3TYGL

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt128 in complex with a glycosylated engineered gp120 outer domain with miniv3 (eodmv3)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
ESALTQPPSASGSPGQSITISCTGTSNNFVSWYQQHAGKAPKLVIYDVNKRPSGVPDRFSGSKSGNTASLTVSGLQTDDEAVYYCGSLVGNWDVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system, viral protein
total genus 35
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2011-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygL02
3N1MC 2EIEA 4GKNB 5K9QI 2AVGA 3SY0B 4G6KL 3DXAA 2GTZA 1RUPL 2LTQC 3EOAA 2H3NA 4LGSB 2N56A 3VG0L 2G5RA 3AB0C 5D4QA 4MQ7B 4YO0B 5HHNA 1UCBH 4ZD3L 5CUSL 1I7RB 1LMKA 2WIIB 3IKCA 1QSEA 3U2SA 2CIIB 2FBJH 3B5TA 4KI5D 3PWPD 1U41A 1H5BC 1KCKA 1I1RA 4Z7QF 3SDYL 4HPOL 4I13B 5L6YH 2O93L 3DURB 2F54E 3GMLA 3SDCC 3S3JA 5BZDA 1T22A 4WJ5A 1Q0YL 3SJVB 4BSWA 1C12B 4J23A 2BMKB 2QQNH 5CZXD 1RUQH 5CJQH 4PJFF 3UROR 2CIKB 3WFEH 1RQ5A 3WN5C 4YX2L 5DFVC 4I0PB 5IVXF 1BZQK 1EUTA 1I8LA 2X9XA 2AXHA 4FQ1H 5IQ7H 2HJLB 1OP5K 1LEIA 3CFCH 3FRPG 2R1WB 2QQQA 4U1MA 4B7IA 4NQEE 1YJDL 4Y7MA 4LCWE 2ENSA 3EUUA 2ZOLA 3L6FA 3UTTE 1BD2D 1QFUH 3KPNB 3MOAL 3TO4C 1AXIB 2R0ZL 4E0RB 4PJ9C 1P4BL 4YHYB 2PYEA 4APQA 4O2CA 3AY4A 3MACL 2BNRE 4DFIA 3CVHL 4OUOA 2CDFA 3UYRL 2VDQL 1OP3H 2EDLA 1RZFL 1AGBB 3K4ZA 3LN5B 4JQXA 3QIUA 1CYGA 4O00A 4NQXA 4LRIC 3FB6B 4P2OB 2OK0H 2IWGA 1LO0H 3X3FH 5ICYB 3RY5A 2OL3L 2DQFA 4XPAH 4ELME 5C0AD 4XH2A 3MLUL 3ZDZF 2YWZA 2YD2A 2PKDA 2MJWA 1EMTH 4Z8FH 3B6SB 1KJVA 4CMHC 1NGXA 5GGVH 4HXAL 1EAPB 2HLAA 1Z9OA 2NYYC 3MRPA 5F71A 5F8QC 3QUYC 4MDJA 5E8EA 3UJTH 3U30C 3O8XD 3ULVL 2APFA 3PWPA 3O3BA 1PQZA 4MSWB 1A8JH 4P4KB 1ACYH 2YMXL 3QQ4B 5DD1L 5DRNB 1J1OH 4PJAA 3KNBA 5HVWA 5AZ2H 4FQIH 4XBPA 3N1PC 1AY1L 4GRLD 4QNPF 4X0KB 3O9WD 1F6AA 4JEGB 1KN2H 3HZYB 3QYCA 3HMWL 3KPRD 4ETYA 3MLVH 1I9IL 3UPCA 4M7KH 3MRCB 1N5YL 1U8OB 4PJ8B 1MWAB 4GQ9H 3LRSB 4YBHA 3T3MF 5IB3A 4R4BA 1IM3A 4HKZA 3FT2A 1BD2A 2CLVA 1EVTC 4PJCF 3LPGA 5DZNA 4S1DC 3LKQA 1RZGB 2D7NA 5SV4A 4H1LG 2QADD 3Q48A 1DBBL 4JGMA 5HVHC 4WTZA 4G8IA 3RVXC 1G7PB 1JI1A 1NFIA 3PWUB 4GFTB 2X4SA 2R0KL 4RISL 3P11H 3X11B 1I1AD 2VITB 3FQWA 4MJ6A 3T0DA 1DQDL 1F4YL 2HG5A 1FO0L 3F58L 4S0TD 1Q1JL 1OPGL 3KJ6H 2HVJA 1OLZA 1JWMA 1RY7B 1DEEB 5DJCA 5HGGS 1HNGA 5C0AA 4ONGL 2X4QA 4WI8A 4P2RD 1RJZA 4JN1L 1QUNA 3VFTB 4DW2L 1NCAH 5E8NA 3WUWA 4PB0L 1T66C 1QFWM 4ZUSA 4OGYH 5HTSA 2YUZA 2DMKA 3O8XA 4TSAH 4S1SH 4HLJA 1IAIM 5A16B 4WCYL 1X5FA 4LNRA 1VFBB 3DUSB 2VLKB 1HWGB 2GQHA 1MFDH 4JR9H 4ZFGL 5CZVL 2X7LA 3ARBA 2LV4A 4G6KH 2VXVH 1RUPH 3VGAB 1HQRB 1SJEB 5GSRB 3O9WA 3TWCH 1XGUA 3HPLB 1H3PH 5K93A 1AP2B 2C5DC 1XIWC 3VMOA 1OGAB 1KF9B 2PNDA 3LPWA 3KPRA 1KFAL 5C09D 4C59B 2WBJB 3GSNB 3L7FA 1CIDA 5IB4B 2IAMD 4TPRL 3OAZH 4HPOH 4XNZB 3U79A 1UWXH 4IS6A 1DQLH 1JTTA 2WK2A 1UADC 4IM8A 4N90E 1Q0YH 4POUB 1F8TH 5HYSA 2VWEC 4UDTA 4MHHI 1N2RA 1W72L 1ADQH 3ILQD 3EYFA 3QCUH 4ZDHB 3MV7B 3W39B 3VXUE 1TENA 1ADQA 1JN6A 1T6VN 3HI1B 3EJYC 5SWZE 5EORH 3QIBC 4N68A 1VEPA 4JCLA 3T4YA 1BZ7B 3O11A 4UIKH 5HHOD 4RDQF 3WFHA 4WFGE 2B20A 4U1NB 1B2WL 3ME0A 1I1AA 3HG1D 4NO3A 3I3DA 1MREL 3FRUA 1P4BH 2V17H 3QUMH 4WFFD 3MRHA 2NY6B 3RHWK 3HI6H 3MACH 5JLZA 3H3PH 1CFVH 1N7ML 1GGTA 5BS0D 3WSQH 1U8LA 2RCSH 1J05A 2HRLA 2LU7A 4P2RA 2YN5A 3NAAL 3G6JA 1AR1D 3WHE0 4I5BB 4KJQC 4PUBL 4P5MB 3QH3B 1PX3A 5DVNA 3REWA 3TBYB 4JDVB 4M43L 1A6AB 1UYWL 3G5XA 5EBLB 5F9WB 4EI5D 5F7EL 3V52L 1D5IL 4N9GB 2APXA 4DVBB 1MI5D 1A1OA 1YN6A 4G3YL 3QZWB 4PJBB 4YAQB 4XBGA 4YGVB 5EG6C 3X12A 1CG9A 1UM6L 3GJFA 4M6ML 5EU6B 3DWTA 2UYLA 1MELA 4PJ7A 4JPKL 4Y2DD 4EUPB 4YEFA 2NY0D 1YMMD 1A7QL 1E4WL 3MV7E 1PVHA 4W81A 2JIXD 5GRXG 2V2TB 1Z5LA 1KIRB 3DROA 1BX2B 4X9HA 4KTDH 5CP7A 5C09A 3WDHA 1TJGH 4PGBA 3MV8B 2YMXH 5DD5H 2CXGA 1FBIL 1G7LB 2A6DA 4V1DD 4JFYA 2VLRE 5E0QA 1CGYA 4U1GB 1BREA 2CUMA 4JFEB 5CBEA 1LEKA 4MCYA 1I8LC 4GAYB 2EXYD 1GIGH 1NEZG 2DKSA 5EBWB 1TPXC 3FAWA 5TDOA 1WCBB 2DD8H 1QBAA 4PJGF 5HYJB 2ERJC 1AI1L 1JYVA 1XGYH 3W0WD 3N1QC 2NY7H 5H94A 2Q8BH 4KKAC 5HHOA 5DD0L 5JO5B 3C2SA 3MJ8A 4PJBE 3AY4C 4LARH 3HG1A 4JGUA 1BFTA 3O45B 5EU6E 2ILLA 4ZAKA 3CFEB 3RUGA 2HFEA 3GB7A 1KCVH 4Q6IC 3LRGA 1CFSA 4R3SB 2A1WL 3L95B 5BS0A 3KPMA 3CXDL 4X4ZA 5FOJA 2HMIC 4JQXC 5HHXL 3SE9H 3HB3C 3QIUC 4JRXD 4JG0H 2R56L 4HGMA 2DRUA 3DX7A 3MFGB 2XTJC 1INQA 3UAJC 5D8JH 2FWOA 5GS1B 2J12B 5D5MA 4KK6C 1FO0H 3F58H 1RUML 1OPGH 3T3PE 4LDLB 5I74C 2CO6B 3GSQA 2D3VA 2F5AL 1S7RA 4L8BA 4JFEE 1MI5A 4KTYA 3MCLL 1R5VB 5CSZB 5JMRA 3SDXA 4QRPB 3IJYA 3K74B 3AS0A 4Y2DA 1YMMA 1A7RL 5GS3A 1OQXA 3VXRB 4KI5C 4TUOA 4E5XB 1X5KA 1R6VA 3H7LA 4NZRL 3JTTB 4JB9H 1MCBA 4L4VD 3OXSB 2I07A 3HZVB 5CEZH 5E99L 1A9BA 1S9XB 1IC4H 4WCYH 1ZS8A 3K4AA 1TVBA 1TVHB 1TTUA 5CZXC 2CKBB 3TNMB 4WTWA 5KOMC 4V1DA 2J8UB 1NC2B 1WZKA 5BXFA 1Q9OA 3O6FD 1W8NA 2F58H 3OGOE 5DUPL 3U0WL 1KFAH 5D7KD 4PP2A 1HXYA 2Y6SD 4PLOB 3IVKB 4TPRH 5JHLL 3W0WA 1KCSH 3BT2H 3MODH 5GGSB 1KLFA 2WLYA 2F19L 1O7VA 2P24B 3JV6B 3FO2A 1CXIA 4PRHB 3TN0B 4IRSB 3S97C 4QRPE 3ULVF 1N3NA 4WHYG 3P2TA 3I6GB 5A43C 1CTOA 1RZ7H 4RZCB 4RMRA 3HPJA 5J7CC 3N85L 2KUTA 4LQFL 1QLEL 4ZNEE 4JRXA 1P4LA 5DLML 3HTLX 2DQUH 3PGFL 4PRDB 1BM3H 2J1KA 2HJKB 1FAIL 4X7FC 1X6NA 2C4FU 3QJFB 3AGVA 3VU2A 4AH2B 1NAMA 2J8UE 4X5XA 4F3FA 1U58A 4ERSL 4K94C 4Y0GA 3OG4B 4LKXA 2FIKA 3OKMA 5TQ2H 3ARPA 1I8IA 4FQXB 5M7QA 4L8CA 3NAAH 3FQTA 2BOCB 1XCTA 4M4PA 4OZIF 5L0QB 3HE6A 2JJSA 4FFVC 3O8XC 4PUBH 4KK8D 1M7IA 1WFTA 3FFCA 4L4VA 4LVNB 5DJDA 4M6OL 2B0SH 3VFMB 3L3HB 1KB5L 5F7EH 1V7MH 4R8WL 1DBAH 3ARBC 4PRHE 2FB4L 4XMPL 3T2OA 3VGDA 4X99B 3L3OA 2VQTA 3IXTA 4HIXL 2ATKB 2O61B 4HFUL 1DLFH 5JHDE 2DS4A 2LTQB 3A6OA 4G42B 2CUIA 3AB0B 3O6FA 3U4BL 2D9CA 1WISA 1X5JA 5FO9A 3VW3H 5KAQF 4NQVB 4U7KA 1AQDA 4UOJA 1G9NC 1OVZA 4LGRB 2VAAA 3LRHA 2EKSA 5GJSL 1NSNL 2LAAA 3FB7A 5B3NA 3QDMB 2PTTA 4PV8B 2OP4H 4HFWA 4XP6L 4IEFB 5I8CB 1ZT1B 3VFGL 4PJHB 5ESAA 3F8UB 1UZ8A 4AT6A 1Q38A 1P4IL 1NGYB 3P73A 4ZUWA 1I1AC 3HA0A 1K9TA 1QYGH 1JPFB 1S5IL 3KR3H 1A1NA 4KFZC 2NZ9D 3KYNB 3QEGL 4FP8L 2VIRB 4LSUL 5IHZA 3MMEB 5HYEA 1T1XB 3RWFA 3CPLB 1BFOA 3FQRA 2X70B 2G60L 4NKQB 5KVFH 1D7FA 3RX5A 1HIMH 2A1WH 4NHCH 1ODAA 1G7HB 4DGVL 3MUJA 2CLZA 2QV2A 4JHWL 4N1EA 5ACLA 1JZ6A 1NDMA 5EUOE 3ALXA 4JVUA 3WNMA 2WWKO 2FBOJ 3IKKA 4FFYH 5DQDH 4RRPA 5GGSY 4U6XB 2GTWA 1OGTA 4RFOL 2AV7B 1HKLL 2DBLH 1Y0LA 4MNGB 3RL1A 3DO7B 4FFZL 2F5AH 5DTFB 4MA3B 4YDKL 2C7UB 3W2DH 1MFEL 3MROB 2DQDL 2A9NL 4QGTA 4QTIH 3RWDB 1MCLA 3SKJL 4U1JB 1A7RH 1QVOA 2VR9A 2KZ1B 1FFOB 4Z6AT 1DDHA 4FABH 4H1LB 2OCFD 1ORQB 3VD3A 2CH8A 4E41E 3MYZA 1RHHB 2Z0BA 4XNXL 3PJSB 4OGAD 1OAYL 3QDGD 3ILQC 3C60D 2BCKB 5KVGH 1QKZL 1AE6L 3I84A 4P99A 4WEBL 4NQDB 4NQSB 3AUVA 2EIZB 5L8JB 3QEHB 3LCYA 2D7MA 3V5DB 3IF1A 4ZAKC 3SO3B 1I7ZB 1N0XL 5TGBB 5DI8A 2XYCA 1U2HA 4JGJA 1SYVA 1U93B 3TYFA 4GW1A 5E7FA 3NIGE 4AEFA 2VRAA 4UQ2A 2B7DT 2EDNA 3BWAB 1RIUH 4R9HA 3P0VH 1L6XA 3KPQA 1QZ1A 1FLTX 3TT1L 2HRPL 5IJVA 1X5LA 4PY7A 5DRWB 1MCWW 5DLMH 5EC1A 1MHHB 5JMOC 3DGGA 3TEUA 3GNMH 3RTQD 3THML 3N0PB 1MIML 4Z7WF 4NZJA 2I9LB 3TZVC 1TQBB 2NY0C 5DMKA 5JW3H 1GPOL 1DN0B 3Q6FB 4UTAL 1PEWA 1TTFA 3E8UL 4OAWB 3EOBB 4DOHB 4U2YA 4JPWL 1EHNA 4HG4J 1B3JA 3MRIA 3MYJA 3FQXB 1CDHA 1KELL 5LCVL 2V5YA 1JGUH 2IH1B 1H0DA 4X6CB 4L4TD 5JW4M 5FYLH 3BXNB 5L88L 2R4RH 2JB6A 1BJ8A 3QRGH 4KROD 2VMFA 4KRPD 2UZXB 1T5WB 2JJUA 3J7HA 3PXHA 1F90L 4PJXE 4QHMB 3QDGA 3QULB 2DQIL 3C60A 15C8H 4FFWD 4FA8A 1S7XA 3LKRA 3PQYD 3U4BH 2O5ZH 2BSSB 4N0YL 2XTLA 1MCRA 1HHHB 2FYYA 3TYGL 2VDOL 1MRFL 5HGDA 1P7KB 4XWOD 5F72S 2DQJL 4DWHA 3K2UH 4Y4HB 1NSNH 3HNSL 4RMQA 1N6VA 4PJDB 2J5LB 2CR6A 2DQHH 2P42B 5J06A 2IPKA 4QRQB 4Q9CA 1FC2D 1KLGA 5I6XB 3SDAA 5I75C 5CINL 3VRJB 1FYTD 3CC5B 4DCQA 4BQ9A 3ZMRA 1VENA 5GHWH 4NFDA 2RFXA 4HH9B 5D6CB 1OAQH 5ERWA 3P40A 1I3UA 5JXAH 3BEVB 1R3IL 1JFQL 2FEDD 2A38A 5IHLB 1HXMA 3IDYC 1QR1B 4FQJL 4KPHL 4OLUL 2HH0H 1U36A 1DUYB 2E7BA 4NN5B 3TBVA 4XCYA 1IAOB 2AQ1A 3OKKA 5A2IH 1FIGH 1RZKH 1TNNA 3F6LA 5EPMA 5ICXB 3WS3B 3HE6C 5BOZG 3EFFA 2JJSC 2NLJA 3PGCB 4GG6A 2Q6WA 4LLAA 3QG7H 2ORBL 5M94B 5D7IA 1RI8A 3RNKA 4U1IA 5D96B 1W0WB 3T4AA 2F53B 1NEZB 1T7XA 5AD0B 2GKIA 4RFOH 4E42A 4E9LA 4L4TA 4F7TA 3GBLA 4HDIA 4CN4A 2EYSB 2E7LC 1QA9B 2DLEA 3QPXH 4WI5A 3AMKA 2AV1A 4PB9L 4UV4L 3GIVA 5TF1H 3MGTA 4LVEA 4XPHH 4R7DA 1FZMB 1VA9A 5E8PB 2H6PB 3BPLC 2A6JB 3PQYA 4RWYH 4OV6F 1FV1A 1IM9D 3B9KC 3FAXA 4MXQD 1NKOA 3TCXA 2AEIT 1NCWL 1XF3B 4N0UA 4JVWA 2NCMA 1DQTA 2EYTA 2YPKA 4P57A 3QUXC 2O26U 3CDGB 1M4KA 1P84J 1JHLH 1G1YA 4XP9L 5FHAL 1FZOA 2HT4D 1FNHA 1PG7H 4HPYH 3FN9A 2FO1A 1AE6H 4HC1A 1V3JA 4GW4A 5LGKA 4OGXL 1Q72H 5TE4L 1MCKA 2C1PA 4GMSH 2UZIH 2JKXA 4RA0C 2F53E 1FH5L 4JFDD 1P9MA 1YDPB 1GVIA 3BUTA 1C7SA 4MAUH 4YDJB 4G6AC 1KXQE 2X10A 3FHAA 3C2AL 1EXUB 4J8RB 4BKLA 3WNOA 1N0XH 1CE6B 1A6UH 4BQCA 5D71L 2DQTH 1ZSDA 3ROLB 2YD3A 3G9AB 3UZEA 4OZGA 4XNUL 3U4EB 5F7NC 4Q6IB 5HGBB 3E0GA 4H25B 3VI3F 4U6HA 1FL3A 4KK8C 5F1IB 5F7HA 2HRPH 1S7TA 4FMFA 4RWHA 2UZYB 3HNVH 4PRPB 3T0ED 4CAGA 5BVJB 4XCCL 1FN4B 3UBXI 1MHPL 5IVZB 1HH6B 2HKFL 3CFJB 5K9JL 3FONB 1OAUL 5DJZB 3TC9A 2DJUA 4WHTB 4K8RL 1CLYL 1MIMH 4KHXL 4NZTH 4GAGH 4LCIH 5J6HB 3L1OL 2R2HA 1G7IB 2UWEA 2V7NA 3QFDB 4G8GE 4H8WH 1UXSB 5IEKB 4IMLA 3IFLH 1JGLH 2R69H 1MFCH 1M05A 4YFLF 4WW2A 4EDWL 5DRZB 3BRDA 1J86A 4JPWH 4XP1H 3WFDH 1S9YA 1ZA3A 1IQDB 3BEWA 4G9FE 4QXWA 1XGTA 2GCYA 1IM9A 5FUZH 3T1FB 3RA7L 2CDEA 3LQMA 4F57H 3DMMB 1S7WA 1QRNE 1XCQA 1F90H 1HHJB 1ZVSA 3BIKA 3A67H 3BISA 2YHGA 3NZ8A 5F7DB 5BQ7B 3I3BA 4PREA 2CDGA 4BFBD 3HMXH 4YHLH 1H3WM 3EYVA 1F4WL 3T2PA 1MSPA 4PTUB 4Y19E 3NPZB 4BH8A 2BRRL 2Q8AL 5DMJB 1GGCL 1D5XB 1OARH 3TYGH 2D2OA 4UDUB 2NZ9C 5ESQB 5HHMD 5FK9B 1QLFA 4TSBH 5J9PA 5DQ9A 1FVCB 4JFDA 5FM4A 4RAUB 3VH8A 1QBLL 2ZPKH 3WIHH 3HNSH 5D7SH 2FLRT 2GSIB 3NACL 5EBMA 2R0LL 1OB1B 4NO0B 1KGCD 1C5BH 3OGCA 1B90A 4OT1L 4TVPH 5IB1A 3HC0A 4HUNB 4LHJB 4U0RC 2PW1A 2XWBB 4XVTL 1INDL 2NY2B 2VO5A 2W59A 5I8EB 1B0GB 2WANA 4GO6B 5E1AA 3DI3B 4FTVD 5FHBL 1I1FB 2YA2A 1IRAY 3T0EA 1IGTB 2H1PL 4KPHH 1WEJL 4YR6B 4C83B 3QI9B 4JFOA 1N59A 2OZ4A 4DTGH 1MHCB 1KBGL 3RDTA 2YKLH 4I48A 1ZEAH 2B4CL 4NM4L 5GRUL 4P59L 4NT6B 4ELMF 1RU9L 4WDIB 3T0WA 3U36B 1U3YA 3D2UD 4F58H 5EO1A 4IDJL 3LAFA 5L2KB 1ZT4B 4UU9A 4IHOA 1MUJA 1JK8B 1F97A 3MO1B 1DL7H 5EU3A 2FD6H 2H32B 2XWTB 4X4XA 4HT1L 5CZKA 4HQQH 3PP3K 3FO1B 2VAJA 4OGAC 3FTGA 1SHMA 2ICWA 1MVUB 3E6HA 2FH6A 2O5YL 3SE8L 4X7TB 3C60C 3Q5TA 3CUPB 3JSSA 4QHKJ 3MBXH 2R2EA 4GAJL 3QQ3B 4HS6A 1SEQL 5CILL 1DR9A 4OZHE 5SWSB 5J1AB 1Z0NA 4MWFB 2CKBL 5BZWA 1DANU 3LN4A 3STBA 3LKOA 5B4MD 5DMIH 2R2BB 2PR4H 4K7FB 1S7QA 5BW7A 4YHML 1R5WA 3VCLB 2R8SL 4DGYH 4OBSA 1L7IH 2LABA 4PY8J 3SDAC 3OZ9L 4P3DB 4XP9H 2QQLL 1CD9B 2AJUH 2PYFB 1CR9L 4HF5H 4HBQA 1LILA 2C4FT 3BE1L 3ZO0A 5L2KE 1TZIA 1CIUA 5CD3A 2DTMH 5L7XL 4OGXH 2C26A 3CIQA 4MS8C 4M5ZH 1U8PA 4HMDA 5F3HA 4FTVA 3C2AH 4NHUA 4P9MH 4FZ8L 2WWMD 3DRTB 4QRTB 2MOVA 3RWGB 2OMNA 3ZTJG 3PHOA 1FIEA 4G80A 4HIIA 1OP5H 4PJCA 5I1HH 43C9B 4ZUTA 3NFSH 1YNLL 3IT8D 3G04A 5SWSE 3D2UA 5DR5H 3KWWA 4NJAH 3C5JB 3MNWB 1FJ1A 4O9HH 5EO0B 3V5HA 5DJAB 3QEUA 1EBPA 5KZCD 1NCDL 4KROC 1OAUH 4HCRA 3U9PH 4CVUA 2DMBA 4ELKA 1IAKA 3OAUH 5I16B 3FZUD 3WLBB 1EERB 3WO4B 5DRXA 3U7AA 5FOBA 1ERNA 3QUKA 4FFWC 4EXPX 4F37F 3JUZA 1U3HC 3DLQR 5IW1B 5ITBH 2Q86A 3TCLA 3V5KB 1BQHA 1UVQA 2FH8A 5HDQL 3T0BA 3QWOA 3TBSB 3BQUB 3BKYL 3LKNB 1DCLA 3NCJH 1B6UA 5FYJD 3D39D 4X9FA 4Z0BH 3OKOA 2A6KB 2QHLA 5J13B 3ULUE 4GUPA 2KH2B 3MLWH 4CU6A 5IEHB 2VLME 3O3EA 2VXUH 3WIIL 4MJIA 1X5YA 4OFYD 2V9QA 4AEHL 2NTFB 4OD3H 1F4WH 3D0LB 5GGUA 4JHZA 1PEZA 1N4XL 3NABH 3GBML 3PUCA 1CGVA 2ZWLT 1Y18A 4L9LB 1P9MC 4NRYA 1GGCH 4QRSB 2JCCE 4J3UA 3P77B 5DD6A 3RWCA 3F7QA 5C9JB 3GIZL 1B88A 4TUJB 4I2XE 2XV6B 5FUOL 4WNQA 1QP1A 1LD9A 3CZFB 2QEJA 4D8PB 2R29L 3T8XA 4HV8B 4JDZB 3DV4A 3IAQA 4H20L 4LMQE 2Z9TA 3WEXA 2DM4A 4LPTA 4PGEA 2P8MA 3P3YA 1A7PL 2GJZB 4ZSOB 2ESVD 2A77H 5D7LB 4OJFH 4XVTH 4KHTH 1DQML 4PG2A 2CMRL 5EULV 5JDSA 5FHBH 3O3AA 5M95B 3GO1L 1KJ2A 5F7UA 5I1AB 1UB5B 4G9DB 3VXMB 2ZJSL 3R4DA 5KOVC 1WEJH 2GAZB 3BGAA 3QDJB 4MA1C 4JY5H 4OCNC 5IR1B 2R9HD 1KLUB 4P59H 4XAKE 4JLRB 4HKXB 5D9SB 5IK3B 3TZVB 4H26B 3OPZH 2IAND 2FZ3B 3VXSD 4UNTA 2IGFH 3H42H 3QNZB 4HJJL 1UZ6E 4LEOA 3BPNC 1JRHH 1SYSA 4K23L 5I1DA 4YXLL 3MRKB 4P5KB 5E2JA 32C2A 5BCAA 4LL9A 2YUXA 5FYJH 2E9JA 2APBA 2X4TA 4XCFH 1A6PA 3D39A 4LF3B 3H9HA 2X44D 4JKMA 2O5YH 3C8KA 2HT4C 2EC9U 1ZLWK 5C0JB 3FT3B 1GGUA 1IGJB 2E6PA 3KS0J 4JO2L 5EOTB 4UT7H 3S35L 5CKAA 3H9SD 1U8HA 1CDIA 4OFYA 4C4KO 2X4OA 1CVSC 4ZSOE 2NW3A 1U0QA 5I1EL 2BSRB 1ZHBA 4HUWB 3MA7A 2D0GA 3AU1A 5MEQA 4ZPVB 3LEXA 3KPPA 3GJEA 2ZNXA 4ZOBA 5C08D 2ICWJ 3MXWH 4AEIH 3QDJE 2W0PA 4YIQA 1K8IA 3QO0B 1HYSD 1HE7A 3OZ9H 1D5ZA 2R1YA 1X7QA 1ZT7A 5AG8A 4PJBF 1S5HA 4NUJA 5IKCA 5DHVH 4OCLC 4QHKI 1A6ZA 1WAAE 2HJFB 3GSRB 5C0CB 3I75B 5C0IB 5GJTL 2YPLD 1R24A 2VH5H 1VADA 3AS1A 3TIEB 4ZFOB 5FB8A 2ESVA 1K8DA 1VHPA 4GS7B 4J6RL 4QRUB 2BNUB 4L8DA 1QBBA 5F1NA 2GITA 3MRFB 4B53A 3RDTC 1WGOA 3O4LD 4JM2D 3CLEH 5EOCH 3HUJB 3U1SH 5DYOA 4PY8I 5JQ6H 4YHPB 3T3PF 5MENB 1J18A 2NW2B 5EZLB 2BHYA 2EEAA 2Z4QB 3GMRA 1CLOH 5I9QB 3AS2A 1HSAA 4JFZL 5L8KB 1ZANH 5JIPA 3VXSA 2IANA 5C0FA 1FG2B 4KGLA 5L2JA 2DF3A 3HC4H 4LLDB 5F8RC 2CGRH 1U9KA 4MLSA 5LWYL 2BSTA 1AGDB 4Y5XB 3OAYK 5I1IL 3ARWA 4HH8A 3LY6A 3HNTL 4NJ9L 4Z7UA 2IPUG 4L3CB 3KGRA 4LCUA 5TQ0H 2K7QA 5C0CE 1T0NB 2X5PA 4B50A 4JKPH 5HDQH 1NDGA 3JWDH 2FJGA 2YUWA 3PG2A 3HE7D 4KK5D 5BW7C 4X9BA 3MBEB 2EH7L 3HHRB 3EBAA 4GOSA 1OOAA 1FORH 4NUGL 5C08A 3HRPA 5D2LA 3HUJE 1MJJA 4H0HB 1T20A 5AZEH 4PV9B 4KZDH 3QUXB 2OQJB 3AFLA 3M8OH 3RRQA 4JZNA 3WIFA 3EFDH 5HHPB 3PV7A 2BC4A 4AEHH 4AENB 4YDVB 3SEPA 4ETQA 1I3RA 1MCWM 2YPLA 5EC2A 2VLJB 3DI2B 3WXVL 4JN2A 1FFNB 5AAWA 5MHSD 5D72H 1ETZB 2WNGA 1FLRL 1GZPA 5CSBA 4HK0A 1BJ1J 4ZTPL 3RVUD 2WSKA 3AXLB 3C9NA 4P3CH 1YEEH 5ANMB 1MCPL 3O4LA 4JM2A 4LHUG 3REVB 1NC4D 5C8JB 3OF6D 4I18B 2J8UF 3TJHD 4N8VA 5JOFB 5KW9L 1NGZB 3PL6B 4PG9A 2DWDB 3OG6B 3BO8A 3WNNA 4W70A 3SDDD 5HDLA 3LMJL 4ZXBC 3HR6A 1XR9B 5I8KH 2YK1H 4KMQA 4X83A 4BSVB 2BVPB 1YECH 2P7TA 5EBGA 3I02A 3I6LD 5SX5K 3EYSL 3RY4A 1MPAL 3FOMB 1F11A 4O51A 3IDGB 3MTRA 2HT2C 1BMGA 4DKFH 5DDHA 3NCEB 3S35X 3RZWA 3DTXA 2WMPA 4G7VH 4YBQC 5EU4B 5CJXA 5B8CA 2VLJE 1WTGT 4HJJH 4OKVB 2AABH 4L9DA 5B4MC 2C1OA 4LLYA 2B8OT 3HE7A 4Y1AD 3CLFL 1XFPA 4LSSL 5GSVA 3WV0A 4OLZH 2Z91B 1T04A 4UQ3B 2Y07H 5LGHL 4HMEA 1YUHA 1U6AH 2AKRB 4G7YL 2CPCA 4LVOB 1BFVH 4RNRA 4Y16C 3TT3L 1L9NA 2XZQL 4FQLH 1C1EH 5HGAB 1BZ9B 1F45A 2EE6A 3RHWF 1OWRM 4F15C 3MFFB 2E27H 1GGIH 2OMBA 4UT6L 3DVFA 5K33A 3LHPL 5K59E 4QCIB 5I2IA 1J5OL 5IB5A 2DIAA 4PJ5E 3EZ8A 1LEGA 2WWMC 2H45A 4R2GB 5IBLD 4A2MA 2JB5L 4WW1B 1ZLUK 1OAZL 5A40E 2Y7QB 2A74B 1W0VA 1NAKH 4GW5A 1Q9KB 1UA6L 4J7RA 4OI9A 5IM7A 5IG7A 3MR9A 4OKDA 3VFVA 5HJ3A 3OF6A 2AXJA 2OI9B 3G5YA 2XY2A 1ZTXL 4PG2C 5IFJB 1SJHB 4U6YA 3V95A 3IFPB 1OSZA 3SDDA 1GC1L 5BRZD 2MCPH 1CXLA 3P4OA 4C56A 4ZS7H 5IJKA 3EDDA 3NPSB 5EOQL 3CMGA 2CJUH 4M8QA 3FQUB 5EUOF 4NO5A 3ZYJA 5ALCH 4XPGL 4NPYB 2VABB 3FB8A 4S2SB 1WZMA 1YNTA 3FT4B 5T33L 4MNQB 4X6EB 5J6GB 4QXUH 3GBNL 3QXTA 5EB9A 1HHIA 4XGZB 3IXAA 3BH9B 5DURD 5T5FH 4HBCL 4X6DA 3QAZC 4MD5B 5IMKA 5F9OH 1NMAH 4AL8L 1QLRB 4X8JB 3UTQA 3QCVL 1E6OH 3E2HC 3L3KA 1KTDB 4Y1AA 3MRQA 3LS4L 1W72A 5LWYH 3S96A 1JIBA 1BVLA 5EOCJ 3HNTH 3DPBA 1YY8A 1EDQA 5IIEA 5DK2A 4WUUD 3NTCL 4D9QE 5DO2D 4UAOC 3P4MB 4RDQG 1BBDL 5GS0C 2ATPA 3F7VA 1FGVH 2W60B 2NX5B 1DUZA 1A14H 5FAAA 3F6IA 4WGWB 1LE5A 2ZKHH 2JTDA 5BO1L 4ZFFA 3G9VA 3OKNB 5F6IB 4L5FH 2IQAB 1NBZA 1HILA 1I4FA 2X1PA 4WFEE 3V4UL 1BBJA 4MJ4A 4MNQE 5I66A 4P4RA 1UWGH 3SKMA 2DLFH 4O5LL 5E2VH 4WO4D 2J3SA 4XVJH 4IRZL 4K7PL 3MRMA 2MSPA 3E6FB 4YUEL 1MJ7H 4J3TA 3BGMA 3BN9C 5E9DE 2IPUK 4U7MA 2BRQA 4DAGH 1FLRH 3IJSB 5BRZA 4POZD 1MCFA 2GYSA 3ARTA 5IW3A 1BEYL 2R9HC 3Q5YA 5EZIL 4UILH 4LAQH 1FFRA 5CWSB 1ED3A 5KW9H 3ULSB 4ODXA 5EN2A 5CSGA 2NX5E 1QSFD 2K1MA 4WU5B 5CGYD 3R0NA 2GK0A 3WUWG 3UZQA 1RJYA 3A6CL 5KTEL 3DJ9A 2FDBP 4EEEA 1WWAX 2BXZA 2C3GA 3W9EB 3P9LB 1JGDA 2XFXA 3VFNA 5CBAA 3MRBA 1FVEB 4KDVA 3O0RH 1R0AL 4HIJA 2J6EA 1FE8L 1QEWA 3LV3A 2ZZUT 1DANT 1HQ4B 1P53A 1I9JH 3P4NB 1Z2KA 4N0CD 4WFHE 1YJDC 1XGRA 4WUUA 1J0HA 2RBLA 1B6DA 1VEMA 1U8JA 5DC0A 2IG2H 4PJXF 2FX9L 4XPFL 1XAUA 4OLYL 4Z7OE 2FR4B 5INCB 3EZJB 5IGXL 1RZ8A 3S88L 5T1LD 1G9MH 35C8H 3MNVA 3D3VE 4DZ8A 1U95A 4OI7A 4LLVA 1WT5A 5LGHH 5HYSG 3TJEL 1H3TA 4PGJA 5KVEH 4BJLA 5JW4N 2C4XA 1N8ZB 4YHNA 4DN3L 4QRRD 2CLRA 2XZQH 3ALPA 5F9JB 1AO7D 4HWBL 5IMOB 5GZND 4PP1C 1BPVA 3DRQB 3C5ZB 3S34L 5HYQA 3QEQB 5GRYA 4ZUVA 4WO4A 4KV5E 3LHPH 1B4JL 1YPZB 4FQCH 3PDDA 4LU5H 2VDKH 5T1KD 5MEOB 2DOCA 4HKBB 4LSRL 5I1KL 5E8OA 2DQGL 4WY7H 2ZG3A 3MJ9H 3O41B 1ZWIB 4ACPA 5CIPA 1DSFL 2Y4SA 1YN7A 4LDOB 3ULVC 5I76A 5HSFA 4KKLD 3QUZD 3K1DA 2Y06L 1UH4A 4NM8H 4JFFA 5IOPA 2WQRA 3G6DH 1QSFA 3SKUD 4P2QD 7FABL 5A3ID 3ULUL 1L0YA 3CK0L 5C07D 2D0FA 1KNOB 4D0CB 1ZA6A 1JGEA 5F6HI 4O2FB 1P7QD 4MA1B 4JO3L 2FHBA 1IAIH 3ZKSD 4ALAL 1ZHNA 2DDQL 5CJXC 1KC5H 5B8CC 2LVEA 5MEPB 1AGCB 3BKML 4QOKE 1RV6X 2ITCB 1JF6A 1Q0XH 3UTZA 2D7TL 1H3GA 1LP9B 1YPZE 4D9RD 2VDMH 4AL8H 3BP7A 4NP4L 5EUKA 5T1LA 1U42A 5MERA 1XT5A 3LS4H 1NMCB 1A9EB 1XGQA 3IDXL 1JHKL 2R1XA 4K9EL 3Q6GL 2BOBA 3BP4A 1HSBB 1WFUA 4GKSB 4IIQA 3EDFA 4QRRA 3QA3A 4K07A 1AO7A 3AREB 4K7PX 4RA3A 3WO3B 1XZ0A 1WFOA 1UB6A 1J1PH 2W0LA 1K4DB 2YXFA 3CFKB 5HI5D 3EYOA 1RPQA 3ROOA 1AXTL 2DIBA 4S1RH 2ZP0T 2V6HA 1FFPA 4XRCB 1YMHA 2VDPL 3RVUC 1EJOL 5T1KA 2WAHA 3U0TB 2B2XH 2XPGB 1J11A 5FM5O 2BNQD 3TNNB 3H8NA 3BD5A 1F3JA 1BIHA 1L7TL 2F54D 1JPSL 4XC1H 4I0CC 1KIQA 4YFEA 3VJ6A 5CJOL 1G6RH 4KK9C 2VDNH 1BVKB 3IDMB 3WFBH 4JANB 4PJFB 4IRZH 1AC0A 3QUZA 4K7PH 3SDDC 5IVXB 1G6RA 4KUZL 4NZUL 3M17B 1B4RA 4ZFZA 5TDPA 3TFKD 2DYPD 1YEHH 1T4KA 5IJKC 4R0LC 4YUEH 1KB5A 3VGHA 5GZOD 2E7HA 3CAFA 3WNLA 5KANG 5IV2B 4P2QA 5KS9B 4U1KB 2CXKA 3UO1H 3DNKA 5TE7L 1AKJB 4R26H 2YBRA 5D2NB 1WLHA 3AS3A 3GK8L 4XXDA 1CCZA 1LK2A 4HWEL 4O58L 5JORB 4PJIA 4NN6B 4YC2C 1R3LB 1KV3A 1FRGH 2APVA 2IADB 4ZMAT 3PWJB 4YDIH 1YEKH 5K9OA 4LCWD 4NN7C 5KAQG 1S7UA 5C7XH 1P7QA 3O2DL 3UTTD 1DQJA 1KG0A 3R06A 4M48L 4U7SA 1CE1H 1BHGA 4F7MB 5DK0B 4HD9A 2GUOA 5C71A 2BY3A 5KTEH 3LOWA 3VFOB 3QNYA 2FGZA 4IRJB 4JAMB 2P8LA 2P8PB 4BFGA 3QNXB 1UM4L 5B38G 3TVMD 3P30H 3VFWA 4XCEA 5ID1A 1UWEL 4DGIH 1KPVA 5CLWA 1FE8H 3STZA 5ELIA 5C0BE 2H41A 5AYQA 3SJVD 1SJXA 1UM5L 4YHIB 3RX8A 3ARZA 4PJFE 1F5WA 2XXCB 3MRDA 3T2QA 3WBDA 3VD4A 1AHWA 3OKDA 1S9KC 1B0RB 4OLYH 1C08A 4I0PD 3BZ4A 4LHUB 5KS9E 1HHGB 2EDWA 4L3EB 5IGXH 1BP3B 2Q1EA 3VGFA 5IBLC 5D2NE 4GKZA 2AI0L 4PRID 2ADFL 3LQAL 3OHXB 4AIZB 3CX5J 5TE6H 2YSSA 1KSRA 4RSVA 2F54A 3Q5OA 4KWUA 3BVNB 3N06B 2CR3A 1JE6A 2AQ3A 4A6YA 4GKOA 4MA8L 4D9LH 6FABL 3GHBH 2DYPA 1I8MB 3DXAB 4Z78A 1XMWA 4MZ3A 3RNQA 1OLLA 2VWEE 3ECBA 1OW0A 2AP2A 5E94A 2GFBA 3EO1B 1JGVL 5AWNH 5ACMA 5I1KH 2DQGH 3DUUA 3NFPB 1JF1A 4P2OD 2FSEB 4YWGL 4XAWL 1YQVH 1YY9D 4LCWA 4UB0L 3VXOA 1YNKL 3UTTA 4I1NB 5JA8B 3D48R 4GKNA 1V3LA 5GISL 3SY0A 1CF8H 5JW4R 4JVPA 1G0YR 4L3EE 5HHVL 4NFBA 4MQ7A 4YO0A 1S3KH 4OD1H 1TCRB 1I7RA 2WIIA 4NQCE 1E4XL 5D1XB 5DUBB 3KYKL 5BMFH 2CIIA 4GSDH 5IP4A 1CZ8L 1RULH 4JZJB 2EDJA 4JO3H 2NY1B 1UKQA 2BFVL 4U1MB 1AGEA 3SJVA 1C12A 1QO3B 3BKMH 3L6FB 1H15B 1SM3H 3ZYOA 1SY6L 3DXAE 2CIKA 4APQB 2Y5TA 2FJHB 4OZHF 3W11C 4I0PA 4AY0A 4FQHB 4NP4H 2QJDA 1WT5C 4C54A 3CFDA 5IHUL 2CDFB 2QL1A 2HJLA 4IOIB 3GSXB 4PJ8D 4LLMB 3IDXH 2H26B 4PRIA 4F7PB 4CADB 1J88A 1FC1A 5E6YA 4RGOL 4B0MM 4WO4C 3P0YH 4Y16B 5E2WH 3VFRB 3KPNA 4JFQA 4E0RA 1FPTH 1Z0MA 3TV3H 2RAMA 4NKMB 2PW2B 1OQOA 2N1KA 5LGJB 1S9VB 4DVRL 5FKPA 3ARYA 1AXSB 3T2NL 1Z3GL 4POZC 4TVSa 1E27B 1OSPL 4QT5B 4KKNA 2W07A 1AGBA 3LN5A 4U1LB 3KYOA 2YD8A 1Z9LA 4YXKL 1A02N 3FB6A 4P2OA 3SGEH 5ICYA 1MY5A 4BQ6A 2B1AH 4NZUH 2PXYB 3ZE2F 3GGWB 2WP3T 1REIA 1U8QB 1VFAB 2PYEE 5AUMB 3ZE0E 1TJHH 3B6SA 1A22B 1IC5L 4X4MA 1F3DJ 1ZAGA 1EAPA 5JW5B 3QCTL 4MAYC 3KHOA 4I3SH 4OF8A 4B7LA 4MSWA 5ISZB 3QQ4A 5DRNA 4B5EA 4LSTL 4KJPD 4FQPA 2VLKD 4Q58C 2P44B 1C16A 3MOBH 4X0KA 1DBJH 4HKZB 3FT2B 2WW8A 1OGAD 2Y1VA 3HZYA 3PXJA 4JREB 5D7JC 4M1CC 3STLB 2WBJD 3MRCA 1UM4H 1EA9C 3ARGD 3TBTB 4IIQC 3HI5H 1U8OA 1EFQA 3SE4A 4PJ8A 4PYGA 3DIFB 3A6BL 1MWAA 4KI5E 3PWPE 5GZNC 3ULUF 3LRSA 1ZLSL 4ZPTB 2O5XL 3FQWB 4PJAE 1RJCA 4X7EC 5FGRA 2IPTL 2G75A 2HVJB 1SEBB 4OIIH 3K7UA 2E8YA 1RZGA 1DZBA 3MV7D 4FXKB 5I71B 4M93C 2VDLH 3VD7A 3ZL4L 5I8OL 2JCCF 2IQ9H 4LP5A 3HLAB 4M6AA 5E8NB 1G7PA 4FQ2H 4RGMC 3PWUA 3WUWB 5I30L 1VGKB 4Y5VB 4KKLC 3X11A 1URLA 2VITA 4R97C 3WXWH 1KCRH 1T03L 1FDLL 3QUZC 4ONHB 2MNUA 3UJIL 2X1OA 3PDGA 3V0WL 4LSPL 1BD2E 1WSST 5A3IC 5HDOA 2GEEA 2X7LB 4K8RD 1JF5A 2X9YA 4GRLB 4XX1G 4PJGB 3O9WB 5FA4B 3VFTA 1XGUB 1XF1A 3D9AH 3S4SB 4JJHA 1F42A 4G6JL 3U7WL 1MF2H 1YYLL 3HS0B 4KJWC 1N5AB 4MNHB 3KPRB 4U05A 3BUYA 5E00B 4EDXB 2QKIB 3ZKXC 5A16A 1YEGL 1VFBA 3DUSA 2VLKA 1XR8B 3RVTD 2ED7A 3HR5B 4PS4H 1HQRA 1SBSH 1SJEA 5GSRA 4F33B 1EK3A 1GAFL 1KCUL 4NO2B 5C0AE 3HPLA 3JWOH 5CCKH 1AP2A 2YOCA 1CFQB 1NL0L 4Y4FB 2DBJA 3O2WH 3MRRB 1OGAA 1UZ6F 4N9OB 3GSNH 1Y6KR 4HUXB 3C6LB 4HIEB 3ZT7A 2WBJA 2QADB 5DC9B 3GSNA 3MV8D 3ARGA 4KUCD 5IB4A 1LO2L 4HG4K 1AHWC 4BZ2L 3EYQD 3WFHB 2YD6A 2ZCKH 5GIRB 1EFXB 4JFED 4OV5B 1A3LL 4EVNB 5HI5C 2VC2H 4ENED 3QXWA 2XQBH 1FNGB 4KVNL 2AJXL 1U8KB 3QUMB 4ZDHA 2OJZL 3MV7A 3W39A 1HHKB 3HI1A 5HYJD 5GRVK 3GI9L 4G43A 3G6JB 2DM3A 3KPRE 4MXVE 1BZ7A 1NBVL 4KI1A 5FA3B 4U1NA 2J88L 4RGOH 3CMOL 1X5IA 1LO3L 2ZUYA 3TFKC 2K9UA 4X7DC 5FDWB 3MLZH 3M1BB 1K3IA 5DT1L 4XBGB 1WAAF 4PBXA 2OL3B 4DVRH 2EE2A 1Z3GH 2X4PB 1OSPH 4X98B 1NUDA 1YEDB 4I5BA 4M9OA 4I3GA 4XHQA 4P5MA 4DQOL 3TBYA 4CBPA 4JDVA 3I2CL 1A6AA 5EBLA 3SGKA 3MV9D 5F44A 2IAMB 4N9GA 4DVBA 4OCSL 4NWUH 4PJBA 3QZWA 5IVOA 4DN4L 4YAQA 1AFVL 2P48B 5EU6A 4AEEA 2B1HL 3QXAB 2P5WB 1JNLH 2YD7A 3IU3B 4EUPA 1HNFA 8CGTA 2ZUUA 3QQ9D 4PRBB 3BSZH 5L9DL 3VXRD 4JG1L 4P2RE 2V2TA 1OAXH 2OXGA 2AAVA 1R5IA 1KIRA 3G6JE 5FGCE 1MCSA 1BX2A 4U1HB 3BX7C 3MV8A 2Z8SA 1G7LA 2XKUA 1PSKL 3OMZA 4WV1B 1BFSA 1YQ2A 4DUXA 5ILTH 1DFBH 4KXZI 2VKXA 4JFEA 1A5FL 4I0PC 1U91A 4HULB 4GAYA 4OZIB 5EBWA 3BGFB 4O02L 2DI9A 3F7YB 5BS0B 1WCBA 2I5YH 4F7EB 4Q9RH 5HYJA 4IOSD 4J3VA 5C09E 2R23B 4UI2A 1RZJL 4PRHD 4JO1H 5JO5A 4YHYC 4HUKB 3TN0D 4IRSD 4Q0XL 5D6DA 4OCWH 4EI5B 3CH1B 3O45A 2MTPA 4RX4D 2HFFB 3CFEA 1FO0B 1ND0B 2NR6D 2P5WE 1MI5B 5DUML 1NLBH 1P84K 2QBWA 4DUVA 3IJYB 5I8OH 4K2UH 1PLGH 2Z93B 4Y2DB 2Q7YB 3K2MC 1A0QL 4P2OC 2JIXB 5FV2A 5ITFB 4N5EC 5FKAB 5GS1A 1YY9C 1T03H 1CN4A 3U46B 4HIHA 1GOHA 4UUJB 3V0WH 4FQQB 4I4WB 2AEPH 3HG1E 5TDNB 5B38B 2JELH 5CSZA 2V5SA 4OZIE 3RUGE 2VUYA 4FQXD 4WFFE 2FHFA 4UINH 1CICC 5ADOH 4I3RH 5BS0E 2D4DA 2GY7B 3VXQA 3VXRA 3L3GB 4E5XA 4P4KC 5ABDE 3RVWD 3JTTA 1XF4B 2GJJA 3BKJL 3UMTA 4WWKB 3HZVA 1AGFB 4PP2B 3RFZC 4P9HH 1S9XA 4YHOH 4HAGA 3W0WB 3N1GC 2VKWA 3TPUB 1TVHA 4Y5YC 2CKBA 1JNNL 3GRWL 4LLQA 2QSCL 2J8UA 1TZHB 4JJ5B 4OLVL 4YFLI 3OJDA 4ODWB 5EH1A 1MI5E 5CHNA 3TBWA 1GAFH 2ZUQB 3GI8L 3SDXE 1A2YB 3EDKA 2A73A 3DYPA 2WUBH 4XHJD 4XNYL 5FYKH 3SE4C 4PJ8C 3WL9B 5GPRA 1YMME 4OQ1A 5F7FA 4MD0B 3HPJB 1UXWB 3IVKA 1IEAB 1ITCA 4CDGC 5GGSA 1U8NB 4BZ2H 2P24A 3JV6A 5E5RB 3DUHA 3G6AB 4PRHA 2W9EL 3O6MH 3TN0A 4X80L 1OTSC 1A3LH 3QDMD 1CDYA 4IRSA 4V1DE 4RX4A 4HAFA 3I6GA 3MPCA 2AJYH 4MQXD 4RZCA 2IEPA 2IMNA 2OJZH 3IAPA 3OKMB 1IZJA 5JDJA 1I85A 5K59F 4DKEH 1ULVA 1CGSL 5EU7C 4AIOA 4D94A 2R4SL 3IAGC 2VL5B 3R1GL 1LO4L 2HJKA 3W0WE 4XZUB 3QJFA 4PLJD 4AH2A 3LEVH 3TO4D 4PJ9D 4WI9A 5CP3H 8FABB 5ID0B 2VYRE 1EHLL 1WV7T 3BKCL 4FXLA 3OSKA 4PRAB 4FZEL 2WIMA 4FQXA 4G5ZL 2BOCA 5DJ6B 3ZHDA 3O6FB 4XMKH 4XTRD 2Q20A 5T1DL 4JRXE 3MLRH 2IH3B 4KJPC 3QG6B 5BV7H 2AJZB 1HH9A 4Y8AA 3VGAC 3C87A 1GH7A 2VAAB 3FB5B 5DJXA 1KEGH 1AFVH 2VZVA 4X99A 2ATKA 2O61A 3TO2B 1MQKL 2X4NB 1MCDA 4TTDD 4HFWB 2WBJC 4G42A 1H8OA 3GHEL 3TP4A 1WZLA 4R7NB 2NYYD 1T2QH 3N9GL 4XNZC 3MNZB 1UZ8B 3CFIC 1UG9A 4W6YB 1MLBB 1U8MB 1KTKE 4NQVA 2NXZC 3I9GL 4OI8A 4Z7WB 3D5OF 4L4VE 1XF5B 4XVUD 5KG9B 4ZUUA 2W9LA 2ARJQ 3PHQB 1A5FH 3QDMA 4M7LT 4PV8A 1CDJA 5SX5H 2DM2A 1AQKL 5I8CA 4PJHA 1NCNA 1TETH 5FUCE 3BHBB 1MCQA 4NQDD 1NGYA 4HWNA 4MA7L 1NDMB 5D7KE 3TIDB 5IFHH 2Y72A 5FFLA 2ZCLL 4JPVH 2Z8VC 3GEWB 2NY6C 5JOPD 3WE6A 4Q0XH 3MMEA 1T1XA 3CPLA 4LCYB 2X70A 4K8RC 3B9AA 4PIRF 4PJ9A 1GRWA 4ODBD 1MRDL 1JWUB 1KPRA 1G7HA 3PABB 3GDBA 1QFHA 1Q94B 2DL9A 4RGNB 1R3KB 5F7MC 2BSED 5F9WC 1MAML 3SGKC 1FZKB 4WI6A 2EDYA 2SEBB 4U6XA 1GHFL 4Z7WE 2AV7A 4UT9L 1AIFB 4MNGA 3SOBL 3UTSB 2DTSA 3DO7A 1I1CA 4KDWA 3FN0L 4W6WB 5DTFA 3IETB 5CKGA 5C9KA 1QHPA 4MA3A 3O6KL 5F1OB 2C7UA 2D4FA 3MROA 4HGWA 5TPWH 4U1JA 2VNCA 3UPRB 1FAKT 1UCBL 3QJHB 1KEMH 4Z7VF 3EYUH 3JWNC 4D0DB 2W91A 1T66D 3GMPB 1A6TA 1FFOA 1NFKA 1HOCB 5L6YL 4PGZA 4BZYA 4ISVB 3K3QA 5DD3H 1QRKA 4U1GC 4H1LA 1ORQA 2F9BT 4G8FA 5I1GH 4BZ1H 1KIPB 1EHXA 2QQNL 1BQHG 5CEYB 5CJQL 3WFEL 2BCKA 2EO1A 4FQ1L 4Z7OF 5IQ7L 1AH1A 2MFNA 5I17B 2EDTA 4JRWA 3CFCL 1EVUA 4NQDA 1LDSA 4NQSA 2IF7A 2OXHA 4ODUB 4QHUB 2VTFA 4NZDA 4TQEH 2EIZA 2D7OA 5D6DC 4LVHB 5IVNA 3QEHA 3UX9B 2AEWA 3V5DA 4Y4HD 1QFUL 4Y8DC 3VXNB 3Q2CA 1PKQB 5H37H 1O5DT 3H0TB 1WC7B 1NUGA 3WFCH 1U93A 4PGDB 2DL2A 5T3XH 4BQ8A 3QP3A 2B4CC 4PRNB 3EGSB 3BWAA 4KV5F 5IW6B 3K8MA 5GS1C 2E8ZA 3VRIB 2XN9B 1CD1B 3AVEA 4LPXA 2R4SH 1MHHA 5A2LH 3ZE1E 4RGMB 2OK0L 1LO0L 1H0DB 1HCVA 4MXWH 3X14B 1N0LA 2I9LA 1DE4B 1PJ9A 1IEHA 3QQ9C 1EMTL 1DN0A 5DA4A 4Z8FL 3Q6FA 5GGVL 4W6XB 1BF8A 3B2VH 3EOBA 4X6FB 5JXED 4U31A 3LEYH 2XNAB 2F53D 5T1DH 3VE0B 5HI3D 4X6CA 1J1OL 3T09A 4XX1E 3BXNA 5C2UB 5AZ2L 5JNYB 4FQIL 2BY2A 4FNLH 1PKQE 3UZVB 1T5WA 4D0BB 5B39B 5DEZA 4NWTH 2X2YA 3HAEH 4DK3A 2Y9RT 2E9BA 3OB0K 1KN2L 4QHMA 5FF6B 1SMAA 3QULA 2IPKB 1XF2B 2X89D 3AM8A 3CU1A 5IF0B 3T65B 2BSSA 3RGVB 1HHHA 2RFXB 5EZOH 4GQ9L 4YHZH 1J8HB 1P7KA 3TN0C 2NNAB 4IRSC 1I9RH 3L7EB 3V4PH 4Y4HA 5HGHB 5JZ7D 5FYLE 3RTQB 4F37K 2NR6C 4PJDA 4QRQA 4LEXH 3OKKB 2FATL 1AQKH 1GSMA 3VRJA 3GUTB 1LE9B 2CQVA 3CC5A 1PY9A 1KULA 3TF7C 3D69A 2NY4B 4HH9A 5D6CA 1NANI 3P11L 2EZ0C 2X1QA 1OCWH 3BEVA 3C08H 4CW1B 2G9HB 1K6QH 2ZOKB 4KKAD 3KJ6L 1QR1A 4JRYB 1FNSL 3WMSA 2XWJB 3FMGH 1DUYA 1IAOA 3CVIH 2OTPA 4FQXC 3IU4H 5ICXA 3UC0L 3O3UN 3WS3A 5L0QC 5T1MB 1XH3B 4Z0XB 3PGCA 1NCAL 1QG3A 1NEUA 4PGCB 1U8IA 3F5WB 3RVWC 3VWKB 4LVNC 4S0SD 5JXEA 4OGYL 1CT8B 4PRPD 1W0WA 2HFTA 2XTJD 3UAJD 1FV1B 2F53A 4NQEB 4S1SL 1MOEA 1NEZA 5AD0A 4UT9H 1C5DB 1CGTA 1FSKB 4BUGA 3PHSA 2Z31B 4JR9L 2EYSA 1MFDL 2ZCHH 3FN0H 4OF7A 1QA9A 2LU4A 3T77B 1N6QL 2I27N 2VXVL 3O6KH 2GK2A 3H6JA 4FRWA 4P5TB 4WUKH 3TWCL 2BNRB 1H3PL 4C4KT 4XHJC 1P2CB 4GG6E 1FZMA 1MCOH 2A6JA 2X89A 1FYTB 5I1LB 3KPSB 1IAMA 2JJWA 5BJTB 4GW4B 5D7IE 1DQLL 1XF3A 4OZFH 5FIEA 4JRYE 4L4TE 3DMMD 4Q6YA 4OZFA 1F8TL 3CDGA 4ELMB 1BF2A 2APWA 2DLTA 5GRJH 2V2XB 2VDRL 4MQXC 2ZUTA 1N6UA 1ADQL 3VI4E 4LPUA 3QCUL 1J87A 4UBDD 3FQNB 2AGJH 5EORL 1A7BA 2OS7A 5KS9F 3RGHA 5IROA 4UIKL 4U6HB 3PQYE 5H2BB 4X9IA 3WHXB 3GMNB 1WIPA 1YDPA 4PLJC 4YDJA 1EXUA 4J8RA 4N0UE 1CE6A 1IGCH 1IARB 5F93C 3BWUC 2MQ3A 2V17L 3KLSA 3QUML 3IDJB 3OKLB 4QWWC 3HI6L 3ROLA 1FL5B 3H3PL 5C0GB 1CFVL 3WSQL 4QKXB 4NCC2 2RCSL 3U4EA 3O2VH 4Q6IA 3PNWB 2DAVA 1JNHB 4H25A 5ALBH 5F1IA 2NY2D 2VSCA 4XTRC 1FYTE 2I24N 3KPSE 4WW2B 4K3GA 1MLCB 5DJ8B 2Y25A 4PRPA 5BVJA 1FN4A 5BVPH 3HKFA 3UYOD 5IVZA 1HH6A 3CFJA 3FONA 1DJSA 2H2SC 1S8DB 3L3IB 4WHTA 5DJZA 2XY1A 2IFFH 5DS8B 5GXBB 4CL7A 4XNMB 4XPTL 3ARFB 2DKMA 3FO9B 2YS4A 1T7WA 5J6HA 3JV0A 1G7IA 3QFDA 4TTDC 2QLVB 1UXSA 3GMOB 5IEKA 3BIKB 3NZ8B 5L2KD 5DRZA 1CICB 4I77H 4Z77B 4YBLB 1IQDA 4FFVD 4KTDL 2A6IB 1TJGL 2OTUB 2BVQB 4WI7A 5DD5L 4YPGB 4XVUC 3T1FA 4AIXA 4K3JL 5LQBH 3ARBD 2XACC 1AJ7H 3DMMA 3RP1A 5FDYA 4JFPA 4Y5YB 1HHJA 1CL7L 2PF6A 1GIGL 2G5BB 5F7DA 5BQ7A 4X8XA 3RBSA 2UWEE 4LKCB 3ZKQD 5IB1B 2DD8L 4PTUA 1M71B 1ES0B 3CU7A 1D5XA 1XGYL 5GGRB 1EGJA 2ADIA 4UDUA 2NY7L 3SO3C 5ESQA 2BXYA 2Q8BL 5FK9A 1ITBB 1FVCA 4RAUA 1IT9L 4HS8H 4LARL 5DK3A 3T0EB 5E6IB 2GSIA 4MJ2A 1OB1A 4NC1C 1FNEB 1KCVL 5J56B 2FATH 2VSDA 3MLXH 2EKJA 2AJ3B 3SE9L 5E8DH 4JG0L 2F15A 2MPAH 2EDQA 1BJMA 2EO9A 2XWBA 4BH7B 4XC3L 5I8EA 4IHOB 4JY4B 5D8JL 2HKHL 5FXCH 1WIOA 4JZOB 1JYWA 4OZ4B 4JM4H 1I1FA 1UCTA 1GYAA 5JA9A 3U7YH 3JXAA 1IGTA 4YR6A 1FNSH 4C83A 2ZSWB 2YPVH 1TQBC 4NKIH 3C09B 1MHCA 4Z95H 2VLMD 2HT3C 4K94H 5ESVA 1NMBL 3H3BC 3JUYA 3UC0H 4D3CH 4WDIA 2J2ZA 3FO0H 3FFDA 3U36A 3VXUB 3FOLB 1A7OH 5L2KA 4TVPE 5E4EB 3IJHB 5SWZB 3ZE0F 3B43A 4JB9L 3IDIB 1A4KB 1JK8A 4WEUD 5E4IA 2OTWB 3MO1A 5CEZL 4Z5RB 1TNMA 1K4CA 2XWTA 3LH2H 4ORGB 1IC4L 2HLFD 5GQBA 3EO9H 3ILPB 1CXKA 3FO1A 3T0EE 1PZUB 5HHMB 1N6QH 3IDUA 1MVUA 5IBUG 4KRNA 3L3DB 4N0FB 3V79C 1MCHA 4X7TA 3S37H 3CUPA 1F4XL 4TUKH 3AM8C 1RMFH 2NY3B 3QQ3A 2F58L 3RWHA 2XRAL 4ODVL 5J1AA 4MWFA 1K5NB 3BQUD 3DSFL 4R90H 4GQPH 1KCSL 3BT2L 3MODL 2D7PA 4Y4HC 3QHTC 1G9NH 2VUOA 2J5LC 2NXZB 2R2BA 4K7FA 1R3HB 2JLLA 3VCLA 4FTVB 4KI5F 5I6XC 2DLGA 3MOQA 4JDTL 4P3DA 5LBSH 4YQXL 3A0OA 2EDOA 4NCDA 2VDRH 4PJAF 4X6BB 4XAKD 3WD5H 1RZ7L 2PYFA 1VSCA 1YEJH 4PD4J 1X4XA 4G80B 3D0VA 3MZGB 5J12B 4LIQH 5IMMB 1VESA 1WTLA 2DQUL 3ARSA 3LQZA 12E8H 4P23B 3VFUB 1BM3L 1FJ1B 4F2MA 4P48A 1VFUA 4NN5C 3V5HB 5HHME 4ZAKD 3DRTA 2VLRB 4OLXH 2XZAH 4QRTA 4MCZA 3VWJC 3RWGA 1OT2A 5GRVL 5TQ2L 1X3DA 1WVZA 1YEFH 5FGSA 1EX0A 1KGCE 43C9A 5JXEC 4OUUA 5HVGB 3QUKB 5D7LD 1BVZA 5D96C 4L3AA 1VEOA 4RMVA 1EEYB 3C5JA 3MNWA 5GGRY 1BQHB 1UVQB 5HI3C 1BOGB 2R39A 5EO0A 2B0SL 3VXMD 1V7ML 1DBAL 3KPLB 3GJFH 4FTVE 3IRZA 3TA3B 5I16A 2OR7A 1KJ3H 4XPTH 1SBBA 3WLBA 2EYRA 1DLFL 2FJFB 3TZVD 1EH9A 3QQNA 4OF6A 5HD8D 1IL1B 5IW1A 3BYYA 1NBYB 3V5KA 3JVGA 1BQUA 1V7NH 3VW3L 2MQ0A 1XEDA 2DQEH 3K0WA 3BQUA 5FM5M 3MX0A 3LKNA 1RUAH 1ZGLB 4K3JH 2A6KA 2NZIA 5JZ7C 1RIHH 3RWCB 3T1WA 3BOVA 3R0MA 5IEHA 3V6OA 3ZSSA 4EI6B 1CL7H 2OP4L 1T7YA 1TCMA 5IROC 3ZYIA 4KZEH 2NTFA 3CZJA 4KH2A 3D0LA 3S6CA 3CXHK 3BFOA 4L9LA 4QRSA 1T1YB 1M7XA 1QYGL 2WV3A 4XWGH 3KR3L 1GC1C 3P77A 4UIMA 2DI7A 4MXVF 1IT9H 5C9JA 4TUJA 2GJ6D 3VA2C 1G1CA 4WHDA 2ED8A 3BP5B 5KZCB 2VE6B 1QFOA 5KVFL 4HV8A 2VISB 1FGNH 4KKBD 4JDZA 1SQ2N 1A47A 1HIML 3V0AC 4NHCL 1CI5A 4G6FB 1KTLB 3GSUB 4JFXB 2GJZA 2XICA 4FXGB 4ZOCA 1IC7H 5D7LA 3O2DA 1J8KA 4XC3H 5F9AC 5DQDL 4FFYL 2HKHH 1NPUA 2GSGB 1RVFH 1TLKA 2DBLL 1VPOH 5I1AA 3NFNA 1UB5A 3VXMA 2GAZA 3QDJA 2F8XC 3QXUA 3NIDE 2J8OA 4MB5A 1A1MB 5MEND 3W2DL 4LQ1A 4QTIL 4Q2ZB 4M7JH 1NMBH 3LDBC 5IR1A 1KLUA 4JLRA 1ZK9A 4HKXA 5IK3A 3TZVA 4H26A 1UACL 3HE6D 2F74B 1IEBB 4ODHH 2FZ3A 3G08B 1FHGA 1U8HB 4NNXB 3FFCD 3IFNH 3QNZA 1IFHH 4UTBH 2UVFA 1CK0H 2FX8H 3MRKA 2F5BH 4P5KA 3ABZA 4KY1H 3G6JF 2QHRH 3LEXB 4FABL 5KJRH 1PFCA 4UOW0 3DMMC 3UBXA 4IJ3B 1NCUA 2OR9H 4LF3A 1WQVT 4CNIA 4TRPH 5C0JA 3FT3A 1OL0A 1F4XH 4UBDC 1IGJA 5EOTA 2ARJB 5KVGL 2XRAH 2Q87A 1V8HA 2OSLB 4MX7B 4OFKA 2HP4A 4ODVH 5CFHA 4M6NH 4PJ7F 5DHVB 2BSRA 4HUWA 3DSFH 4ZPVA 4OD2A 3EDJA 4OIBA 2APTA 4ONOA 3O6LL 3MBED 3OTTA 1RIVH 3ZDXE 3B9KD 5I15H 1MFBH 5H35B 3HC3H 3QO0A 3QUXD 5FYJE 1F4AA 2GJ6A 1T21B 3D39E 4JDTH 4Q9QH 4YQXH 4MDIA 5JHDB 2AXGB 4BQBA 2HJFA 3GSRA 1B9ZA 1RIUL 5C0IA 1JZ2A 2NY2C 3P0VL 43CAB 1OTUD 5C0RH 2VZTA 2HFGH 3TIEA 1WBXB 4ZFOA 3MA9H 5CAYB 3GNML 3QI9C 1NAMH 4QRUA 1F13A 5IT2H 1IKFH 3MRFA 4G6AD 5DA0B 3P9MB 4P0DA 3HUJA 3EJJX 3QR2A 1D6VH 2EECA 5JW3L 4YHPA 5MENA 2NW2A 1NJ9B 3GM8A 3PL6D 5EZLA 4NKOB 1IBGL 2Z4QA 4L29B 2X09A 3ZKNC 3RUGF 1J7VR 3MCG1 3SQOH 1FG2A 3H9SB 4XB7A 1JGUL 3L5JA 2M8XA 1RK0B 3BDXA 2ID5A 2FJGB 5FYLL 4N8CH 2R4RL 2XZZA 2AXFB 2VN7A 3QRGL 3VD9A 5KSBB 1GCFA 1AGDA 4Y5XA 5F89B 2E7LA 4L3CA 1LK3H 15C8L 1T0NA 1WWBX 2QSQA 3DGCR 4YE4H 2O5ZL 3SDXF 2IANE 5EUOB 1I3RB 4K3EH 4MJ5A 1PZ5A 4JN2B 3MBEA 5KSVB 1MNUH 3B9KA 5MI0B 4ODTH 1T5XA 3K2UL 1RUKH 5T3ZD 2DQHL 5E08H 4PV9A 3QUXA 1GOGA 2OQJA 3VG9B 1TQCB 5HHPA 5JUEH 5DEGB 4AENA 3B3IB 5C0EB 2BVOB 4YDVA 5GHWL 5I18H 4U1SA 3TPKA 4OM0H 1OAQL 3QHFH 3H9SE 1FFNA 5JXAL 2YD5A 2D7QA 4Y88A 1ETZA 1I7UB 1E28B 3ULUC 4R2GD 2D31A 2VN4A 3PWNB 5KSBE 4E41B 2HH0L 3AXLA 5C08E 5ANMA 5D2LE 4R96B 5CEXB 2NY5C 1FIGL 1RZKL 3REVA 2GIYA 4M02A 5C8JA 4I18A 3CX5K 5JOFA 3PL6A 2AK4B 2X6MA 3QG7L 2DWDA 5IFAH 5I19L 3ARRA 4GMTH 2YPLE 3OX8B 1XR9A 2HN7B 2HLFC 3RJQB 4BSVA 2BVPA 4F9LC 5DSCB 3MQIA 1D5BB 3I85A 2AS5M 5I1JL 2C1OB 3WO4C 3QPXL 2C3VB 3FOMA 3K8KA 1N64H 3IDGA 3O4LE 4J12A 4K9EC 4H88H 3JVGC 1II4E 3W5MA 1UACH 4OFIA 5TF1L 4XPHL 3T0VA 3D25B 5EU4A 3BQUC 5D1QB 4RWYL 4OKVA 3G5VB 3RIAK 3TESA 5J13C 3MJ7A 5I2IB 4DEPB 1WUNT 5IB5B 1BQSA 2VQUA 3V6OC 2Z91A 4UQ3A 1X4ZA 4TOYH 3SGJA 4M1GH 3KG5A 1JHLL 5HGAA 1KN4L 4EOWH 1PG7L 2AK4E 4L9LC 2NX5D 4HPYL 3VFVB 1NC4B 3MFFA 4YGAB 1TMCB 1D9KB 1Q72L 4TULH 3V8CA 4AMKH 4GMSL 2UZIL 3K4DA 5SV3A 4QCIA 3O6LH 1PX4A 2J4WL 4MAUL 4BFIB 5IB2B 4QF1B 4M8QB 2DN7A 4WW1A 1A6UL 2BJMH 4NO5B 2Y7QA 1WWCA 2DQTL 4KMTH 3SE3A 2A74A 3SDAD 1Q9KA 4PJXB 1MJ8L 4HX1B 1OT1A 3PWLB 4ZOEA 1EZVX 3IXAB 1I8KB 4AG4H 1TJIL 5IFJA 1SJHA 5I1CL 2MKLC 3IFPA 5IBUB 1TZGL 1CDBA 3HNVL 4MS8D 3BD4A 2ICEB 2X40A 1QQDB 3I6KB 3FQUA 1EO8H 3E3QE 5MHSE 3DX9A 3NIFE 4NPYA 2VABA 4S2SA 2H9GB 4NZTL 1I7TA 5JW4Q 3FT4A 3OR7A 4K3DH 4MNQA 4GAGL 4X6EA 5J6GA 4LCIL 4N1HB 4XGZA 4H8WL 1VDGA 2BHUA 1IBGH 5DK2B 1V3KA 5HD8C 3BH9A 3IFLL 1JGLL 1DQQB 1MFCL 2R69L 1T1WB 1J12A 3WFDL 4XP1L 2N7AA 1CFNB 4LLUB 4MD5A 1DUZB 2P46B 1QLRA 3MRJA 5FUZL 5LXGH 4PJEA 4X8JA 5E5MB 4O4YH 4CVZB 1KTDA 1ZHKB 4F57L 1NBZB 3I6LE 2R0WH 1BBJB 3LQAC 1QPPA 1CLZH 3A67L 2IJ0C 4P4RB 3HMXL 4XP5L 4CRPA 3P4MA 5C6TH 2XA3A 4YHLL 4ZO7A 1SJVA 2D9QB 2W60A 1NUFA 1U3HD 4L8SB 2NX5A 1IGYB 4EXKA 5E2TH 3SCMC 1OARL 3S36H 4X6DE 2DQCH 5K9KB 5INDB 3OKNA 4TSBL 3VDBA 3BZFB 3OKEB 1MH5A 4OFDA 2NPLX 2IQAA 1HDMB 2ZPKL 3WIHL 3EAKA 4Y1AE 4HWUA 5D7SL 1UGNA 4KKBC 4PBWD 5DVLA 3ARDB 1C5BL 4TVPL 2RHEA 1KT2B 3C5ZD 3QEQD 1AD9B 3KPOB 1S78D 1MQ8A 4LSQL 2X4RB 4KC3B 4L1DA 3E6FA 4GS7C 3S3SA 4OCXH 3PGDB 3IJSA 3NVQA 4YH6A 5C6PB 5CD5D 1J1XH 5J1SC 5CMAB 4S1QH 4I0KA 3ZE1F 1I75A 4DTGL 1UQSB 5CBAB 2YKLL 4XMLH 1QBMH 1ZEAL 1Q9LB 1CBVH 1MCEA 5EIIB 4M5YH 1L9MA 5I9QC 5KSAB 1QEWB 2EH8H 3KAAA 5CWSA 3LV3B 3VWJB 3RKDD 3ULSA 4F58L 3BRGC 1EEZB 4WU5A 3HZKB 4HWZB 5I19H 1ZGLP 2BERA 1AD0B 1DL7L 2FD6L 3W9EA 4Y5XC 3P9LA 4HZLB 4HQQL 5BRZE 3WDJA 5I1JH 2ADJB 3BH8B 1A3RL 3KJ4B 3VXPA 1FVEA 4HSQA 4OQTH 3C8DA 4FMKA 2J8HA 4OQTA 1HQ4A 4KTEH 3MBXL 4NRZB 3P4NA 5TFSH 3RWIB 3SN6N 4YHNB 1PG7X 5E7BA 1FFQA 2RGSA 5LKNA 2WQ8A 2YD9A 1U3HA 4R4FH 3MBEC 2HWZH 2FR4A 5INCA 1FCCA 3C8HA 5DMIL 4P2YA 3U6RA 2PR4L 4DGYL 1L7IL 2Q76B 4OSUH 4P46C 3DV6B 1N8ZA 4POYA 5F9JA 3WJJA 2AJUL 4G8GB 4HF5L 1KN4H 3ARED 5IMOA 4LLWB 4HC1H 1OTUC 3DRQA 1TFHA 3C5ZA 3MXVH 3IB4A 3QEQA 2DTML 3FL7A 4PPTA 2OLDA 4G9FB 5IOPB 3GKWL 1YPZA 4M5ZL 5D93B 1NGWB 3V0VB 2J4WH 4U3XA 2W38A 4P9ML 3EDEA 3O41A 4I18C 4BK5A 1ZWIA 1G7MB 1QRNB 5CS7A 1E6JH 3PL6C 3SGDI 2NXYB 3SPVB 1MJ8H 5I1HL 2VXSH 3NCMA 3NFSL 2IALB 1ZHNB 2LQRA 5I0ZA 3UXFA 1TJIH 3OXRA 4Y19B 5DR5L 5I1CH 4NJAL 4O9HL 1OF2B 1TZGH 1AKJD 1LVEA 3GRWA 3QSKB 4YHKH 4KRLB 5TH2B 3UDWA 5I73B 4NGHH 4BM7A 5C2BH 3U9PL 1KNOA 4D0CA 1S7VB 3RAJH 3RDTD 3OAUL 4BUHA 3JBG7 1MIEH 3SHSA 4JHBA 1A64A 2MHAB 5JIKA 3LDBB 1ONQB 5ITBL 5MEPA 4QRRB 1AGCA 2I60H 3QA3B 3KYMB 1HEZB 2ITCA 1LP9A 4C55A 4GG6F 5HY9B 3NCJL 3SGJC 4YJZL 4Z0BL 1FFPB 3HZMB 3CSBA 1YMHB 1FL6B 4LVOC 1A9EA 4O2EB 5D7IF 3MLWL 5T1KB 1E0OB 1HYRC 5A2KH 5K9QG 4F7CB 1HSBA 2VXUL 4JY6B 4GKSA 4W68A 1F3JB 3NH7H 4XP5H 3DVNB 4OD3L 3AREA 1BAFH 3NABL 3PE9A 2UVEA 3B8YA 4OCYH 3VI4F 4LHUD 1K4DA 3CFKA 4R2GC 2VXTH 4XRCA 2I26N 1S9WB 3SE3C 3QRFM 1LDPH 4FS0A 3U0TA 2XPGA 3OB0H 2YBRB 4PBVC 5C07B 5ICZB 5EO9B 4RFNB 1E4XI 2OI9C 1X5HA 1YYML 1BIIA 1BVKA 3IDMA 4QRRE 4JANA 4PJFA 4OZHB 1DQJB 4LSQH 5IVXA 1KG0B 1AO7E 1BGXH 2JK5B 3M17A 2A77L 1DVFB 4OJFL 3NPSC 5J11B 2GUOB 4KHTL 5DZLA 5IV2A 5KS9A 4U1KA 1FVDB 2OZ4H 1AKJA 1JBJA 5D2NA 2Q3AA 3B9DA 4LRNH 3EOTH 5JORA 4JY5L 1R3LA 3Q1SH 4ODSH 2XG4A 1V5JA 4X7SH 2IADA 1MJUH 3VFWB 3PWJA 4XVSL 3KS0H 1I1YB 1I3GH 4NIKB 4OB5H 3OPZL 2CO7B 1YC7A 4F7MA 2IGFL 3H42L 5DK0A 3NN8A 3KXFB 4OZGF 3DSNA 2FECL 1UJ3C 1JRHL 1G7QB 4ZXBD 2UV3A 3VFOA 4M00A 2ICES 3IGAB 5FYJL 4P2QE 4IRJA 3BDYH 4JAMA 4LFHD 2P8PA 2K7PA 4XCFL 3QNXA 1LGVA 5C07E 1CGWA 1A3RH 2H8PB 2Y36H 4YNYB 4EBQH 4PR5B 4PJIE 2QR0B 3U83A 5DJ2B 4ZG1A 2BNQB 2YSSB 2HT2D 4YHIA 2XA8H 4UT7L 4M62L 5FM8A 3ZSTA 2AW2A 4M7LH 4YBQD 3KLHC 4M61A 1B0RA 5F6IC 2UWEF 4LHUA 3MUHL 4KVCH 1HHGA 3FCTB 4U33A 2HVKB 4WW2F 25C8H 4D9RE 2X1XR 3ES6B 3RNQB 3MXWL 4AEIL 1F58H 2Z92B 3OHXA 4AIZA 4G6MH 2YA0A 4MJID 4Y16D 3WNKA 2A9MH 3DHJA 4QXGH 3BVNA 1RHFA 5DQJB 2VH5L 1JPTH 3QWQB 1JYNA 3KXFE 2DMCA 5L8LB 4GXVH 4QTHB 3GKWH 1IVLA 3ISWA 1OM3L 3BP6B 4ZTOH 1I8MA 5GGTA 1RK1B 5JPNB 4HXBL 3EO1A 2V7HB 5IBTH 3MRNB 3CLEL 2FGWH 5EOCL 3U1SL 3NFPA 5JQ6L 2FSEA 2BNQE 3U48A 3TVMB 5J4MA 3ZE2E 4CU8A 1CLOL 4HUVA 5D70L 1ZANL 1QOKA 4QHLB 1AGEB 2PXYD 4MB3A 2C3XA 5C1MB 1NFDB 4Y2OA 3EO0B 2JCCB 4K7PY 3HC4L 3CD4A 3VGBA 2CGRL 4HCRH 4XBEH 4ZXBA 2KDGA 4YK4C 2Y5TB 4WU7B 1TCRA 5D1XA 5DUBA 3IFOB 4JPIB 4I2XB 3CFDB 5DZOA 5ISZD 1ZVYA 1JHTB 3PWVB 4PRIB 4JZJA 4ZS6C 2VZUA 3I50H 5TQ0L 3S98A 3KDMB 4HKJB 1RZJC 4WI3A 1J0KA 4MD4B 1QO3A 1H15A 3DX8B 4JFQB 2HYMA 4JKPL 3MRGB 3JWDL 3C6SB 5DC4B 4TNWK 1PAMA 1CGXA 2FJHA 4ZO9A 4M7ZB 4FQHA 1KOAA 2ITDB 2V9RA 2RQ8A 5FKPB 4ZQKB 1FORL 1BJ1H 3UP1A 3H7BB 3MGAA 4IOIA 3GSXA 3SQBA 4CVWA 3WJJC 4LLMA 5AZEL 2H26A 2W65B 5HPMB 4NFCA 4KZDL 4F7PA 3M8OL 4CADA 3NCCB 3C5ZC 1ORSB 3EFDL 1N26A 3KYOB 4PLKC 4LASH 4Y16A 1S78C 3VFRA 1PY4A 4JQIH 4BA8A 1CU4L 5F96H 5GS0D 3GMMB 1HINH 1DBMH 3SJVE 5J57B 1BLNB 4NKMA 1NFDE 2PW2A 3MSPA 5LGJA 2V5RA 2B5IB 1S9VA 1AXSA 3O4OB 2AJVH 5D72L 1E27A 5CD5C 3MLTB 4HJ0C 4QT5A 4YDLB 3HCVB 4WWID 3NGBC 2BHZA 1HZHH 4P3CL 2LAGB 1YEEL 2NQCA 3PIQB 4U1LA 3NBNA 4PRIE 4MHHG 1YYMH 1NGPH 3RKDC 5DF0A 4K3HA 1UC6A 2GHWB 3VFPB 1X5ZA 3CJJA 2IBZX 4CJ1A 1C16B 2PXYA 4XNQB 4KKCD 3UDWC 3GGWA 1KJ2H 1U8QA 1VFAA 5E2UH 5I8KL 5AUMA 2YK1L 1X5XA 1YECL 3BN9D 5ECJE 1NGQH 5KSUB 5JW5A 2KQMA 3VXTA 2BK8A 3V8OA 2W9DH 5ISZA 1T0MB 3QPQD 4DKFL 4XVSH 3V6FB 4G7VL 5IQ9B 1UEMA 2YC1B 1KENH 2PCPA 3FHQA 2G75B 2AABL 4Y4FD 1NMCC 1JTOA 3STLA 3C6LD 4X4ME 4OLZL 2Y07L 3TBTA 5GGQH 1U6AL 3GKZA 5MP6H 4NRXB 4NKDB 4MGXA 1BFVL 3DIFA 1MRCL 3L5WA 4FQLL 1JZ8A 3AREC 1C1EL 5F88B 1EFXD 2V9TA 4CU7A 4M62H 4ZPTA 5GS0H 1L6ZA 2E27L 1GGIL 4HUUA 5AYUH 3MC0A 1SEBA 4Y4KB 5C6WH 2D0HA 5F21B 3G5ZB 4FXKA 4NSKB 3V6ZA 3SCMB 5B3JE 2W0FB 1VKXB 5J0BA 2BVTA 3HLAA 5D1ZB 3VRLF 2ED9A 4GG8B 1NAKL 3K81A 1VGKA 5DWUH 4Y5VA 5H37G 4ONHA 4I8DA 3BUYB 3MREB 3QFJD 2AEQH 4PP1D 3OR6A 2I25N 2LU3A 3BYTA 4UOW1 3ARUA 5C0DB 3S5LA 2MCPL 1OM3H 5D2NC 5ENWB 1IQWL 4GRLA 4ZS7L 1CLCA 4PJGA 2CJUL 5FA4A 3VG0H 4NN6C 4HXBH 3S4SA 5ALCL 4ZD3H 3GSWB 5CUSH 3HS0A 1N5AA 4MNHA 3R8QA 2EDRA 1OP9A 4QXUL 4YZFE 5E00A 4EDXA 2QKIA 3ARGB 3ULVD 1E4JA 3SDYH 3NIDF 5EU7E 4ESKA 1G84A 5D70H 1XR8A 5T5FL 4F8TA 4DKDC 4XP4L 3U0PB 2P5WD 3HR5A 4F33A 4IRJC 4LOUD 5F9OL 1NMAL 4NO2A 1CQKA 3JV5A 4U3CA 4GBXB 1CFQA 4Y4FA 5DEFB 4UNVA 1E6OL 1MCIA 3MRRA 4YX2H 4QHNB 3WS6A 4HUXA 3C6LA 4HIEA 4EKXA 3QIWB 4G43B 1UJTA 2VZOA 2HA1A 3LD8C 2ZSVA 3DVGB 5DHXB 3RWEB 3HAEG 1YJDH 5GIRA 1EFXA 1FGVL 2P45B 4OV5A 1A14L 4EVNA 1OWWA 4D2NA 2VLKE 3MOAH 2Z35B 1VACB 2ZKHL 2R0ZH 2FX7L 2EXWD 4KQ4L 1FNGA 4IMKA 3C5SB 1M7DB 4K55A 1U8KA 4ZO6A 3PDOB 4L5FL 3QUMA 5A2JH 3RX7A 5B22A 1P1ZB 1IGML 1HHKA 3CVHH 1OGAE 3UYRH 1G9EA 3ZDXF 4BELD 3CVHA 2VDQH 2OJEB 3OWEA 4RIRB 1UWGL 4EJ1C 1MFAL 3LKPB 1RZFH 5FA3A 1MHEA 2DLFL 4P46B 1WITA 1P5UA 3U9UB 5E2VL 4XVJL 3D85B 5EA0L 1CU4H 3QFJA 5EU5B 2OL3H 3Q3GB 5FDWA 3M1BA 1MJ7L 3RWJB 3BJ91 2OL3A 3MLUH 4DAGL 2X4PA 3W9DB 3CFBB 4X98A 4W4NA 4X4YB 5C3LD 1YEDA 2ZNWA 3CSYB 4HXAH 1ZV5A 2DWEB 1HI6B 1R5IB 1RZIA 3B2UD 4UILL 4LAQL 2Y23A 4NBYB 3ULVH 2BVUA 5DD1H 5LVEA 5CEZD 2IAMA 4X5WB 4KK9D 5C86A 2X41A 3P4LA 1CFTA 1AY1H 4C56D 3QXAA 2P5WA 5GRZA 3IU3A 1U91B 4KJYB 5D1XC 4PRBA 4PJ5B 5DJ0B 5SX4H 1OTTD 2J6EL 1EO5A 3HMWH 1IE5A 1I9IH 3GMQB 4JZJC 4WWKD 3O0RL 3OL2A 4U1HA 2NY1C 1N5YH 2QTEA 1I9JL 4WV1A 1FP5A 4CDHA 2IG2L 2FO4B 3KPTA 4APQC 2A0LC 4RFEB 5DMGC 3MGOA 5F7KC 4ZYKB 4OZIA 2PO6B 3LKSB 1G9ML 35C8L 2MQCA 3ELAT 3SKOB 4CVXB 3F7YA 1KYOJ 4F7EA 3LZFL 1DBBH 4OZFG 4JFHE 2G2RB 2UY6A 5KVEL 1MRCH 4TSCL 5EZJB 2R23A 3MV8E 3MUGB 3VFSB 1D6EB 2R0KH 4RISH 3RI5F 2CRZA 1DQDH 1F4YH 3JTSB 3LSOB 1Q1JH 4EI5A 3CH1A 1RFDL 4HIHB 5LG1A 1H8SA 2HFFA 3MV9B 1M6OA 5HDBF 4Z7UF 1FO0A 4PTTB 1BWMA 1ND0A 1LO5A 4FQCL 5IHBA 3BPOB 2YR3A 4LU5L 2VDKL 3IDNB 4ONGH 1WWWX 2XOTA 4JN1H 3L9RB 2Q7YA 2Z93A 4DW2H 4OCRL 4WY7L 3MJ9L 3VXQB 5F6HJ 2JIXA 5ITFA 5HYJE 4PB0H 5FKAA 5KSBF 5D2LF 3U46A 4NM8L 2PXYC 4UUJA 2M26A 4FQQA 4I4WA 3G6DL 5B38A 5TDNA 1P6AB 4ZFGH 2X4UB 3EOYG 4GLRI 4LLQB 5CZVH 1INEL 5HHQB 3OJDB 4Z76B 1IQWH 5CHNB 4R0LA 4HLZH 3RZCB 3TBWB 4K71B 3F12B 1T80A 2A73B 3L3GA 4EN3B 4GRWH 1QFWL 2DJSA 4A2LA 1XF4A 4WWKA 1AGFA 3MJGX 1IAIL 1WBYB 1KC5L 1Q9WB 4LCCB 3TPUA 4CMMA 4JM2F 3MV9E 1TZHA 3MRLB 4JJ5A 1Q0XL 4XP4H 4ODWA 4HK3J 4JREC 2VDML 5FYKU 5E9DB 1A2YA 1W72H 1UJ3B 2YRLA 3WL9A 4HJGB 4RMWA 2FL5B 3CCHB 4MD0A 3VXRE 1UXWA 3N50A 1PYWB 1IEAA 3QO1B 2AJSL 3VGEA 1U8NA 4G8EB 5ACZB 2ADGB 3G6AA 3ZKMD 1B2WH 4P3WA 4QYOB 1MREH 5I71C 4KQ4H 1J1PL 2FX7H