3TYGH

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt128 in complex with a glycosylated engineered gp120 outer domain with miniv3 (eodmv3)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
234
Chain Sequence
b'EPQLQESGPTLVEASETLSLTCAVSGDSTAACNSFWGWVRQPPGKGLEWVGSLSHCASYWNRGWTYHNPSLKSRLTLALDTPKNLVFLKLNSVTAADTATYYCARFGGEVLRYTDWPKPAWVDLWGRGTLVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system, viral protein
total genus 32
structure length 234
sequence length 236
ec nomenclature
pdb deposition date 2011-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygH01
4XMKH 1PZ5A 4HIXH 4TQEH 1ZS8A 3VXRA 4HWBL 3AB0C 4S1RL 4HHAB 3MV7D 1KLGB 3C8KA 3KJ4C 3WEXB 2ED9A 4KHXH 1NCDL 1F58L 1AKJB 1IKFH 3G6AB 4G8IB 3KPMB 3UTSE 2X4UB 3RWEB 3SQOH 3U30C 1JPTL 4JDZA 3EGSA 5D7SL 1AGBB 1C5BH 1FGNH 4ZDHB 3GMNA 5CKGA 1NCUA 4KK8D 4IOFD 4X8JA 4YNYA 3I6LE 3MLXL 1AR1C 3B6SA 5E56A 1ZT7B 2DYPA 1NC2A 3LKQA 3LCYA 5HJ3B 4PJCE 5SX5K 1HZHH 2W0FA 1AR2A 3V4PL 3RUGE 1N6QL 1URLA 5FA3A 1XR8B 4OCNC 3QUZB 2FD6L 4GRWE 2VXVH 3IU3A 5J11C 2P5EB 4YGVB 3EO9L 1I7TB 3AC0A 3SPVA 5C09E 1FV1B 3BEWB 1XIWA 3S88H 2Z31D 2GITB 3MNVB 4NRXA 1IAOB 1J1PL 2NY6D 2NY3B 2CGRL 3RY6C 2EYTB 1G7HB 3TBTA 5AG9A 3FJTA 2XTJC 2EYRA 4XAKE 3ZT7A 5I17B 4PG9B 5DTFB 3K4DA 3G04A 1WQVT 1CFTA 3GGWA 5IQ7L 3O11A 4KQ4H 5F1NB 5GGQH 5C8JA 4OZIA 5HYEA 2NY4C 1JRHL 3QG7L 5ALCH 1OQOA 3FO9A 4MCYB 4AQOA 4MD0A 4DCQA 1L7TH 4OV5B 3S97C 3GUTA 4N0YL 3G08B 3GJEA 2ENYA 2FEDC 3RWHA 4UOJA 1FNEA 2MFNA 2X4PA 4GXVH 5FYJD 2EH7L 4DN4H 4MA1C 1DBAH 5DMGC 4AL8L 2WIIA 1F2XK 2A9MH 3RKDD 2VDOL 3SHSA 1MCKA 1EGJL 4ETYA 3S36X 1JRHI 1U0QA 4GAFB 2X4RB 3PWLA 2WBKA 4ODTL 4PJBA 4QTHB 1A6WL 2W9LA 5MERB 3I6KA 4JJ5B 2AJYH 4HG4K 1CGWA 4QF1B 1A4JA 5E6IA 3TIEB 5C0GB 1BIHA 1R3HA 5I74C 4XPTL 5FIEA 3MA9L 3OKEA 4KQ3L 4MQ7B 5EZJA 2FHCA 2FX9H 2VIRA 7FABH 1O7SA 3SO5A 4NCC1 2D0HA 3BDYH 5DJAA 3ARFA 3WD5H 1MCOH 3WIIL 2EXWC 4KI5E 3QWOA 4MHHG 2NY0B 4NUGH 4YR6B 1MAML 5TFSL 4ZUUA 3BKJH 4AEIL 5J13B 5FO7B 3GSQB 4KU1A 5F8RC 1XGQA 4FG6C 3OXRB 5DC4B 5T3XE 3X14A 1R0AL 1KEML 4NHCL 3C5ZC 2Z4QB 4HUXA 4GG6B 2BNQA 5T3XL 1DQDH 3IDGB 3U7WH 1CK0L 2WUCH 5D1QA 1MHHB 4P2OD 4DKAA 4QXTB 2IAMC 4XXDB 2FJHB 15C8L 3PF2A 1VA9A 4PPTA 4U49A 3ARDA 2EC9T 2BMKA 3ULUF 2G5BB 4RAHA 3CVIH 4ZMAT 3U4BH 4ZXBC 4QRRA 2DF3A 2ZOLA 3K7UA 4EOWL 5FUZL 5C08E 1I9EA 1GC1H 4WI8A 5FCSH 2CSPA 4U1JA 2H8PA 1XR9B 4NYLA 3KPNB 4OZHF 3H3BC 3MBEC 1T7ZA 3QA3A 1KULA 4NO5A 2NZIA 1HINL 2WBWB 2E27H 4QHLA 3D85D 1DQMH 2P48B 2XN9B 3WFDL 1YNTB 5D71L 2V6HA 1T0PB 3MPCA 3PWPE 4JFEB 1A6ZA 1UXWA 1RPQA 2H32A 3TP4A 3F58L 5GS1C 3JTTB 1E6OH 2VDKL 4QNPF 2EDLA 1V3KA 1JI1A 2EKSB 3T3MF 2A0LD 3CCHA 1RZFL 1TTGA 4MZ2A 1DVFC 5EIQA 3O2DL 2AXFA 4X9GA 3U36A 4PTUB 5MI0B 4LCWA 1PKQE 1WZ1L 4NQCD 4KJQC 3H0TA 1AFVH 3SDDB 4JO4L 3MA7B 2HFGH 1TMCB 2DMKA 3HLAA 3OBAA 2IBZY 1T7YA 4NBYB 5FHAH 3TC9A 1TJHL 4F7TB 1NKOA 2AERT 4A6YH 4DZBA 4JM4L 3VXOB 3MV01 2VXSH 5F8QC 5HYJE 4K71B 1M7IB 3BRDA 3IKCB 2ORBH 4I5BA 4ZS7L 3D39D 1P2CA 3FT3A 3OG4B 4NM8L 1MCRA 4TUJA 2DIJA 1ULVA 5DD6B 1ZLVK 5DI8A 2JF1A 4HPYH 1R3IH 1RHFA 2W38A 3SGEH 4MNHA 1NGZB 3MBXH 4J7RA 4F7EA 2PR4H 4RSVA 3OKKA 4G7YH 3RVWC 4EN3C 1A6PA 2VLKB 1A1NA 5LAXA 5K9JH 2OTPA 4OZFH 4LCIL 4EKXA 1X5ZA 1YDPA 1S7TA 4OUOA 3N1FC 3W39B 4QHMB 5MEPB 2NQCA 3AROA 3LN4A 4OD3L 5F7LB 4L4TD 1QFWM 1N7ML 1YEKH 4L29B 3LZFH 1M7DA 4O9HL 1WCBA 3RY5A 3H2WA 4U1MA 4XNXH 5GGRA 3UJJH 1R5VA 3W5MA 4CVXB 1XH3B 4OFYA 3O6LH 5FA4B 4UI2A 3KLSA 4EDXA 4N9GA 4HWZB 5FXCH 3PGFH 3VG9C 3ES6B 2K9UA 3CGTA 1KCRL 2HT3C 4U1GB 2BHYA 3NZ8B 4QHNA 2VR5A 2DICA 3K4ZA 2NXYB 1NFDA 1BQLL 4JFDB 3HC4H 1EAPA 2ID5A 1A6TB 2AJXL 3V6BR 3SE9H 4BZ1L 2IH3A 5F96L 3BWAA 3G5VB 3MGAA 2IC2A 3VFMB 4CMHB 4FP8L 1QSEB 2H9GA 2A38A 3L3HA 4XVJL 3V0VB 5F97E 4P46A 3IFPB 3FFCB 2JB5L 3QXAA 1N2RB 1RZ8A 4IOIA 5EBWA 4P23D 2ZSVB 2XPGA 4LCCA 5I2IA 4OSUL 2F19L 3K8MA 2XRAH 2FHBA 3G5ZA 1CBVH 5MEND 3P2TA 4Z0BL 2CRYA 3PL6A 3R0NA 2DQHL 3QDMD 2A6IB 1OVZA 4Y4KD 4IRJA 3KPRE 4QHKJ 4L9DA 5HVHB 5GSRA 3BRFA 3W2DL 1MREL 4HWBH 4S1RH 2FRGP 1P7KB 4LVHB 1MJ7L 5DUBA 1GOHA 4JRXA 2GSIB 1OGAB 4ZG1A 1NCDH 3LVEA 1F58H 4PP2A 3QRGL 5EFIA 5ESVA 5CJBA 3FN3A 4CVZA 4OD2A 1JPTH 3MV9D 5B8CC 4O4YL 5B38B 5D7SH 1YA5A 3QEQB 2GJ6B 4PJDE 5ETUA 1VFBB 1JWSB 5DD1L 3QIWA 2X89A 1F00I 3QB7C 3MLXH 5DQ9B 3LKPB 1D7FA 2Q3AA 4PJHE 1P7HL 5J12C 3HHRB 1JHTA 3P0YL 4QTIL 4WNQB 2VLJA 1N6QH 1QO3A 4HS6B 5C6WH 5JOEA 1QBML 5SWSB 2FD6H 2ZG1A 1UGNA 2Z93A 4JG1L 2VL5B 3EO9H 2PCPA 5C0CB 3CX5J 2OSLB 1J1PH 2Q8BL 5L8KB 1I3VA 2CGRH 3ARBA 4GRWH 5F7EL 3RUGF 2ESVA 5KVFL 1YZZA 5C0EB 5CAYB 4GRWF 4LNRA 3KHQA 1NC4D 5SWZD 1YNLL 1JMXA 1KIQA 4M6OH 2BFVL 2X1OA 4PV9A 3QFJA 3SKMA 3MGTB 5F9OL 1ONQA 4P5TC 2EYSA 2ATKB 1FPTL 1I7ZB 2NTSP 4N90D 5M7QA 1OF2B 4GBXB 3DOSA 5BVJA 3JUYA 1TNMA 1KCVL 5IQ7H 4WEMB 1HXYB 5GHWL 3DARA 3QG7H 1JRHH 5GQBA 4LLYB 2V2WA 3GB7B 4UU9B 4N0YH 5IHUL 3PHQB 3P11L 2YPKB 4G42B 4F33B 4RAVA 1VFOA 4QWWC 5E5UB 1HQRB 5C07A 2E6PA 2EH7H 3O3EB 4AL8H 1T1XA 4HWEL 4M5YH 2VDOH 1AJ7L 4P2CG 1EGJH 1ZHLB 5IB5A 4I3GA 2GK2A 5CZKA 3QDGD 2A73B 5IFJB 4ODTH 4XBPA 1A6WH 2BVUA 5GISL 2VAAA 3VXNB 1K3IA 1SJHB 4GW4A 5E24E 3TZVB 3S9DB 4L8SC 5DJZB 5DFVC 2ERJC 4XPTH 5HY9A 2UWEB 3MA9H 2VZVA 2ITDB 2GQHA 4WFHE 1F45A 4OCRL 4YHKL 4I18B 3VMNA 2HTLD 4O58L 4JFFB 4Z7VE 5EO9B 5TQ2H 5IMLB 1EHXA 3WIIH 5E8PA 4NJAL 3AXLB 3TA3A 4EVNA 1TQBB 3BGMA 1AXSB 1BJ1H 1MAMH 3S37L 2YC1B 4QRTB 2OI9B 2R23A 4AEIH 2RAMA 3UTSD 3HE7A 5D2NC 4LCYA 4B7IA 1R0AH 4M48L 1KEMH 4NHCH 5EO0A 5BRZE 5JPNB 9CGTA 5F7YC 1CVSC 4QRQA 4IEFB 2VXTL 1GRWA 1PBYA 5T3XH 3ZKMC 1CK0H 3I6LD 4GXUM 1T1WB 3MRIA 3QIBC 15C8H 4NZTL 2VC2L 1HILB 3DRQA 3K8LA 4RX4A 4Z5RA 5T33L 4PJ9D 4IOFC 4YBQD 1W0VA 3UYRL 3LKRA 2ICWA 1JHKL 3VXSE 1VGKB 4OZ4A 4PYHA 4F37F 1TVHB 2J6EA 3HE6C 3ULSB 4EOWH 1YN6A 2Z35B 1FG2A 5C09D 2I9LB 4GW1A 4XXCA 1TDQA 5EC2B 4JRYA 5CWSB 3AM8A 3FONB 1TPXC 1X3DA 4J1UB 1KIPA 3WFDH 4YK4C 2Z31C 3F7QA 3J7HA 4ZFOL 4XAKD 4QYOB 2BVPA 3O41B 2NY6C 4MXWL 4F37K 5JDSA 1WTGT 2HAZA 3F58H 2FHFA 2HLAB 5ESQB 2VDKH 3NFSL 5DHVH 5TDPB 1RD6A 3QUXB 1AGCB 4ZO7A 4F58L 1OW0C 1SMOA 2EDFA 1CZ8L 3P77B 4JZNB 5C0BB 1RZFH 3SJVA 3L5HA 3M07A 3LQAC 4W6YB 3O2DH 5SX4I 3MFFB 2QSVA 4IS6A 3V79C 1WZ1H 1AO7D 4UQ3A 4JM2D 4UTBL 1NGWA 4JO4H 5CJXC 3KPPA 2JKXA 1MY7A 2YPLE 1UYWL 3MRBA 1IM3A 1TJHH 1TLKA 4F15C 1N3NB 3RZCD 1YY9D 4JM4H 1EEZB 2MCPH 2YWYA 3QO0B 1AGEA 1T22A 4XNMB 3I75A 2FCBA 3CD4A 4JHWL 4FQJL 4C56E 1CG9A 4NM8H 1KT2B 1UZ8B 3G6JB 1FRGL 1XZ0A 1D5BA 3RGVA 4R8WL 2NW3A 5DRWA 5KSAB 3RTQD 1QP1A 2ZNWA 3EYQC 4GAYA 4LSVL 3EBAA 3ARZA 2H26B 3SDXE 4JDVB 5E2WL 4XAWL 4KI5D 1IAMA 4LCIH 3CFCL 5EU7C 2VITB 3BAEL 3NCMA 4HGMA 4CN6A 5I19L 5A3ID 3DSNA 4NQXA 5T3XD 4OD3H 1U8LA 5C0FA 4M3JA 4K8RL 1T3FA 5EN2B 3TN0A 4U7KA 1N7MH 3ZLQC 1ZGLA 4GO6B 1JI2A 1DANT 4O9HH 3PJSB 2GK0B 2YD5A 2W9DL 5B39A 4QRPE 1ZHBB 4U0RC 3GJFA 3TEUA 1I9RH 4YHZH 4M02A 3QXDA 2Z8RA 1E4XL 5DEGB 4YJZL 2NZ9C 3CFDA 2VXQL 4JANA 3RJDA 4NRYB 1NMBL 1ZTXL 3U9UB 1ND0A 1FFPB 4HKZA 1AXIB 2LVEA 4NO0D 1MUJB 2VABA 4XI5C 5DD3L 3U0PA 1EMTL 4I48B 4YDLC 2AEWA 3OAUL 1UKSA 5AYQA 4HXBL 5C08D 4YHLL 3KR3L 5D8JH 1KCRH 5E00B 5JPMB 1D5IL 4IRSA 3BZFB 1BQLH 3QG6A 1U36A 4MLIA 3LKOB 2AJXH 5IFAL 4BZ1H 2HRPL 5GIRA 5F96H 3QWRD 4GRMA 4FP8H 3PWPD 5JA9A 4XVJH 1PZ5B 3MRKA 2VLRE 1I7UA 3ZZ1A 3B4NA 5BXFB 5IB3B 3VXRB 5BV7H 1S7QA 3DXAD 2JB5H 1REIA 2PXYB 3JXAA 1F90L 3EOAA 2W0KA 4OSUH 3CXDL 4MMZC 2IEPA 4DOHE 2J8UE 4ZOEA 4Z0BH 1HEZA 3KXFA 2A1WH 2DQHH 3OKOA 3FOLB 1XGUA 4MWFA 4UIKH 1I1AD 2IPKB 1AGFA 1ODAA 1LD9A 2I5YL 4JDZB 1CFBA 1I7RB 3EGSB 3W2DH 4XZUA 2A0LC 5EU5B 3G5YA 4JQIL 1MREH 3RP1A 5DVNA 3J8F7 4NKDB 1MJ7H 2HT4D 3JV5A 1ROWA 2CJUL 5KSUA 1RHHA 2AJVL 3FHQA 4JFXB 3D9AL 3LKQB 3KG5A 2W0FB 3L7FA 4YFLI 5HYJD 3KS0H 3QZWA 4R0LB 5BQ7A 4OLXH 1PFCA 2UV3A 4O4YH 3RVXD 1KACB 4NCDA 4NN6C 3S37X 1XIWB 2AJZB 5DD1H 4L9LA 1VCAA 3PP4L 2X70A 4FHBD 3V52L 1Q9LB 3PP3H 1MJUL 4XVTL 1F13A 4NJ9L 5HHOA 2P5EE 2JB6A 5ISZA 3P0YH 4QTIH 5L7XL 4NKOA 1ZLWH 5GRZA 4YWGL 1QBMH 5CGMA 1A7QL 4N5ED 3BQUA 4JG1H 4AZ8A 1GGIL 4NUJB 4PG2A 5FOJA 5C8JB 1K8IA 2Q8BH 3BD5A 5F7EH 5KVFH 3VG0L 4D9RE 2XZQL 3GUTB 4Z7UA 3M1BA 5IB4B 1Q9WA 1YNLH 3E6FB 5K59E 2BFVH 1H3PL 1YQVL 5L0QC 4H8WC 3WFZA 5F9OH 4CMMB 2AK4A 2YD3A 1P7QB 1FNEB 1OAUL 1FPTH 2VQ1A 3KPOA 1KPVA 3SKOA 3ULUC 3D18A 4Y16A 2QKIA 1KCVH 4R97C 3VFTB 1BBJB 4M3KB 4Z7OE 3P4LA 4KRPB 3TCXA 3PWNB 3CDGA 5LGJB 2ATPB 1T5XB 1GC1C 4ZQKA 1NEZB 3I6KB 5E5MA 4G9FA 5IHUH 1JUFA 3P11H 1KB9J 5IBTL 3VWJD 5HSFA 3DYMA 1KNOA 4L4VB 5F7MC 4R7DB 1EH9A 3O3BA 2XWBB 1WBYA 5EZJB 3DUUB 2CUMA 3WCYA 1AJ7H 3NCJL 4Y2DC 1FVDB 3T08A 4Y5XA 3ARFB 3IVKB 3C2SA 3DRTA 1SYVB 4IMLA 3DGGB 4D9QE 1T5WA 2BERA 5GISH 1A9EB 4LKXA 2W07A 4MJIA 2WM0A 3OKNA 1Q8MA 4OI8A 3HI5L 4GW5B 3MMEA 5FGRA 1K8DA 2CLZB 3QEUA 3FCTA 4ENED 4X7CC 4AIZA 4OCRH 4RMUA 5DDHA 5D1XA 4ELKB 3LRHA 4O58H 2ZUQC 3FRUA 1G7IB 2ZUYA 4N8CL 2BNQB 3UTPD 3RIFF 4L3AA 2MJWA 3K0WA 3ZL4L 3STLA 4NJAH 5D1QB 4GSDL 1VSCA 3Q3GB 2AJ3B 2EEAA 3S37H 3NIGE 4JDTL 3L1OH 4GG6E 3NIFF 5GS3A 4DKDC 4NN7B 2X4OA 2UVEA 4M48H 3CH1B 4I4WB 3NN8A 3GSRA 5DJXA 4DWHA 4U1JB 2VXTH 2ZKHL 3O4LA 3L3OA 3RIFK 3GO1L 1MHCA 3CFEB 1QYGL 43C9B 4P5MA 2WBJA 4LSUL 4KTYA 4L4JA 2CLRB 5DJ8B 1VB9A 1JWMA 2VC2H 1CGYA 5T33H 4HUVB 4U1LA 3C9NB 3W9DB 3IFOA 1A6ZB 5IKCA 3CXHJ 1JHKH 2H6PA 3U46B 2H32B 1HKLL 4BFIB 2XN9E 3BUYB 1QBLL 3ARGD 5ESAA 1KJMA 2EE6A 1QSFB 1D5XA 1B4RA 3E1F1 2AXFB 3NFPB 4WGVB 2BK8A 5SX4H 1OM3L 1E6JL 5HI4D 5EOQL 3X3FL 2C3VA 2VXUL 2EEDA 4MXWH 2ARJA 4PJ5E 3NFSH 5DLML 2VZSA 3ZYJA 5JXAL 4F58H 3HLAB 4NHUA 4LHUD 5E4IA 3N1QC 4NC2B 4WWKC 4JAMB 3MRMA 4HAGA 1CE1L 4H1LH 3BRGC 4X4ME 1AP2A 3SDAA 1A4KB 1LEGB 3DV4A 2WLZA 1QVOA 2R1YA 4TUJB 4UTBH 5DI8B 4XP5L 4MNHB 1UYWH 2E5EA 1P1ZA 1EEYB 3U4EA 1B0WA 4U3CA 3DSFL 2IFGA 4EI5B 1D9KC 3KPQB 4ALAL 1JZ6A 4KTEH 3HUJA 5EU6A 2FX7L 1T66D 1NBZA 4YE4L 3VFSA 3OX8A 3RNKB 1S7TB 3ARXA 3QI9A 3S4SG 1JF5A 4JHWH 4FQJH 3BEVA 4X0KA 1K6QL 1FRGH 4R8WH 2OJEA 2VLKE 2ZUUA 4WFHD 5I8EA 1P84K 1SEBB 4LSVH 1MCEA 4ODHL 1WCBB 4MJ2A 4U1MB 4OF0A 3HMWL 4M7ZB 1C5DA 5E2WH 4LVOC 3DUSA 5EOTB 1GOGA 4XAWH 3REWB 4YXLL 3P9WB 3GDBA 3BGFB 3CFCH 3VU2A 1S7WB 1HHHA 3BAEH 4RRPA 4Q97A 4J4PA 5I19H 3IJYA 2ZSWB 3WUWG 1INQA 4EDXB 1UC6A 1XGYL 3RI5K 1CXLA 4K8RH 1ZVHA 4Y19B 1AQDB 3RL2B 3FT2B 5BRZD 1T7VA 5IM7A 1JZ5A 1ACYH 4MQSB 1B90A 2W9DH 4QHNB 3FQNA 4TSCL 3TO4A 3KHOA 1AD0A 4NPYA 1E4XH 2VZOA 5E6YA 4AEHL 2VXQH 4UDUB 1NMBH 4ZNCD 1YYLL 3KYAA 4MGXA 4X80H 3VXSD 1S7UA 5DD3H 1EMTH 4JFDE 5C0ND 2RR3A 5MEQA 3V6OE 4IOIB 5EBWB 4HXBH 3HS0A 4YHLH 4LCCB 2CUHA 3KR3H 5I2IB 4X6EB 1D5IH 1PY4A 4YBQC 2B4CL 1QD0A 2XNAA 3V6FA 2NY1B 1S7XA 3PL6B 3FFCE 1L4IA 3MLVL 1RIVL 3MRGB 1HOCA 5GGTA 5IFAH 1HE7A 4WUUA 3LOWA 2HRPH 3TBYB 3E6HB 3HZMA 4KKLD 2RQ8A 4LLAA 1GPOL 4IRJB 3UP1A 3I3EA 1LP9E 4PGZA 5GSRB 1CYGA 1IL1B 2PO6D 1VKXB 1NANI 1P84J 1JHLH 2PF6A 4AENB 4M1CC 5T1KB 1RK0A 4WEBL 3VD7A 3CXDH 4KJWC 4P9ML 3U79A 4G3YL 4X6CB 4FQ2L 5J6HA 5FO9B 2P5WB 3BSZL 1JPGA 4MJ5A 2HH0L 4JO3L 4V1DB 1ED3B 2I5YH 4WJ5B 3HRPA 3ZDXE 1CFNB 3AAZA 1OGAE 4YFLF 2BNRA 5CSGA 4JQIH 5BOZG 1JVKA 1IRAY 2QHLA 3IDXL 4KY1L 4OIBA 2YPLD 2FECL 1I8KA 4F57L 3HI1A 2CJUH 4I9WD 1MH5B 2IALA 2AJVH 4I2XA 2FWOA 3QEQE 2GJ6E 4M8VA 1OOAA 2DN7A 3EYVA 2F54A 4P2QB 2WQRA 3Q6GL 4KMTL 1QO3B 3ULVE 3QCUL 1Z2KA 4WUKL 4C56D 1AIFA 4EXKA 3OJDA 3RZCC 1JIBA 2FECI 4PGCA 3B2UD 4PB9L 4MB3A 3PP4H 3ULVL 4D0CA 3V52H 5DC0A 2RBLA 3JV0A 1FFOA 2ARJQ 1FFQA 3FL7A 3GNML 4I77L 4M93B 5SWSE 4AT6B 4YDKL 1MJUH 4JE4B 2L4OA 4NJ9H 3MRRA 3NZHL 5JLZB 5F9WC 2DQDL 5C0CE 4K8RD 2C9AA 4PBVC 1T89A 3EYOA 3UX9B 5L7XH 1SYSA 2AK1L 3EDFA 1BF8A 2HKFL 4YWGH 2WWMD 2VRAA 3VFWA 1A7QH 5BVJB 5JNYA 3VFPA 1JL8A 3QHZL 1NCWL 1NMCC 4WHTB 4Y2OA 1L0YA 3PIQA 1UWEL 3LB6C 2V2WB 4NT6A 3SKJL 2XZQH 3BE1L 3X12B 5D7JA 3VA2C 3PDOA 4YDJA 1KXTB 1OARL 1H3PH 4RAVB 1HHGB 3C60D 1F4XL 1OAUH 4M5ZL 1EFXA 3W0WB 5L2KE 2VYRE 5CSZA 3H9YA 3WHE0 4JO2L 3TBSA 5K59F 3QJFA 1ZT4A 3LEXA 5CFHA 5DYOB 2VB5A 4XBPB 5IJKC 1IAKB 4EQ3A 1FHGA 3V5HA 5IBTH 4GW4B 4MA3B 3DIFB 4ESKA 4ZTOL 2XYCA 5GGRY 3GMOA 1FG9C 3B3IB 5HY9B 2PUQT 4ZTPH 1V7NL 5J06A 5ANMB 2VLRD 4ZSOB 1MCFA 3NCJH 4EIGB 3BP4A 3VGAC 4UT7H 1CDYA 5E8PB 4JFYB 4DZ8A 1HHIB 2UWEE 2LTQC 3TA3B 5DMJB 1T7WA 1UJ3A 3CDCA 3L3JB 5H2BA 1DUZA 1H3WM 2R23B 5H35A 3WJLA 4JFFE 4L3CB 3FT4A 2VISB 2P46B 4Z0XA 4AY0A 2BY0A 3FQXA 4NZRH 4BKLA 5IMOB 3UTQA 3QPQC 2F8VA 4UOW0 3I02B 5EO0B 4ZUVA 2DQFB 4N8CH 4RCAA 3O8XA 5EORL 2PYFA 5JXEC 4GSDH 2CLVA 2YK1H 3C6SB 1UM5H 4AMKL 3S98A 4JDTH 4H0IA 1FE8L 3FQUA 2KL6A 2HT4C 4OZ4B 4Z77B 2I9TA 1OL0A 4JPKL 4PJAF 1KF9B 5C1MB 4E42A 5IQ9A 2JCCA 4M7LT 4GW1B 2ZKHH 1DBJH 4NN5B 2Y5TB 1DP0A 1QYGH 2WSKA 4LSUH 3FB6A 3C87A 5J1SC 5IB1A 3RVXC 4N5UA 4NBXB 2GCYA 5E70A 2P5ED 2P4AB 5D96C 3VA6A 4S1SL 1U8JA 3X13A 2NY3D 5JDSB 1RUKL 4IIQC 1XF3A 4J3XA 1P9MA 1QBLH 1ZWIA 5JO5B 5HHQA 2RIKA 4LLDA 2HN7B 1S9VA 3GBLA 4D9RD 4N5EC 4U05A 2X4NB 4Y5VC 3BI9X 5K9OB 4GXUN 1OM3H 1E6JH 3JTSB 1KPUA 4ZD3L 3WL9A 2LAGB 5IG7A 5LGHL 3X3FH 2EXYD 2VXUH 3B9KC 5K9QI 4X5XB 3P9MB 5C0BE 2OBGA 4JEGB 5DLMH 5JXAH 3TNNA 4HC1A 4X98A 2QQKL 2W60A 3LHPL 3MTRA 3OKDA 4FQXB 3BJ91 4N1HB 1U8KB 2AJSL 1CE1H 4O2FA 2OTUA 5D93B 4RZCA 1H3VA 3HTLX 1D5BB 4XPHL 2VQTA 3U7YL 2V2TB 5E03A 1VADA 5FF6B 1U58A 4XP5H 2Q7YB 3BMVA 4AQ1B 5JHDB 5DRNA 1E27A 4DEPB 5JORA 1S7SA 4ALAH 4Y1AA 3Q5TA 2YN3A 3NOIA 5ALBL 2FX7H 3O3DB 4G6FD 4WHYH 1AXTL 4YE4H 5KVEH 1BZ9A 3DMMB 2R8SL 1YEFL 3NCEB 2GTWA 4PJIA 3RY6A 3LPGA 2X6MA 5E1AB 2VKWA 5D1ZA 2HT2C 1K6QH 4Y4FB 2KKQA 4RMWA 1U8LB 3UBXI 3RWFA 3O3AA 2NY0D 4NKMA 1CE6B 4PRDB 4KKCD 4XP1L 4ODHH 4ZO6A 5F3BB 3UYPA 3HMWH 4YXLH 4AYFA 4MNGB 2VDQL 4X4YA 1UCBL 4OFPA 4I0PB 3HC0A 5KVGL 5ELIA 1UM6H 1IGYB 4HKZB 3HZVA 1XGYH 2GUOB 1ZANL 3JV6B 3RVVC 3DVIA 3CFBB 4QT5B 4HKJA 5KS9F 4Q6IC 4GMSL 4FTVD 1BLNB 4TSCH 5EUOB 1INEL 1CDJA 3MLUL 5DJDB 5FV2A 1GIGH 2ICWJ 4YHML 4AEHH 4HIJB 3P9LB 3TCLA 3ARED 5GIRB 1J05B 5BOPA 1YYLH 1W0WA 5EIIA 3U0TB 3SCMD 5BVPL 5J0BA 3CMOL 4KJPC 3BPOB 1NANH 2XN9D 1F02I 3QO1B 3GI9H 4S2SA 5FDYA 4K55A 2B4CH 4X6FB 3KXFB 3VXRE 1RIVH 1AGFB 1U8NA 4PY7A 1GPOH 5I1KL 3ARGC 4JCLA 1VFMA 1LK2A 4LFHD 1MFDL 4TSAL 4XZUB 3H6JA 5GS0L 3KAAA 1DLFL 4Y0GA 4PJ5D 3SDCD 2H2SD 1IBGL 4D9LL 1JWUA 1YC7A 1MCBA 4JQXC 4WEBH 4MVBD 3QIUC 5JIIA 2CQVA 3GMMB 3C5ZA 3PQYA 4XP4L 1WBXA 4P9MH 1IC1A 3K80A 4G3YH 3MUGA 1IGML 3KYMA 4FQ2H 2EC9U 3BSZH 4NBZB 1UQSB 2HH0H 4JO3H 5D5MA 3QZWB 4EQ2A 1CU4L 4X7TA 2IAMA 4YDVB 4WI7A 2G5RA 1K2DA 3SKNB 4PJFB 4HMEA 3TH4T 4JLRA 2CKBB 2FH6A 3IDXH 2NNAA 4KY1H 2WP3O 3KWWA 5ADOL 3SKUD 4ODWB 2X70B 4F57H 1PQZB 4G5ZL 4ZXBA 5LXGL 2EIBA 3QEHB 3ZDXF 1W0YT 2GFBA 3IRZA 1TZGL 3MRFA 1R3KB 5DJCB 5FFLA 2EH8L 2WK2A 3F7VB 4U6HA 4KHTL 5I0DA 3Q6GH 4F2MB 4KMTH 3QCUH 4X5LA 1MCPL 5DUML 5LBSL 2OTWB 1HYSD 4K23H 3VI3E 3KDMA 4F7PA 1HN1A 4PB9H 1T66C 5JZ7D 3ULVH 3DO7A 3GNMH 3ZO0A 5GS1A 4I77H 3ULVF 3VGHA 4YDKH 2ADFL 2AEQL 1OGTB 2EIZB 3NZHH 1G1CA 1Q9WB 4F7MB 2DQDH 3IAPA 3RWDA 2AK1H 1A7PL 4GKNB 1UENA 2IANA 2HFFA 1DVFA 2HKFH 4NQDD 4WCYL 3KPOB 3CSYA 5SWQA 4F7CA 4OIIL 4YAQB 1AHWC 1H15A 2QKIB 3QHZH 4OF7A 1NCWH 1I1YB 1IEBB 1HNGA 1K5NB 3VXTA 3MLPA 1I8IA 2JJSC 3QUYC 1ZA6A 1F2QA 1MIMH 2NMSA 4U2ZA 4PS4L 4U6XA 1UWEH 3T3PE 3SKJH 3BE1H 5C0JA 4WGWB 1G1YA 4KKAD 4RAUA 3MREA 3GSWA 5I66B 1OARH 2ADIB 1YMMA 2AGJL 3MRPB 2BVTA 1EXUB 4KZDL 1WV7T 4YHYC 4UQ2B 4M5ZH 4U4BA 5IOPA 4AG4L 2BRRL 4KV5F 3FOMB 2NXYD 5B21A 4JO2H 4JFDD 4L4VE 1T5WB 4R4FL 4LKXB 1NAMH 3D25A 5FCUL 2HA1A 1D5ZB 1MHPL 3DBXB 3OKNB 3WNOA 2XY1A 3FFCD 4WU5B 5TH2B 3TFKD 1U42A 1Z5LB 5ABDE 4EN3A 1OAXL 4PRAA 5DJ2B 1V7NH 5HI5D 5I18L 2V9RA 2V9TA 5DDHB 3ECBA 4DGIL 2G2RA 3H9ZA 4PJEA 4JFPA 1SEQL 3QQ9D 2R0KL 4YH6A 1MEXL 3DI2B 4KKLC 1RJLA 1D6VL 3MLZL 2N4IA 3Q5YA 3SO3C 4OTXL 5IWLA 2P8MA 3KPSA 1TVBB 3VD5A 2BNQE 1T6VN 3R0MA 4OKVA 1T6WA 4F3FA 2C1PA 2P7TB 3HR5B 1G7LB 5D6DA 1ZE3C 1OGAD 2IH1B 2R2EA 1CWVA 2AV7B 2WINB 4QOKB 5DJXB 5L8LB 2WV3A 3T2PA 3E2HB 2G60L 4RGMB 4LMQE 1ZXQA 1OSPL 3D0VB 5EORH 3P4MB 4LLQA 2NY2B 3TYFB 3HG1A 3ARVA 3QNYA 5D7IB 4PJ8B 4IBLT 3LRSA 3QEQD 4AMKH 2GJ6D 5HGBA 2BSSA 4U1LB 1FE8H 2XWJA 1QNZL 3T65B 2HWZL 5CBAB 3ULVD 3S6CA 3RY4A 4JPKH 4B5EA 1OP5K 4X9HA 4CJ1A 1K4DA 4JFQA 4NNYA 5KJRH 2RFXA 4P2OB 4WU7A 1KN2L 1I1FA 2HTKD 1D5XB 2BSRA 5IW1A 5SWSD 2QR0A 1GJIA 4S1SH 5A16A 5C0CD 3B2UC 2YEZA 3W11C 2E7BA 4WVRA 4XC1L 4X5WA 1RUKH 1UXSB 1N8ZB 2VE6A 4FQLL 3VXMA 4P2RA 1IZKA 5T1MB 3D85B 4NHUB 4K8RC 3ZKNC 5IJVA 3GKWH 4LCWE 5CEZE 1MIEL 3ZT6A 4GBXD 1CN4A 2XTLA 1F6AA 3QDJD 4K2UL 4ZD3H 5CEZL 3T77B 5LGHH 3DV4B 2V2XA 3OL2A 5GZOD 4HKXA 5L2KD 4ZS6D 4M61A 1RUPL 4CRPA 1KTDB 2QQKH 4OGYL 1P1ZB 5B8CA 5EBLA 1CD8A 5TGBA 4UDTA 3LHPH 3IJHA 2UY6A 3V4VH 4NQCB 4FQCL 4L8BA 1NBYB 2Q20A 1NBZB 3OX8B 1T83C 3QI9B 1NGYA 1EX0A 2CIKB 2VDLL 3VFVA 5ID0B 3BEVB 4X0KB 2GT9A 2YR3A 3OGCB 2APVA 2UZIL 3TIDB 3U7YH 3V6ZB 1TZHB 2QADC 1UB5B 3PHOB 1GYAA 1JYNA 2F53A 3WLBB 2EDNA 2DLEA 5MHSE 4XH2B 3HAEG 4LKCA 2EDJA 5ALBH 1AXTH 1HHHB 2ARWA 2E7MA 2R8SH 1YEFH 4GG8B 5FGSA 4JFFD 5IEHB 5F88A 1JGDB 4PD4J 4LCUB 5DJ0A 1T7XA 2NYYD 3UZVB 2BC4A 3G6JF 2I07B 1VEMA 4Z6AT 3SQBA 1H3TA 3ARTA 4P5TA 4CDHA 4HX1A 5H94A 2BX5A 4XP1H 2OR8A 4HIHB 3EYFA 5GGSA 3DI3B 1KB5A 1HH6A 4WO4C 3PABA 1AD0B 1XF4B 2VDQH 2FLBT 1JGEB 2ZWLT 1UCBH 3JWDL 3C5SB 1K9TA 3EDKA 4L4TB 5KVGH 4L3EB 1IAIL 1S9WA 1TQCB 4I0CC 3VE0A 1ZANH 1UB6B 2YS4A 1CICD 4XMPL 2YD9A 3ARPA 5L6YL 4HZAA 4KK6D 1AC6A 4GMSH 4OI9A 4YEFA 2FL5A 1INEH 4J2XA 3MLUH 4V2CB 1NCBL 4PIRF 1FZMA 3U9PL 4YHMH 1Y18B 5I75B 2AXGB 1NQBA 1IAII 3LQZB 3MV11 1U9KA 5HDOA 1R5WA 5EG6C 1UWXK 2X1PA 4ZAKD 5BVPH 1OAQH 2EZ0D 3LIZL 3RA7H 2V7NB 3WS6C 2A2QT 4JY4A 1A3RL 3CMOH 4L8SA 3QUZC 1LO0L 5M94B 5BZDB 1WWAX 4YHNA 3FHAA 3QBTB 3BH9A 3BXNB 2EDKA 1F97A 1P9MC 2GIYA 2NY3C 5J6HB 4PGEB 3E0GA 1ZK9A 4MJ5B 2DTML 5I1KH 3VFGH 4QHUA 1WWWX 1JNLL 3AAZB 5I1JL 1EA9C 4F9LC 5IR1B 1MFDH 2ZG2A 1FJ1B 1BVKB 4TSAH 5GS0H 4QKXB 4LBEB 5C0BD 1DLFH 4ZUSA 1RV6X 5MENB 4NQSA 1IBGH 4X6BA 4D9LH 3FQTB 1KBGH 3WIHL 5D2NA 1KUMA 2P5WE 3MV7A 3QDMB 4V1DE 3VFRA 2HMID 4PGJA 3TLRA 4Y4KB 4I2XB 1G6RB 4D8PB 1IGMH 4KROB 1J0YA 4L5FL 3AU1A 4YXKL 3QIBA 4FZ8H 4N0FB 4I8DA 1GL4B 2FJGB 2VERN 3OJDB 3L6FB 1TETL 4OBRA 1S9YA 5D9SA 4EI6A 5ADOH 4NO3A 2N7AA 4GH7B 4M1DL 1RURL 3F62A 3S7GA 3V7AG 4MD4A 4HMCA 1LVEA 4G5ZH 4OCMC 5LXGH 3HE6A 3MV9B 3MRQB 3MRRB 2VSDA 3N06B 5KSAD 1T0NB 2FR4A 1SYSB 2EH8H 4FXGB 4KHTH 1FL6A 1KXQE 2O5ZH 1U91B 2LU3A 2LFGA 3IKKA 4H26A 4OZFB 4U7MA 1MCPH 5CJOL 4LAJH 5DUMH 2CDEA 5F6IC 5LBSH 4WTZG 3VFPB 4H1LG 4G8FA 3T2NL 3GSNB 2AVGA 4FMKA 3OGOE 3O6FB 4LPWA 5KN5B 4HSQA 4NT6B 4M4PA 3E3QE 2ADFH 2AEQH 1H5BB 4YHIB 4LHQB 1OW0A 2PW1A 3VI3F 2XKNB 2NY0C 1A7PH 3WNKA 4KKCC 4OI7A 4HS8L 2OK0L 4X6DB 5J13C 2EDYA 4ELMA 1M1SA 4OIIH 5CJQL 2MWCA 4OJFL 2VZTA 4E0RA 1LE9A 5GXBB 3LEXB 1NC4B 3HPLB 5FGCB 4PS4H 5C0AA 2GEEA 3OF6D 5CJXA 1CDGA 4XCNA 4K7FA 3W0WE 4MDIA 4ZOAA 2AEPL 3HC3H 2AGJH 1TIUA 1NDGB 1NUGA 4ZNEA 3VWKB 1HQ4A 3ZE1E 3RWCA 3T3PF 1KG0B 4P99A 4AG4H 2DQCL 2BRRH 4B0MM 5ILTH 3ARQA 2Z0BA 3WE6B 5DO2C 5DA0B 2Q7NA 1KJ2B 3SGJC 5E7FA 4HUNB 4AH2B 2PTUA 4DZ8B 3BDBA 4R4FH 3H9SD 2JK5B 5I1CL 3EIFA 1UJ3B 1VDGA 4OGXL 5FCUH 3OTTA 1MHPH 5IBLD 3PWVA 1DUZB 3VXRD 1VFAA 3QQ3B 1JPFA 4MCZB 1Z6JT 5HDQL 1EO7A 4LLWB 5IIEA 3KNBA 3EJYD 5I18H 3UTQB 1DANU 2R1WA 4DGIH 2VR4A 5KTEL 2R0KH 3KYOA 1MEXH 3O8XB 4O02L 43CAA 4JFHE 4RQQA 3LKSA 4RWHA 1D6VH 3MLZH 1JNNH 1LEIA 4OTXH 5DQJA 2NTFA 4QRUB 2C26A 1ZV5A 3HI6L 3WDHA 2JIXA 5C70A 1EZVY 3MCKA 1QRKA 3QNZA 5IEKA 4EUPA 2DYPD 4HZLA 1X7QA 3BKCL 4J3OC 3SDDC 2G60H 4Y4HA 3D1MC 3IAQA 1BD2A 1OSPH 1RZJC 1UG9A 2KQNA 3HKFA 4LOUD 4RIRB 4UUJA 2H3NB 3KPLA 2R2BA 3NMEA 2Y7QA 1F11B 1XIWD 5I16A 1U8JB 3IF1A 2PNDA 4R6UA 5D2LB 1QNZH 4K71C 4H5SA 2BP3A 2BZDA 3VGBA 3PUCA 4XBGB 4QRSB 1S78D 2XG5A 5L8JB 1ZWIB 2DD8L 5HGHB 2YPVL 4M8QA 3BPLB 1AD9B 4PJ9B 4NDMA 5CHNA 3AB0B 4D3CL 1QRNB 3Q0HA 1A7RL 1H3UA 1ZHNA 2V9QA 2K3TA 3S3PA 1HYSC 5IVZB 3KJ4B 1A9BB 3DVNA 1W2KT 5CGYD 2KPNA 3WSQL 5JZ7C 4NZJA 1JPSL 1NDMA 5EBMA 4M4RA 1ES0B 4BH7B 2H32H 5I1LA 4K94L 2DQJL 4FQLH 1IGJA 2CRZA 1N64L 2X1XR 4X98B 2W60B 4KRMB 2EE9A 3THML 3TT3L 1CT8B 2WWKO 1MIEH 1P7QD 3OQ3B 5FM5M 5DVMA 4D94A 1T03L 5ACZB 5AYUL 1SJVA 3EJZD 2OTUB 4K2UH 2HVKA 4LSPL 5J3HC 4RZCB 3T4YA 5CEZH 3BT2L 3FB8A 1BZ7A 4PJXF 4PGBA 4NNXA 2AV1A 4BQ9A 1RUPH 4OGYH 2CDFA 5E6ID 5CZXC 1SVCP 1GGBL 4HEME 4L4VD 4LLUB 4WV1C 2Y25A 4FQCH 3OSKA 4HJ0C 4U1GC 5DZNA 1AO7B 1OTTC 3OAZK 4JM2B 2B4CC 5DQDL 2NXYC 2VMFA 4RFEA 2GTWB 5JHDE 3WJJC 3P73A 4UIMB 1P4BL 4C83B 1UEYA 2VDLH 3ARFD 3V6OC 5FB8B 5D1ZB 1HCVA 4UAOB 3FQRB 2UZIH 3UROR 1U95B 4CMHC 1HH9B 4NKMB 1WSST 3IDIB 1SJXA 5E8NB 3TFKC 1AH1A 3IAGC 1CDBA 1DTUA 2VDRL 1IEHA 2H2PD 2FIKA 5HI5C 1TENA 2YRLA 1ZT1B 4JN1H 1XT5A 3V5DB 5A43C 5JOPE 3MJ8B 2IBGA 3RTQB 5GRVK 3STZA 3CFJB 2CR6A 2BNQD 5TDNA 1R24B 5D1QD 1P4LB 1WIPA 1AC0A 5HVHC 5T3ZL 4RBPK 2FBOJ 3MRCB 1BVLB 3DTXA 1AGDA 3FB7B 3GIZL 3ARDD 4POZD 2XZCH 4DVBA 2FATL 3CPLA 3RRQA 2OQJA 4U1SB 3CK0L 4P48A 2Y9RT 3GFUA 1PAMA 3W82A 4YZFE 3QNXA 3JWDH 4G8EB 4OZHA 3MLYH 4HULB 3MO1A 4HS3B 1IAIH 3HZKB 1OTUD 1TZIB 1X5KA 5I1DB 5EUOE 4XMPH 3WFHB 1EDQA 5L6YH 4MSWA 3TNMA 5LKNA 5T1LA 4RMSA 2SEBB 3AFLA 5I1EL 1NCBH 4NOBA 3ULVC 1MJJA 5FYJU 1I9JL 1B0RB 1JNHA 4XNUH 4Y2DA 3QQ4A 3TWCL 3UXFA 1UCTA 1U8OA 4CNIB 4NO0B 5E95B 2VAJA 4TRPL 3LIZH 5C08B 2NW2B 5HHNA 5E1HB 2HTKC 4GRLC 3OJMB 3KXFE 1XGTB 2Z92B 5HHMB 3F5WB 3T8XB 1JWUB 1VESA 1LO0H 2OZ4A 3AS0A 1IQDA 2BSED 1P5VA 5HHVL 5JUEL 4LCWD 5DHVB 3DX9B 2YD7A 3VFUA 1G7PA 2DTMH 3DXAB 3F6IA 2R0LL 1N4XL 1JNLH 2HFTA 5CZVL 5I1JH 1MCQA 4LK4A 5K9KA 3B5TA 4KDWA 3MLTA 5ECJE 5EU3A 4A6YA 1IARB 4GBXC 3KWWB 3WIHH 2BSTB 4BQBA 1I1AB 3OKLB 3FQWB 5GZOC 1OP3H 4ZS6C 4E41A 4X6CF 5DS8A 4OB5L 2BDNH 4YXKH 5FK9B 2P1YA 2R15A 3T4AB 4XCEA 1TETH 2CKBL 5CEXA 4OIAA 5ISZE 4U1HB 1QLFA 3AS2A 4F7PB 2D9CA 1VENA 4GKSB 2VDNL 1N5AB 2W9EL 3X17A 1LK3L 4M1DH 1RURH 3CH8A 2L0DA 2B0SL 5C9JA 5TDOA 2HFEB 5IUSA 3K81A 3WO3B 3NGBB 1U8PA 2PTTA 1A6AB 1FVEB 5MHSD 3ARUA 3W9EB 3UPAA 4DAGL 4YXHL 2V5SA 1J8HA 2KQMA 4QY8B 1N59A 1WBZA 1BFOB 2IANB 4FQ1L 5F93C 3TZVC 3DX6B 4RFOL 5CJOH 4TNWF 3REVA 1C08A 1H15B 2BVQB 1VERA 3RHWF 3T2NH 1YN7A 1I8IB 4HDIA 3VMPA 4G9DB 2NX5A 4I18C 4HCRL 2AK4E 4OFYD 4U6XB 5IVXF 4GUPB 1C5CL 3MRNA 4JN2A 5C0JB 5HPMB 1B9ZA 3ARRA 5SWZA 5JOFB 4RAUB 3BD3A 4UBDC 2EDHA 4R96B 3GMRB 1WZKA 4ZUTA 1M05A 1TQBC 2VLLA 4NRZB 3KLDA 2OK0H 4HS8H 4WWKA 3IETA 1I85C 3INUH 4TNWK 2OI9C 4FMFA 1PY9A 3BZ4A 4WHYG 5CJQH 3RHWK 4MQTB 4XCYB 1OTSD 2XFXA 3KLAB 4HBCL 3OZ9L 5F6HJ 2CPCA 2DMBA 3IDNB 3QJHA 1MCLA 5DMKA 1PKOA 3MJ7B 1PW3A 4P46D 3ETBF 4JHBA 3U2SA 4D0BA 3FZUD 4MAYB 1YNKL 2AEPH 1D9KA 4KK6C 4A2MA 1ETZB 2APBA 3MUY1 5HYQB 5DT1L 4OBSA 2DQCH 5FYJE 2NY1D 3PL6D 2MHAA 3B9DA 4P4KA 3QDGA 3VWJB 1XCQA 4FFVD 3T09A 1G7QA 5BV7B 3O6ML 2V7HA 1UVQA 4IRJD 4YO0A 2EZ0C 2YBRB 5I1CH 2XZZA 5FYJL 1DBKL 2A6JA 3B8YA 4BSVB 3MLWL 4YUEL 4HWBA 3KPSB 1IGCL 1ZGLM 1FVCB 5DFWH 2UUDH 4OKVB 4JRXD 4F3FB 2X5PA 2XWTA 2R2EB 3IXTA 4J3TA 5DXWA 5J1AB 5KTEH 2N56A 2P5WD 4MQXC 3RWIB 4PJGF 3QUXC 2DQTL 3HG1B 3MZTA 1IC7L 4YPGA 3RX5A 4QOKE 5HGBB 1EERB 4YX2L 1FN4A 3QUKA 4ODUA 3O4LE 1EV2E 3I6GB 2GAZB 3LKNA 3QIWD 3HI6H 5HHPB 2HMIC 1F4WL 3CSGA 4NNYB 5GJSL 5D7IE 1NAKL 4XPGL 3BKYH 2FEEL 4KK9C 2X9YA 1PYWB 3BPNB 2M8XA 3TVMB 1I1FB 2MQ0A 3VCLA 1N6VA 2VLJD 5IB2B 4TTDD 5ICZB 1NGQL 3HNTL 1F3JA 4OT1L 1QLRB 1X5AA 1PG7X 5CILL 1MFAL 4ZPVB 5B3NA 3FO0L 5A16B 3WN5B 4J8RA 3SBWA 3RUGA 4PJDB 4NQVB 1MCSA 3ARBD 1A1OA 1KPRA 2VE6B 3CUPA 3RVTC 5JIPA 1HI6A 4MB5A 5C09A 4P3DA 2DD8H 2YPVH 3UAJD 3MCG1 5KSAC 4PJHB 1CTNA 1I8MA 4HMDA 3QISA 2WWKT 2R29H 4D3CH 1A7RH 3GSVA 1CGTA 3MV8A 3VD3A 5FHBH 3DWTA 3OJVC 3U0WL 3WSQH 4HUWB 4YHPB 1JPSH 4G6AC 2HVJA 2FGZA 1FZKA 3Q1SL 1FL3A 1CDHA 4K94H 4OZGB 2DQJH 3GIVB 3VMOA 3ZE0F 1N64H 4RMQA 4RA3A 4S1QH 3TT3H 1TCRB 3CMGA 3GSOB 3L3IB 5B38G 5C07D 1UH2A 4L8BB 5GGQL 3W0WD 2V5MA 1HIML 5AYUH 4X7FC 3MRDB 4LSPH 1NGYB 1EGJA 3BT2H 3VFVB 2VR9A 1WZLA 5IMKA 4LHUB 5GGUA 3X11B 1QPXA 6CGTA 3VJ6A 5DGQA 2D7TL 2ZOKA 1R5IA 1NPUA 3CLFL 4U2YA 2R2CA 3ZDYF 3PGDB 1GGBH 3N9GL 3RZCA 1M7XA 1X5YA 4KUCD 5KANI 5BCAA 1KJVB 5DK0B 4DUXA 3NPZB 5DQDH 4YPJA 3ILPB 3O2WL 25C8L 2BXZA 5ICXB 1T4KA 1MFBH 1EHNA 5GSVA 3TA3D 4TOYL 4HX1B 5IBLC 3H7BA 4IDJL 5F7DA 4BH8B 5GS0C 5GGSB 3GMQA 1T80A 2PXYC 3OHXB 1QEWB 1G7JA 3I85A 3RZWA 4JFHD 3BDYL 3EJYC 2JE8A 4U0QB 4NUGL 5E5RB 1U2CA 2Q86A 4JR9L 3BKJL 2D7QA 3EO1B 2KZ1B 5T3ZH 4B7LA 5T5FL 2GJZA 3GIZH 1OB1B 4JZJB 4L3EE 2FATH 4R4BB 3FO1B 5JMRA 3QR2A 4G80A 1HSBB 4R4NC 3TJEL 3ROLB 3U7WL 1U93B 2DQIL 1IM9A 5IJKA 1MHEA 1I3RA 5B22A 4LLMB 2VWEE 2K1MA 5CD5C 4JRYD 4R0LC 2F74A 2X7LA 1RUQL 3F8UB 4PP1D 1FO0B 1YPZB 4YZFF 1K4CB 2DLHA 3MOAL 2J2ZA 4LSRL 3CLEL 3V0AC 3SOBL 1GHFH 5EUOF 3SE8L 1I9JH 3S8WA 3TWCH 1S78C 2PW2B 2I24N 3T0DA 4TRPH 5KSVA 5FECB 1DQML 2FYYA 2ICEA 3PWPA 4TUOA 2ITCA 1B2WL 1CDIA 4PY8I 1NUFA 2IGFL 2UVFA 4NIKB 3RX8A 3O2DA 4JPIA 3C8HA 5HHVH 3VFRB 5DRXA 5JUEH 2X4TB 4W81A 4X8XA 1MF2L 2FDBP 5HGDA 1UH3A 5MENE 2YA1A 3LSOB 2PO6B 2FIRT 5JXEA 1QACA 2E9WA 2R0LH 3QDME 1N4XH 4ORGA 2DWDA 5CZVH 1PKQA 3IDJB 2W65B 1FAIL 4I2XE 4HBQA 4KJYA 4CN4A 2F54E 3TF7C 1PZUB 1X5IA 4ONFL 1LQSR 1IGTA 2ADGB 3IB4A 1G6RL 4KRPC 2A6KB 3RGVD 4FFZL 2F8OA 1JZ3A 1U8HA 5HYJA 2X1QA 4OB5H 3DVGA 4O00A 4OLUL 4E5XA 5J7CC 2COQA 2ENSA 4H26B 3ZTNH 2YPLB 2BNUB 5DJ6A 2CKBH 5IK3A 1A7OL 4PJFF 1RZKC 2VDNH 5E2VL 1LK3H 2ICES 4M6AA 2B0SH 1EO8L 3MGOA 4WW2B 4IHOB 2A83B 4IIQA 5AAWA 1BQHB 3ARFC 4FRWA 4NM4L 2R39A 3WUZA 3TN0D 4DAGH 4Y8DC 2AP2A 4OCXL 5HGAA 4YXHH 2DI9A 5FYLE 5JOPD 1MOEA 4FQ1H 1CLYL 4RFOH 4PLNC 1UACL 3DROB 1U8IA 4ELMB 3MJGX 3PWJA 4N8VB 4Y5VA 3SDXB 2ILLA 4PRHA 3GSNL 3MRLA 3UTTA 4W6WB 3OAYK 2AQ3A 3B9KA 4G8GA 4UNTA 5FYLL 4HCRH 2OMBA 3FN9A 5C0AB 3SGEI 4X6DE 1F3DJ 4LDLB 5D1QC 3HNVL 1YYML 1G9ML 4P5KA 5IW6A 1JNJA 4R7NA 3L9RA 1OPGH 4KH2A 4JG0L 4BSWA 1HQ4B 5FGCE 2UY7A 5GRXG 4JO1L 4JKLA 4IRSD 2FLRT 4OF3A 4NN7C 5BZWB 3UC0L 1X4YA 3WFCL 2Y1VA 3MROA 3OZ9H 2HP4A 1X4ZA 3C60B 3P0GB 4CW1A 5AUMA 1KXVC 3ZKXB 5GGSY 5L9DL 1A2YB 1VFAB 1YNKH 4KK5D 2V5TA 4IOSD 5LGKA 1Z9MA 1EPFA 3SE9L 4Z78B 3MOBL 1KJ2L 3KXFD 4MXQC 4DGYL 3TV3L 1CXIA 5I8CB 2O61A 1ZSDB 3BIKB 1GSMA 5GJTL 3GBML 5I1IL 2OCFD 3NA9L 3UPCA 43CAB 4RQQB 3GM8A 3O6MH 5TE7L 1T04A 5FYJH 1DBKH 2G75B 1ORQB 3MLWH 4YUEH 5DQJB 3R06A 2OX5A 5ID1B 1IGCH 5EO1B 3RWJA 1JZ7A 4FFYL 2DMCA 3KPRA 4POUB 3C6LB 1ORSA 4EUPB 3JVGC 4U1NB 4XRCA 3WMSA 4HZLB 3FAWA 4DOHB 3RQ3A 1DUYA 2EE2A 2J8UB 2DLFL 1CR9L 4Y4HB 5FUCE 3SDYL 1U3HC 3TO2A 4UUJB 5EC1A 5BW7C 1FNGA 3PGCB 4HJGB 1I4FB 2DQTH 2D7OA 2NLJB 3KPLB 4NCC2 2R2BB 2EDBA 4MAUL 1YMHA 5AWNL 1MVUB 2J12B 2JCCE 1IC7H 4Q6IA 2NPLX 2Y7QB 4N0RA 2HJLA 1WLHA 4YX2H 1CFSB 2BJML 3IF1B 3P4NA 1JGUH 2OR7A 4H5SB 4M7LL 1AQKL 4PRPB 3NFNA 4CVUA 1V05A 3QXVA 1F4WH 4U1IA 5GJSH 2X09A 3VFOA 5HHOD 1NAKH 2IMNA 4XPGH 5ISZD 4WI5A 2PYEB 1NJ9A 4XTRD 4W4NA 2D4DA 5D2LE 1M4KA 2O26U 3LS4L 1NGQH 3HNTH 5EU4A 4OT1H 4EI5C 3BQUD 1SJEA 3DX7A 4PRNA 4Q2ZA 2MOVA 4HUKB 1MFAH 5CILH 1TCMA 5D7IF 4DUVA 3FO0H 3QDHA 2C4FT 4HK0B 3SGDI 3NCYP 1D5MB 3DX8B 3HCVA 5IROC 1Q9OA 1QRNE 5ITFA 5TE4L 5CEYA 4ODXA 4U33A 3R4DA 2BVOA 3ARGA 5FM5O 1EUUA 2AXJA 1KIRB 4GFTB 2AK4D 1A0QL 5DK2A 1NCAL 4M7ZC 4JQXA 3FMGL 3HAEA 1OAKL 5DRZA 3T4YB 3U0WH 3QIUA 2XZAL 3BGFC 4ZFZA 3UPRA 3L3GA 3Q1SH 4HFUL 3JWDC 1S7VB 4M6OL 4LGRB 4UINL 4CU8A 2XIDA 3M8OL 1WC7B 3ROOA 1M71A 3BP6B 1PVHA 3CZFB 1F3RB 3BZEA 4HUUA 2HG5B 1OSZB 1HIMH 3VGFA 3W5NA 4RFEB 5DMIL 1GZPB 2P8PA 1OTSC 3GMLA 3H3PL 4Y1AE 1T1YA 2YXFA 3SGKC 5LVEA 2VN7A 4D0DB 1AO7E 1KLUA 2D7TH 4PJIE 1DEDA 3CLFH 2IQAA 4M5YL 1H3GA 3N9GH 4FA8A 3QULB 4FXKB 3IXAB 5TQ0L 5IHLB 5K33A 3LQMA 3GMPA 5D1XD 1FNHA 3O2WH 25C8H 4RNRB 1A5FL 1RJYA 4MMXC 3I3DA 5JA8B 3QH3B 3QQNA 3KLHD 5TDNB 5BS0A 4LLVA 3GSUA 3QCTL 1CFQA 4IRJC 1UKTA 3BFOA 4TOYH 4MDJB 4IDJH 4G6FB 4LEXH 3PWUB 3V5KA 3FFDA 1AHWA 2E9JA 5TQ2L 2JJSA 3QUYA 3QNXB 4OLVL 5HI3D 4FS0A 4QOKD 4H25A 4OZHB 1NCCL 4Y5YA 1NEUA 3O4LD 1NEZG 5HVGB 3VXQB 2X4SA 4JR9H 3BN3B 2WBJD 2NY2D 4MXVE 1WVZA 4MSWB 4HPOL 4PJ8D 1D6EA 5T5FH 3OJ2C 4NKIL 3BPCB 3MLRH 4ONHB 5CGTA 1YY8B 4Y2DB 1JNHB 3TJEH 4URTB 1DN0A 2DQIH 3MJ9L 2AI0L 4R90L 5IGXL 1RU9L 4Z7WB 4S11A 5HHNB 5CIPB 4FTVB 4NNPL 1RUQH 2X4QA 1KCSH 4PRIB 5DHYA 5FKPB 3MOAH 3AREB 4LSRH 3CLEH 5EUKB 3RWGB 4NO2B 5IHBA 3SOBH 1XF5A 1R3LA 4ZFOA 3D0LA 4TVSa 3SCMB 3SE8H 5GGTH 2XKUA 1KN4L 5HHME 4M93C 3LEYL 3UTOA 1DEEB 4HG4J 5LQBL 5DEFB 1QFHA 2YD4A 3PQYE 1B2WH 3F12A 1ZVSA 4XHJD 1VEOA 2IGFH 1MSPA 1NGXB 3E3QC 3WS3A 4WTZA 4H1LA 2CIIB 3ZE2F 1S8DA 2ZNXA 2J88L 3GSXA 2UYLB 5D5ME 3DXAE 4EEEA 4IDLA 1TITA 3UTZB 3B9VA 3IGAB 4UTAL 3HRZB 4Z9KB 1DLHA 1MF2H 1JP5A 4PJ5B 1S9XA 3SDCB 3MX0A 2P24B 1KTLA 4XCEB 2MPAL 4JZOA 4J23A 1FAIH 5CEXB 5B3JE 2CMRL 3VFNB 4XPFL 1BJ8A 1A64A 1E4JA 3QI9D 3TPUA 4ONFH 1U3YA 5DR5L 1S3KL 1CGXA 2R2HB 5TF1L 1GZQA 1G6RH 2YD6A 4R2GD 4FFZH 4MX7A 1MCWM 3OPZL 5KG9A 1J8HB 1N59B 1WT5C 4OLUH 3Q48A 1WBZB 5EPMA 2MCPL 1HYRC 1YEDA 4P59L 5E99L 3E8UH 1MRDL 3U6RA 1A7OH 1YN7B 2VZ3A 5E2VH 2NX5B 5F1IB 5ICYA 3F7YA 4J4PD 1EO8H 2IANE 3VRLE 1KOAA 5LWYL 3BHBB 5C3LD 1S7RB 4OD1H 3BP7A 3H42L 1FZOB 4NM4H 5KSBF 1U92A 2JTDA 2P8LA 3TA3C 5KVDL 1EJOL 3DJ9A 4OCXH 3S3SA 2YA0A 1T0MA 1CLYH 4Z18A 1WISA 1UACH 4GJTB 3GSNH 1CDCA 4Y88A 4UILL 1U3JA 4OAWA 4PY8J 5FYLH 4X9IA 2F9BT 2XFXB 2ZUXA 4QRPA 4L3ED 4KTDL 1HWGB 5DVKA 4NQDB 2O93L 5DMKB 4L8CA 3HNVH 4JKWA 1YYMH 1G9MH 4XB8A 4FQHA 1DSFL 1I9RL 4YHZL 1VPOL 4LF3B 4JG0H 5EIVA 3TBWB 5C0IA 2F58L 4X6DF 4JO1H 2VUYA 4APQB 1T83A 4KXZH 4P4KB 4OCWL 1NCTA 5DSCB 3UC0H 4WUUD 3WFCH 4Z76B 4BA8A 3S5LB 5J6GA 4YO0B 1OWRM 3ESUF 4NN5C 5L9DH 5D8JL 5E8EA 3JWNC 2B5IB 5L2JA 1QKZL 2YD1A 1MLBB 1NFIA 3V0WL 2XQYG 4YDIL 3MOBH 3WO4C 1KJ2H 4DGYH 3OKMA 1Q0YL 3TV3H 2AJUL 3KPSE 4PR5B 5GJTH 5I1IH 3GBMH 3V4UL 1EUTA 3NA9H 1Q94A 5BV7L 4I1NB 4YHOL 1AI1H 3QAZB 5TE7H 3DO3A 1MVFA 2Q76A 1LP9B 4LIQE 4ODUB 4HHAA 1FL5B 3TJHD 4M6NL 4FFYH 4WO4A 2A1WL 1KLGA 2KBGA 3WEXA 2EDWA 4UIKL 2FNBA 3BWUC 3HG1E 4O51B 4J3WA 1AKJA 3G6AA 4G8IA 2DLFH 3KPMA 1CR9H 4KROD 5HXMA 1NGPL 3SDYH 1BFVL 2F54D 2X4UA 5FV1L 3IS1X 5DJYB 2CXGA 3S34L 1J8KA 3UTPE 4MAUH 5F7WC 5AWNH 4FQXC 1AGBA 4GS7C 5HD8D 4KVCL 2YUXA 2BJMH 2X41A 4OF5A 1NLDL 4Q9BA 4Q9QL 2IJ0C 3K1DA 4M7LH 3GZKA 3SGDH 2QSTA 1AQKH 5D93C 3VH8B 3DLQR 1ZT7A 2E6QA 3CUPB 1QR1A 4K3EL 2IPUK 4CN1A 2Y6SD 4OLXL 4XPBL 2NCMA 5HJ3A 1DQQB 3MSPA 2X40A 4BQ6A 3LPWA 1PD6A 1XR8A 4WFFE 3LS4H 3QUZA 4LP5A 3T0EB 2P5EA 4DEPC 4YGVA 1I7TA 2A74B 2HYMA 3BEWA 2BCKA 2GITA 3P4OB 1NH6A 2HVJB 1FZKB 3MYJA 1FL3B 3O6FD 3DMMC 3G9AB 5FYLD 3RPKA 3ZMRA 5D2LF 4LSSH 2EYTA 3O9WB 1G7HA 5TE4H 3M17B 5CMAA 5D7JD 4Y4FC 1KGCE 2DLTA 1Q9KB 5I76B 3VRIB 4F9LA 3EDJA 1LE5A 4PG9A 1A0QH 4AM0A 1NCAH 4PJCF 1FLRL 4OZGE 1QUNA 3FMGH 1OAKH 2XZAH 3U4AA 5F1NA 1XF2A 1B6DA 5MP6H 4HFUH 4I0PC 5IMKB 4HXAL 4MD5B 4OCSL 4MCYA 1T21B 4OV5A 3HMXL 4UINH 2QHRL 2ADJB 3G08A 5J8OA 3M8OH 1CXKA 2AABL 2ZOKB 2MMXA 1R5IB 3WIFB 4HV8B 3B83A 3QDJB 3T04D 3VWKD 2VNCA 1BPVA 2OMNA 1UJTA 2J8OA 3ORJA 5HVFB 3X3GL 3ZHLA 5DMIH 4N0UA 5L2KB 3AVEA 3WNLA 1IVLA 2CDGB 2OL3B 1NAMB 4HFWB 5CSBA 3RDTB 5FOBB 3H3PH 2X4RA 1BX2B 3TH3T 4QTHA 4BFGA 5J57B 2J4WL 5MERA 4JJ5A 1WEJL 1MI5A 3N50A 2XKSA 4YIQB 3L95B 2D0GA 4KK5C 5C0GA 3BPOC 4BELD 5J89A 1RIHL 3WHE1 2XXCB 3OB8A 5TQ0H 4MQ7A 4TVPE 5C86A 2DWEB 1DQJB 4JM2F 3QXUA 1A5FH 4FABH 5F70A 3PV7A 1G7MB 5E4EB 3BH8B 1J10A 3O8XD 2Q86B 3QCTH 4TVPL 5H37G 2E7LC 1KCLA 5IHZA 4W6XB 4X99B 5FO7A 3GSQA 3I84A 4LEOB 4JFOB 3OXRA 4PJAA 4KKBC 3IT8D 4DGVL 4G80B 2EDQA 4OLVH 2Z4QA 3L3KA 1NCCH 3IDGA 2M1KA 1MHHA 3L1OL 1P69B 2FJHA 2B1HL 4HPOH 4R3SA 4KI5F 4NKIH 3GM0A 2W0PA 4UOW1 3N1MC 3ILQD 4W70A 3SGJA 4JKPL 1L9NA 1CICB 1L0QA 1YPZE 3MJ9H 3DV6B 1Q1JL 2AI0H 4R90H 2LTQB 4JGUA 5INCB 3G5XB 5IGXH 3LV3B 1RU9H 1X9QA 3KPNA 4ZO8A 4LSTL 4U6YA 4XTRC 2MTPA 3CVHA 5AD0A 4NNPH 4YC2B 4KK8C 1QRND 1FO0L 1FFNB 4JPIB 5EZLB 1YNTA 5DRXB 3R8QA 4JFEA 4ZAKB 1KN4H 5HGDB 3JTTA 3LEYH 2LQRA 1PEWA 2YWZA 5LQBH 3NTCH 3DVFA 3OWEA 4PJ7B 3FN0L 2BY3A 3FB5B 5HYSA 2ED8A 2EKSA 4M9PA 1QFOA 3RX7A 4GLRH 2J5LC 1WWBX 2J88H 4XNQB 1B3JA 1JPST 3MNWB 4PTUA 5D70H 5JQ6H 1J0HA 4NC1E 3UDWC 1MY5A 3SDDA 4UTAH 5IT2H 3MA7A 5IMMB 1WFNA 3S96A 3HZYB 1U8HB 4X4MA 1PJ9A 4K3JL 4ONGH 5DK3A 2MPAH 3CX2A 3O2VL 2AXHA 4F7TA 1BZQK 4POYA 1I3UA 1DJSA 4Y1AD 5EA0L 4HIEB 4MS8D 2CMRH 1DR9A 4S10A 3VXOA 4XPFH 3MNZB 3ALXA 3DHMA 3IKCA 3ZKQD 5C0DB 3HA0A 5DR5H 1U8QB 5HGGS 1S3KH 1BWWA 4MZ3A 5TF1H 3Q6FB 1PLGL 5D1ZD 4BFEA 4OFKA 5DD6A 4I9WE 5B3JF 3OPZH 4KTEL 3TYGL 1RK1B 1NGZA 3T0WA 1TFHA 3RKDC 1BJ1J 4P59H 5E99H 1U8IB 32C2A 4XVUD 1MRDH 4PRHB 2VLKA 1JZ2A 2D0FA 3BVNB 1BBDL 1EEUA 3F6LA 3TBVB 2NY4D 1JK8A 1C16B 4OQTL 4CAGA 2BOBA 5LWYH 2BOCA 3W39A 3H42H 3D69A 4ELME 5MEPA 1FIGL 1JF6A 4BQCA 5KVDH 4R7NB 2R1XB 5KS9A 1EJOH 2FEDD 4L29A 2GSGB 2BY2A 4BSWB 1O5DT 5C0AE 2P44B 4J6RL 3VRLF 2CUIA 3C8DA 4LPUA 4UILH 1WWCA 3ZTJH 4CVXA 4OLEA 4ZNEE 4YQXL 5FA4A 5JHLL 1A7BA 3TGXA 1BM3H 4HLZH 4KTDH 3E2HC 4RGMC 1YQ2A 4HWZA 4NQTA 4H88L 1ACYL 1MQKL 2NY2C 4PRBB 1DSFH 1VPOH 4PJ8C 4WV1A 1FNSL 2F58H 3ZT5A 2H1PH 5BJTB 1ZMYA 4JFDA 3WJJA 1A6TA 4OCWH 4U1KB 5H8DA 4X80L 3V6OA 1KV3A 5E08L 3MQIA 4P2OC 4RGOL 2EXWD 1R3JB 3VFMA 1QSEA 5EU7E 4TN9A 1WICA 5E9DB 3V0VA 3FFCA 2F5BL 3QUMA 5CD3B 5HHMD 4R9HA 1E4XI 1QKZH 2KDGA 1KFAL 4FG6D 2ZSVA 3V0WH 3V8CA 3PNWB 1JF1A 3PQYD 1SY6L 4YDIH 1QQDB 2O5XL 3H9SB 4K07A 1Q0YH 2YHGA 1J0JA 1C1EH 2AJUH 5FUOL 1ZS8B 3V4UH 3IDMA 4RGNB 1FNGB 1ZHKA 1JHLL 4YHOH 2DL9A 2IAMD 2B8OT 3DPBA 2X9XA 3C8KB 4XHJC 1G0XA 3TM6A 4NZDA 1CGSL 1P7KA 4X7SL 4M6NH 5DWUL 1IFHL 4G6MH 1MWAA 1T2QL 2GSIA 4HF5L 1PDKA 4LIQH 3ZSSA 1NFKA 2D31A 4LVNB 1NGPH 5DD0L 1BFVH 4PLOB 1QFUL 3GMNB 5CP3H 4IMKC 4X8JB 4PRPE 3S34H 3BW9A 4YNYB 5B38A 3DX7B 3FRPG 3QEQA 1CGUA 2GJ6A 3B6SB 4KVCH 1VFBA 1VFUA 2DYPB 2PYEE 1JWSA 1NLDH 4Q9QH 1NC2B 3HCVB 3QI9C 4GQPH 4K3EH 4P57A 3LKPA 2X42A 5FA3B 1H3XA 2BVOB 5I71B 4KGLA 4XPBH 3IU3B 4ODBD 1MCDA 4WNQA 3SPVB 4GRLA 2IAND 1DVFD 4HS6A 4NRXB 5SWSA 3VW3L 2VL5A 4BJLA 3QIUB 4NOFA 1IC5L 4YFEA 1MAKA 4KJQD 3TBTB 4P4RA 4PLKD 4PJDF 2EYRB 2EDOA 5C0EA 3JBG7 3TT1L 1M71B 3QZWG 3G04B 3N0PB 1CFTB 1YMMD 3MGTA 4N8PA 3A6CL 4FFWD 4PJHF 3GGWB 2ATKA 3O11B 1G9NL 4OZIB 4GBXA 3CDYA 1FLRH 1MFNA 3FO9B 3O4OB 5F72S 4MD0B 4DCQB 4Z7QE 3PP3K 1HXYA 3GJEB 2ICCA 3OG6B 4HXAH 4OCSH 5TE6H 3HMXH 3GB7A 4W4OC 3RWHB 2QHRH 1TQCC 3BISA 4OZGF 2X4PB 1LDPL 3PHQA 2AABH 4JY6A 1ZLWK 2WIIB 2YPKA 4RA0C 4F33A 4MAYD 4JHZA 4XP9L 5F9DC 3QRFM 4BYHA 4DTGL 4LPYA 1HQRA 2MCG1 3B9EA 4LQFL 1P5UA 4M6ML 2VWEC 3PWLB 1RAMA 3X3GH 3GMPB 4PJBB 5IFHH 1ZHLA 5CCKL 1A4JB 5I75C 1JTPA 4HAFA 2R4SL 2LE9A 2A73A 4NFBA 5E6IB 3H8NA 5HBBA 3GRWL 3WKNA 2J4WH 5K93A 1R3HB 1WTLA 35C8L 5FYKD 3VXNA 1MJ8L 5I1AA 1WEJH 5A2JH 1SJHA 3OKEB 4ZTPL 3TZVA 1JFQL 5A2LH 3KPSD 5E2UL 1NUDA 1RIHH 2VIRB 4ZOBA 2Y72A 2ZPKL 5DJAB 2ITDA 1N26A 4UT7L 1FSKB 3RKPA 4I18A 3QWOB 4GT7A 2B39A 4Y5YB 5EO9A 1KSRA 3ULUE 1OQXA 4ZUUB 1M6OA 1FDLL 4TVPH 3HG1D 2Q6WA 1XGQB 3MC0A 2EIDA 1AXSA 4P23C 3X14B 4NZRL 4YHYB 1I85A 1RZ7L 4QRTA 5T1DL 4OZHE 2HT3D 3PXHA 3EOTL 1CDUA 4XVSL 3TJHC 2P42B 2QSCL 4HUXB 3S35L 4DGVH 2BXYA 1DN0B 4Y4KC 4OV6F 5JPNA 4UNVA 1F3DH 4LRIC 4KROC 4S0TD 1ADQL 2YK1L 1UM5L 2AQ1A 2EKJA 1XCTA 3TVMD 4U6VL 3ARDB 1T1WA 1L6XA 4HEPG 3DETD 4Z7VF 3MACL 2B1HH 1AY1L 2BMKB 2WUBL 1HILA 5HD8C 4QRRB 2ZOLB 4Z7WE 3RPIA 3D0LB 1VGKA 2H8PB 4FTVE 4NYLB 4PLJD 4WFFD 1DBJL 3K2UL 3QT2A 2P47B 1WCQA 4JKPH 3FO2A 1TVHA 3QA3B 5KAQG 4NO5B 4PRIE 3ULSA 4P2RD 2Z35A 1NSNL 1Q1JH 4QHLB 4JFZH 1J12A 3MJ6A 5EC2A 4LSTH 3MUHL 5IW3A 3F12B 1EFQA 1LO2L 5CWSA 2OZ4L 2DOCA 1FO0H 3FONA 1UXWB 1S8DB 1KGCD 3GSXB 4J1UA 1YPZF 3S36L 1Y6MR 4QYOA 3O6FC 1RIUL 5ESQA 3CCHB 1H5BC 5TDPA 3QUXA 1AGCA 3BN9D 4P2YA 1KTLB 4X4ZA 3FN0H 1G9MC 3P77A 4JZNA 1Z9SA 5HYFA 3U36B 1D3CA 4LCWB 2LV4A 4DVRH 3H0TB 3MFFA 1N6UA 3LD8B 5EOCJ 3T1FA 3U1SL 5EZIL 4G6KL 2RHEA 4AEFA 3S3JA 1DBBL 4K3JH 3UBXA 4DZBB 3O2VH 2F53D 3JWOL 4WIQA 5HTSA 1JE6A 1N3NA 4I5BB 3VWKC 1P4IL 5FKAA 5EA0H 3U6RB 1P2CB 3FT3B 2AEIT 3QO0A 5AG8A 1J8HE 4HGWA 4QHKI 1OLLA 4XNMA 3LPFA 2IG2L 1JTOA 1KT2A 1PLGH 1DQTA 1UZ8A 3G6JA 3M45A 4F7EB 5KSAA 3OKKB 1FYHB 4CJ0A 4TVPD 1UJ3C 4EZMA 3TYGH 5C9KA 2NX5E 1A1NB 5LAXB 2H26A 1BEYL 4M1GL 1YDPB 5KVEL 4H0GA 2Y06L 5KANG 1JTTA 3HB3D 4OAWB 1QOKA 1BBDH 3LN4B 4I0KA 2VITA 1XMWA 3IRPX 4OQTH 2VJXA 1M7DB 4RFNB 4WW2F 5KZCD 1FIGH 3O8XC 5GRYA 5EN2A 4YGAB 1V8HA 5GGRB 4H20H 4QWWD 1X5FA 1R5VB 3PJSA 2GK0A 2DQUH 4J6RH 2OP4L 4L1DA 1ZHBA 5FUCC 2HTLC 1T1ZA 4NQDE 1UM6L 3SDXF 5DEGA 4N9GB 4YQXH 4NRYA 5JHLH 3U9UA 4JVWA 1BIIA 3C09B 5F89A 1CXFA 4H88H 3VDCA 1MQKH 2IBZX 4I48A 2C7UA 4CBPA 5DFVD 1NFDB 1GIGL 4D2NA 1EAPB 1FNSH 4XNYL 4YBLB 5E00A 5JPMA 2IH3B 5MEOA 3O3UN 1INDH 3BZFA 1HDMA 5IBUB 3BWAB 4Z7NE 1RJZA 1IZJA 3OKMB 3L7EA 2H9GB 1H8NA 3L3HB 3LKOA 4P3WA 4P46B 5E08H 3O45A 4RGOH 2BVYA 3QXAB 4OKDA 1RZ8B 3BPLC 2XPGB 5BXFA 2Q76B 3GI9L 5IB3A 2F5BH 3G5ZB 4PJ9C 5CJ5A 4ZFFA 2PXYA 2YZ8A 4WO4B 1KFAH 2IF7A 3FAXA 4HK3N 1SY6H 2O5XH 4NGHL 5SX5H 5JW4Q 5FUOH 2ZJSL 3FOLA 2NXZB 3NABH 2IPKA 3ZKMD 5J4MA 4LASL 3QIBD 1ZAGA 3NACL 1I7RA 5E8DL 5DUBB 4JRXB 5EU5A 4UV7L 1CGSH 4X7SH 4PP2B 5EFIB 5ESVB 1X6LA 2X10A 4NKDA 5KOMC 5DWUH 4CVZB 1IFHH 1T2QH 4EUPH 1QR1B 5J9PA 4HF5H 3HE6D 4JFXA 4OD2B 3JSSA 3FKUS 5DD0H 2J8UF 3ARSA 4ORZC 1QFUH 4K3GA 4R0LA 5ETUB 5J56B 4BFBD 2FGWH 4RDQF 3QIWB 4MNQA 4MB4A 4MS8C 3DYPA 2BCKB 2AJZA 5F71A 3EHBD 3MYJB 4JM2C 2N1KA 3S35X 1JHTB 2B1AL 1Q9LA 2VLJB 1A6VL 3MV8E 5CMAB 5D1ZC 3T0EE 4UAOC 2Z93B 5F7HA 1LNUA 1LE5B 1YY9C 3ABZA 4K23L 2PCPB 4PTTA 4EIZC 4AM0B 1X5XA 3VW3H 4XVUC 3ARBB 1ITBB 2ESVB 4NUJA 1IC5H 3NCFB 1XF2B 4LNRB 2DIBA 1KIQB 4M9OA 5C0AD 4UT6H 4PV9B 3QFJB 3SKMB 3RTQC 4AEEA 1MCHA 1ONQB 1FZJA 2YZ1A 2EYSB 4OM1L 2D3VA 3TT1H 3O0RL 5IB4A 4K7PY 2CXKA 3E6FA 5EZOL 4CMMA 3A6CH 1P7QA 4KI5C 2YA2A 1QPPA 1G9NH 1MIML 3NAAL 4N0UB 1C12A 3VFTA 5A3IC 3VXUA 1BBJA 3BJLA 3PWNA 3QDJE 5LGJA 2ATPA 1T5XA 2IPTH 2WIMA 4OF6A 1NEZA 1H0DA 4PB0L 5C07B 1LDPH 1MI5B 3EYQD 1T1XB 4Z7QF 4DKFL 4XP9H 4OZFG 4DTGH 5F6IB 4L4VA 4QXGH 5IB5B 4R7DA 4LQFH 4M6MH 2AQ2A 2XWBA 3DUUA 1A3QA 1I1RA 4UT9L 4O5LL 3MRJA 1FVDA 2OL3L 1NAML 2VAAB 4GMTH 5CCKH 3IVKA 2R4SH 1J86A 1SYVA 3DGGA 3HPJA 1IMHC 3GRWH 4DN3L 1TJGL 3IJSA 1X5GA 1A9EA 1J1XL 35C8H 1MJ8H 4KZEH 4Z7OF 1JMZA 1LWRA 1RULL 5IHZB 1JFQH 4GW5A 5E2UH 1UFUA 2CLZA 2ZPKH 4PJAB 2JIXD 4WWID 3C6LD 2NZ9D 1NBQA 4ELKA 1GGCL 4EVNB 3L3KB 1G7IA 2YSSA 3BGMB 4Y4HD 1BD2D 4C59B 1E0OB 1FDLH 5SV4A 4H8WH 4XI5D 5I1HL 3HE7B 3Q3GA 2AJ3A 4LCYB 2BY1A 4R3SB 5ITBL 1RZ7H 5T1DH 3ULUH 3EOTH 4XVSH 4QRQB 4N0CD 2QSCH 2QBWA 1BFTA 3S35H 4J3VA 3IDYC 4PRPD 4M7KH 3CH1A 4I4WA 1I1AC 4J3UA 3MRIB 1UZ6E 2PYED 5DF0A 4U6YB 1ADQH 3CVHB 5AD0B 3DRQB 3CFEA 4Z5RB 43C9A 2YMXL 4U6VH 1O7VA 1W0VB 3LKRB 3MACH 1AY1H 2CLRA 2ICWB 5DJ8A 2WUBH 4HUVA 3C9NA 3W9DA 5KJRL 1FFRA 1YN6B 3CC5A 1FG2B 4NSKA 3U46A 2IPUG 4KKNA 3NIGF 1W8NA 3K2UH 4GG6F 2DDQL 5DMYA 4JRYB 3EZJB 4BFIA 1NSNH 3NGBC 3BUYA 3KYNA 2EIEA 5CIPH 5HYSB 4RMTA 1KIPB 4Z7WF 1QSFA 1LO4L 1LO2H 2OZ4H 3N85L 2BVPB 3NFPA 3S36H 3PDGA 4PJ7E 4HW6A 3JVGA 4PJXA 1HK6A 4Z95L 1OHQA 3BIAX 5TF0A 1ZLVH 4PLKC 4ZPTA 1RIUH 3S96B 3GKWL 4HQQL 1U3HA 3SJVB 5BW7A 1MPAL 3T0XA 3UMTA 4FFWC 3LAFA 4P3CL 4IS6B 4JAMA 1YJDL 3EO0A 4EBQL 2V5RA 3QYCA 4UQ3B 4W68A 1A4KA 1NGWB 1LEGA 3UEZA 3KPPB 1G84A 3MUJA 3MRBB 2EE3A 1N0XL 3U1SH 5EZIH 1IM3B 3NH7L 1OLZA 2C4FU 4G6KH 5E0QA 1IKNC 3F65A 3STBA 1DBBH 1RY7B 3V4VL 1K85A 1EEYA 3VDBA 4MAYC 3JWOH 4EI5A 1AGEB 1NLBL 1T22B 32C2B 3KPQA 1DQLL 3B5GA 1P4IH 3I75B 1MRFL 1CG9B 1XZ0B 3RGVB 3RNKA 3UCRA 2J8HA 2NW3B 5DRWB 5IROA 3ZDZE 2IG2H 1JK8B 2Q87A 4GKZA 1WITA 2BOBB 1HHKA 2BOCB 3CJJA 2ZUTA 3D69B 1TNNA 4GAYB 3VWJC 4S1DD 4PRHE 5BV7C 3UTTE 5KS9B 4GQ9L 4G8GE 2J7LA 1SEBA 5IWLC 1BEYH 4M1GH 5INDA 3ULUD 3BX7C 1WAAE 5EOTA 2Y06H 4WW1A 3REWA 5D6DC 2XT1B 4NQXB 1S7WA 1CF8L 5C0FB 5D7LA 3TN0B 1T3FB 3DURA 2ZSWA 1ZGLB 5CBEA 4XHQA 5B39B 4Y19A 3GJFB 1AQDA 3RL2A 3FT2A 4FNLH 3QHFL 4ENEC 3QXDB 4WV1B 5T1LD 4JGMA 2OP4H 3D2UA 3CFDB 4JANB 1A6UL 5CLWA 3VDAA 1ND0B 1BF2A 4Y2DD 2C4XA 4UDUA 3U0PB 2VABB 5I30L 3D3VA 3SGKA 3WHXA 4NP4L 5I8KL 3BPNC 3TVMC 3QUMB 5I6XB 3DETC 3KGRA 4IRSB 2VKXA 3BO8A 4PRID 5KOVC 3RL1A 3QG6B 4XNYH 3I9GL 3CX5K 4X6EA 4IJ3B 1JF1B 3WN5C 1EVTC 3P30L 5E9DE 5C3TA 5IF0A 4GRMB 4PLJC 1OAQL 4KGJA 3MRGA 3MRKB 3RA7L 1I7UB 3TBYA 3E6HA 3IDMB 4TTGA 1DE4A 1S7QB 1ZHKB 1SQ2N 1F42A 4HH9A 3EOAB 3LS5L 3H9SE 1IL1A 4Z7NF 1VKXA 2EO9A 4OLWL 4AENA 2QQNL 5F9AC 5T1KA 1JGLL 1HEZB 3WIHA 4RGNE 3OKOB 1MWAB 1XGUB 4MWFB 4PFEA 1LD9B 3B5HA 4NGHH 3VFGL 2D31B 5KBNC 4X6CA 2HJKA 2ZJSH 5FO9A 4E41D 2P5WA 3G5YB 4F80A 1QBAA 1A22B 4V1DA 1ED3A 3BN9C 4LASH 4WJ5A 1CFNA 3NACH 1KBGL 3BW9B 5E8DH 1QTYT 4UV7H 4NQEA 5HI4C 2P43B 5KSUB 1LP9F 1RHHB 3CNKA 2Z8WC 4BQ8A 1RMFL 2VDML 3L7FB 1CQYA 3MR9A 1WGOA 1MH5A 3JV4A 4P57B 5BQ7B 4FZ8L 1UT9A 4HKBA 4P9HL 1QSVA 3ZHDA 3LDBB 1FCCA 4C54A 3V4PH 1J8HD 4GRLB 4P2QA 4EDWL 5DA4A 4OGZA 1MCCA 3VGEA 2WLYA 1DDHA 4L9LB 2I26N 2DTSA 4WEUD 1YEHL 5HHOB 5IVXA 2JB6B 5ISZB 2NX5D 1VACA 4P4RB 2B1AH 3MBEA 4AT6A 4NKOB 1A6VH 2O5ZL 1GXEA 5JLZA 1N5YL 2PETA 5ACMA 3BQUB 2DQGL 4WWKD 1K8IB 2EDTA 2O5YL 3HB3C 4WHTA 4Z7UB 3M1BB 4EXPX 2WANA 1B0GA 1BHGA 2AK4B 4OZIE 2NY5L 4OM1H 1WFUA 3X12A 1S9KC 3O0RH 4JY6B 2VQ1B 1KPVB 3SKOB 5EZOH