3TYGH

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt128 in complex with a glycosylated engineered gp120 outer domain with miniv3 (eodmv3)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
234
Chain Sequence
EPQLQESGPTLVEASETLSLTCAVSGDSTAACNSFWGWVRQPPGKGLEWVGSLSHCASYWNRGWTYHNPSLKSRLTLALDTPKNLVFLKLNSVTAADTATYYCARFGGEVLRYTDWPKPAWVDLWGRGTLVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system, viral protein
molecule keywords Envelope glycoprotein gp160
total genus 32
structure length 234
sequence length 236
ec nomenclature
pdb deposition date 2011-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH01
3P77A 3TIDA 5ISZE 5TQ2H 4Y19A 3LKRA 1LEKB 4JFYA 2VLKB 1S7VA 4NOBA 4R7DB 3WV0A 5AYUH 1C7TA 4FQ2H 1U8PA 3FB6B 5TDPA 1QBLH 5C0GB 1HN1A 4YPGB 2AJUH 1UM4L 3C09C 2DJ4A 3QBTB 1TQBC 5EBMA 1DLFH 5A3ID 5C8JB 3QJFA 4MNQB 1KIUA 1GAFL 1U95B 3B9DA 3PIQA 1T4KA 4L1HA 4YXHL 3TWCL 3CH8A 5IVXB 1D9KA 4CVXB 1YMME 3TYGH 3RWFB 5FYLL 1TPXB 1FGVL 2VN4A 2X4TB 3SDDC 4Q9QH 3F7VB 4GRWB 1OLLA 1HKLL 1QR4A 1NSNH 3QEQA 2I9TA 2Z0BA 3OQ3B 4HFUH 5EG6C 4O4YH 4ZXBC 1B0RB 3EYOB 5GXBB 3ULVL 1KIPA 2WANA 3OKEB 5DJ6A 5GGVY 5C07E 1WBYB 2F53E 2H9GA 1ZLWK 4OLZH 4C57C 4EXPX 1NKOA 5KG9A 5CAYB 1T0NB 3WEXA 4LEXL 4LEOB 4WEBL 1CD1B 4I0CC 5JO5A 4ALAL 5I0ZA 1WISA 4P9HH 3D1MC 4ZAKC 3FO2B 3MACL 3RZCA 3FFDA 3DSFH 4NZDA 1F2XK 1FLRL 5J12C 3DX6B 5HHVL 1EHAA 5F7EL 1BQHG 4L9LB 4Y4FB 1YYMH 2DD8L 2Z4QB 5F7UA 3ES6B 1QSEB 4I18C 5DEFB 2QTEA 1JP5A 2DIBA 5ENWB 4DUVA 1CXLA 1ZT1B 2ZNXA 4QOKB 1RIHL 3ARRA 1UCTA 3HI1A 3LEVL 1R0AL 1FGNL 3CVIH 3LKQA 4NYLA 1B90A 1U42A 1BOYA 2RBLA 2ZG3A 5EU6B 1JV5B 3QEQE 1MNUL 4F15B 1XEDA 3MCKA 2OR9H 2BOCB 5GRJL 4D94A 2GJ6B 2VLJB 1TJHL 4OKDA 1EBAA 1I8KA 4NJAL 4X6CE 3L3JA 2EH8L 3V5HA 2PXYC 5HHVH 3MFFA 1H3VA 5DI8A 3MYJB 4BA8A 3WXVL 4G7YH 4PJAA 5FYKU 3WJLA 5GGVL 1CDCA 1WIUA 2FH8A 3BWUC 3WNPA 5TE7H 2ICWA 2R56H 4OAWB 3X12A 3N9GL 5DO2C 4XNQB 3C5ZB 5T1DH 4CN1A 3FZUC 3LOWA 1FL3A 2RCSL 1AGEA 2Y36L 1NCAL 2PYED 4TUOA 4D0DA 1QA9B 2FSEB 3DGGA 4R9HA 4YUEH 2IC2A 3PDOA 1UGNA 3L3HA 2G60H 1HH6B 4NJ9H 3T0VA 4WUUA 2GAZB 4JFQA 3G08A 4U6YA 3QDJE 4HJ0C 2B0SL 2P8LA 4YHZL 5I1IH 3GJFK 1WICA 3U9PL 2ARJA 2Z31B 4XPFL 5T5FH 1FIGH 1UQSA 3PGDA 5FM4A 2DJUA 2W0FA 4DZ8B 2XY2A 4I48B 3GMRA 3TIEB 1ULVA 4GBXD 1P2CA 2XZAH 2R0LH 4Y16B 3CNKA 5KS9F 3HNSH 3T08A 1YY9D 1HCFX 3ALPA 4XPFH 4GRMB 3VE0B 4KKAD 3S9DB 2IPKB 5DJ0A 5CGYC 3ZE2F 3DVGA 4U6HA 1DL7L 2ZUQC 5C07D 5K9OA 5GHWH 5DK0B 1KFAL 5DA0B 4WHDA 2IFGA 2HLAA 3C60C 5EU7C 1X4XA 5JW3L 5CWSA 3MNWB 1W8NA 4E42B 3VWJC 2ZSWA 1J86A 2PR4L 4G7VL 1WWWX 1IAKA 3HTLX 2OTPA 4KU1A 3MRCB 2VL5B 1BD2B 5D1XB 1IC4L 1YY8A 3MNVA 2BERA 4M1DH 5FYLH 4FNLH 4U6TA 5FUCE 3WIIL 4Q9QL 1T22A 1DN0B 2AABH 4KHXL 4PG9B 5FGSA 5GGRB 5BZWB 3VXRE 1CE1L 5AEAA 1KLUB 4XVTH 3E6FA 2EE9A 5GZNC 4U1GC 5EOTA 2ADJA 2FO1A 5EU6E 5HYIA 4OD1H 4MB5A 3WS3B 1PG7X 1ZT4A 3WS3A 4L5FL 3DUSB 4OT1L 5DXWA 2M1KA 2CDEA 3WL9B 4FMFA 1GZQB 1YEGH 2VUYA 1E4KA 3G9VA 2H1PH 3E6FB 4JM2B 4QCIB 1MIEL 1GGCH 3ILPB 4YBQD 4JZOA 1CQYA 4Q6YA 2ATKB 3ARBD 4QRRA 1Q1JL 2I07A 4LMQE 2YD8A 4HWBL 2MQ0A 4EXKA 2CKBH 4S1SL 2YN5A 3MJ8A 5KW9H 3O6LH 4HIXL 4GAYB 2VL5A 1NANH 4PGJA 4FFYH 4P4KA 1N5YH 4EKXA 1NCWH 4E41A 1BQHB 4X0KA 2F53B 5DJ2A 5IFHH 5JLZA 3NN8B 4ZPTA 3QO0B 1CZ8H 4HX1B 3T09A 1K6QH 4FQXC 4JQIH 3MGOB 5L6YL 3I6LE 4YDJB 4ZUVA 1QRND 4PJHB 4U1MA 3T0EB 4YHYB 4PJXA 3BN9D 3GSVA 4KJPD 3OF6A 2IPKA 3G6JB 2BFVH 3MLRH 2VERN 1HSBB 3HMWL 5CGMA 4C56A 2KH2B 4M7JH 1P7QD 5GJSH 2NY4D 3JV4B 3HCVA 4J4PD 4X5WA 4XVJL 3RDTA 3T3PF 3UO1L 4QHNB 3GMRB 2GITB 2NY5L 4PJBA 1XCTB 1LO0H 3DYOA 5FHBH 4R2GC 1MCHA 1N3NA 3ULVE 3TZVA 4ALAH 1C12A 3QCTL 1Q94B 1DFBH 1XIWC 1T03H 1NFIB 4RWYH 4BJLA 3QISA 4B7LA 3F62A 1MHCB 2WSKA 5KVMC 3NCJL 1P5VA 2Y06L 3CFEB 4XB8A 4LLMB 2AI0L 2EDRA 3CVHA 2YPLE 1CDBA 4NQEB 3L3OA 4HFUL 5FOBB 1J87A 3W9DA 1MWAH 2AJUL 3P0YL 1ERNA 2C1OA 1IE5A 4R26H 4TRPL 1A6TA 3LRSA 1WBXB 1DTUA 2SEBB 4L3EB 1RPQA 3H7BA 3ZYJA 3RVTD 2R69H 5FYLD 4KKCC 2XNAA 3C2SA 2BHZA 5I2IB 5DFVC 1ZK9A 2HVKA 4ZS6D 3REWA 5E7BA 3RKPA 5AZ2L 3CK0H 3D9AH 3WSQL 4HCRA 3E2HB 1JGLH 3QWQB 2DQUH 3MCLL 5DURD 4YX2L 1NFIA 4MA8H 4YDIL 5F9OL 5D2NA 5ENWA 5I73B 2D31A 1HE7A 2VISA 4U6XA 5B22A 5J1AB 1H9VA 1UKQA 1P1ZB 4KGJA 4Y4FA 4QYOA 3HHRB 1FLRH 1YNTB 4ZD3H 2FEEI 4JHBA 3AVEA 3HMXL 4Z7VE 2EXYD 3BJLA 3PHSA 1MCSA 3MV7D 5KSAC 5DFVD 4MWFA 5JIPA 4IIQB 1RK1A 3C8DA 4GLRH 3MRRA 2Y25A 1C1EL 3MOQA 4U1IB 5MERB 2N56A 3FRUA 5CEYA 2JJVA 4WHYH 2DLGA 4MNGE 2J1KA 4LLVA 1GC1L 2H9GB 1FYTD 3U7AA 3QPXL 2IMMA 5L2KB 4DN3H 4ODUB 5EIQA 3TVMB 4L4VE 5C09D 3KPSB 4GRLD 1C1EH 4U7SA 3L5XH 2X70A 4XNXL 2L4OA 3KYMB 1JYWA 4HIEA 4U3CA 5CLTA 4OZGB 3FFCB 3PWVA 1IL1B 4TPRL 5A2JH 3CLFL 3W2DL 4G8EA 5D2LB 3QA3B 1T7XA 5E8OA 3QJFB 4DVRH 3TM6A 2EKJA 5D9SA 5CD5C 2HFFA 2JELH 4I0PA 1NDGA 1UB6B 1FSKB 1PAMA 4GW5A 4XNMB 1BAFH 2IH3B 4LVNC 5KOVC 2R8SH 2ZOKA 1KCVH 1J11A 1DBKL 4YHKL 5EC1B 3OR6A 4CDGC 5HYJB 4M6NL 3KYAA 4ZG1A 4KDTC 3QQ3A 4NNPH 1KUMA 5FGCE 4OZHA 4K9EC 1PZ5A 3P4LA 2R9HD 4FQLL 3L5XL 4TUJA 1V3KA 1WWAX 4JN2B 3ZSTA 1MRDH 3HC4L 2J6EL 4WO4D 5E8EB 3H8NA 3IKCB 2ZCKH 1LK2A 3RIAF 3PJSA 4P59L 3QRGL 2DLIA 4ELKB 2AJSL 4I77L 5HHPB 4DVBA 5HJ3A 1BVKB 3D2UB 3WFBH 3WO4B 3FHQA 3V5KA 4W4OC 3IKCA 4DFHA 3AU1B 1CXIA 4J4PC 5C09E 3MBEC 1KCRH 3VRJB 1BJMA 2CRIA 4ZUUA 5T3ZH 5TJWK 3B5TA 1VDGA 4RFNB 4KZDL 1YY8B 4PJFF 2YPKB 5J57B 1FPTH 4EOWL 4NC1C 4L8CB 2YXFA 2JCCF 4TUKL 3I50H 4QTIH 3LAFA 1V3MA 3V4PL 3VFRB 1BFSA 2E27H 2ESVB 4X9BA 3PQYA 1QG3A 1T6WA 2NQCA 3HMXA 3O2VH 1NGWB 4XMKL 4Y4HB 1AKJB 3MLZL 4G43B 3LHPL 4G6FD 3GMOB 1MCEA 3TBWB 3IU3A 4XPBL 4NBZB 4X6DF 4FQJH 4PR5B 4BFIA 4H5SB 5IVXF 2OM5A 3T4YB 4KTDL 1FZJA 2YD4A 2X4RB 4KZDH 3MRBB 4U05A 1F3JB 3S34H 4FTVD 3EYFA 3T2QA 1I4FB 3VH8B 5KSVB 4RMSA 3U0TB 2YKLL 3WKMH 4EN3D 2PO6C 3QDMD 3EYSL 3TFKC 2B4CH 3DRTA 3RX7A 3S98A 1OVZA 3DLQR 1MEXL 3WUZA 1WLHA 5DZLA 4NT6B 2GK0B 1EGJA 1A21A 5E03A 1F58H 3IDJA 4TTDC 1G7MA 4LCWA 3NCJH 5J3HC 2G5BB 1QBBA 4UNTA 1FNSL 2LTQC 2WWKO 4BM7A 3VXNA 2CK0L 4C4KO 4S1RH 1ACZA 3MV7B 5F3BB 1GVIA 4LDEB 4YAQA 5HHXL 5CMAB 3MBED 5E94B 2CSPA 1NEZG 1EPFA 1C7SA 4KROC 3UDWC 4N8VB 3KYOA 1PZUB 1I1AC 3BIAX 3LH2H 4G9FE 4RDQF 5D72L 3CVHL 4Y2DA 5JXEA 3DMMB 4RGOH 4G80B 1NBVH 2QQQA 5I71C 1GC1C 4MX7A 1K3ZA 3ARXA 4LKXA 4G9DB 1G0XA 2E9WA 3MO1B 2DQGL 4JZJB 1KBGH 1I9EA 1YMMD 4NGHL 5L7XL 5DK3A 3N1QC 2ICWI 4G9DA 3W9EB 1IQDA 4JPVL 5C7XH 2VXUL 1SYSB 4MA8L 1D5ZB 3LRSB 1MJJB 1I7RA 2DQFB 1FYHB 2FB4L 4KI5F 1ZT1A 1W0WB 3EOYG 1ZKAA 1KPRA 4LCWE 2VDNL 1DQTA 2EDKA 3TH3T 4M7JL 4APQD 2Z93A 3HUJE 3CXDL 1OHQA 1YY9C 1YYLL 1SHMA 4LCWD 3T8XA 3RVVC 3QUMH 4HUXB 1FORH 5I18H 1A7QH 1SJHB 3SGJA 4Z7QE 4KK5C 3IDJB 4KVCL 2VB5A 1CXEA 2DKSA 3V0VA 1JHLH 1DFBL 2FO4A 1A14L 2AJ3B 5CKGA 5SWSA 4H8WL 1T03L 2D3VA 2NY3D 5LG1A 1K85A 4JCMA 4UOJA 5F6IC 4LVNB 4G7VH 1NCCL 2BVQA 5KZCD 1KIPB 4HXBH 5BVPL 2DQIH 4NKOB 1U8OB 2RQ8A 5FGRA 3GRWH 5HVGB 4RMWA 5KVFL 3WJJA 3LKPA 1BHGA 2DM2A 4P2OC 3HI6H 1RAMA 1E28B 3T4YA 1I7TB 4NHCH 3C6LB 2BVPB 1FCCA 4QNPF 4J3OC 3F7VA 1OGAE 1LEIA 3O41B 5HPOA 1FZOB 1K8DA 4HLJA 3RWEB 2ZPKL 3JTSB 1OF2A 1BOGA 1OAKH 4Y1AD 3FL7A 1U6AH 3FQNB 2X2YA 3WIIH 4ODWA 5TDPB 1R5WB 1HCVA 1A1NB 3E2HC 4X0KB 2O5XL 4NN5C 4ORGA 4OIAA 4OQTH 5JXAL 2BNQA 3MFGB 5F1OB 3M07A 1U8JB 3GBMH 3G6JF 4YFDB 2D7PA 4Y19B 1VCAA 4YEEA 2DLFH 3BH9B 1E0OB 2V6HA 2HRPL 3OKYA 4JRYD 3CX5J 1IT9L 3ARGA 1A6WL 3AC0A 3MRFA 5DQ9A 4OCNC 1G7QA 4R4FH 5CIPH 2ZNWA 4QRRB 1IAIL 3FQXA 3AU1A 1CCZA 4MA1C 1A8JH 2H2PC 2D9QB 2OL3A 3LRGA 3RRQA 1HQRA 2NXZB 3CUPA 1K2DA 3PGFL 5EOCH 1PYWA 3JVGA 1UG9A 5IM7A 1K4CA 1LO3L 4YZFE 4F37F 4MNHB 2CDEB 4XVUC 2DQDL 5CKAA 4ORZC 2GQHA 4X80L 1RULL 4G6MH 3DUUA 1IAIH 4XX1G 4KRPC 3UC0H 2VNCA 4HWBH 2AJVL 1JNNH 1NJ9B 3SGJC 5EOCL 4WFFE 5FYLE 3F7RA 1H3GA 4GQ9L 2F58L 5H8DA 1VFAB 2OK0L 2NXYC 1EX0A 4OLXH 3O0RL 2I27N 4CNIB 4OCWH 1EJOL 4KDWA 3MRPA 4R4ND 4WU7B 5KN5B 4K23H 1MWAB 2VR4A 5HI4C 3CGTA 3T0BA 2NCMA 2HFFB 3FQRA 4HQQH 3MNVB 5M95B 2F58H 5D1XA 5HVHB 4IRZH 5IHUL 1OGTB 1FVDB 2VITB 5LXGH 1YEKH 4J7RA 4GMTL 1T1XB 4LOUD 4UTBL 1RJCA 5DHXB 1ACYL 1ITBB 4MJID 4HUMB 3TVMA 1I85A 3DYPA 3NCEB 2JJUA 1IKNA 7FABL 5D6CB 4LSPL 5CJXA 1NCTA 1IBGL 3I3BA 5JQHC 1FO0B 3EOBB 5DK2A 1UACH 1BX2B 1MIML 2BHYA 2ZJSH 4Z78A 2JIXB 3BZDA 5ADOH 4ZS6C 2CRYA 4K07A 4LPWA 2F54B 3GBNH 4PJGE 3PWLB 4KY1L 1ZHNA 5I1CH 3BKJH 1MREL 3B9KC 1U58A 5FK9B 3WUWG 4NQCE 3UBXA 1IGFH 3WHXB 2P24A 4X4YA 5L2JA 5T5FL 4K3DL 5E4IA 4UBDD 2FYYA 3FOMA 2VZUA 1UZ8B 2CR6A 4UOW1 4LCIL 3QUZA 4PJGB 1Z2KA 1TENA 4KWUA 3BGAA 5AZEH 1MY7A 1AH1A 5DRWA 3NVQA 4W6WB 4CVZB 4OD3L 1JI2A 5SX5K 3UPCA 3HPJA 4D0BA 1TJIH 5HBBA 4M4PA 4MNGB 4Y4KC 4PJAB 4ONOA 1ZV5A 3Q6GL 4XP6H 4GAFB 2YUXA 1XR9B 2W9DL 5K9QI 1A6TB 1NBVL 1N0LA 3PNWA 4ZAKD 3S36L 3VGDA 3BHBB 1QKZL 5AAMA 2C1OB 3DX7A 1UFUA 1GGYA 1HKLH 3UTPE 2DICA 4OZHF 4J6RL 1UCBL 4X5LA 4P5TD 2WINB 4JZJA 3SDXF 3D39A 3V7AG 2GJ6A 4F3FA 1U8HB 1Z9LA 5IEHB 4MX7B 5CINH 5C2UB 5CBEA 3NABL 1DQML 3Q5YA 4ZXBD 2PYEA 3KLDA 1LO5A 5E9DD 1D7FA 3RY6A 2ZUSA 4RIRB 3RKDD 2HKHL 4QRRD 3NPSC 3SDAB 4PRPE 5ICZB 3LQZB 1RIHH 3LEVH 3F5WA 5C0AE 4APQB 2ICES 3F8UB 1HI6B 4NBXB 1V05A 3MRJA 1J8HE 3ZE1E 4TVPE 5D1ZB 2X1QA 5FCSH 1O7SA 2NW3B 4LKCB 4OV5A 1O7VA 2QHRH 3KPSD 4GRLB 4KAQH 3E6HA 4D9RD 4ZUTB 4ELME 1T21B 1DQJB 1Y18B 1MVUB 4XP4H 5JO5B 3OAZK 3G6AA 3WEXB 1CF8H 4ZD3L 1N8ZA 2AJVH 3DX9B 3GSVB 3QUYD 4XT1C 3MGAA 3BIBX 4YFLI 3FHAA 2EE3A 4EQ2A 3CDGB 5IKCA 43CAB 3VDCA 3A0OA 3T0EE 4HXBL 4RAUB 4H1LB 3O6FC 4ODSL 5DO2D 1EJOH 4LVOB 2Q76B 3KJ6H 3PHOA 3ZTJG 2CLRB 1MHPH 3GMLB 3LQMA 1JZ3A 3ZKXB 3IJHA 4S2SB 1MHPL 1D9KB 2UWEE 4LGPB 3UZEA 4CVXA 1X7QA 3I2CL 4PJEF 4QRPD 1EDQA 3BP6A 1NMAH 1U95A 1CI5A 5D7LB 1MCBA 5C8JA 1U3HA 2VTFA 3QFJA 3DVIA 3WNMA 2VAAA 3X13A 4P5TC 4FFZH 3EFFA 4C83B 2OR7A 3LEXA 5F9AC 2DMCA 1NAKL 1DQLH 1JWMA 1OCWL 4U0QB 1OD9A 2J2ZA 4WUKH 4YDLB 3MUZ1 1ETZA 3QO1B 4NKMA 3U48A 3VH8G 1X5HA 4JFYB 3IGAB 1QHOA 4UINH 5FDWB 4I77H 3TWCH 2F74A 3SO3B 1NEUA 5IROA 3QYCA 2BC4A 5A3IC 2F5BL 3WDJA 1FVCA 2HAZA 1EZVY 4PJDF 5D7IB 4O51B 4MNHA 1W72H 5ANMA 2VN7A 4FQ1L 5CSZB 2W0LA 2NXZD 2YN3A 3LIZL 3QWOB 1Y6KR 4AJ0A 4RFEA 4O2FA 3PJSB 1B2WL 1YPZE 2ORBL 4NQXA 4F58L 3C60D 3MYZA 2HT3C 5GGRA 5BZWA 3FQXB 1MRDL 3O9WA 1RK0A 1RULH 1X5LA 1JPSL 2WWMC 3A67H 2NY4C 4HWNA 4M6AA 1KJVB 4Y19D 3MRMA 1BD2A 2QQNL 5HD8C 1CIDA 2VLKD 4OFDA 3ZYZA 3ULUF 3OR6B 5DQDL 5ITFB 1FBIL 5IJVB 5C1MB 1S5HA 4PLJD 5BMFH 1QFUH 3KG5A 3ARGD 3HE6C 5CSBA 5J13C 3K4ZA 4I0PB 5H2BB 4I3RH 3UCRA 4QXTB 2PO6B 1XGUB 1I1FA 2EO1A 2FJGA 5MP6L 3EJYD 4KFZC 5FB8B 1OT2A 1CGSL 2FEDD 5D7JD 5E99H 5KS9E 1OOAA 1AXIB 2HLFC 1OB1A 1QQDB 1RJYB 3KPSA 5F72S 1LGVA 5JA9A 1EO5A 5HXMA 4NKOA 1GAFH 2Y72A 2J8OA 1WC7A 1YMHA 2Q86A 1NGQH 3QUMB 1S9XA 3U30C 7CGTA 5C08B 3MRHB 4P46A 2FO4B 4MQ7A 4HIHA 2ARJB 2Z31A 3D25A 4X8JB 4JR9L 4NKIH 5ICYA 5DR5L 3G08B 4MNQD 2E27L 5D6DC 5E9DA 3RTQC 4TSAH 3F65A 1S7RB 3JBG7 2VXUH 2JB5H 2CGRH 4JVUA 5CCKL 2BCKA 3DOSA 5J1SC 5CCKH 4YZFF 2BDNL 2ZP0T 4QHMA 5F1SA 4RGNB 1T6VN 4D9QE 4LASL 2KUTA 1KPUB 5I1JL 2H6PB 4HUWB 4QHLB 1LE5A 2NY3C 4DGYL 5HHMB 2R1WA 5TPWH 5LGKA 4BELD 1KTKE 1N7ML 3B8YA 3QHFL 1IQDB 1MPAL 4PS4L 3GSXA 4ZO7A 3P11H 3QNZB 4LSSL 3MCKB 4PRHE 4XRCB 4MA3A 3QWRA 4AH2B 3VXSD 1XGPB 1A6UL 2ZUVA 1SEQL 4OFYA 2X1WL 4Q9CA 1DBAL 3RIFF 2XWTB 3HI1B 2BVEA 2Q7NA 1UACL 5ICXA 1UENA 1LE5B 1SY6L 1U8LA 4HH9A 3ES6A 4PY8I 4ZFFB 5HVWA 1YEIH 1SYVA 5E94A 3QIBB 5GISH 3NOIA 4NM8L 4GW1B 1ADQL 1FNEB 1JYVA 5C0AA 4QOKD 2YA2A 3ALXA 3DV4B 4Y5YC 5KVGH 3B2UC 1MFCL 1OARH 2OJEB 4OSUL 3D25B 4X8JA 4HIHB 1IAMA 3RTQD 4RWYL 4TYUA 3ARWA 1S9XB 3QUMA 4HUKB 1WBYA 3OKEA 5DD0H 2OI9B 5A16A 1RMFH 3KXFE 3QEQD 4CBPA 1FYTB 4JJHA 4Y1AB 1SVZA 3LN5A 1LDPH 1F4YH 3QEQB 4YJZL 3P9MB 5JXED 4AIZB 1WFOA 4KKBC 3IU3B 4OLYL 2WBKA 4ISVB 1AKJA 3T0EA 1G7JB 2FJGB 4JPIB 2NYYD 5SWZE 4PTTA 2PYFA 4L3CA 5BW7C 5H2BA 1KGCD 3ZSSA 1KLGA 1ZS8A 1HSAA 5DMYA 2WUBL 1S8DB 5E0QA 1KCLA 3WUWA 4ZPTB 3VFGL 1XF5B 4JFHD 4AL8H 1MF2H 1D3CA 3OV6A 1P7HL 4XB7A 1T89C 4MD5A 1EEZB 5CZVL 3RZCC 2N7AA 4TVPH 1LEKA 3VXMD 2MQ3A 3ALWA 2Q87A 1PJ9A 2EDXA 2I07B 3STBA 4Z5RB 4APQC 2X9WA 4GKSB 4FQQA 3C5SB 2Y9RT 4FQ1H 1BMGA 2YRPA 1KT2A 1LO3H 2X89A 4FRWA 3K81A 4P49A 4X4MA 4JRXE 2VDML 4OGXL 2WQ8A 1DVFD 5BV7B 1RJZA 2Z8VC 4ZQKB 4TULL 2IPUK 5TFSH 2OR8A 2YUVA 1ZA6B 4F37K 3SGDI 5E6IA 3MLYL 3DSFL 3MLUH 2IFFH 3GJFA 3QFDB 3KPPA 3TO2B 3QRGH 4PGDA 1YPZF 2GFBB 2JJSA 1DSFH 5IHUH 1F3RB 4N90D 4JPKL 4AIXA 1PEZA 4OCRL 3ULUE 1AXSA 4X9FA 2H3NA 4Z7VB 3R8BB 1UXWA 1VEPA 4P2OB 2MWCA 3EFFB 4BQ9A 3RWJA 4Y4HD 2PCPA 3BSZL 3EOTL 1DE4A 1U3HB 1LHZA 3QR2A 3FO9A 3UTTB 1SMAA 1FG2B 4PRPB 3SDYL 3IJHB 1AR1C 3GMMB 1S7QA 4OZGA 4QTHB 3KYMA 4KY1H 3BESR 5I1CL 1I8IA 4PJIB 5EO9A 1BBDL 4H1LA 2GSGA 1UH2A 2VUOA 4FFWC 1XF4B 2HT2D 5I8CA 3CMOL 1TCRB 2ED8A 2NY1D 43CAA 4F2MB 2FX9L 3EYVA 1JZ5A 5K9OB 4JHWL 3VG0L 5E8NB 1EH9A 1WFNA 4GKNA 4QWWD 2VDOL 2OP4H 1KGCE 2GUOA 5EBLA 3TNMB 4MB4A 1DQJA 4NC2B 3IDIA 1T2QH 4GRLA 3RWHA 2P5ED 1JZ6A 5FECA 4PJAE 1NGZA 1JWUA 3QJHA 3ARBC 2F19L 2ZSVB 4UU9B 3VI3E 5JIIA 3V6FB 5TDOB 4NFDA 2EYSA 4CDHA 2Q8BH 1KYOK 4I4WA 1LO4H 2VXTL 4W70A 1YJDC 1DEEB 3F58H 3FN0H 5DMIH 2ICWJ 3GSWA 4JFQB 4U6YB 1J0KA 5EOQL 4YBLC 3DO7A 4BH7B 3N1MC 4QXGL 3GJFH 4LSPH 4XTRD 3HMXH 5DA4A 1KJMB 1MQKH 2X4OA 4ODHH 4ONFL 4NQCB 4PJEA 5KSAD 1MFNA 2HVKB 1AD9B 5CP3H 3CFDA 1FL3B 2APVA 1FDLL 1RZ8A 3IF1B 1FV1B 5MEPA 2DAVA 4YXLL 2YMXH 4OAWA 1T3FA 3X12B 4CN4A 1I9RL 3VW3L 1PDKA 5F6HJ 3V9FA 2GYSA 1KEGL 4JFOA 3RHWF 3H7BB 5C70A 5BQ7A 5LWYH 4HKZB 4MNGA 4CMMB 1VFBA 1X5KA 2MKWA 3HPJB 4D0BB 5GGVH 3QXAB 4KI5C 5ESVA 4MDIA 4ETQA 2FNBA 3KPLB 5KVEH 2KKQA 4P46D 4ZO6A 4NQEA 4S10A 3CVHB 4D2NA 4ZAKA 5M7QA 1MRCH 2LFGA 4X6BA 4ONHA 1RUKL 1UA6L 3VFOA 1NAMA 3CLEL 4NYLB 1T0MA 3LKOA 2P48B 4A6YL 1RJLB 4OZ4A 4K3EL 2VDQL 5HI3C 3FQWA 1U58B 5FK9A 2HJFA 3G5VB 4U6VL 2VDNH 2AS5M 2HH0L 1ZHNB 4KHXH 1YEFL 3RGHA 4OM0H 3GKZA 1KXTB 1UM6H 2WLZA 5F44A 4X99B 1YYML 1Z9MA 3AS0A 3L5JA 4TQEH 3BD4A 4HDIA 4C56B 3NFPA 1KJ2L 3QNYA 5HYFA 1I1AD 4GSDL 3FO1A 3V6ZA 1CD1A 1G0YR 3OB0K 1JHLL 1Z0NA 4OT1H 5FA4A 3WLBA 5KG9B 8FABA 4PJXB 4YHKH 1JGDB 3BVNB 3B9VA 3J8F7 8CGTA 3G5ZA 3RGVC 5IT2L 2P8PA 3EGSB 4Y2DC 2OTUA 2DJSA 4JQVA 4CADB 4V1DD 4HUVB 5MENB 1IC7H 2X4QB 1P9MA 2OTWA 1IGIL 2O93L 4LAQH 1R3IH 1T1XA 3ARQA 1T7ZA 1GGUA 4G6AD 5JORA 4LU5L 1FORL 1T4KB 3IFPA 4RFOH 3BW9A 4K3JL 1DBAH 3QIWD 5F8RC 4PJCE 1TETL 3RTQB 5IGXH 3MLTB 4OJFH 1JCKA 1KCSL 4PJAF 5T3ZL 2ATKA 2X89D 4XCEB 2XQBH 4KJQD 5DRXB 5DT1L 1XR8A 3MOAL 4Y8DC 2DOCA 1UM4H 2DLTA 4JB9H 1S7VB 5CJBA 4JM2D 3SGKC 4PJGF 2VDRL 3EJZD 1RMFL 4WFHE 3W0WA 2V7NB 1JNHB 2X42A 1OAUH 3PWPA 1I1YB 3L3KA 3KNBB 4PJFB 4FNLL 5DHVH 4YQXH 4MAUH 5FKPA 2IH1A 4WO4A 1FH5L 1EERB 4RISL 3R4DA 2ADJB 4GAJL 5GRUL 5C0BE 5D1QC 4LFHD 5FYKH 2CLVA 3MV9D 4WFGE 1UZ6E 3UROR 4PRHA 2W92A 1KG0B 3OHXA 3C60A 5E99L 3TJHD 1YQ2A 4DZBB 2MCPL 5DT1H 3MJ9L 4L9LC 1T2XA 1UH4A 2DS4A 4O4YL 3W82A 1QR1A 3HUJF 2NY2C 1VGEH 2W60A 3MOBH 4HK3N 5J12B 5EUOE 5MHSE 2WQRA 3BZ4B 3QIWA 3WKML 5EORH 3RWIA 1FZKA 3RL2A 4E42A 1PKQB 4F7EB 1JRHL 1LD9A 5B38G 5IVNA 5SWZD 2V2XB 4KUCD 3FRPG 4WUUE 1IJ9A 1BOGB 1OF2B 2YK1L 5IB3B 4HUNB 4R26L 1A1OA 3ARDB 4P3CH 1ZHBB 1CD9B 4JO2L 5FAAA 4Q74A 3STLA 3UZVB 4JY4B 4YK4B 2FIKB 2G9HB 5F7EH 1YNKH 2HKFH 2HG5A 3A6OA 2NY2D 2V9QA 1E28A 3WFCH 2FLBT 4EIZC 1NFDA 1U2CA 1XF2A 4LASH 1F90L 3VXUE 1KSRA 1S7UA 1F3DH 1UXSA 1UWXH 4Y4KD 4GQ9H 2BVQB 2A83B 4C55A 4L3AA 1TQBB 3E1F1 4DZ8A 1CTNA 3DXAD 3BEWA 2B5IB 2GEEA 1AGDB 2NY5H 4KKCD 3G5YA 4KPHL 2WIIA 4MHHG 4QOKE 3RJQB 2VKWA 4QRSB 3OWEA 5HGDA 3RVWD 3TA3A 4BZ1L 4LCCA 5D72H 2X1PA 1QYGH 5E6YA 3SE3C 3BP4B 4EEEA 1BQUA 5FXCH 3C08H 4BH8A 2FCBA 4KQ4L 4KK5D 2WWMD 2NY7L 3G5XB 4J3TA 4ZSOA 3T1FA 2HWZH 1QA9A 5FGBA 1ZVHA 4AT6A 4KAQL 3I02A 3SKNB 4M5YL 3C5ZA 1TJHH 3HE7D 5JIKA 5KSBE 4KJWD 4JY6B 4DGYH 5D5ME 1EGJL 1FC2D 3C5JB 4YR6A 4TOYH 4WUUD 5BXFA 1IARB 4ETYA 1LK3L 1MH5B 1OSZA 4TSCL 1SYSA 4RZCA 2BJML 5HI4D 1FFQA 3QPXH 1HINH 4R4BA 1A22B 3CPLB 4P2CG 3V5HB 2W1NA 1DZBA 2DQGH 1NC2A 5IFHL 1QHPA 4WI9A 5DSCA 5D4QA 4DUWA 1JK8A 3RUGE 1YMMA 4JKPL 2UZIL 1I8KB 4E0RB 1IGMH 3ZYOA 2BOCA 4PJHF 1XGYH 3QG7L 2FWOA 1KEMH 4HC1L 3RNKA 2HLFD 3VXTA 4PRAB 4UV7L 3D0LB 3VG0H 3IDNA 3LKQB 1QFWH 3EO0B 3WFHA 5ACMA 4JLRA 3OKOA 3MLXH 2VZ3A 4B0MM 2VQ1A 1MI5E 1XFPA 1F11A 4N8VA 3HI6L 4HUUA 2NY6B 3EJJX 1DBML 4YC2B 5EOCJ 4LLUA 4NM8H 1N2RA 3OG6B 5FYKD 5IESL 4OZFG 4KZEL 3RDTD 2R0ZH 1P69B 4LF3A 1MH5A 2NZ9D 4M7KL 1CVSC 2E6PA 2KDGA 5BV7H 2OJZH 4NT6A 4YE4H 2XZQL 3HG1B 4LEOA 4XAWH 5ELIA 4Z7UA 2PTUA 1WBZA 1INEH 4P3WA 2GJZA 3KYNB 5DJ6B 2FHBA 4PLKD 3U0TA 3DI3B 3GKWH 2XTJD 2AJZB 3QEHA 5JDJA 3PE9A 1IC7L 2V5TA 4M3KB 4PBVC 1UCBH 2WIIB 4OD2A 2NXZC 3P4NB 3MR9B 3KPRB 1G7IA 2APWA 3T77A 1ADQH 2APTA 1JF6A 4Y5XB 4DGIH 2E8YA 1AE6L 1T1ZB 1G9ML 1RZIB 5F7NC 4UT9H 2O5ZL 2V17H 3P73B 1XGTA 5E5UB 3A6BL 2W38A 3HPLB 3PP4H 4Y4KA 5L8LB 1WCBA 2R23A 3HNVL 1JTOA 4XAWL 2QR0B 2XV6B 1YN6A 3EYQC 4PV9A 1JZ8A 4MXQD 3HR5B 2PKDA 1JGLL 3WS6C 1P7QA 4P23D 1ZHBA 2DL9A 5FKAB 2YPKA 1J9CT 5MP6H 1BM3H 3FT4A 2IPTH 4A6YA 2WK2A 1PSKL 4PGCB 2R2BB 1NAML 5KJRL 5GIRB 1MF2L 5B38B 3BPOC 1JGUH 4EQ3A 5GS0H 3IJYB 3FFCE 2DQCH 4HQQL 3D2UA 3ECBB 4IRSA 1U9KA 5JW5A 3BPNC 2QHLA 2B1AH 4JRXD 3SCMC 3E8UH 4HCRH 2ZCHH 1B6UA 1KJ2H 2EDEA 2Y1VA 4JREB 4NP4H 4PTUB 1CZ8L 1ZLSL 4PRHB 2FDBP 5AWNL 3ZKQD 2PTTA 4OZHB 5C92A 1A6VL 3QI9A 1U8QB 3RU8L 3NCYP 1KCKA 4H25A 1I3UA 3KHQA 4GT7A 4WV1B 1S3KL 4U1JB 5HPMA 5HYJA 4YHPA 4M1CC 4XMPH 1S9WB 4B50A 3LVEA 4OF5A 3PL6A 1BZ7A 1KN4L 5DJ8B 2GY5A 1M7DB 4PLOB 2IALB 2ZUWA 4PP2B 3DURA 4X7TA 1NL0L 4ELMF 5EUOA 1RUAH 3B2VL 3HC0B 3HRZA 2NTFA 3O3EA 3L5WB 4WHYG 3A67L 4NQVA 5E2UH 5C0IB 4GAGL 4RCAA 2CUHA 3WBDA 4DTGH 3RX5A 3TESA 4ZODA 5EZJA 7FABH 3B6SA 2BVYA 5T33H 1FO0L 3QDAA 2VSDA 2B5IC 3AS1A 4XCEA 5DRXA 3V0WL 4UZGA 5IWLA 3VXSE 2H32A 3K1DA 4JVPA 2Y4SA 1XIWB 3L6FB 1UJ3B 2C1PA 3VDAA 5B8CA 5LGHH 3IVKA 2DMKA 5IUSA 2GCYB 1J1XH 2C3HA 4N8CH 2A9MH 3IFPB 1NCWL 5FCUL 1D6EA 3VXUA 3RIFK 1I8MA 1NFDE 2CDGA 5DD3H 1QSFA 4X6DE 4JQVC 5TGBA 3C9NB 2A77L 2D7MA 5MERA 3NTCL 1I1AA 3HAEG 3MRRB 5E24E 3F6LA 4OGAD 1U8MB 4RAHA 4HXAL 3TBSB 1N59A 1FE8L 1JN6B 3DMMC 4KTDH 1IGFL 1OY3B 5LQBL 2P5EE 4OZIB 3D0VB 2CIKB 3QIUB 1C08B 5GJTL 5DHYA 1EFXA 1BLNB 1REIA 5F7FA 5J1AA 5F9OH 5A40E 2LTQB 2W0KA 4QTIL 1N6UA 5DUBA 3BRFA 3GSNL 4AEHL 1KIQA 1MAML 3FONB 4KMTH 4R0LB 2BJMH 5J6HB 1R0AH 1INEL 1Q9OA 5D2NC 4JJ5B 3SPVB 2V2TA 4NUJB 3VFPB 4R3SB 3OXRA 4ZNCD 5JNYB 3CDYA 4X6FB 2XNAB 2YZ8A 4Y4FC 3LZFL 5GGTH 4DKFL 4F7CA 4OZ4B 1DLFL 4QWWC 3SDXE 3MV8A 4ZNEE 1QBMH 1WZ1H 4ZYKB 2Y6SC 1S9YB 5F70A 4L3EA 1KELH 1WBXA 5T1KA 1MRFH 4ZAKB 1KXVC 5E8DH 1EUUA 4PJXE 3IJSA 5EH1A 4XMLH 5ESVB 2QQKL 3U30B 4AYFA 4ETQB 2FBJH 5GS0D 1UKTA 4UV4H 1VFBB 1LEGA 3OKKB 2HA1A 2D03H 4M7KH 3ZDXF 3QIWC 1ORQA 4Z7VF 3MV8B 1BWWA 1GPOL 1QP1A 2HN7A 2C5DC 3EYQD 4GXVH 2BXYA 1BQLH 4M03A 1Q72L 4E9LA 5D71H 3T04D 4G8IA 4BQCA 4K3HA 1HEZA 1YDPA 2NY6C 1I3RA 2FX8L 5MEPB 1EFQA 1XCTA 2R8SL 4JCLA 4PRBB 3N9GH 5T1DL 3T1WA 4PRIB 5AZ2H 4PJBB 4J23A 4Q9BA 2X4OB 1HQ4A 2UYLA 1QLEH 2FL5B 4AMKL 4EDXB 3HCVB 1BQLL 4GG6A 3DO7B 4Q9RL 3JV6B 4HK3J 5DFWH 3BD5A 1AO7D 3SKJL 4PY7A 1CICC 2DQEH 2UWEB 4AENB 2EDLA 2FJFB 1MRCL 2NW2A 1VKXB 4KV5F 1XF3A 4XBEH 4AM0B 1UM6L 3QIUA 3CU1A 3WE6B 4UU9A 4PJ5D 4LU5H 4MSWB 5EIIB 2D2OA 1CLCA 3WIHA 3AXLB 1DSFL 4XVUD 4JG1L 2QQLH 3LKNA 1KBGL 1NGXA 1A9EB 3SJVE 1U8MA 4HKBA 4P4RA 4WEMB 5HYJD 3I6GA 4XZUA 3QNXA 5BS0D 3TV3H 1UB5A 3BP5A 2GIYA 3SE3A 4CU8A 3SDXB 3VFMB 4L8SB 1D5BA 1R5IB 4F2MA 4UINL 2BNRB 3HS0B 4LSTH 1J5OL 4ODSH 2XI9A 1WZLA 3FB5B 4LSTL 1F6AB 5D1ZD 1DQLL 4R8WH 1BFOB 5JIHA 2V2WB 4WFFD 3GMMA 5T3XH 1BFVL 1ZLUH 3VXPA 4AEFA 4JO4H 4L8DB 2XZAL 2VSCA 3LS4H 4JDTL 3ARTA 4NUGH 2ZWLT 1GZQA 1EVUA 4NIKB 3OX8B 4XWOC 4QEGA 4MXVE 3GEWB 3I9GL 2QQLL 4OJFL 3IS0X 4PB0H 4PJ7E 3SGDH 4NFCA 3SKOA 2EECA 1UXWB 4P2OA 3RGVD 4EBQH 3H9SB 1BZ7B 2X4PB 2IMNA 3GO1L 1JPGA 1QRNE 2EO9A 4PJ5A 4OLEA 1WT5A 5I1GL 2UUDH 3B3IA 4MCZB 1ZHLA 4YXHH 4YK4C 5J7CC 1V7MH 3O11B 1CWVA 1JPGB 2W9EH 3TO4A 3H9SA 4Y0GA 6FABL 4FXGB 4PLKC 4PTUA 4HIIA 1DN0A 2EKSA 5BCAA 3HR6A 4PRHD 3V7AE 3OX8A 3O4LB 3VWKC 4NO5A 4O2EA 4Y89A 1MI5A 1GOHA 3K74B 5ISZD 1OTUC 2H26B 1MCOL 1L7TH 1MQKL 4FN0A 4YDVB 3QUKA 2EDOA 3UTQB 2VKXA 5DJXA 2XPGA 4RFNC 3HZVA 2BRQA 2R2BA 1U8NA 5L8JB 5DTFB 2BRRL 3PWPD 3LQAH 3MRQB 3KPTA 4LCYB 5DK0A 4G8GB 4DGVL 4OI8A 3LV3B 4MD5B 4N9OB 1YNKL 3SKMB 4LL9A 3DVGB 5JR1H 3NTCH 5IQ7H 5KSUB 4M6OH 3M8OH 4XZUB 2WW8A 4LHUA 3QUYA 4UDTB 3DYMA 1AQKL 1RUQL 3LY6A 2HP4A 4AEEA 4P2QE 4EI5B 3ESVF 1AKJD 1A6ZA 2XA8L 1TVHA 3KDMB 1QEWA 4JHWH 4LDLB 2OSLB 4X7CC 5ILTH 4BUGA 4WI4A 2XRAL 4M1GL 4P5MB 1DVFC 3JV6A 3N50A 1AP2B 1FYTA 4M1GH 1X6NA 4WI8A 2IFFL 1YYLH 4FP8L 2J4WH 3I6KB 3KYKH 1OLZA 5LGJB 2RB8A 5CJOL 4X9GA 1ZT7B 5GSVA 1AGEB 4TUOB 3HG1A 2OS7A 2P5WE 3MLXL 4PV8A 2QKIB 1C5CL 2IAMA 15C8H 5KSAA 5E70A 5TQ2L 1M71A 3PABB 15C8L 5LAXB 4D9QD 5E5MB 2H2SC 5EPMA 3TO4C 5D70L 2Q8AL 4OCYL 3MFFB 1BBJB 4PJ9A 5C0BD 5CJXC 4HUUB 5FA3B 2E7MA 1IAII 4QF1A 5H35B 4NQUA 3HAEA 4ODXB 3S4SB 1UADC 1D5IH 4OCXL 1EVTC 3T0WA 5T3XD 2VLLB 5AUMA 1T5XA 4YH6A 2FB4H 3RNKB 5AUMB 1XGPA 3O6FB 4L4TB 5INDB 3BDXA 4OFYD 1FGVH 5K9KB 5TE6H 4ODXA 5IBUG 2B7DT 4P2QB 3Q5TA 3JWOC 5FGCB 4ODVL 2JB6B 4MD4B 1YMMB 2HTLD 1FSKC 1TITA 3BDYL 4M8VA 2VXSH 3PWJA 4NUJA 5SX4H 1BBJA 1CFSB 5E6ZA 1Q9OB 2P5WB 5KVGL 3CLEH 3N85H 1KIQB 1HOCA 4YXLH 3U9PH 1XGRB 5KANG 4AEHH 3TBYA 3NH7L 2OZ4L 3I02B 1VB9A 1BQSA 4U31A 3ABZA 2IAMD 5GZOC 3MV9E 1NCCH 1ADQA 2FH6A 2I9LA 4EDWH 3HZKB 3D0VA 1ZXQA 4NN5B 4PGZA 4QRSA 4PD4J 5ICYB 1AC0A 1SQ2N 2R0WH 2XXMB 2WUBH 1AGBB 4GKOA 1AGDA 2OSLA 4PB9L 1M4KA 2VXQH 4YGVA 1QSFB 2KQMA 3LN9A 1TVHB 1UWGH 4JM4L 4UOW0 5T5NF 3JVGC 4M61A 3SJVA 1DLHA 4LRIC 3PGFH 5GRVK 4UNVA 3ROLB 2IAMC 3SDDA 3IETB 5HHME 4BQ6A 5FF6B 1U8PB 1F4AA 4K23L 1BIIA 3SE4A 4K94C 1OAZH 4KHTL 3OXSA 5DJZA 1I1FB 2XKUA 4HEME 3IFNH 2E5EA 1U91A 2OK0H 4NNPL 3QRFM 3ARBB 4H0IA 2HKHH 3VFVA 2DDQH 3VXQA 3WD5L 3GUTB 3WFCL 4WHTB 4S0SD 3RWIB 1TDQA 1KCVL 1EHLL 3BZ4A 1CLZH 1BVZA 3RZWA 3IFLH 4XCYA 4NO5B 3G6DH 4PJCF 5AD0A 1F5WA 2WNGA 4CW1A 4O5LH 1JZ4A 1DDHB 3TBVB 4NPYA 1M05A 3MLRL 2WUCH 5I9QC 2EKSB 4BKLA 5E1AB 5GRXG 1RZJH 2YSSA 3NIDE 3OHXB 3QAZC 5M94B 5I15L 4Z8FL 2Q3ZA 3H3KA 4KRLB 1S3KH 1C16B 1S7SA 3U4BL 4XCYB 1AHWC 4IRJA 4WTXA 5C6TH 4FQCH 4N8CL 2J4WL 2CIIA 1PSKH 3WFBL 1P84K 4TTGA 1GCFA 3HZYA 1T0PB 3QZWB 5DD1L 5DD5L 1IGJB 4PGCA 3MJ7A 3OSKA 1MCWM 1U3HD 1LWRA 2DI9A 5IQ9A 4DTGL 4P5KB 5C2BL 4RFOL 1ZMYA 3DV6B 4JPKH 4RRPA 1GGIL 3RBSA 1HIMH 3ARDD 2Y5EA 3SGEI 1XR8B 2F8VA 2IADB 2F15A 4JDZA 1BEYL 3K46A 4PS4H 4MJ2A 4MJ5B 4OZGF 4GW4A 3FB5A 3UYOD 4ZTOH 2VR9A 4MXWH 3QEGH 2G5RA 5EC2B 4Y5XA 3Q6GH 1T83C 1H0DA 5FM5M 2ZZUT 2JCCE 1YEHL 4FQLH 5ERWA 4F15C 1RURH 3KPOA 2O5YH 5T1MB 4CU7A 3QNXB 3I6GB 1WWBX 3EDJA 5DD6B 3GNML 2QADC 5MENA 4OD2B 3DXAB 2G75B 3UAJD 4HWEH 5IIEA 2FD6H 3O9WC 4ODBD 3RHWK 2OXHA 4TSAL 5IK3A 1A02N 4XI5D 5EFIB 3WE6A 4EI5D 2RHEA 2X41A 6CGTA 3O3AB 1GZPB 4MLSA 3DX9A 1D5XB 3H9HA 1B6DA 3KJ4B 3V6ZB 4FQHA 5IHZB 1Y18A 3NFPB 3CU7A 4UT6H 4BFEA 2XZQH 4KKLC 4D9LL 1P4LB 1RFDL 2NW3A 1BF8A 2IG2L 2FL5A 2P5WA 5IMMA 3MRJB 5TPWL 5JR1L 3FTGB 1HI6A 1OP3K 4P57B 3PWJB 1FJ1B 3V5DA 4Z95H 5ICZA 5BOPA 4O02H 3GIZL 4ESKA 1JZ2A 2JB6A 2BDNH 2H8PA 1O0VA 3WN5A 4NO3A 1TQCB 1OPGL 3QXDB 4ZXBB 3ZDYF 4PJDB 2PYEB 3QCVL 3ROOB 5HDQL 2XACC 3V4UH 3DVFA 5JQ6L 2DMBA 2A73B 5MENE 4JVWA 5IW1B 2QSTA 2EIZB 2XWJB 2GJ6D 1ZGLP 3UTOA 3KPLA 3H3BC 3IJSB 5D8JH 1F8TL 5BO1L 2Z31C 4HK0B 4Q2ZA 1HZHL 3MROA 1B0WA 2EIZA 3QG6A 4FP8H 5D1XC 5C0NC 2AXGB 4TPRH 1Z3GH 3ZTJH 3AGVA 1QKZH 2J88H 3LD8C 5FV1L 4NQSB 4KUCF 2AEQL 4NJAH 4WGVB 1H3PH 4KDTA 1PD6A 4MD0A 4RSVA 3VRIA 4CVZA 3CD4A 5F1IB 5CHNA 4EUPA 3V5DB 3RPIB 1NAKH 4FABL 4K55A 1K8IB 4NQCA 3ZKXC 4HZLB 1NCDL 3MODH 4QO1A 3MLWH 4LCUA 1E4KC 1CGYA 4GRWH 4IDJH 2YD5A 4LVOC 4Z7UE 4XP4L 1IGCL 2P24B 3X3GH 2BK8A 5LVEA 2LV4A 5DUBB 3UBXB 1UM5H 1OAYH 2AJXH 2EYSB 5DJCB 1NDMA 5TDOA 2AXJA 5DHYB 1A6ZB 1J18A 3CSBA 2A83A 4Z9KB 3X17A 2VIRB 4OLUH 5IK3B 3I3DA 4I2XA 2L7JA 4WI5A 1NGZB 3RI5K 3BZEB 1OAUL 2FHCA 1NFDB 2XFXA 4V1DB 4HC1A 1AIFA 2A6KB 2UZIH 4N0UB 3WDIA 5DD6A 1BX2A 3DPBA 5BS0E 1U93A 4I18B 1HHHB 2VXVL 4XC1L 2H45A 3MOAH 4PRNB 1QSVA 4S1QL 2AW2A 1MCWW 1HILB 5I8CB 4LCYA 3BFOA 4JKKA 5EORL 3ZL4H 3QDGE 4R97C 3GMNB 2V2XA 2CRMA 4BSVB 1CK0H 1YC8A 3QZWG 4HGWB 3T65A 4NKDA 1JMZA 5HI5D 1X6LA 5JHLH 3C6SB 1NPUA 4JRYE 4O2EB 1EHNA 2HJKB 4P3CL 4DVRL 1ZANH 2NTFB 3O3EB 3OZ9L 2VABA 3O4OC 5DQJA 5MI0C 5D7KE 5I1AB 1KCUL 4JO1L 1OTTC 5GGSY 4DZBA 4DUXA 3A6CH 3B4NA 4F57L 4XPGH 3QUXC 2X7LA 1MUJB 3OKLA 3RVVD 5DMGC 1SVCP 3UEZA 2CIIB 4X6DA 4F7MA 4IOIB 3EYUH 4JPWL 5IFAH 1NC4B 5GZOD 1C16A 4K7PX 1INQA 4PJ5B 2EDDA 2VLJE 4NN7B 2PNDA 2X4PA 2GT9A 5CP3A 5FKPB 3SKOB 3RQ3A 1FZMA 1GIGL 1JF1A 3L3KB 4ZQKA 5TE4H 4X98B 1X4ZA 3T0ED 1F6FB 1SMOA 4DCQA 4N1CA 3LIZH 3EO9L 1HK6A 3NPSB 5AD0B 1BREA 4PG2A 3QT2A 5IB2B 2DQDH 3U46A 5HHNB 3ZO0A 3F6IA 2A6IB 2FZ3B 3V0AC 4PY8J 1MLBB 5JW3H 3EHBC 5TDNA 2BRRH 3DIFB 1GH7A 3VFVB 4JFFD 2WV3A 4G5ZH 4ZDHB 4GMSH 3EYUL 4JPWH 1U91B 3D85D 3QQ9D 3UJTL 4TN9A 3RVUC 3CJJA 1KXQE 4L29A 2PW2B 5I0DA 1QVOB 3RI5F 4K7PL 1CGSH 5JOFB 4Q0XL 3FJTA 4FG6C 1QACA 1T5WB 1A3QA 4WHCA 1HINL 4PJ8D 4WIQA 2QR0A 1Q0YH 4Y8AA 4KTEH 3HAEH 2OTWB 2UVEA 2WP3O 1AIFB 2A6KA 4I3RL 3LKNB 3NPZB 1HSAB 1JNNL 3TYFA 1EGJH 2PYFB 1T2QL 5FO9B 4ZOEA 5ACZA 3UYRH 4LRIA 2BXZA 4XWOD 2Q8AH 2ZUUA 1NMCB 3O6KL 3D39E 4YGVB 1LEIB 5BRZE 5I19L 4P5TA 4NZUH 4ENED 5I19H 4E5XB 3S36X 5FDYA 2DYPD 1A7PL 3D39D 4RGND 1TVDA 4ZOCA 1XH3A 1XGYL 3O8XA 3UYRL 5EZLB 3J7HA 4S1RL 2OL3L 2OXGA 2JTDA 4F9LC 5FYJL 1JPFA 3Q0HA 5IMOA 4DAGH 2PN5A 4N8PA 1OP5H 2OCFD 3BE1H 4Y19E 2JF1A 1XF1A 4G42A 5CHNB 4EUPB 1RD6A 3CC5A 5TE7L 5AZEL 1OPGH 4WDIB 3JWNC 3BSZH 1ORQB 4GG6E 1J8HD 1G0DA 2LVCA 4HF5H 2IJ0C 3BDBA 1F97A 2XA8H 4X83A 1FAIH 3LDBB 3QG6B 1A7QL 2NX5D 3QDMB 4Z18A 3MROB 1NGPH 4PJIF 4QHUA 1QFOA 4NZRH 1AGCA 3BXNB 3VJ6A 2ICCA 4P2QA 4WEUD 1KOAA 1NBYA 3L9RB 3H9ZA 5IB5A 1YEDA 4CMMA 4GRLC 2JE8A 3O6FA 4L4TA 4OB5L 5CINL 1T5XB 2DRUA 4JFOB 2WLYA 4MA3B 3VA6A 3PHQB 2DQIL 2XN9B 4OLWH 1MIMH 2WAHA 3ZL4L 3WN5B 1EV2E 1U6AL 2J6EA 1CT8B 5DSCB 4U7KA 2VLJD 5EBWA 4HS8H 4U1GB 1HDMB 2WBJC 2I5YH 5DC9B 1TTFA 3DMMA 4M6MH 3FONA 4KQ3H 4XXCC 5EZIH 4J4PA 3HNTH 3VFSB 4NRZB 3RWGA 1G1YA 1MHHB 4CVWA 1FN4B 1WAAE 1X9QA 2I24N 1JJUA 4Z76B 2VC2L 4LGRB 3R06B 1S7RA 1H5BA 1WIOA 3BKML 3RWHB 3V95A 4XCFL 5HYSA 2HRPH 5KVEL 2IEPA 5H37H 4YHMH 4F9LA 4P2RD 5C08A 1D6EB 3IB4A 3VXUB 3ZT5A 4O00A 4XX1E 5IEKA 3FB7A 4UT9L 3GRWL 5C0DA 1MSPA 3CFIC 5LBSH 4LDOB 1W2KT 3FCTB 3MLPA 5I66A 1KN4H 5E08L 5LCVL 4LHUB 3K0WA 5TFSL 5JDSA 5D1QA 2C4FT 1WFTA 2D7TH 3B6SB 4XAKE 2XTJB 3QDGA 2JJSC 4AMKH 3DV6A 1IC4H 3FB8B 3B43A 1CGTA 1IILE 4LCCC 1A1OB 1FP5A 1NCUA 2ADIB 2YD7A 4QXTA 4RGNE 3MV7E 3QUXB 4OFPA 5E08H 5EZOL 3PQYD 4Z7OE 3O45B 1S78C 2IALA 4WWID 3MXWH 2MPAL 3P2TA 4MAYA 2VLRA 1NEZA 1MLCA 4XBPA 3UTQA 4QRPB 3PWPE 2NTSP 4YHPB 1HKFA 4U1JA 1OQOA 5CJ5A 5J6GA 4OI9A 1MCPH 2UZYB 2PTTB 1ZANL 3RGVA 3RPKA 3TT3L 5C08E 1HHGB 2P45B 5IW6B 3RIAK 4FXGA 5GS1C 1M05B 2BY0A 1ACYH 1CYGA 3FQUB 2P1YA 4NZTH 2AVGA 1UWEL 1G1CA 3LB6C 4M8QB 3V5KB 3WJJC 4RFEB 3SBWA 2ED9A 2R4SH 3AREC 1Q9LA 4Y5VA 5D6DA 4ERSL 3GI9H 4UUJB 3MREB 3OPZH 4JFFE 1MLCB 2DI7A 3GK8L 1NBZA 3GGWA 4NRXA 5GIRA 3LPWA 3ARBA 4DQOH 3R1GL 4JFXA 4MGXA 1H5BC 3ZTNL 4KV5E 3SDYH 1NMAL 1JWSB 5IP4A 3NCCB 2W65A 5E95B 5CD5D 3N1GC 1CFQB 3S37L 1OT1A 1TTGA 4WWKD 2IWGA 2V5YA 3ZLQC 4PTTB 3ULSA 4N0UE 3BW9B 3ZE1F 3QA3A 2IG2H 4XCCL 4JPIA 1GYAA 5IEKB 1CQKA 3ISWA 4JO2H 4OIIH 3Q6FA 4WI2A 4UQ2B 1JHTB 5DJDA 3I50L 3V4VH 1AJ7L 1EO8H 5IG7B 3ARFD 3LD8B 4RAUA 5I8OH 2ZCKL 2FR4A 1Z5LB 1JPTL 4Y2OA 5FCUH 3G5ZB 5C09A 2N7BA 4PGEB 4Z7UB 4HFWA 4OF3A 2XA3A 2NY7H 1G9MC 4FXLA 4WJ5A 3MA9H 3D85B 2C3XA 4IS6A 3VRLE 4GXUM 4PJ7F 2FGZA 3B9AA 5BZDA 4XCCH 3M17B 3S96A 4XMKH 1KPVA 3CDFA 1CFSA 3FO0L 1N2RB 4OLVH 1ZTXH 3QIBA 1WZKA 1K5NA 5E6IC 1J7VR 4HWBA 1CFTA 1QSZA 5K9KA 4JAMB 3VXSA 3QG7H 3D0LA 3BRDA 3VU2A 1WGOA 4OF7A 4XPTH 3S4SA 1NBYB 3L9RA 5I2IA 3VMOA 3BXNA 2EXYC 2WINA 4ZOAA 4XP1H 4PJDE 4R96A 1RFDH 4N5UA 4I5BB 3QXAA 2FGWH 3O8XD 4FQIL 1QYGL 1J0HA 3TT1L 4XBEL 2YKLH 1VACB 1X44A 2VE6A 2QADD 1ODAA 4RA3A 4OF0A 5LAXA 5EU6D 5DRNA 5I18L 1QNZL 2ZCLH 4ELMB 1YN7B 4JY6A 4NQTA 4LAJH 3QXTA 3C8HA 2FGWL 5I17B 4NQDD 1J8HB 3GRWA 1R3LA 4HGKC 1M1SA 3G5XA 3HA0A 4LLMA 4WUKL 4W6XB 4JJ5A 2R1XA 5ACLA 3SEPA 4HSQA 5JPNB 5E2WH 1MHCA 2A1WL 3W11C 1AP2A 2I5YL 4Y88A 4CRPA 1VADB 3UZQA 1N3NB 4K8RC 3BIKA 3C5ZD 4P5TB 4PBXA 4X7DC 4JFDA 1YC7A 5FM5O 3WS6A 3V6FA 2GITA 1AGFA 1DL7H 1IVLA 5F96L 1S7UB 3K4AA 2VH5L 3RJDA 4BQBA 1CICB 5CGTA 3EUUA 5FO8B 1IGML 3KS0H 5EBLB 1I1AB 4RAVA 3G6JA 1CR9H 3HLAA 4AL8L 1AHWB 2X40A 1I8MB 4OKVB 3SKMA 1EUTA 3IDXL 4R4NC 1UWGL 2R2HB 4U49A 4PJHA 2PUQT 5I1GH 3QQ4A 5CEZD 5B8CB 1YQVH 4EVNB 5I1IL 1FRGL 5DS8B 2H32B 4XC3L 2ZUXA 5F7MC 4XNYH 3RL2B 3PL6D 5GGQL 2A6IA 2AABL 2EE2A 5T1LB 1JNJA 4HBCH 1MI5D 3AS3A 4GAYA 5I1KL 3MZGB 4CN6A 3IDYB 1OQXA 4OF8A 1NCNA 1QR1B 3BN9C 1RK0B 3VD9A 1DQQB 4TNWF 4WW1A 4LK4A 4K2UH 1WQVT 4JZOB 2BNRD 3P3YA 4YGAB 4YPJA 3MRDA 5I1KH 5F3HA 3U36A 4OZFH 4H25B 1D5MB 2X7LB 4WO4B 1OGAA 1F45A 1L6ZA 2P5EA 1K4DB 1JFQL 2FBOJ 3GBLA 4R4FL 2Q7YA 4XNYL 1FFPA 2E9JA 5L9DH 1TXKA 5DQJB 1UEMA 3CMGA 4FHBD 1PG7H 3RWDA 1GHFH 5IM7B 2J12B 2JKXA 4K94L 1PG7L 1WAAF 4OCMC 1E6JH 1LDSA 4R0LC 1YEKL 4HGWA 3QFJD 5T33L 4LLDB 3QB7C 1QFUL 3JTTB 1G9NL 4C83A 1JGEB 2BFVL 3MLTA 5FHAH 4M5YH 3S5LG 3BZFA 1JGVL 4BSVA 4JE4B 1ZEAH 1B88A 4H26A 4A6YB 1AD0B 4POZD 2CKBL 4S1SH 5J3HD 4BK4A 1T04A 4DN4H 1AQKH 5E00A 3R0NA 1HYSD 4S2SA 4M93C 5C9KA 2XKNB 4RQQA 1XF5A 4P4RB 2R23B 1TVBA 4N0UA 1A9EA 5IBTL 1QSFE 5CS7A 2EIBA 4CADA 1AI1H 4WCYH 3RU8H 3KWWB 2R9HC 4WCYL 4L3ED 3O2DH 2EC9U 3NCMA 4XVJH 1AR2A 5IMKA 3BWAB 4ISVA 3NGBC 1EXUB 4Q58C 1IBGH 3KXFB 3KPRA 5KBNC 2ZOLB 1MCLA 3TN0B 1RIUL 3GSUB 3LN5B 3QEHB 1N0XL 1U8OA 3P11L 4X7EC 1C5BL 4K3DH 3TNNB 3CAFA 4HHAA 4J8RB 1RHFA 4QRRE 3H3PL 5B21A 5AYQA 2XTJC 3PGDB 3KVQA 3SDAA 4MAYC 4PIRF 3MRIA 4IRJC 2BSRB 5GGTL 4DKFH 4LVHB 1RZFH 2MQCA 4Y2DD 5FYJH 4W68A 3MV11 5ADPH 4MLIA 5JW4M 3H7LA 3T8XB 1MFAH 3NFSL 4F7PA 3JXAA 1NMCC 3PDDA 2I60L 2FSEA 3DGGB 5BV7C 4NGHH 4KI5E 4HH9B 4MQXD 1U8LB 3BEVA 2JJTC 1X5AA 4FG6D 5ICXB 2OZ4H 2P44B 3WFHB 1IEBA 3SDDD 2A73A 1I7RB 3AREA 1HYSC 1WTGT 1ZLWH 1EAJA 2V5RA 2AV1B 2R0LL 2EIDA 3DO3A 1N26A 3KPNB 3MRKA 1X5GA 3BDYH 4OZIF 3OF6D 3IXAB 5I76A 5HHQB 5CLWA 1EEUA 1B4JH 4LRNH 4S11A 4G3YH 4LCIH 3TT1H 1CE6A 4J3XA 3BQUC 4G80A 1TZGH 3BKJL 1QPXA 2OJZL 5F7LB 1NBQA 3EOAA 1OAKL 3WXWL 4PUBH 4O9HL 2DQHL 3S88L 2DF3A 4YHNB 4JN1L 4I4WB 4AT6B 4E41E 5B3JE 4ZSOB 4KK6D 1VEMA 3FQTA 3UP1A 4BH8B 2DQTL 3U7YL 3TLRA 2A0LD 4P2QD 1JWUB 4LCWB 5FECB 3FFDB 3QDHA 1OTTD 2JIXA 2BNRE 3D3VB 3O2WH 1NC2D 2VDPL 4QRUA 3X14B 5CUSH 3KPOB 2ERJC 3BEWB 5TGBB 2XKSA 4HJJL 1EHLH 1YEGL 4J12A 5CEXA 2Q86B 2VJXA 1I4FA 3OGCA 3VH8A 1XF4A 5IMLA 2OR9L 3EYFB 3C6LD 5FO7A 4GW4B 1FZJB 4KXZH 3REVB 1RZKL 4JFFA 4JDZB 4H5SA 3QI9C 5D7IE 2X4NB 3TBWA 5BVJA 5EZJB 3EDFA 2WBJB 5D96C 2VITA 2BHUA 2DN7A 3UXFA 3V2AR 1B0GA 2BNQD 1DBJH 1CL7L 4R97B 3LN4A 4YEFA 3L5WA 4N0YH 3SE9L 2AEQH 2PCPB 5F88B 1MOEA 3ORJA 3VXRD 4K7PY 4X7TB 4G6KH 1AO7E 3BPCB 3VD7A 1JNLL 1FFRA 2H3NB 4Z7VA 1P4IH 1A3LL 2C3VA 5GRZA 1OCWH 1GRWA 2FEEL 4KJPC 3QFDA 3O6LL 4IRJB 2RGSA 3GJFB 4U1HA 4P23B 1SY6A 4W4NA 3IAQA 1G6VK 1S7SB 3MV9A 3ZDZF 1FL5A 1TZHA 3ILQD 3QUZC 2MCG1 4YHZH 4NCC1 5E1AA 3E0GA 3UC0L 2Z35B 3S37H 5B8CC 3DNKA 3VRJA 4TUKH 5I1LA 1L7IL 4GG6F 3JSSA 1DDHA 3TBVA 2NY1B 3BQUA 3GSNB 3NCBB 3GMPA 5FYJD 1K2DB 3GMPB 2FX9H 1RZJC 2AP2A 3LS5L 3HZMA 4RGNC 4QRTB 5C07A 5ITBL 5E8EA 4Z7QF 4NHCL 1ZEAL 3CFBA 4ENEC 3VXQB 4X4ZA 5IJKA 1TCMA 2EYRA 5BOZG 3LKSA 2YPVL 3FT4B 1UVQA 1EEYA 1L6XA 3GJEA 3V4PH 4ZMAT 2AV7A 5EBGA 1FL5B 1TZHB 4LNVA 3LMJL 2CPCA 5DUPL 4P23A 3UJIH 1EEZA 1KB5H 3HR5A 4N90E 4P2YA 4LVEA 1GGCL 2C3VB 1T1WB 3SDCB 4F7TB 3BP7A 35C8L 2A77H 4IMLA 4TNVK 4XC3H 3L3IB 5I1DA 3MRLA 5L6YH 4ZFGL 1PQZB 3U2SA 4FFVC 3VGHA 3L3GB 1LNUA 2A9ML 2FD6L 4HG4J 1GXEA 2PXYD 3SJVB 3BP6B 4XTRC 4M61B 1FZOA 1K8DB 3QHZL 5HYEA 4FFYL 3T77B 1UT9A 3LB6D 4BZYA 2Q76A 2X70B 3MR9A 1MCRA 4DFIA 4Z7NE 2YMXL 3LKPB 3V6OA 3B83A 1C5BH 3LZFH 4JR9H 4NKIL 3X11A 3BOVA 4X6CA 4H20H 4BUHA 3TGXA 3IFOB 4WW2B 5CEXB 3IKKA 2FLRT 3DROA 8FABB 4U1SA 1C5DB 3MBXH 1Q0XH 3FRUB 5CEYB 3TBTA 3QNYB 4CKVX 2OJEA 1HOCB 1QZ1A 4PRIE 2EC9T 1DEDA 1HHKB 5C0AB 1FVEA 2Z8WC 5I8EB 2A6JB 5CEZL 4WWKC 4DK6A 1SJXA 4M62H 2BVOB 2D31B 2VISB 4UT6L 1KPRB 2P46B 4JLRB 1LE9A 1W0WA 1JPTH 5DFTA 3BYTA 4PRDA 5CJQL 1T0MB 2NY1C 2QADB 3WDHA 1NAMB 3VFOB 1Z3GL 4KRMB 3UTSD 4AH2A 4X6BB 4GRWF 1U8HA 5IEHA 3QNZA 3PV7A 5DJAA 3IXAA 5I76B 4LLWA 1CFNB 5E2JA 3KR3L 4S1DD 5FA3A 4L8SC 5IFJA 1FHGA 1RZKH 4P23C 4HJ0D 3ZKND 1L0XA 4V1DE 2L7UA 1NUGA 3AREB 5E5MA 2VL4A 5EUOF 4CJ0A 1A0QH 2HT2C 3CSYB 4YR6B 2JELL 2C9AA 2QKIA 4QXWA 4RMRA 5FUOL 3BEVB 3NACL 1SJEB 32C2A 4X6EA 5IVZB 4KKBD 1RZ8B 3IF1A 1EEQA 2EIEA 4LSVL 4CMHC 1R3KA 4NNXB 5D2NE 4YFLF 1A6UH 1UM5L 4R7NB 2BSTB 3VXNB 5I74C 1WF5A 1IAIM 1KJ3H 3AM8A 4K8RL 1UJ3C 3MPCA 4X5XB 1WAAA 1R3JA 5HGDB 2BSRA 1IFHH 4F9PC 2Y07H 4HLZH 2RR3A 5DUMH 2KQNA 2GK0A 3WHXA 2YD1A 1DEEA 5C86A 2DB8A 2C3GA 2A74B 3K8MA 4QHNA 5I9QB 4HHAB 4J8RA 1SEQH 1VPOL 2ZSVA 1KTRL 2A2QT 3JV4A 1HH9A 5FUOH 1QQDA 3VI4E 3RY6C 4G6JH 3A6BH 1DANT 1HSBA 3S5LB 5DK2B 3P30L 3TCLA 5KSUA 4TRPH 3V79C 4JFEA 5HGHA 5AG8A 4GKNB 4RMQA 3C87A 5CD3B 2VLMD 3BX7C 1X5YA 1F13A 5IMKB 5D6CA 4GKZB 5TH2A 2APBA 3SOBL 4YDJA 4ZUVB 3RVXD 1FFOA 4BSWB 5EZIL 1A4JA 4KUZL 1Q9WB 1U8IA 2YPLB 3HUJA 3Q3GA 2B4CC 4HGMA 1LD9B 4LIQL 3HZVB 4HH8A 4JGJA 1IZJA 2DKUA 1YEIL 2AJYL 3W11D 2XKNA 4RQQB 4HBCL 1BQHA 3S3JA 3VWKA 1KB9J 1Y0LA 2VZSA 5FM8A 4YIQB 4P2OD 3HG1E 4XCNA 3MNZA 5KVFH 3MXVL 1Z0MA 4IMKA 1FRGH 4X4XA 3IDGA 2NR6D 2YD6A 5E4EB 4WU7A 1PG7W 4OGYL 4HIIB 4OZHE 4CNIA 1XAUA 4ONGH 5JPMA 2GFBA 3MJGX 3HFMH 1FQ9C 1HNFA 1MQ8A 3U4BH 1CE1H 4PJBF 2IPTL 3RWDB 5HHOD 3U4EA 1LK2B 3TA3C 4FZEL 3K8KA 4Q6IC 1LILA 4PFEA 1FFNB 1ZT4B 3ARYA 1FFPB 1FVCB 3ZHKA 1OGAB 3LMJH 4PREA 3DXAE 4AEIH 1KIRB 3U4EB 3AM8C 3P0VL 4OM1L 5BS0A 5JOPE 3IGAA 3MRDB 5AYUL 2CDFA 4P2RA 3QO1A 4NKMB 2O5ZH 2OL3B 4Y4FD 1NUDA 2J5LB 3IRPX 5DQ9B 2IH3A 2XG4A 5AWNH 3X13B 3LQAL 5EULV 4KKLD 1ZLVK 2Q3AA 3RA7L 5GGSB 3LDBC 2VZTA 3IFNL 1ZLVH 5D2LA 4NOFA 2EDQA 2M2DA 1HWGB 5IB1A 5JORB 3DSNA 3UX9B 5T1LA 2ADGB 1X5IA 1MJUH 1P7KA 3FT2A 1KF9B 3OKMA 1BAFL 5CWSB 4HUVA 4Q7DA 3FQNA 3QAZB 4N0CC 4R2GB 1Q9WA 1U8IB 2YPLA 3HUJB 1RUQH 2GTZA 3H6JA 4ZPVB 4TNVF 3JTSA 3SE8H 1IC5L 1PLGH 3ARED 4UI2A 3DVNB 4MJIE 1WWCA 2ZKHL 2GTWB 4OKVA 4U6HB 2XICA 4B7IA 1N8ZB 4NFBA 5B3NA 2NW2B 5SV4A 4RX4D 2C26A 3UTZB 3WN5C 1YNLH 4AIZA 3HC4H 4U4BA 4Z7NF 5IOPA 2E7BA 5JUEH 2Y5TA 2ZJSL 4RMTA 1IM9D 2LU7A 4LKCA 4OV5B 4Y16A 5I8OL 2V5SA 1SBSL 4XXDA 1P2CB 5LJYH 1VGKB 3VXOB 3RVUD 3TIEA 3AB0C 2DBLL 3U0WH 4N0CD 1KNOA 5GRYA 2A74A 4QYOB 3VD4A 1J0JA 3H0TB 1N64L 1MFBL 3WNNA 4PRBA 4QNPE 3FQWB 4PJ8C 4OQ1A 1MCDA 1G9EA 4HZAA 1NCBL 4LSDA 4G9FB 5DRZA 2GAZA 4XPAH 3ZKMD 4Z7WB 1LO5B 2YHGA 1RU9H 4N1HB 3QHZH 4GW1A 2R1XB 3PDOB 3VCLA 1LEGB 3NGBB 3L5HA 4F3FB 5BRZB 1SYVB 3VWKD 3HE7A 2H41A 2ZUYA 5T3ZD 2E7HA 4GFTB 4MDIB 3GIZH 1S9KC 1H15A 2QQKH 4HKZA 5T1KB 3W5NA 1VACA 2YXMA 4WI6A 4XGZA 1H15B 4XRCA 2OMNA 3LPFA 3SY0A 1T3FB 1NCAH 1CFNA 3HNTL 5BRZA 4WFGD 3DRQB 4LKXB 1HHJB 3UMTA 1QLRA 3LSOB 4PB9H 4OBSA 3U83A 3VCLB 2AERT 3TC9A 2D7OA 1J0YA 1CFBA 4M43L 4XVSL 1CD8A 3IDMB 2GK2A 3MRGB 1PX4A 4FXKA 5CBAA 5FYJU 4J1UA 4PG2C 4P9HL 4N9GB 4RNRA 1ZHKA 5AAWA 5C0RH 4L9LA 1KNOB 4WFHD 2DQTH 4YAQB 1H3XA 1X5FA 5MI0B 2DQUL 3QDJA 4LHQB 2P5WD 3I2CH 3M17A 3S96B 3DX6A 4GXVL 3QJHB 3ILQC 5F97E 3VGGA 2W91A 1FDLH 3IS1X 2MKLC 3FO2A 3E8UL 4HCRL 4Z78B 5C0BA 2NNAA 2P7TB 2IBGA 1QUNA 2FBJL 3OGOE 1R24B 1FO0A 4WU5B 1T0NA 5AG9A 3VFTB 2CDGB 4G3YL 1MCIA 3R8QA 4U1MB 4MDJB 5C09B 3TJHC 2H1PL 2DYPA 2GCYA 3K80A 3GSQB 4DK3A 4X6CB 3BKCL 4L4VD 1TMCB 3MGOA 4LQFL 3X11B 2VDQH 1PY9A 3MRBA 2J8UE 4OCWL 1PY4A 4LQFH 2WWKT 4LVHC 4LPCA 5HD8D 4HKXA 5A2FA 4I9WD 3L7FB 3AAZB 3HG1D 4POYA 4RX4A 1KCSH 1MCNA 1M6OA 4PP1C 5FB8A 4G43A 3UYPA 4DWHA 3ULSB 2ESVA 3O8XC 1CFVH 1DE4B 3DJ9A 2O26U 3RWJB 3PP4L 3MUGA 3BRGC 1OD7A 4R90L 2X10A 2MSPA 3KJ6L 4R90H 3MRPB 3FB6A 3O4OB 2WUCL 4L8CA 2WM0A 2XXCB 2AJYH 1RUAL 2R0KH 4JM2A 4QCIA 5T3XL 5BS0B 4W81A 5IT2H 1U8QA 4OD1L 1KIRA 5D7LD 1G7HB 4EI5C 4DOHB 1UVQB 3HNSL 4LHUD 3VXUD 4ERSH 4ZFOL 2W59A 5IBLD 1OM3H 4K3GA 1ZA6A 1CGVA 3BJ91 2MHAA 4U1NA 5C07B 1A6VH 4NZTL 3PP3H 4HMCA 5EA0H 5E2VH 3CFCH 5EOTB 1MIEH 1PYWB 1Q9LB 1X5ZA 4Y5VB 2FATH 1KT2B 5DWUH 1KLUA 3SE9H 5CSZA 1QBAA 5DVOA 3GSNA 4WFEE 3ZHDA 1GGBH 2BMKB 1HHGA 4PYGA 5DJYA 3DX8B 5E2VL 3VMNA 3ARUA 1EO8L 2PR4H 2FX7L 4K9EH 1ZVSA 4LFHG 5DUPH 3IDXH 2QL1A 5C6TL 4QLRA 3U0PA 4WNQA 4NUGL 4YIQA 5FDWA 1U8JA 2Z92A 1XZ0A 5E9DE 2BNQB 1ETZB 5GGTA 3MGTB 4AQOA 4PV9B 1A5FH 3VWKB 5EC1A 1P53A 4QRPA 3LEXB 1A7OL 1VESA 3CSPA 5DC0A 3TP4A 2LABA 3GO1H 3QXVA 2ADIA 1T1ZA 5ISZB 5DVKA 1ZLUK 1B0GB 3BD3A 4G8EB 1X7QB 4XP6L 2CK0H 1DUZB 5INCA 4HIEB 2AEWA 3PHOB 3S5LA 1KTDA 3AAZA 4KJWC 5E8DL 3IU4L 2FX7H 5FO7B 1YZZA 2E8ZA 3KJ4C 1MELA 1H8OA 4Y1AA 3T0XA 1J1PH 2O61B 4UQ3A 5L2KA 4C56E 2AXFA 4MDJA 1HHIB 3VI3F 3FT3A 2CJUH 2R2CA 1R24A 4WU5A 4HXAH 5HHXH 4IOFD 1MVUA 3MRNA 3D3VA 5F8QC 1P9MC 4ZUTA 3E6HB 5GS3A 1U3ZA 3EFDL 4MWFB 3PUCA 1N4XL 3QQ9C 5JW4N 4LPVA 1HXYB 4PJ7B 3ZZ1A 4FQIH 5C7XL 1S5IH 3MLWL 5JA8B 5H94A 5DHVB 4Y4HC 2YRLA 1MFEH 3L95A 4LSRH 4XNQA 1MFBH 1M7XA 3OKOB 2UVFA 3OAYK 4XBGA 4RIRA 3CSYA 2HYMA 5C0EB 3ARFC 1L0QA 3GMQB 1IRAY 3OB0H 1MJJA 4GAGH 2NY6D 3ZMRA 4UIKL 5IWLC 3VXTB 5CBEB 4IM8A 5C0CB 4OLUL 3S6CA 5GGUB 3QIUD 4Z95L 1QFWL 1CT8A 4XMLL 4ZNEA 1UH3A 1C5CH 5IBTH 3DTXA 2BY2A 5DJAB 2AK1L 3SO3C 2XN9A 3W5MA 1Y6NR 3CXHJ 1IC5H 1PLGL 5EU5B 4JFPA 3S97C 1MPAH 1AQDA 5J8OA 3P9LB 4EN3A 2DD8H 3VFUA 4XBGB 4YHLH 4Y5VC 1KPUA 2YD3A 4Z7UF 1I8LA 4ZFZA 2DWDA 1W72A 3INUH 3SKNA 3X3GL 3VWJD 3GM8A 5CMAA 1RUMH 3QUZB 5F3BA 3ET9F 3MV7A 4LHJB 4X7SH 4AQ1B 3WLWC 2LAGB 5EN2B 2ITDB 1NQBA 4U0RC 1IEAA 2R2EB 2HWZL 4RA0C 4Z7WA 4YXKL 4NHUB 4G9FA 3TZVB 3KS0J 4X4YB 4WDIA 3FRPA 1OM3L 1EHXA 4XPAL 4F80A 1GOGA 3H42L 3GFUA 3WXVH 1WEJH 4WW2A 2B2XH 4J3WA 4ODHL 4ONFH 4Z6AT 3O8XB 3MV8E 4BZ2H 4KRNA 1XF2B 4NN6C 4LPYA 2G9HA 1B9ZA 2LU4A 2GI7A 5LKNA 5ESAB 4JG1H 3UPAA 5EBMB 4OQTA 1IZKA 2GTZB 1FYTE 1XCQB 2CKNA 4F7EA 1I9JL 4IMLB 3NN8A 3TA3D 3VXRB 3WNKA 5ABDE 4LNRB 2ZUTA 2CXGA 4G5ZL 3QIWB 2Z9TA 2AK4E 2VLKA 3QUYC 2EXWD 2NZ9C 3GJEB 5DF0A 1FC1A 3NAAL 1L9MA 5DJYB 4FQJL 3HNVH 4Y5XC 3ZT7A 1KG0A 1W0VB 1BECA 3CFJA 2F5AL 3FN3A 5EU3A 4NQXB 5TE4L 1DQDH 3B8SA 4P2RB 5HDOA 2QEJA 3U1SL 3D48R 5IB2A 3TVMD 3EDDA 2B20A 5I6XB 4JRXB 4DCQB 5F9JB 2EE6A 3UJJL 4O58L 5HVFB 5I1LB 4I2XE 4U1NB 1OL0A 3UJJH 5KTEH 3DUUB 4XP5H 5D7JB 2P5EB 2K9UA 4OZIE 2HFTA 4CVUA 1PZ5B 4JKMA 3VGEA 5F9JA 1OAZL 2D4DA 3W0WB 1INQB 3MV9B 1NC4D 3GSRA 2VAJA 4KMLB 4HPOH 4X6DB 4F7MB 1H8SA 5GRVL 2IGFH 1Q9KB 4L4JA 1G9NH 1IQWL 1G7QB 1VFOA 2BNQE 4R2GD 1BD2E 3HMWH 4F8TA 5FUZL 5C3LD 3IDGB 4OI7A 3CH1B 4XCNB 2XWBB 2HJKA 4D0CA 2Z8RA 1IAKB 2XZZA 2P4AB 3PWVB 1MNUH 4ORGB 5SWZB 5JW4R 4KK9C 3TCXA 4HKXB 3S3PA 3GNMH 1AJ7H 5JHDB 4FTVE 3QQ4B 4HPYH 3W81A 3OGCB 3MLSL 2HFEB 2DYPB 3SCMB 4FQCL 1N5YL 3O41A 3M8OL 3SCMD 5SWSD 1SEBB 3BAEH 4I18A 1XT5A 1IGYB 1T2JA 25C8H 4QRUB 3X14A 4A2MA 3C6LA 2DM7A 4JO3L 4IIQA 4HPYL 5T5NG 5J4MA 2E9BA 2BY1A 2VXSL 5MEQB 2A9NH 4YHOL 2HRLA 2J8UA 1ZA3A 3CZFA 4FZ8L 2DLHA 4HMDA 1BJ1H 1AGFB 3MJ9A 1OP5K 1RURL 1YNTA 1LO0L 2QLVB 4APQA 4JFDB 4OLZL 1UQSB 2BVUA 3L1OH 3F5WB 4U6XB 4YHNA 3LCYA 4YE4L 2P8LB 5L8KB 4WGWB 3SGKA 1MEXH 5D5MF 1J88A 4MXWL 4J1UB 1CE6B 4WV1C 3UJIL 4EOWH 4HUXA 4HLZG 5IB4B 4OIIL 2DL2A 2BSTA 1KELL 2ICEB 5DD0L 3L1OL 4POUB 1HHJA 2IF7A 4Z7OF 1R3KB 3BKMH 4D0DB 5GSRA 5IVZA 3MRKB 3KPNA 4GBXC 1A6AB 1OTUD 4X4ME 3GSOB 2AV1A 5CZXC 3KXFD 3OAUL 4HF5L 1EZVX 2AQ3A 3MYJA 4JFPB 5C0CD 5HDBE 4M48H 4UIKH 4YHLL 1IEBB 2EDFA 2O5YL 4GG8B 2XN9E 4M6ML 3TH4T 5IFJB 4XPTL 4HK0A 4UILH 2X9YA 3KPQA 1ITCA 3L3OB 2D4FA 4UILL 4HG4K 2XWJA 2CMRL 3ARSA 3CK0L 3KPRE 2NZIA 2AK1H 2ICEA 5IW3A 2Q20A 4JQXA 5F71A 5C0CA 1VFMA 1YJDL 3ROOA 3T2NH 3BKCH 4LSRL 5B4MD 1UYWH 3S35H 4CGTA 4W4OA 1QSEA 4G6KL 3U9UB 3H42H 3H0TA 1INDH 1RZ7H 3PWLA 4LAQL 4HWZA 4U1LB 5H94B 3IDYC 1FVEB 2APXA 5I8EA 4MQXC 3MCLH 2DM4A 3TNNA 2G5BA 1HXYA 4PJ7A 4IDJL 1G7MB 1E6OH 4Y5YB 4D3CL 5J1TC 2HJLB 3RZCB 4M9OA 2M26A 2ZOLA 1S7WA 1JI1A 3KXFA 4TOYL 3DRTB 1EXUA 3DI2B 4AG4H 3O3AA 5D7IF 1HHIA 4DN3L 4J3SA 2VC2H 4W6YB 4OCYH 2AXFB 3NMEA 1F02I 1T20A 4TQEL 2VMFA 3MUJA 1B0RA 3KPRD 4BZ2L 2OYPA 2UZXB 2HMID 2DQJH 3WFDH 3QO0A 4C56D 2I9TB 4N0FB 1L0YA 2F53A 5DJ2B 4JM4H 2ADGA 3MC0A 5SWZA 3SBWC 1S7QB 5CZVH 5HDLA 5DVNA 3MQIA 4PPTA 5ALBL 2GY7B 1G9NC 3UTTA 2CLZB 3PIQB 1GOFA 5LBSL 3CH1A 4CMHB 1T7VA 1X4YA 3C5ZC 3FQRB 3IAPA 1A1MA 1Q72H 4H26B 1MWAA 3KPMB 1NANI 4P3DA 5IGXL 4ZTPH 3SN6N 3SDCA 4F7TA 5F9WC 4KHTH 2QSCL 5A2KH 4N5ED 1VFAA 3ZHLA 4K3JH 2CDFB 1EMTH 1T7YA 2Z92B 3LKRB 3U0PB 2FATL 5C6PB 2CUIA 3P9WB 3TIDB 1ZVSB 4JFXB 1DCLA 3LKSB 3MJ7B 3DX8A 1RIVL 1CICD 3HZYB 1R5VA 2PW1B 4U3XA 4JRXA 1TFHA 4MS8C 4I3GA 3H9YA 4OFIA 5F3HB 1HQRB 5FYKL 4EN3C 5IR1B 4NO0D 3QDME 3QI9D 5JPMB 1GGBL 4XPBH 3UBXI 4OUUB 2Z35A 4ZTPL 3MRFB 4JN2A 4NPYB 4XPHH 4YHIB 3BH9A