 4MCYA 1BOGB 4HIJB 2C3VB 1PEZA 1MJ8L 1OCWL 3VXNA 2KQMA 4BZ2L 3QUZC 5HY9B 2GUOB 4WTZG 2BSED 3O4LD 5CEYA 5HI3D 1VFUA 1CGXA 3DRQA 5ICZB 2Z93B 4EDXB 2AVGA 4UAOC 2C4XA 1H3VA 3DVNB 4MJ5B 4JAMA 3MRKA 1UWEH 4N8CL 1GL4B 2P5WD 3WBDA 3QHFL 3TV3H 2A83B 3TBTA 1ZT7B 4CMMB 5EUOE 1WK0A 4U6TA 4Y4HC 1XGTB 3LMJH 3GIZL 3VGAC 4PJDE 2COQA 1IAKA 2ATPA 3RNKB 3TN0D 3FTGB 4K71B 3EDJA 5MEOB 1P4BL 5A2JH 2UY7A 2DQIL 3FT4B 1L0YA 5LGJA 2XPGB 3DRTA 2J4WL 4OUOA 1II4E 4FQJH 3SDYL 1YEIL 1GC1L 1IT9L 2YXFA 4LCCC 3IDJB 2IALA 3IT8D 4OI8A 4XWOD 5IEHA 1T5WA 3ZYOA 1EERB 2E9IA 1CFNA 2UVFA 4YDIL 3Q0HA 4I2XB 1TQBC 1GOGA 1S7XA 1QVOB 3RNQB 3BX7C 4ZOBA 3MFFB 3EGSA 3QCVH 3AREA 3W5NA 1A9BA 2FR4A 2FGWL 1NCCL 4FTVE 5I8CA 3GSXB 3MUZ1 1RAMA 1UM4L 3SDCD 1H3TA 3QUXB 2X70A 1J5OL 3MJ9L 4Q6IA 4X7TB 4G7VL 5D7SL 2FJGB 4DQOL 1HHIB 1FVDA 4HK3J 3GSVA 5I1AB 3U2SB 1VACB 2QR0B 3DX7A 1D5MB 3P30H 5EU4B 1DQMH 4FQ2H 4DEPB 2FO4B 4XC1H 4MXWH 1N4XH 3BRDA 4WUKL 4Y89A 3UPRB 4Y5VA 5F89B 1A1OA 4UOW0 4MHHI 4ZTPL 3F5WB 3H9YA 4HIEA 4J4PA 3ZDZF 3L3DB 4Z77A 4G8GE 2C4FT 2FIRT 3MCLL 5HYSG 4O02L 4PRPE 4QKXB 2APWA 2YPLE 3T2NH 5J3HD 4JRYD 1QPPA 1OTUC 5JW3L 5D7KD 1XF2A 4PG2C 4UU9A 1HINH 3QEQB 1F5WA 2BHYA 2KQNA 2LAAA 3QNYB 2E6JA 3QULA 2PO6D 4NPYB 1Q0YL 4HS3A 3VI3F 3IDMB 3LEYL 4LF3B 4M8QB 4F7TB 1EUTA 1AGEB 3EDDA 3T65A 4YEFA 1M7DA 1MFBH 5FV2A 3Q6GL 3H7LA 1JNLL 4XVJL 3CFDB 4OZGE 1OAZH 3TBSB 1IVLA 2VDPH 3CVHL 1QBAA 4UV4L 4EI5B 1NAKH 2AGJL 5EOQH 2A1WH 5DFWH 1A14H 1H3GA 5CINL 4MJID 1WWBX 1JGLH 1T1WB 1F00I 1YY8B 3G5ZB 4QHLA 4XP1H 1F4XH 1ZA3A 3DTXB 1P6FA 5J4MA 3GMMA 4WDIB 5C2BH 1VESA 2FX8L 4MAUL 4GT7A 2DIJA 4HBQA 3SOBL 5KSAB 3CLFH 1IGCL 2EXYC 3WIFB 4HC1L 3KPNB 2ZWLT 3T2OA 3PQYD 1XCQA 1CG9B 2A6JA 1K3IA 5DTFA 4MDIB 4RWYH 3MRMB 4N68A 3BQUA 1A4KB 3BH8A 3P9WB 4LLYA 3VD3A 3ZKXB 4F33B 1MJ8H 1OCWH 3IFNL 3VWJB 3IXTA 4BZ2H 2AW2A 5C0AA 1FSKB 3BP7A 1R5VB 1GSMA 4WW1A 3FHAA 3BUYA 3PXJA 1AP2A 4G6AD 3BISA 4ZFOL 3WUWA 2XKNB 3B43A 3TO2A 4Z7QE 2GTWB 3OWEA 4CADB 4N8CH 4LVNC 5EULV 4AENB 3QHFH 2O5XL 4FOMA 4GRWE 1LEKB 2NY4B 4WJ5B 3GZKA 4PY8I 5F21B 1DLHB 1D6VL 5IB1B 2AJ3A 3RTQD 3SDCA 1UH4A 3GIZH 4O2FB 2ID5A 1BQHA 1MCJA 2NW3B 3FQUB 5C0CD 4U31A 1IQWL 3V9FA 3F7QA 1WZ1L 1P4BH 2DQIH 5C08E 2DIBA 1AR1D 3MJ8B 1LO4L 2J4WH 3SDYH 1YEIH 4F7CA 1GC1H 1IT9H 4F7PA 3GSNB 1VPOL 1NLDL 1CQYA 4WWKC 4YDIH 3ESVF 4LHUD 4PTUA 1OAYL 5MERB 3SE3C 1H3XA 4Z78A 3RWHA 2DLHA 4XP5L 3TNNA 1T89A 3MV9D 4ISVB 4OZ4A 1MQKL 2AXFB 1BJ8A 3VRJB 3V6BR 2GITA 3UX9B 4I0PC 5HYQB 2FGWH 1NCCH 2G9HB 1UENA 2EDQA 4UQ3A 1Y0LA 1GGBL 3FO0L 4HFWA 4Z9KB 1PD6A 1ZLVH 4Z76B 1MLBA 3FB5B 3MRBB 5E9DA 5EBLA 4OBSA 1UM4H 3B2UD 3VH8G 3NABL 3T4YB 2PO6A 2W0LA 5CP3H 4XBGA 4R0LC 5ABDE 1J5OH 3MJ9H 3QWQB 2DQFA 1AIFB 4JM4L 4Q74A 1K5NA 4P57A 1OD9A 4G7VH 1CGYA 4BK5A 2VZVA 5D7SH 5ESVA 4WTXA 4L8BA 1T2QL 4DQOH 3K3QA 1O0VA 1X3DA 4RGOL 4LMQE 5CBAA 2D3VA 1MEXL 4PJGF 3UTOA 1P2CB 4PJ8D 1AHWB 3C5SA 3CFEB 4WUKH 3MLYL 4ZTPH 1SQ2N 3DX9B 2V5TA 2C3GA 3OKKA 3MCLH 4O02H 5FYJU 4CVUA 3CMGA 1S9YB 4FQHB 5FB8A 1OGAD 2EC9T 1R3HA 1UJ3C 5JW3H 3JV4B 1Z9LA 1PW3A 4TVPE 3D25A 3PWUA 3L3HB 5GS1C 3GUTA 4NO3B 5HYJA 2VN4A 5ACLA 3PQYA 5D2NE 1Q0YH 5C0EB 2ZSVB 1ZA6B 1FCGA 2ICWB 2Y6SC 4NIKB 3LEYH 3TVMC 1NCAL 2HT2C 3T0EC 1MCDA 4ODVL 4HK0B 4AH2B 2FL5A 5GXBB 2A0LD 1LHZA 3Q6GH 1JNLH 4LSRL 1F90L 1T7YA 4XVJH 5IB3A 2VITB 4R9HA 2ZOKA 4PRDB 4Y5XA 3CVHH 1GH7A 3MOAL 4UV4H 4GOSA 3V0VA 3QQ3A 4GW4A 4DFIA 2AGJH 3GKZA 2QADD 5FHAL 1JP5A 3NN8B 1W0YT 5CINH 5J6GB 5JOPD 4RGND 4NZTL 1XGUA 4TRPL 5GIRB 2F15A 1X5KA 2VR9A 2Y72A 3HI5L 5IHLB 4UI2A 2Y07L 2V2TB 4NKOA 5L0QB 3ZZ1A 2FX8H 4R3SB 1HNFA 3O6MH 4MAUH 1PSKL 5TF1L 3SOBH 4DW2L 1IGCH 4HC1H 3RTQA 1XGQA 1UQSA 1L7TL 5E00B 4ODUA 1YPZB 4G6JL 1BWMA 5IMMA 1B9ZA 2NY0D 3ULSB 3IFNH 1L9MA 3QIBD 5F7LB 3QG6A 3TZVC 5ESQA 4N8VG 3O9WB 4PLOB 1UWGL 1L4IA 4LHUA 4Z7UF 3IFLL 4M1CC 3DJ9A 3SY0B 4U1HB 5FYLE 2R0LL 1S78C 2O5XH 4N5ED 5KS9B 3H7BB 4FQQB 2Q8BL 4XNUL 5IEKB 2YEZA 3GMNB 4QNPF 3WUWG 1NKOA 1D6VH 5GGVL 1REIA 1DVFA 4ETQB 5DQJA 1IQWH 1F45A 4HPYL 1WZ1H 1IARB 5ADOL 4P2QE 2OXGA 4NRZA 3BW9A 3TBWA 3A6BL 3SJVD 3BN3B 1LO4H 2F19L 1KEML 1WBYB 1BQHG 5C8JA 1VPOH 2BNUB 1NLDH 4NYLA 3FMGH 1A0QL 1OAYH 1JN6B 32C2B 1HHKB 4JDZA 1MWAL 2W9EL 3BEWB 3ZYJA 2Y23A 4XP5H 4E5XB 4HG4K 2GAZB 4M8VA 2YD9A 1MQKH 1HKFA 5HDOA 1M7XA 3JBG7 2MQ3A 3VDAA 4EN3B 3TIEB 4OCXL 4G8EB 1GGBH 1OGAA 3FO0H 3QHZL 1UXWB 2MWCA 1TTUA 1Y18A 2ED9A 3ZHKA 2IG2L 4J3XA 5TDOA 2MJWA 3I6GA 1QHPA 4LOUC 3GGWA 3FO2A 3NABH 4I77L 4U0RB 3EZ8A 4ZFFB 2BP3A 1OOAA 2E9JA 2ZP0T 4IIQC 5FV1L 3STZA 4JN2A 3UDWC 4D9LL 1CCZA 4JM4H 1KELL 2Q86A 5L6YL 3T77A 5DJAA 5AWNL 5D7JB 5MHSD 1T2QH 5GRJL 3SDDA 4P46D 1P7KB 1J0HA 1WFNA 5JIHA 4RGOH 2PTUA 1MEXH 3PNWB 2NXYD 3PGDB 5IR1A 3X11A 3LKRB 3NZ8A 2R1XA 4GAFB 1ZGLM 5CSBA 5C6TL 4MZ2A 3WNKA 1RJLA 3MLYH 1G7QB 1FL5B 4BSWA 5TJWK 3HAEA 3O8XB 4AJ0A 4Z7WF 4YHNB 3DMMA 1PG7X 4PTTB 5JPMB 4Y0GA 4KQ4L 4MNQB 1F3JA 3DV6A 4WU7A 5ICXB 3QFJA 1C5BL 4PRAB 4PREB 1YN6A 1ZGLP 1A7OL 1F2QA 2BCKB 5F1SA 5DT1L 4H1LG 3VXQB 3EOAB 4Y5YB 4FS0A 1DBML 1HKLL 3FRUA 5I19L 2ZOLB 4PJGA 3KYOA 4QYOA 1MELA 3GI9L 3TNMB 5DEZA 4L4TB 1QFWL 1LO5A 1NCAH 2WZPD 5DQ9B 3KLAB 3T2PA 4APQD 5CEXB 4ODVH 1N2RA 3PP3K 1A6ZA 4P2OB 4U6HA 2GK0A 1QNZL 3ROLB 2F5AL 4GRLC 1MCPL 4LSRH 1F90H 5BVJB 2CUHA 3MOAH 3IDGA 4MQ7B 5FHAH 1R24B 1UGNA 4NZTH 1N6VA 5GZND 4TRPH 1AO7E 1TQCC 3I3DA 3HI5H 3KXFA 3OKMB 1VGEL 2Y07H 2X6MA 1U8NB 3GIVA 2D9CA 1PSKH 4DW2H 2K9UA 1WBZA 4JFXA 4OV5B 2ERJC 3VCLB 3BZEA 5BRZA 5JIKA 1B0RB 1L7TH 3IB4A 4G6JH 1T1XA 3D3VE 1DEEB 1HQRA 5B38B 3HS0B 3SKOA 4JRYE 2MTPA 4OUUA 3SCMB 3TYFA 3U46A 4PJDF 5D7IF 5EU3A 4N1HB 3Q6FA 1HDMB 4X99A 1UWGH 3VFRB 2FYYB 4CMHC 4AT6B 4WHYH 3AU1B 2BRRL 5SWZD 1C12A 3ZKQD 4R96A 3IFLH 3GSQA 5F3HA 5IVXB 5JW4Q 5MI0C 4BH7A 1RHHA 3MYZA 4P9ML 4ZFZA 4X5LA 2R0LH 3HE6D 3QUMA 5BQ7B 1GC1C 4X5XA 4LHUG 2CUMA 3MJ7B 2Q8BH 4XNUH 3JWOL 3ARUA 3QDJA 3D39B 3RIFF 2P49B 1A6AB 3O2VH 5GGVH 4YDLB 3MV8B 4NO2B 3NGBB 3KPPA 4MDJA 4MJIE 1HHJA 3DPBA 4HPYH 4OFVA 2IH3B 5ADOH 5B8CC 2DQUL 5ACZB 4Z7UA 2J5LC 1GZQB 4AEEA 3A6BH 4WUUA 2F19H 1J0ZA 1HI6B 1KEMH 4E41A 2VLLB 3WHE0 5F6HJ 1MI5E 4YBQD 2D03L 1IEAB 4TNWF 1A0QH 1Z9MA 1EBPA 4OGZA 1MWAH 2EKSB 2W9EH 4PRIE 5FYKU 1G7JA 1KN2L 3VGBA 1IC4L 3TT1L 1IEBA 4OCXH 3MO1B 3QHZH 2IG2H 1JMZA 4CDHA 1MQ8A 2HT3C 3HRZB 3MGTA 5IK3A 3K7UA 1NUDA 2W0PA 4I77H 1YQ2A 4WO4B 2N4IA 4I4WB 4JO4L 3P4OB 4D9LH 3S96A 1KELH 4G7YL 2DOCA 3FQXB 5L6YH 3EJYC 2FHCA 3TWCL 3MROB 5AWNH 4APQA 5GRJH 3VMNA 2AI0L 1NL0L 2FSEB 3L5WA 3W9EB 2CDEA 2YPKA 5C6TH 3NMEA 1CFTB 1WUNT 4IJ3C 3E6FA 2X9YA 5CKGA 3E6HA 3L5XH 4KQ4H 1D9KA 5FIEA 4Z7VE 1E4KC 3MREB 1YMHA 2XA8L 4NQEA 1C5BH 1T04A 1NH6A 1A7OH 3TA3D 2JJWA 3IVKB 4MNHB 5DT1H 3OTTA 3PHQA 1OSZA 1I9JL 2P5ED 4I5BA 1DBMH 1HKLH 5I19H 4Q9QL 3GI9H 3HPJA 3MV9E 1QFWH 3WHXA 5T3ZD 5HGAB 4YBHA 4PG9B 3F7PC 5FO7B 5TE4L 4UIMA 3LY6A 1QNZH 4Z7WA 2GFBA 1M71B 1HHHA 1MCPH 1U8MB 2F5AH 3JV5A 1KIUA 2GT9B 5T1MA 3ARFC 1HH6B 2XG4A 1ZK9A 1BGXL 1BQSA 5KZCB 1U8QB 3OKDA 2EE2A 3C5ZA 5FEBA 4RMTA 1U9KA 1ZLUK 3AROA 1VGEH 4CJ1A 3BO8B 5JOFB 1BJ1J 1HXYB 4IRJA 3BVNA 1VHPA 1QSZA 4FQXB 5I76A 4Z7QF 3HLAA 4OCSL 3EIFA 2HH0L 1R3KB 4UDUB 2NY6B 2VERN 3MUGB 3P73A 3T2QA 2BOBB 4CDGC 3IS1X 3DVGB 3D69A 3FQWB 5JIPA 5IWLC 1OHQA 1I1YA 1CGUA 1U8OA 4UBDC 3RY4A 3U1SL 3ALPA 4EIZC 1XGPA 1ZHNA 5AYUL 2BRRH 1CLCA 4HWZB 2W60A 1BZ7A 5AYQA 4L4VA 4P9MH 5IMOA 3B2VL 5DJDB 3G6JF 3O3BB 4P2YA 4PRPB 4JFPA 3S36X 4NQVB 4KC3B 4KKNA 3EO1B 1FPTL 2PW1A 4O2CB 1TMCB 3QISA 3JWOH 4UOW1 1U8HB 3O2WL 1G6RB 1RUQL 3JVGA 3VFPA 8FABB 3L6FB 5CSZA 3QDGD 1C7TA 3Q2CA 1DUZA 4XVUC 5C9JA 3W0WA 4FG6D 5D7IA 4DZ8A 2Q6WB 5JOPE 5EIIA 4LKXA 4I3GA 2HJFB 1NJ9B 4FXGB 2CO6B 2DQUH 3FAXA 3STLA 4QHMA 2CLVA 4XPHL 5C07B 2IBZY 3T4AB 2V5SA 4Z6AT 2DLEA 1X5GA 1J12A 2D03H 3QZWG 3ES6B 5DR5L 1NGXB 1T83A 3P4LA 4NQSB 4C55A 3U83A 5JNYA 3NAAL 4HLJA 1KN2H 3WL9A 1IC4H 3TT1H 1ZWIB 2PNDA 2BHZA 4PJHE 1GGUA 2HG5A 1S7VB 4Y4HD 3VXOA 2PTTA 4MLIA 2P5EA 4PJIA 5F1KC 2J3SA 1UH2A 3PWLA 4JO4H 2I9TB 1CVRA 1P4LA 5JXEC 5DEGB 4U1IA 1MFEL 4G7YH 2UWEE 4JPKL 1DQJA 4X98A 3T8XA 3PWVA 3TWCH 3BFOA 4N1EA 3KS0J 4BKLA 1UM5L 3FO1B 2AI0H 4N90E 3ECBB 1NL0H 1A8JH 1N59A 5ECJE 5F1IB 3KHOA 5DS8A 3V4UL 5DEFB 3LSOA 2R9HD 1LGVA 4LDOB 3HFML 1WCBB 2C3WA 2JIXB 2ICES 3GMOA 3HUJF 5EU6D 2DN7A 4G8GA 1D3CA 2BRQA 1QPXA 3DROB 2YPLA 4YXLL 2GCYB 3PE9A 3M45A 4XNMA 2XA8H 4GRWB 3ILPB 3HG1B 3LD8B 5DVOA 2XNAB 1IILE 1M1SA 3BYYA 3SQBA 1I9JH 2OMNA 1KJ2L 1ZLUH 4XP9L 4DEPC 4Q9QH 3ZKNC 4DGYL 4JZOA 3T08A 4WFHD 5E8OB 3FFCD 3IKKA 4EI6B 3P40A 3ARQA 5TE4H 3VDCA 2Z91A 4EEEA 3QCTL 5EBWA 4LSTL 4S2SA 3V7AG 4ORZC 3RGVA 3FN9A 3BZFB 2EDTA 4R4BB 2X42A 1BGXH 4HT1L 1BFVL 4WIQA 5MHSE 3TO4B 2X1WL 4PRNB 1OTUD 2EE6A 4R6UA 1SY6A 1S7SB 1WICA 3GSOB 3H9SE 3GRWA 2L7UA 4MQXC 3ZTJG 1QZ1A 4OCSH 5DMJB 1U92A 3NZHL 2E7HA 4ORGB 4QXTB 2HH0H 1OP3K 1UKTA 1WC7A 5A43C 1KPRA 4KI5C 4Y4KA 3VU2A 3QUKB 5L2JB 1LE5B 3D85A 2V7HB 4P4KC 1CIDA 1FCCA 2PTVA 1U91B 3QFDA 4X9FA 3DURB 4YHOL 2VDML 2WM0A 2YHGA 2X4UA 3QUZA 3U1SH 5DJXB 1S9VB 3ZDXE 2I07B 2BNQA 3SO3C 5AYUH 1CN4A 4PJ5E 5JPNB 1AKJD 3FB8A 3B2VH 4MHHG 4GKOA 4MCYB 5E5RB 3VXNB 3SDAC 4HMCA 1FPTH 2BMKA 5KTEL 3O2WH 1RUQH 3VD7A 1CF8L 4KJQC 2EXYD 4JO1L 3DRQB 3JV6A 4R4NC 4MJ2A 5D2NB 1SVCP 2JB6A 4JAMB 4NQCE 1BJMA 5IMLB 4X9HA 4XPHH 4NKIL 2P1YA 3TBTB 4OGYL 4ZQKB 3G6JA 5DDHB 4LCCA 1RMFL 3CFBA 5CS7A 3OGCB 3V6OE 5DR5H 3D87B 1A7BA 3ZKMC 1IAKB 2VSDA 4XCYA 1J1PL 3LEXA 3V7AE 3OG6B 3HZKB 4QF1A 2DKUA 3NAAH 1FAKT 1MREL 3NPSB 1WT5C 5DJYA 2YSSB 1XF1A 3VFOB 5IEHB 1T5WB 3PV6A 2WBWB 5FECA 2N1KA 5I17B 4MS8C 5D93C 5SWZE 2HA1A 3EYFB 5BXFA 4MNGE 1S7XB 1G6RL 5FO8A 3B83A 1MFEH 3E2HC 4JPKH 3VH8B 3AREB 1W0VA 4D0CB 1A9BB 4HXAL 5I75B 1UM5H 3V8CA 2P8PB 4WHCA 1VFOA 1SHMA 2XIDA 4K3GA 5FM5O 1AE6L 1FZMB 1ZE3C 1WAAF 3V4UH 4WWKD 5GGTL 2X70B 3QIUC 3HFMH 1E6OL 1AGFA 2Z8WC 1G7HB 2ZUQC 2OS7A 1KACB 3VD4A 4FQ1L 4JHAL 4BFIB 1F3DJ 4ZUWA 3H9HA 4I0PD 2RB8A 2YD6A 3GSVB 4YXLH 2E6PA 3AM8C 2M2DA 1QHOA 3DX7B 3THML 5I1GL 5IFJA 4PPTA 3OF6A 4ZUUA 3TH3T 1DJSA 5CAYB 4Y5VB 1K3ZA 3KDMB 1KJ2H 1BF2A 3A0OA 4NUGL 4P2RA 4XP9H 4K8RL 5GZOC 4OCNC 1MFAL 1AHWC 4DGYH 4X7DC 4Z77B 4L29A 1IM9B 4GAGL 4XHJC 1E6JL 5F6IB 5C0GA 4MAYA 3KHQA 3FQTA 1XF2B 2ZCHL 1OP3H 3QCTH 3HUJA 4M93B 4LSTH 2FJHA 2L7JA 2VZTA 2ORBL 5EZIL 3EOBA 5HDBE 4HT1H 1EFXD 1BFVH 3RX8A 1AKJA 1FQ9C 3JTSB 4YHIB 1NMAL 3TH4T 4NM4L 1LK2B 2PXYA 1M7DB 2XG5A 4YO0A 1RJZA 2Z35A 4NZDA 4KWUA 4GSDL 5JIIA 3MV7A 3VXSD 3C6LC 1WVZA 1KJ3L 3O4LB 1QKZL 4PP1C 1U3HA 4PBWD 4L5FL 3FB6A 4NT6A 3EO9L 3NZHH 5FOBA 5E0QA 1HSBB 2Y6SD 1PG7W 3N1MC 3TVMD 2HT2D 1ZA3B 2P5WB 5CGYC 3T0ED 1Z9OA 4XVTL 3JWOC 4NNXB 1CDJA 2JCCE 4YHOH 3IAQA 1BFSA 2VDMH 4IM8A 4YHPB 2VLRD 1KB9K 4R90L 5IV2A 3QHTC 4R26L 1LP9E 2MOVA 4M61B 1QO3A 1XCQB 1AQDA 2A6JB 3CU7A 5F7EL 4OD3L 4GW1A 1KT2B 3TN0B 1KOAA 3BH8B 5T3XL 2V7NA 4LLYB 3HCVA 1I4FA 1FO0L 1UACL 1S7UB 1ERNA 5C0AB 3ARGA 5KTEH 2AJSL 4WW1B 1CF8H 2CIIB 3BUYB 2CK0L 2XKUA 1AP2B 2XKSA 4JO1H 3MRHA 3L7EA 1FVEA 4TTDC 3WUWB 3TO2B 5IB4B 4HH8A 4QCIA 4OZIE 4JREC 1GOHA 4NKIH 2BVPB 1M05B 5MENE 4OGYH 5T1KD 3TZVD 3WFDL 3KWWA 2E6QA 2EDBA 2A2QT 3VA6A 1CFVL 1RMFH 3IJHA 3SDCB 4U1JB 2ZCKL 1BQHB 4KHXL 4ODHL 1J1PH 4M1CD 3O6FA 3LN9A 4U6XB 4EVNB 4IRZL 4CAGA 1KCRL 1S78D 4I0PA 1MREH 4QRQB 3WS6C 3J8F7 5IGXL 4F7PB 3KJ6L 1NFKA 4J8RA 4V1DD 4YHLL 1TNMA 4PTUB 4N0RA 1ZGLA 4Z78B 3RWHB 3TNNB 3BPOB 1G6RH 4Z7VF 1A3LL 1TDQA 4OZ4B 2GITB 1E4XL 2CIKA 4RAUA 4HXAH 4YHZL 4OF5A 4UQ3B 4JRYB 4HFWB 1IKFL 4X7SL 4G42B 3O81A 5EOCJ 1MLBB 2ZPKL 2FGZA 4AEHL 5BV7L 1AE6H 3GSWB 5EBLB 1HHGB 3ARPA 3QDGE 2PO6B 5GGTH 4XBGB 3PWPD 1E6OH 2DQFB 3VI4E 1K5NB 4P57B 2V2WA 2A6DB 1HYRC 4FQ1H 4JHAH 4NC1C 5C9KA 2D4DA 2AK4D 4L8BB 5KN5A 2UZYB 2RCSL 1H3UA 5CBAB 4A6YA 1FC1A 4OLVL 1UJ3A 3THMH 5I1GH 3HZVA 2IAMA 3UPCA 5GS1A 4LOUD 2VQTA 4KJWC 1QBLL 4NUGH 5E2TL 1CGVA 4K8RH 3M17B 1MFAH 3OKKB 3FKUS 1WAAA 1IAMA 4YGVA 3TVMA 4OV6F 4GAGH 1E6JH 3MRLB 5H37G 4JKLA 3T0EA 2X9WA 4CL7A 1R3HB 3O8XC 1PFCA 2ZCHH 2ITDB 3WD5L 3D25B 5DQDL 2D9QB 3OKLA 5BW7A 5KAQG 3GUTB 3QRFM 5JQ6L 1HWGB 2ORBH 4M5ZL 3PQYB 2FEDC 5EZIH 5FCSH 3W82A 2IFGA 2FJFA 4WI6A 1JZ5A 5HGBA 3NCFB 4IEFB 1NMAH 1D5IL 3WHE1 1LNUA 4NM4H 4R2GC 1AO7A 4U2ZA 5ERWB 5I8OL 3O3DA 2H2PC 1BLNB 4GSDH 5BCAA 2VISB 4GH7B 2BVQA 1T1YB 1OB1A 1KJ3H 4Y5XB 1QKZH 3V0VB 4L5FH 2AK1L 2R2EB 4GG6E 3EO9H 1T22A 3NIGE 1A2YA 3IDYC 3W81A 3B9KA 2VDQL 4XVTH 5CP7A 3WNLA 4KXZH 5F96L 1AGCA 2WNGA 4GRLD 3TZVA 4R90H 5IW3A 4R26H 5I2IA 3CLEL 4NKDA 1W72B 1XGQB 3RTQB 2R2CA 3HE7D 5F7EH 4OD3H 4ODUB 5C0CB 3ZYZA 2DI7A 1E27A 1HCFX 4PJBE 5IMMB 1I8LC 5T3XH 1HEZB 3FFCE 3S98A 2J8UF 1FO0H 4IMLA 4CRPA 1UKSA 1B0GA 1UACH 2V9QA 5IW6A 4YGAB 3QG6B 3BDBA 2AJSH 5ESQB 4V1DA 2CK0H 2Z0BA 1Q0XL 1XFPA 4LHUB 3X3GL 2RAMA 1I7ZA 3MV9B 2MCPL 1T0NA 5HHOA 3BAEL 1YC7A 1A64A 3BP6A 4WFED 3C2SA 4MGXA 3RKPA 3WFDH 1IAOA 5DA4A 1CFVH 1MI5A 2R8SL 1B3JA 1JWMA 2ZCKH 1DVFB 3WJJA 4KHXH 3PWPA 4ODHH 2EDNA 5KSVA 1TFHA 3BIKA 4PJCE 5E7BA 4JVUA 4HD9A 1PYWA 4IRZH 3ULVL 3BW9B 4S11A 1EO7A 1WBXA 3TBWB 1U0QA 4XPGL 3ARXA 4GG8A 1KCRH 3TIDA 5IGXH 4ALAL 4RFNC 3C09B 3KJ6H 2XACC 4HUNB 5I74C 4WI2A 1J8HA 4UB0L 4PJ8B 4K7PY 1K8IB 1YDPB 3IFPA 3VXTA 1DEDA 1WJ3A 4JDZB 1ZVSB 4IIQA 3UDWA 4LASL 1A3LH 1WTLA 2X40A 1RD6A 5CFHA 1FE8L 1KF9B 2Q8AL 3S36L 2C5DC 1E4XH 4PJXE 3RPKA 4YHZH 3RQ3A 2X4SB 3TGXA 1P7QD 3GSRA 5LGKA 4X7SH 1OGAB 1IKFH 3KPSE 2ZPKH 3C8HA 4AEHH 5BV7H 2EEDA 3GGWB 2WBJC 3FO2B 2JK5A 1C08A 4RGMC 5D1ZC 1X5IA 4PV9B 4N0YL 3STZB 4JN2B 3E3QE 4LVOB 3L95B 5D6DA 1ZKAA 2X4OA 2Q86B 4WO4C 5ILTL 3MYJA 2VXUL 1AXTL 2DM4A 2H26A 3SDDB 5LQBL 1QBML 1V3KA 2RCSH 4Z7VA 1RZGB 5FOJA 3OR7B 4OLVH 4KUCF 3X11B 5CIPA 2R1XB 1YN7B 3QWRD 3OJVC 4G80A 3D6GA 5EPMB 1E4JA 4K3EL 1QBLH 5E2TH 3LRGA 4MWFA 1IL1A 5F9OH 4RGNB 1VEPA 2VH5L 3EJYD 1J88A 3CFJB 1F3JB 4WU7B 1YN6B 3QQ4A 5I9QC 3MLRL 3WD5H 4PY7A 5DQDH 4I48A 4TUKL 4NN6C 5BMFL 4MYWB 5JQ6H 2X4PA 4QEGA 4M5ZH 4PJGB 1JTTA 5D7LD 2X1PA 4K7FA 1QSFA 1D5IH 4KTDL 1G7PA 3V0AC 4N9GA 2ZUXA 5DD1L 5I8OH 2NY0B 4Q58C 2DMBA 2BHUA 3QIBB 4D9RD 1HXMA 4DUVA 3MZGB 4GAYA 4RMSA 2OM5A 3N1QC 3BGFB 3IDGB 4YDJA 2AK1H 5F9JA 4Y1AD 4WCYL 3OHXA 5HPOA 4DZBA 5I16A 4X6CB 4I3RL 2UWEB 3WFEL 3G6AA 1BQLL 2VDQH 3KXFB 4PP2A 4KMTL 1UWXK 5F96H 3GIVB 5KOMC 2WBKA 4HWEL 2DYPA 4JFXB 1NMBL 3CLEH 2B2XL 3DETC 5BRZB 5KVFL 3ARFD 4KUCD 1UT9A 3TBVA 4OB5L 5SX4I 1EJ6A 5JOEA 3S8WA 1T1XB 4FQXC 5DHYB 5EOTB 5CKAA 1BFOB 1HQRB 4OUUB 3SJVB 3TYFB 3U46B 3U0PB 3ZE2E 5EU3B 1ZV5A 3ARBC 5E8NA 4O4YL 4X99B 4PLNC 3WSQL 4UNVA 1Q0XH 1C12B 1AD0A 4R96B 5EUKA 3NFPA 1XF4B 5F3HB 3X3GH 4RX4D 1NGZA 4BH7B 1RHHB 4UQ2A 4ZFZB 1KULA 2F8VA 2MCPH 3BAEH 1OP9A 3GMRA 4X5XB 1EHXA 5IBUB 1OT2A 3F7YA 2VNCA 3VXSE 1FL6B 4FRWA 1H15A 4UBDD 2R8SH 5CP3A 4AEFA 2J8UA 5JHDD 1UZ8B 3CVIL 2VDKL 4HKBA 2R69L 3KPPB 3MJ9A 2H45A 1HHJB 4S1SL 1I1AA 2GEEA 1KCUL 1TCRA 3QZWB 5HHMD 3ZSTA 3WIIL 3ULVH 3HC0A 4Z7UB 4MXVE 4XPGH 4KKCC 1I1RA 4E41B 4P46B 1OQOA 3KLSA 1RZ8A 5J11C 4ALAH 2VLRE 2NXYB 3KPLA 4YHML 3FB7B 4QRPA 4UB0H 3IJYA 2VRAA 4XVUD 4K23H 2H6PB 2EECA 3CIQA 4U1LA 1FYTD 4LLMA 5F8RC 2XWBB 1I1CA 4ACPA 1I7RA 4LASH 2ZUYA 5ID0A 1PKQE 3O4OC 1FE8H 1G7JB 2Q8AH 3S36H 1VA9A 1P9MC 4ZAKC 3UJIL 5FDWA 1IEBB 1T1ZA 5K9JL 1LD9B 1YEJL 2BY1A 3PABA 1H5BB 4PFEA 5MEQA 3MGTB 5IK3B 5EZLA 4MXQC 4K8RC 4N0YH 3EBAA 3L3IB 5MP6L 4R7NA 3S96B 2P47B 4M1DL 5HVHC 1QG3A 1S7RA 1UCBL 5D7LA 2AV1A 4ZUVA 2ADFL 5ILTH 4M7ZC 2F54A 2VXUH 3D2UD 1AXTH 3P4MA 4LVEA 4TULL 4APQB 3PUCA 5IMKA 4HAFA 3PJSA 3D0VA 4O5LL 5LQBH 1QBMH 1E4KA 3BP4B 5FYJL 2JF1A 4R97B 3ZE1F 43C9B 2WAHA 3CVHA 5HDBF 2CDEB 2Z9TA 2YPKB 2ADJB 4K3EH 2JJSC 3CFIC 3I2CL 4MX7A 5JXED 3E6FB 1CFQA 1R3JB 1A47A 1DQQB 4Y4FA 5JQHC 2VH5H 4L8SC 3E6HB 3GEWB 2EZ0C 1D9KB 3DX6B 3QNXB 4AZ8A 1YMHB 3NPZB 2XA3A 1T04B 4GS7C 1VEMA 2MHAA 3MCKA 3MNVA 3MLRH 2YD7A 4G8IA 4TUKH 5BMFH 3PHQB 1NMCB 1Q9WA 1OSZB 1KFAL 3LD8C 1KIRA 2HVJB 4X7CC 1NANH 4KRNA 3ARFA 3FN0L 1DN0A 3U36A 4P49A 4NUJA 2CGRL 4FP8L 3WHXB 4JZJA 1MCQA 4JLRB 4CJ0A 4KTDH 1LP9F 4U1SB 5DD1H 2EC8A 4Z7WB 5EU7C 2GFBB 1HHHB 3MR9B 5F7YC 3RWDA 1KG0A 5T1MB 1U2CA 3AAZA 3H9SA 1CDUA 2CD0A 2I9LB 5SWZB 4ZFOA 5I6XB 3ME0A 4WCYH 4MNGB 4KZDL 3OJDA 3ZKND 2EIZA 5CD5C 4I3RH 2O93L 3WFEH 1IGYA 4N0UA 1BQLH 3HE6B 1RZFL 2MPAL 3T3ME 3BMWA 2B1AL 4KMTH 1UC6A 5IWLA 4Q0XL 2X05A 3BVNB 4HWEH 1NMBH 5I76B 2B2XH 1ITBB 3HLAB 2IH1A 5ALBL 2YA2A 5KVFH 3QEQD 3MLUL 2VQ1B 2NX5E 4OB5H 4PJ5A 1BD2A 1ZXQA 4H26A 5BZDA 3UMTA 4QHNB 1PQZA 3U30C 2BNRA 3P73B 3N85L 1L6ZA 3F8UB 3D69B 1Z3GL 3PGCA 1QLFB 4U1MA 1RIHL 5IB5A 2H9GA 2B7DT 4O4YH 4K7PL 3QQ9C 3WSQH 4MQXD 4JFFA 3F62A 1TETL 1XZ0A 1BZ7B 2I5YL 5TGBA 1FYTA 4L4VB 4HULB 3UXFA 2GI7A 4WNQA 4KI5D 2VXQL 2NLJB 3UPAA 4JFPB 4JHZA 4P4KD 3W9DA 1DBKL 3BDXA 3SGDI 1F11A 3EDEA 4D8PA 1T7VA 4HJGA 1AFVL 1NFDF 4DAGL 4JDVA 5C9JB 1DUZB 3W0WB 3CVIH 3V6OA 1F4YL 2VDKH 3L5HA 1X5ZA 2R69H 4S1SH 5EFIB 2A74A 5EIIB 4LKXB 1KCUH 4ZXBC 1X44A 1EEYA 2YPVL 3WIIH 1EO8L 1V3MA 4QHMB 2CLVB 4XNZB 2EDXA 3SDAD 5BV7C 5GRVK 4OTXL 1N5AB 1BP3B 4ZDHA 3MV11 1S7QB 1XIWC 1N5YL 4YHMH 1DQLL 4F58L 4KJQD 4R4ND 5GS0L 3QDMA 1H0DB 4X4ZA 1CZ8H 4Y88A 5BJTB 3RI5F 1BZQK 2I26N 5JNYB 1C7SA 2K1MA 1YQVL 3WL9B 5I15L 3UJIH 1OY3B 3PWNA 2JCCB 1YEJH 1EH9A 3TA3B 2HG5B 4KK8C 4G6KL 1YNTB 1KCLA 2LVCA 3LZFL 1ZLWK 3QUML 3VXOB 2YD3A 2P5EB 4PJIB 1BBJA 2AJZB 3PWLB 3ZKMD 1P4LB 5MP6H 4M1DH 2BSTB 1UCBH 3ZT5A 3K2UL 2DKSA 2ADFH 1DQJB 4X98B 3T8XB 1EX0A 3VRLE 4TULH 4AQ1B 2HTKC 3OL2A 2FWOB 4HGWA 4O5LH 1INEL 3JSSA 3AREC 5FYJH 4XPTL 2X41A 4FFVC 5DS8B 1I1FB 3LSOB 4MD5B 3DO7A 4MS8D 2G5RA 4CNIA 3I2CH 5DHXB 4I13B 2EYTA 4FZEL 4HZLB 1HNGA 1FJ1A 4HIIA 4ONGL 1MLCB 3H0TB 1X5HA 4Q6IC 1SBBA 2R0KL 4J12A 4EXKA 3DBXA 4U2YA 1BVZA 2RIKA 4RQQA 1JHTA 1LILA 1ZLSL 4P2CG 5F1NA 4IRSC 2BVYA 1KFAH 3IJSA 3NIGF 4NHUB 2Q76A 4M4RA 3TP4A 3NH7L 3QIUD 3FN0H 4X4YA 2QQNL 4JZOB 4BSJA 2CGRH 1MHHA 2D7PA 2WW8A 4FP8H 5E24E 3OXSA 4TTGA 2CR3A 2GW5A 4J4PC 4M7JL 3HC3L 2AXHA 1CGTA 1EXUB 1XR9A 5F6IC 3RGVB 2AQ2A 2ARJQ 4G8FA 1D7FA 3B8SA 5F7UA 2AEWA 5GS3A 4PJBF 4Z7NF 5FGCE 3U0TB 4LFHD 3UBXA 5GZOD 3SDXA 4QTHA 4KZDH 3VMOA 4RMVA 4I9WD 5DJ8B 3W2DL 1UB5A 4BH8A 5HYEA 4XHJD 5DJ0A 5CLTA 1U95A 5BS0A 4N5UA 1RZFH 2MPAH 4EUPH 4ZO6A 1RSFA 2B1AH 5ITFB 1GAFL 4Q0XH 2YD2A 3HAEH 5B3JF 5HHPA 3VGHA 3FOMA 4E0RA 1KTRL 2NY3C 3BWAA 1T0PB 5ALBH 4W4OC 3MLUH 2GJ6E 3MRFB 5A16A 4Y4KB 3N85H 4YH6A 4RFOL 5DD6A 3VXRE 1T3FA 3QFDB 1Z3GH 1VGKA 5DRNA 3BXNA 3SDAA 5E99L 1RIHH 3QUZB 3C6LD 2KH2B 1RJCA 4DTGL 1HK6A 4K7PH 2BNQB 4PP1D 2H32H 4M43L 4BA8A 3DHJA 4PJCF 1MWAA 1TETH 1S9WA 1HH9B 1MOEA 1ND0A 3LN4B 2BERA 4UAOB 5C0BA 4W6WB 4K55A 2I5YH 3QO0A 4C56A 4JFHD 3P11L 1BZ9B 3ULVC 3FB8B 3X14A 4P3WA 2VXQH 4KGJA 1IZKA 5CGYD 4GUPB 1QACA 1DBKH 3WN5A 3ARRA 3BQUC 5E70A 1AFVH 4DAGH 3WO3B 2XFXA 3V8OA 4OF3A 4ZSOE 25C8L 3FZUC 4QRSA 1F4YH 4PJXF 4Y1AE 2W38A 1YMME 4Y2DC 2JB6B 5A3IC 2YR3A 1J10A 4NQXA 3VGFA 4OZFA 2Y06L 1ZLWH 3MBXL 2YPVH 3MMEB 1EO8H 5FYKL 2XQBL 2EYRB 4JJ5A 1CFBA 1RFDL 1U2HA 3KPMA 3RL1B 5T1DL 4OQTA 3NFSL 3LOWA 3G6JB 4OTXH 1WT5A 1OP5H 1XCTA 4LCCB 5F7WC 5D8JL 1JMXA 1N5YH 3FFDB 1DQLH 3JTTB 1U8IA 4F58H 5JMOC 3CXHJ 1NFDA 5E5MB 4GG6B 4XCYB 5GS0H 4TTDD 1TQBB 2B8OT 3K4ZA 4RZCA 3AS0A 4ZUTA 2AEQL 5EU6B 2I24N 1YQVH 5I15H 3HI1B 4NBXB 3NOIA 1FL3A 5I30L 2BVTA 4PV8A 3T1WA 4NM8L 3BHBA 4RIRB 1KTKE 4G6KH 3LZFH 3QUMH 4PRHE 5LWYL 3NIDF 2OZ4A 5ESAA 5FO8B 5D96C 3S37L 3QYCA 1AXIB 3K2UH 4GBXA 1W0VB 1FZOA 1J9CT 5D1QA 1BM3L 3RWIA 1T89C 2V2XA 3AXLA 1INEH 4XH2A 5J06A 1XGRA 4J7RA 3V52L 4G9FE 4XPTH 1YC8A 5KVMC 1S5HB 2OJEA 4OCYL 2WUBL 2CLRA 4JANA 3CX5J 1T5XA 4O2EA 5F97E 5JHDE 4OF8A 1N3NA 1D5BA 1AGFB 2CRZA 4FZEH 4YHYC 5HHME 4ONGH 4OLYL 1BREA 4ZUWB 3H9HB 5SX5K 2R0KH 3IGAA 1F8TL 3HI6L 3DOSA 4QRRA 1CLZL 3VXME 5IFJB 1ZLSH 2G75A 2O5YL 4KK9C 4XMLL 5E4EB 1T4KA 1SJXA 2UYLB 2UUDK 3TCXA 3NH7H 4P2RB 3OSKA 5JORA 3O3EA 3WEXB 2QQNH 3BH9B 2D31B 2X4QA 4M7JH 3HC3H 4RNRA 3I75B 1BJ1H 3IKCB 4WW2F 2X44D 2DL2A 1I8MA 3C6LA 5IT2L 4C83A 4Q9CA 4KJWD 3T0AA 2AXJA 3BIBX 3EOBB 3LCYA 4PJ7F 3RIFK 1EBAA 1AKJB 5ISZD 5I1LA 3W2DH 4WHYG 2PXYB 3MFGB 1ES0A 4G9DA 1RJZB 2ILLA 3O8XD 1GAFH 2X7LB 1EEZB 3UBXG 3JZ7A 4MNQD 4G3YL 2EDWA 4QOKD 2EYSA 1BQUA 1ACZA 1KLUA 3BZDA 5FOBB 2FEDD 5L2KD 1NBYA 3R0NA 4UTAL 4TNWK 5SWSA 2VYRE 3RGHA 1A6TA 1A6UL 4R2GD 4RFOH 2PYEA 4S0TD 4LLDB 1S7WA 2XTJC 1GYAA 2H2PD 5E99H 3MRJA 3ABZA 3GBML 4DTGH 1HWHB 4LQ1A 1WGOA 2I27N 1QO3B 3EHBC 3QEUA 1AQDB 4M43H 2CQVA 4OJFL 2XZAL 4WV1A 1JNNL 4GW1B 4C4KT 3P11H 4JE4B 4R4FL 2ED8A 2YRLA 2DJ4A 3KVQA 4AL8L 5J6HA 1JPTL 3HCVB 4LVNB 1G1YA 1BBDL 3MLZL 4HWUA 5J13B 3UTQB 4XXCC 2M8XA 1V3JA 25C8H 3MRHB 3L7EB 5FCUL 3QRGL 4ZYKA 3LPWA 4TNVK 1EFQA 4U3XA 1AC6A 3SHSA 4QCIB 4ZPTB 3GRWL 2Y06H 3MBXH 1XF5A 4KRMB 4PJCA 5FYKH 2XQBH 4WU5A 1B6UA 1RFDH 5T1DH 3NFSH 1CLOL 3S4SA 2WWMC 5F72S 3WS6A 4EQ2A 1U41A 5D8JH 1A4JA 3IJHB 2WINA 3X13A 2NY5L 4X6DE 5ITBL 4WWKB 3NCJL 3QEQE 4M02A 1FV1B 3RU8L 1FIGL 3CH1A 3C6SB 2VUYA 1MAML 3MNZA 4NSKA 4LEOB 5F7NC 3KS0H 3O11A 2LU3A 1PY9A 5IF0A 4I0PB 4P5TA 4X6EA 2JKXA 5I30H 1ROWA 4J8RB 4NM8H 1B88A 1KCVL 5F7DA 4I18C 4ODXA 4ETYA 5LWYH 4JQIL 3MPCA 3RJQB 3S37H 4RAHA 3DGGA 3CSGA 4KMQA 4KI5E 1BM3H 4LCWD 1UEMA 2R56L 3KG5A 1A1NB 1EA9C 3GK8L 5FAAA 1CE6A 3I9GL 4HV8B 5ENWA 3V52H 2J6EA 1JNHB 3NACL 4HHAA 4OCYH 2WUBH 5H2BA 3VFTB 1N6UA 4M7KL 1FH5L 3LN5B 4JRXD 4PJAA 4XCFL 5EN2A 3MOBL 4H88L 1JZ7A 1T7XA 2F53D 2VL4A 5ISZA 4OLYH 1QFUL 3ALWA 2QKIA 3TJEL 1F8TH 3HI6H 4K3DL 1CLZH 1UJ3B 4LAQL 4LFHG 2IAMB 3UTTD 4PS4L 3SDDC 3VFVA 3VXSB 2O5YH 5JW4N 5GS1B 2D0FA 2WBJD 5D1ZD 2C3HA 5FM5M 1S5IL 1WIPA 1TITA 5GSRB 3H3KA 3LRHA 4YDVB 1FRGL 5L2KA 1BWWA 4Q2ZA 2IAND 4WO4D 4YGVB 4OZHF 3TVMB 1NGWA 3HR6A 5ADPL 5HD8C 3T0EB 3G5YA 4NC0B 3DMMC 3O0RL 4BZ1L 3QDHA 1UVQA 2VLRB 3OKLB 5IT2H 1Q9KA 3MLTB 4D3CL 2OBGA 3C8DA 5HGBB 1Q94B 4NBYB 5IFAL 1LNUB 4JM2F 4OSUL 5IKCA 4DN3L 3O3DB 5A40E 4ODBD 5J9PA 5KANG 2BVQB 3O41B 4G3YH 3NBNA 4WW2A 2XICA 3MRDB 4ELME 1T22B 4IMKC 3CC5A 4UTAH 4Y19D 2EIDA 5CP7B 3QR2A 1A6UH 2VUOA 5EIQA 3ULUF 4PJ7A 1AGCB 5T1KB 4B7LA 5GGSA 4X7EC 3GBMH 3TZVB 4RDQG 5I2IB 2EKJA 2HLAB 4NKDB 4QHUA 4OJFH 1EHAA 2XZAH 1DQTA 1JNNH 1YZZA 4UT9L 3C5JB 4YNYA 3E1F1 4R4FH 4QT5B 1VDGA 4AL8H 1AXSA 2FIKA 1FFPB 1JPTH 2NW2A 1VFBB 5ANMA 2BVEA 5AEAA 5INCA 4IMLB 1JTPA 2R39A 1B0GB 5GRZA 5IW6B 5SV4A 1BBDH 4CVZB 1VEOA 3MLZH 1AD9B 4HUWA 5FHBL 1G0DA 4V1DB 5GS0C 3DETD 3CDGB 3SKNA 5FCUH 4L1DA 3QRGH 5HVGB 4ZOEA 5I1EL 1I7ZB 3L7FB 4LLQA 4FQXD 2VLKA 2FB4L 1T0NB 4LLAA 3GRWH 5HHOB 5DMKA 1XMWA 2G2RA 5F44A 1CR9L 3GI8L 5C0DB 3BP6B 4LCWA 1TZIA 3U4EA 2NY6D 3OPZL 5BOZG 1CT8B 1I8IB 1CLOH 3VFWA 1YY9C 1B4JL 1IAOB 2IQ9L 5E8EB 1U8LA 2ZJSL 4J23A 1JWMB 2NY5H 3NCCB 4LSPL 5ITBH 3PWPB 2ZKHL 3NCJH 1HIML 8CGTA 5KSVB 2E7BA 2VJXA 1KTDA 3RU8H 3S4SG 1FIGH 1IEHA 4URTB 3D0LB 5LJYH 3IDNA 3BIKB 4HLZH 1MAMH 3PWJA 4BM7A 1G9NL 2F53A 2AK4B 2EDFA 3D18A 2E8YA 2O61A 1HZHL 1ZTXL 2Q20A 3LS5L 2H3NA 3CZFA 4ZS7L 5FYLL 1KCVH 1IRAY 1KJ2A 1QD0A 3IFPB 3VXTB 4JQIH 2BVUA 5D1ZA 1A7QL 4IIQB 5JDJA 3B5GA 4NKMB 1KPVA 2RHEA 4EXPX 1ZVHA 1F3DH 4OF0A 3RL2B 2PYFA 1GGTA 2R56H 3SGEI 3GK8H 4KKCD 4Z0XB 2WWKO 3I9GH 1K2DA 3R0MA 3DX8B 4CU6A 4K9EL 5CCKH 3NACH 4JCMA 4XVSL 1C08B 1C5CL 2Z92B 3R4DA 1KGCD 4OT1L 2ICCA 2Z31A 3L5JA 4M7KH 1FH5H 2PF6A 3VFUA 2XY2A 4XCFH 2X4OB 3TJHC 3MOBH 1I9RL 4H88H 3MYJB 3NA9L 1ITCA 5F70A 1EJOL 1QFUH 3HKFA 1NGPL 2H26B 1YPZE 4OLEA 4ZAKD 3MXVL 3TJEH 4PRBA 4K3DH 4J3OC 4LAQH 2EIBA 3QUYA 4NRYA 4JFDA 4PS4H 2SEBA 5HYFA 4G80B 5E2WL 2WV3A 1BVKA 4HKJA 4MXQD 2BFVL 4K8RD 4F3FA 1S5IH 1IL1B 2QJDA 1X5AA 1FRGH 1SYSB 2DD8L 2A6KA 4M6NL 5BOPA 5ADPH 2VAAA 4NQUA 3O0RH 3NCYP 4BZ1H 4PY7B 4PLKC 1AGDA 1B0WA 1D9KC 4I48B 5IVZA 4LLWB 1QLEL 3BEVB 5I73C 2HRLA 5DK3A 4D3CH 4KU1A 1INDL 1KPUA 4K7FB 5C3TA 1N0XL 4FQPA 5C0NC 5IFAH 1SJHA 4OSUH 4P23C 2EZ0D 1GGYA 1TQCB 4K94L 3GNML 5D1XA 4DN3H 5IOPA 5ICYA 2R4SL 1UXSA 3EO0A 4OZHA 1FLTX 4GAYB 2NXZC 3UTSA 3CU1A 2VLMD 4YDJB 1KV3A 5A2KH 2ERJB 3DSNA 3HG1D 4A6YL 1HILA 3OHXB 3L1OL 2NX5A 4DZBB 4NHCL 4XCNA 5ALCL 5I16B 1FNEA 2WUCL 2AEIT 3G6AB 1RZ7L 1YNLL 3C5ZC 3QJFA 4PJEF 5JDSA 5TQ0L 1JNJA 4JM2A 2DYPB 3OAZK 1LVEA 3FONA 3ARBA 4OFPA 5JR1L 1BIIB 2DLTA 4CMHB 1PJ9A 1V8HA 1VKXA 4IRJC 3TBVB 4D0DA 4F7EA 1M4KA 4UT9H 1O7SA 1S9XA 2Z4QA 5MI0B 5T3XD 4X4XA 4X6FA 2HWZL 5CD5D 1WZKA 4H25A 5B38G 2Q7YB 5IM7B 1F97A 4LVHC 4GKZB 5FHBH 1LDPL 5C70A 4N1CA 1JZ3A 5EUKB 1QSED 1NGZB 5I1EH 4UQ2B 4LNRA 4LLVB 2FB4H 5B8CB 5FA3A 1CR9H 3GMRB 3GI8H 2J5LB 3OPZH 1P7QB 3VXUD 1NDMA 4OD2A 5C7XL 3F7YB 1B4JH 4MNQE 2IQ9H 4QOKE 2ZJSH 3ARYA 2J8UB 3QQ9D 5JW5A 4LSPH 4LPYA 4HKBB 1MCSA 1PGRB 1ZHBB 3C9NA 3VFMA 2ZKHH 1HIMH 4NWUL 3QCUL 2B0SL 1TCRB 2HMIC 2D4FA 1G9NH 3HC0B 5DD3L 3S3SA 5DUPL 4JVWA 1HZHH 4HGMA 1ZTXH 3LS5H 5HDQL 4NO0D 4O51A 3IU4L 4ZS7H 3WLBA 4XP4L 5FYLH 4QRPB 2OTUB 3IJYB 4LDLB 5LXGL 5T5FL 3L3JA 4U1LB 1A7QH 5ID0B 2DWDA 1IGJA 4AIZA 4ZXBD 4PBXA 3ROOA 3HNSL 5FDWB 1T1ZB 1GZPA 3PABB 4N8PA 5H8DA 5MEQB 4K9EH 1XIWD 3LHPL 5F6HI 5EZLB 4XVSH 1C5CH 2ITCA 1GRWA 4OT1H 3N1PC 4YPGA 2OL3L 3CSPA 4R7NB 5I1JL 4JGUA 5D7LB 2AV1B 4ZUVB 1I9RH 3RFZC 2HFFA 4IJ3B 1K85A 3NA9H 5CWSA 3P4MB 2P7TA 4YX2L 1FVCA 5FA4A 5IMKB 1EJOH 4L8SA 1NGPH 3D0VB 3PJSB 3MXVH 1N64L 4MD4A 4TN9A 3S5LA 3CVHB 4NJ9L 4KK8D 5E2WH 4TSCL 2BFVH 4X4ME 5D2LE 1GGIL 4MX7B 4Y1AB 1CFQB 1G0XA 4C57C 2DD8H 4M6NH 5IVXE 2HTKD 2KZWA 2PCPA 3FT3A 3MCKB 2MHAB 3MNVB 3ARED 2UZIL 4H5SA 4G8IB 2AJVL 4FFVD 3RAJL 1QLEH 4HKZA 3RPIA 4XP6L 1KIRB 3ARFB 1DN0B 1NAMA 3U36B 1INDH 3D39E 4NUJB 3MA9L 5FK9A 1N0XH 2E27L 3VGEA 3MV8E 5DHVH 1FO0A 4K94H 3GNMH 3H8NA 2R4SH 4TYUA 3UJTL 4IRSD 4ZFOB 1WIUA 5F3BB 4A6YH 5IW1A 4JRXE 1R3LA 4NN5C 1MHCA 2W0FB 3L1OH 2EIZB 2OR9L 4NHCH 5ALCH 1XGYL 3WE6A 2WUCH 4UMGA 4N0UB 2NCMA 1RZ7H 4J4PD 2LU4A 3UEZA 1YNLH 3PXHA 5AD0A 3BPLB 3DUSA 4TQEL 5IHZA 3RVVC 3UTTE 5TQ0H 4X5WA 2D0GA 3B9DA 4RWHA 1NCDL 4JPIB 5JR1H 2IH1B 3S34L 1G9EA 1CL7L 5JHDB 3NA4A 3IS0X 1JPFA 4YFLF 5KSBB 1J0JA 4H26B 1CDIA 1HN1A 5FUCC 4L3EA 1KC5L 3DXAD 4PJ9C 3F6LA 3W39A 2HWZH 5HHMB 1F58L 3MLVL 3PGCB 4RA0C 4Y4KC 3BYTA 5D5MA 2UV3A 4U1MB 2NY5C 4NO0A 3P9MA 4YIQA 3B4NA 1LDPH 1JTOA 4JFFB 2NY3D 1KEGL 4PJEA 4X9BA 3X12A 5TGBB 1FYTB 3G08A 2R1WA 1YMMA 4WNQB 4ZXBA 1IGTA 5SWQA 4D8PB 4HJGB 5C7XH 3BD4A 2HFEB 4JDVB 2MNUA 4Y8DC 1XIWA 3Q3GA 3R8QA 3NFNB 4NWUH 4XZUB 2A74B 3QO1B 3QCUH 2B0SH 3ULVD 4YZFE 2WIMA 1BMGA 4JKKA 1EEYB 4Y19E 3MRNA 5DD3H 3D2UB 4LGSB 3LDBC 4FZ8L 5DUPH 1MHEA 3I85A 3BQUD 1OGTA 1K4DA 5HDQH 1J11A 1LQSR 4UNUA 3IU4H 3ARTA 4XP4H 2XWTA 5LXGH 3FZUD 4LSSL 5C0AD 3TCLB 5T5FH 2ED7A 4Y2DD 5A3ID 1T0MA 3MODL 2XN9A 3K4DA 2MMXA 3V4PL 2ARJB 3HNSH 3PWNB 5IHUL 3DARA 1L9NA 4H1LH 3LHPH 4JB9L 5I66A 1T21B 2NYYC 1NBVL 5JO5A 1A5FL 1P6AB 2OL3H 3T0WA 1UYWL 5I1JH 2XT1B 4LCYA 5GGVY 4YX2H 1QA9A 3MBEA 5GRUL 4JQVC 3ZHDA 3C60C 1N64H 4WGWB 4IBLT 5I1DA 4NDMA 3EW3B 1SYVA 2VE6A 2A6IA 3F12B 2V5MA 2CUIA 4NJ9H 5EA0L 1FNGB 4TSCH 3DO7B 4IRSA 4CNIB 4P3DA 4OLZL 4GW5A 5EC1A 1GGIH 5HY9A 4RRPG 3RVXC 2VN7A 3CUPA 2VLJA 4HIIB 3RWEA 2IBBA 1KJVA 2Z93A 4P9HL 3DBXB 1ZLVK 4TUOA 2GKIA 1JHTB 2UZIH 2AJVH 5F1NB 3MZTA 2A83A 3RAJH 4X6DB 2Q76B 4XP6H 1ZT7A 4CMMA 5E9DD 3T04D 5FGSA 4X6BA 4JKPL 5E4EC 4X4YB 5IQ9A 1RY7B 3MA9H 1MHHB 2E27H 5DMIL 1XGTA 3DXAA 1TJHL 5J0BA 5H94B 5H35A 5DJZA 5DVNA 4DCQB 2IFFL 1XR9B 4KV5E 4YC2C 4HS6B 4NCC2 4C59B 4MAYC 3B9AA 4KK9D 3UJTH 1ZSDB 5C07E 5FXCH 3QP3A 2IADB 4UUJA 3KNBA 3FRPA 3UBXB 3QB7C 3SDXB 5CIPH 4QTHB 4W4OA 5BO1L 3H42L 2OR9H 1XGYH 5L8LB 1MVUA 1JI1A 4BH8B 5DJ0B 1F6FB 1D6EA 4P4KB 5BS0B 2QL1A 4I2XA 5I0DA 4HDIA 4PUBL 2ZG3A 4TQEH 1QVOA 1F6AA 2PXYC 3IRPX 2LTQC 1JL8A 2PN5A 5HHPB 3FOMB 1DBAL 1NCDH 4L8CB 3BWAB 1BVLB 3S34H 2OQJA 3GSXA 1CL7H 3IFOA 4YPJA 3VMPA 3SO3B 1UEYA 1YEKL 1MUJB 1U3HC 2NMSA 1TVHB 5A16B 1KC5H 3WFBL 5HYJD 2FD6L 4B5EA 3QUXA 5EO9A 5DD6B 1T3FB 1F58H 3MLVH 1VGKB 3KYKL 3BXNB 3SDAB 1W2KT 3U7AA 2QLVB 1CU4L 5DJ2A 1V5JA 2DLFL 2J8OA 1VACA 1MWAB 2QR0A 1U3YA 1U8JB 1KEGH 1ND0B 4CU7A 1PEWA 2YRZA 3QO0B 1G9NC 5EU4A 4Y2DA 4KK6C 2FO4A 3I3BA 2PETA 3SBWC 3MRCA 4FXKB 3AY4C 5GSVA 5HJ3A 2ARWA 3F5WA 2X2YA 3ZO0A 1NKRA 3L3DA 1JWUB 2XTJD 2XFXB 2DMCA 4XAKE 1CXKA 2IQAA 1X4YA 3ZE0E 3ARGC 4LRIC 1G9ML 3EHBD 4KKBC 5J13C 1JK8B 3HG1E 1YECL 1JFQL 3DIFA 1W0WB 4H8WL 1MCEA 5LAXA 5HI5C 4WI9A 4NPYA 2R23A 4JJ5B 3WNNA 3UTPD 4FZ8H 1Y6KR 3W11C 4K9EC 3RZCC 4J2XA 1XCTB 4WFFD 4Q9BA 3GDBA 4DN4L 4CGTA 4G6FD 2HN7A 4WHTA 1U8IB 4W70A 5HHQA 4LSSH 1NFDB 5D93B 3GJFH 3L3OA 1YPZF 3TBSA 5T3XE 4RZCB 5EO1B 4NQDD 2ZG2A 3MODH 4ELMB 4ZUTB 3E2HB 5C09A 3R1GL 3V4PH 1SBSL 3O6FC 5L7XL 2BK8A 5IHUH 1T1WA 4QRUA 1YY8A 2WWMD 2YBRB 3BHBB 2FZ3B 3BI9X 4JB9H 3TFKC 3LKSA 4WDIA 1NBVH 4LSUL 1A5FH 5TH2B 3QIUB 5ESAB 3H2WA 5E94B 3CH8A 1UYWH 2X4NA 4LAJH 4LCUB 2ZUQB 1GCFA 1FZOB 4GKSB 3KPNA 1DVFD 5D1QB 3HRPA 1I8KB 3RWIB 2V2XB 5GRUH 5FYJD 5KS9F 4XH2B 4HMDA 3VXUE 2ESVD 1XGRB 5C0JA 4MMXC 4WWID 1A4KA 1DBJL 3QXVA 2OJEB 5EA0H 2CLRB 2XQYG 5CMAB 1CWVA 4JANB 1T5XB 4O2EB 5K59E 3QPQD 4PJFB 3VWJA 1U93A 4R8WL 1NSNL 4OLZH 1R5VA 1QRND 3NIFF 4K94C 4JY6B 4P9HH 2UVEA 4K07A 5DURB 3IGAB 1MAKA 4QRRB 2GTWA 4CN1A 2IMMA 2EXWC 4AENA 2ZZUT 1T4KB 1OT1A 4X80L 5IG7B 1VERA 2IAMC 3G5VA 4WJ5A 5JORB 4JKPH 1DLHA 1NQBA 1PY4A 5DMIH 3AS2A 2X4QB 4XI5C 5IB1A 1TJHH 5CEZE 2NW3A 1IAII 5DD5L 2IFFH 2V9RA 2HLFD 1W8NA 3OAUL 4OFIA 3SDDD 3C6LB 3MJ8A 2HT4C 3S7GA 4FFZL 3UAJC 4ENEC 2BSSB 2ADGB 5BW7C 3GSNA 5BO1H 3H42H 1EHLL 5I1LB 1LO3L 1MRFL 4WVRA 5HD8D 1X6LA 3HZMB 2BDNL 4PUBH 4DWHA 1NCWL 3DMMD 2AXFA 5HYQA 2G9HA 1DBAH 3QFJD 3SE8L 3IETB 1P53A 5C3LD 3T09A 4Z76A 1YEKH 1NBYB 2IEPA 3G6DL 3WFBH 5SWSB 2FD6H 2H41A 1A6TB 2A73A 4FNLL 2PYEB 4Z7OF 4ZFGL 1AIFA 1S7WB 3KYKH 2YA0A 3B9KC 1CU4H 3I02A 1UFUA 5DJ6A 2C1PB 4XXCA 2DLFH 4D0BA 3DWTA 1ZOXA 1ORQA 1JF5A 4OCLC 1P2CA 4IOFD 1DDHA 3IXAB 2YA1A 3BP5A 4YR6A 2NY7L 4NQDA 1B6DA 3CFEA 5J6HB 3INUL 4JREB 1DN2A 2DICA 2FDBP 4IS6A 2G60L 3VXPB 3KXFD 2YKLL 4IHOA 4XNQA 4FQHA 1G9MH 1IGML 4ZYKB 1YECH 1JFQH 3RIAK 1J86A 2AXGA 3L3HA 4H8WH 2VB5A 5BRZD 4F80A 1MH5A 2HJLA 3SPVA 3ZDYF 5C0EA 3B6SA 3KYMA 1KJMB 1ZA6A 2ICWA 3S4SB 2ESVA 4D2NA 4LBEA 5DRZA 1LO2L 4DN4H 3FCTA 3PDOB 2WINB 3X13B 3MOQA 5GS0D 3OAYH 4I18A 3QQNA 3ZLQC 4F7MB 2VITA 1QRNA 2AKRB 4FMKA 4PRDA 3MNZB 3WJJC 4NSKB 3O11B 4S1RL 3CXHK 3SKMA 4P5TB 3R1GH 5CJOL 5I1KL 1SBSH 5L7XH 4X6EB 2FHBA 1L6XA 3OX8B 3TESA 1YY9D 4J1UA 5JHLL 5F7DB 4ODXB 2X5PA 4LSUH 3QDJD 1T03L 1WSST 3O4LE 3WO4C 1T6WA 1KSRA 4J3VA 5J1TC 4EQ3A 3LVEA 1YPZA 5ENWB 1EO5A 2P5WE 4Z5RA 1DBJH 3EJZC 5EO0A 4WUUD 4E41D 5H2BB 3ULSA 1JUFA 4OQTL 4R8WH 1NSNH 4PJAB 3FOLA 5EN2B 3EDFA 3ULVE 5GGSY 5ISZB 2VIRB 5D6DC 2R2BB 3CX5K 1QR1A 4OCMC 3RVUC 2QKIB 2EIEA 4CW1B 4EUPA 1CBVL 3IDXL 3MA7A 4JFED 3KPOA 3V0WL 2ENYA 3KPRD 3EFFB 1TCMA 4KJYA 4QOKB 4UOJA 5FKPA 4X80H 5KS9A 5ACMA 2HJKB 3H7BA 4U0QB 5C0AE 4FQQA 1JRHL 1CFSA 3DYPA 5EH1A 4LP4A 4JFOB 2ICWJ 3J7HA 5L2KB 1QFHA 3VFNA 4MSWB 3G5YB 2APVA 2OZ4L 4R2GB 5CBEA 4ETQA 5IROA 5DD5H 4LSQL 1X5YA 2YD5A 1OD7A 3FT2A 3OAUH 1KLGB 5IIEB 2H32A 5CJXA 1Q9KB 4FFZH 4AK1A 5HGDB 4PGBA 5FO9B 2ENSA 3O45A 4M6OL 4D94A 4KUZL 4BFGA 1EHLH 1LO3H 1MRFH 4NJAL 2J2ZA 4IMKA 5IKCB 1PX3A 3IDYB 5IP4A 2YUXA 4E5XA 2BDNH 1NCWH 4XXDA 1JZ2A 1MHPL 4X9IA 4KK5D 1D9KD 2Z8RA 4PGDB 1KENL 4NQED 2L4OA 3SE8H 3UO1L 1LMKA 4LGPB 3TIEA 5LBSL 4HIHA 1UXWA 2HRPL 5TF1H 2V5RA 1SEBB 2V5YA 3LV3B 5F88A 3BJLA 3G6DH 1BECA 4ZFFA 4GXUM 1X5LA 4XPBL 4FNLH 4P23D 2FATL 4ZFGH 3UYRL 5GRXG 1L0QA 5EUOF 5GGSB 1M6OA 1NGYA 3GHEL 1RK0B 3EYUL 1D5XA 2NXZD 4QY8A 1P7KA 4YZFF 5D7KE 5ELIA 3GM0A 5E9DE 4S1QL 2YK1L 5D2LB 3FQRB 4YNYB 2DQHL 1INQB 1RZJL 4TUJA 1K8DA 2FIKB 2NY7H 4KFZC 4YBLC 2NW2B 3INUH 5ANMB 5INCB 3C5ZD 4NNPL 2G60H 5JPMA 2YKLH 3TBYB 3B5HA 1IGMH 2IWGA 4IRJD 3CCHA 2BCKA 3WJLA 2AV7B 3CNKA 5FYKD 3VXQA 3SGJA 5DMKB 2G2RB 5JLZB 4LCWB 3U4EB 3TNMA 2W07A 3VFWB 4L4TA 5DQ9A 4RFNB 3KLAA 1U8LB 1LO2H 1A1MB 2W1NA 1JYWA 4K2UL 5IJVA 5I74B 3KJ4C 4HH9B 4JRXB 1FFQA 4LIQL 5CJ5A 1ADQL 3IDNB 3JXAA 5K93A 2AJXL 2F53B 3PQYE 5IVNA 4S1RH 1I1AC 5CJOH 5I1KH 4HIXL 4L4VD 4JFEA 1NCTA 4YDKL 4XBPA 3EJJX 3KPRA 3UTTB 4MA8L 5JHLH 1KJ2B 3OKMA 2WBJB 4RGMB 1U8NA 5D1ZB 3EYQC 1T03H 3GBNL 3TYGL 1KPVB 2FNBA 3WS3A 1ZHLB 4PD4J 3W0WD 2HMID 4XPAL 1CXFA 2IANB 3A67L 5TE6L 3P0YL 2EE3A 1EK3A 4GRMA 3FHQA 1K2DB 1DEEA 1DLFL 4OZFH 1U8PA 3HS0A 1I9IL 3ARVA 3SCMA 4JDTL 4OQTH 4LHQB 1F4WL 2V9TA 3HR5B 4OLXL 3VFRA 1TTGA 3WDJA 4AT6A 3AU1A 2OTWB 3QH3A 2E8ZA 3F7VA 5C0CE 7CGTA 1CBVH 3UTPE 3IDXH 1HYSC 4TPRL 3V0WH 4NRXB 4KTEL 2LV4A 3ARDC 5I9QB 1J05A 4L9DA 1P84K 2DTML 2CLZB 4NN6B 4OZGF 3CDFA 1BVKB 1HSAB 2FECI 4HKJB 5BQ7A 4KJPC 4EUPG 4F3FB 1JRHH 1EIBA 3MJ7A 3HAEG 3C08L 4H0IA 2A6KB 4Y19B 1MJJA 1F13A 3WXVL 2OZ4H 4P23A 4Y4FC 1W8OA 4LSQH 2HAZA 1AGDB 2IH3A 5K33A 4YFDB 1GZQA 4KRLB 2MQ0A 4DKDC 2VLLA 1KPUB 3F58L 2J6EL 4I3SL 4M6OH 1OAQL 4KUZH 1NDGA 1ONQA 1UB6A 4NJAH 3MRQB 2VL5B 4XX1G 3QWOB 1FGNL 2GIYA 3HPLB 4OKVB 5D1XB 4HFUL 5FYJE 1EZVX 3S88L 4JZJC 3LH2L 1UXSB 4G8GD 3EO0B 4OZHB 1MHPH 2YPLD 1KIPA 3UTSB 1KENH 2KDGA 3UO1H 3U6RB 5LBSH 2HRPH 1HILB 3MRIA 4HAGA 3RDTC 4AG4L 4XCNB 4XPBH 2FATH 3QJFB 3ZE0F 4Y16C 3V2AR 4GRWF 3UYRH 3UZVB 1GXEA 3FQXA 3B5TA 3GHEH 1G9MC 3EYUH 2WP3O 3FONB 3ARBB 3BPLC 4OI9A 1JPGB 1OGAE 2K7QA 2JE8A 5INDA 4NC2B 1ZANL 3VWKA 4X83A 4H8WC 4D0DB 4S1QH 2YK1H 1ED3A 2EH8L 3RGVD 1S9XB 2DQHH 1Z2KA 3H6JA 3Q1SL 4X4XB 2C9AA 4F8QA 1RZJH 2X1OA 1QR4A 2X4RA 4H25B 3V6FA 4MJ4A 4H0HB 4NNPH 1G7IA 2IGFL 2YRPA 4WTWA 1UKQA 3RVVD 4XB7A 5HDLA 3QXDA 3MREA 4X9GA 4OM0L 3BN9C 4OM1L 5EUOA 4MNHA 2B1HL 5E4IA 2DLIA 4PJ9D 4ZODA 2IF7A 4F37K 4PJDA 5IBUG 2A9NL 3PHSA 4RGNE 1N8ZA 4B0MM 4Y4KD 3D85D 5J11B 1UH3A 1IZJA 4K2UH 3QFJE 4PG9A 5JW5B 5B22A 5M94B 4MLSA 5C0RL 3C9NB 2KPNA 2CDFA 3QUZD 3PDGA 3QT2A 4RFEA 4XMPL 1M71A 2F5BL 3KLHC 4LIQH 3RUGB 5DFVC 2BNQD 1ADQH 5F7FA 1KXTB 4WI5A 3V6OC 2XZQL 2AJXH 4ZOCA 4PJGE 3O4OB 5E5UB 4JFZL 4HIXH 4ZAKB 3RHWF 3U4BL 1JGUL 4MQTB 4YDKH 2VABA 4XX1E 4O51B 3WLBB 3SN6N 4P5KA 4MA8H 2DB8A 2E7LC 1AJ7L 4FTVA 4WI3A 5L8KB 1X5FA 2E3VA 3GBNH 1Q8MA 2AP2A 3V5HA 3G5XB 5HVHB 2DWDB 3TYGH 2O5ZL 1IGJB 4AIZB 1AY1L 4XPAH 5I71C 1IQDA 3A67H 4JFQA 2HFTA 5TE6H 3ROOB 3QAZC 4M7ZB 3P0YH 3LB6C 7FABL 1R3KA 4X6CE 3V5DB 2CO7B 1DLFH 1CXIA 2DM3A 3MUGA 3KXFE 1I7UB 4YK4C 2XOTA 1JZ8A 1I9IH 3FQWA 3QBTB 4ONHA 3IDUA 4JDTH 4YPGB 5IVOA 3TH2T 4JCLA 1F4WH 1C16A 2X9XA 2HFFB 5HGHA 1I3VA 5JMRA 5BRZE 4OLXH 5CWSB 3B3IB 1FVCB 4WEBL 5FA4B 4L8SB 4CKVX 4WTZA 4POYA 4TPRH 5DO2C 4ZNCD 4KTEH 1F02I 4GS7B 1EUUA 5DJDA 3BPCA 3S5LB 3ZT6A 3GMLA 5I1IL 4PRPA 5EBMA 2DTMH 3SJVE 1CD0A 4M6ML 2Q7NA 3RWFA 2NYYD 3N06B 1A9EA 1U8HA 3C08H 8FABA 4LDEB 4P3CL 5E6IA 3WXVH 4NNYB 3C60D 4JZNB 5E2JA 2HJFA 3QXWA 4H5SB 5DVKA 1NJ9A 4FXGA 4GKNB 2X4TB 3TV3L 2G5BA 4HKZB 4JY4B 3RPIB 1MF2L 4ZUSB 3QDJE 2OCFD 2YN3A 3F58H 5FK9B 2J6EH 4I3SH 4WGVB 3RVXD 4OZGA 1OAQH 3P77A 3ARSA 1NGXA 5D71L 3T0XA 5AUMA 1FGNH 1FO0B 3M1BA 3V5KA 2R2HA 2OSLB 4HFUH 4ONOA 2Y7QB 4NQSA 3S88H 3LH2H 2EDEA 3PV7A 4Z7UE 3OJ2C 3HHRB 5DUML 4E41E 3Q48A 5IW1B 3O2DL 1QSEB 1R3LB 3OF6D 4BSVB 3MGAA 1F3RB 4AG4H 5HVFB 1X9QA 2QTEA 4PJ9A 4P2RD 4QNPE 5CHNB 3N1GC 4WFGD 1R5IA 1OM3L 3QXTA 3U30B 4NO5A 4PGEA 1HE7A 5HSFA 5DEGA 3VXUB 5IHZB 4R7DA 1UA6L 3S3JA 5GGUA 1EPFA 4OCWL 1EVUA 1AI1L 2AJYL 4MAYD 1WFTA 4Q9RL 1ZANH 1KCKA 3ECBA 4MZ3A 2EH8H 3RWJA 4NN7C 5F1IA 3Q1SH 2PKDA 3W39B 3KYNB 4MMZC 5E8PA 1P1ZB 2JIXA 4PR5B 5D5MB 43CAA 2IGFH 2CKBL 4NO0B 3GB7A 2PXYD 4F15B 3P9MB 2FLBT 4YIQB 4FFWC 4ERSL 4HWBL 1JYXA 3MV7D 3CAFA 4OM0H 3GFUA 1TXKA 4OM1H 5HYSA 3AB0C 5CEYB 2B1HH 1LDSA 4XC1L 1U3HD 1EEQA 1KB5L 3CSBA 4ZXBB 2VWEC 5SWQB 2A9NH 4IOSD 3MRKB 1V05A 1A3QA 5BV7B 1U58A 5C08A 2B4CL 3WN5C 5E8OA 1XIWB 3Q3GB 4NQEE 1ETZA 5C0RH 3ISWA 4XMPH 2VDRL 4JQXA 1JHLL 2F5BH 3BUTA 4KK6D 5EZJA 2XZQH 4JO2L 4M3KB 2ATPB 1QRKA 1YJDL 4JFZH 1OGTB 4MCZA 1EGJL 3U4BH 1K4DB 1JGUH 5LGJB 3QJHA 1ORSA 3DRTB 1MIEL 2XWTB 2GSGA 3TO4A 1AJ7H 3ARGD 4PRNA 4Z7WE 3K46A 4KKBD 2IALB