3TYGL

Crystal structure of broad and potent hiv-1 neutralizing antibody pgt128 in complex with a glycosylated engineered gp120 outer domain with miniv3 (eodmv3)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
ESALTQPPSASGSPGQSITISCTGTSNNFVSWYQQHAGKAPKLVIYDVNKRPSGVPDRFSGSKSGNTASLTVSGLQTDDEAVYYCGSLVGNWDVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system, viral protein
total genus 35
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2011-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tygL02
4GRMA 2XACC 4UV7H 3JBG7 1A8JH 2P8MB 5IB1A 2Z8VC 4M7KH 5JLZA 1JE6A 5EULV 1HQ4A 4O2EA 3SE9L 1AR1D 4HIIA 4OF0A 1AGCA 5CJOL 5K9JH 5C0FB 2WBJB 5D1XB 4CN4A 1K6QH 5IESH 2DQCL 4CAGA 4JG1L 2KKQA 1QFWI 4K7FA 2XWBB 4N8VB 4PG9B 2IMMA 4L4VB 1MHPH 1SMAA 3C6LC 4GRWF 3L7FB 5ILTH 3DROA 1TJIL 4LNRB 4C56E 3MYZA 3F5WB 4XMKH 1BVKB 2XNAA 2DL2A 2CLZB 2EH8H 2RQ8A 2BZDA 3RWIB 1I3RB 1NMCC 4ZQKA 2R8SL 1DQML 2QHRL 2J6EA 1QSEB 5FCUH 2WW8A 4LAQL 4OIIL 4Z9KB 3CX2A 1WAAA 5KVDH 3ROLB 5HJ3B 3SO3B 3L95A 4GBXA 5EORL 3C2AL 1D9KC 4F8QA 2HN7B 3VWJA 2ADJA 2VLKE 4IMLA 1PFCA 1TZIA 4WNQB 1RZGB 4ONHB 4M6MH 4NHUA 1VKXB 2HT4C 2V17H 5D4QA 3P2TA 4EI5A 3G6JA 3GB7A 5C09A 2NY4D 1CE1L 5F88A 5L9DL 1DBBL 4JRYD 3S9DB 5L7XL 3PWUB 3X17A 4QLRA 1DBML 1MF2L 1VEPA 4QRRB 1AY1H 4X6EA 1P84J 3W5NA 1S7UA 1EJOH 1QSVA 3QQ3B 5F89B 1NFDF 1QFPA 1OP3K 3ISWA 2NW2B 3TNNA 4QRUB 2ESVA 4PP1C 4W6YB 1YECL 2VITA 4D9QE 1RJZB 4HLJA 4EN3C 4PP2A 1XGYH 1QA9A 1CXHA 2ZUUA 5DWUL 1MCPH 1N0LA 1KG0A 3LQAC 3WUWB 5F1OB 1YJDC 3ZZ1A 4UNVA 1NLDL 1NAKH 1WCQA 4PR5B 4PRDA 5F97E 4EUPG 3BZFA 2ZCKL 1R5VA 3SKOA 5JR1L 3KAAA 4NQVA 4KKAC 1XF4B 1MHHA 2FLRT 4Y16D 2XQYG 4V1DD 5H2BA 5J89A 2BRRH 4CN1A 3CLEL 2W91A 4AL8H 15C8H 4U3XA 1EJ6A 3LN4A 1BQLL 4ZFOB 3GJEA 4IOIA 4WI7A 4LKXA 3O6KL 4B7IA 4JKKA 3P9MB 2VDPH 4XVJH 5KS9F 3OBAA 3Q5YA 3KXFE 4OZFG 5TQ2L 4RRPG 4WFHD 3SPVA 3O2WH 4Q9BA 1UXSA 2VAJA 4R2GB 5JZ7D 3TYFA 1ZGLM 1IM9A 3DURB 5HGHA 4U0QB 2AGJH 5KSAB 2AK4B 3WE6A 3PWJA 4RGOL 4PB9H 4HV8A 2FSEB 1VEOA 4R97C 3BP5A 1ZHNB 3L1OH 4NBYB 1NUGA 4CVZA 2PW1A 3PWLA 4ODUA 1EFXD 3A67L 1DBKL 1KXTB 5IEKB 3VXUE 4OZGF 3CCHA 3CDFA 5MI0B 2VLJA 5ID1B 5KSVB 2X9XA 3LQAH 1U6AL 5DQ9B 1YJDH 3QUMA 4HMDA 3P9LA 2VDRL 2JE8A 5CJXA 4LVOC 1IGJA 1PSKH 3BKCH 1BECA 4RISL 3D25B 4Y5YA 5DZOA 3QJHB 5FV2A 5C86A 5JXEA 3OPZH 4CVUA 3AB0B 2R2HB 4JZJB 4U1MB 4M6NL 2MCG1 3S5LB 3LKQA 3LEYH 2LU7A 4JCMA 1GAFL 1CYGA 1ZA3B 4LFHD 4PJDB 5IMOB 3B43A 5ESAA 3RZCA 2F58L 5F3BA 1ERNA 4HC1H 4OSUH 3UTSA 2O5ZH 3O6FB 3ROOB 1PBYA 3SOBL 1Q9LB 3TCXA 4JVWA 2YD7A 3PWVB 4TTDD 3EDJA 3EOYG 4EDWL 3T0EA 4G9FE 4Z7VF 4HW6A 4G8GB 5J7CC 5J6HA 2FBJL 2ZUYA 4IOFD 4XNZB 3T3PF 4NM4H 3WLWC 1DSFL 3GMQB 3H0TB 3GSQB 3I6LE 2ZG2A 3ULVC 5MEPA 2GSIB 4I5BA 2BOCB 3T0VA 1T7WA 5EWIL 1ZWIA 4W70A 1KCRH 1IC4L 3OXSB 3VXRE 3O9WA 5DMIL 3HZKA 3IFPA 1LD9A 2VLLB 4TNWK 3MOBH 1FL3A 1U0QA 3NFSH 4KVNL 5IM7A 2ZKHH 5IBUB 5HYSG 4KK5D 4BH7B 1J88A 2DLFL 5DRWA 5HHNA 1AC0A 4HX1B 5TE7L 3S98A 1I7TB 1F90L 1S78C 3X11A 3MLZL 3IKCB 1OARL 2X4TB 3P40A 3QZWG 5EU3B 1BBDH 3ULSB 5CBEA 5DEFB 1R5WB 1N6VA 25C8L 3DV4A 4XVSH 5D1QD 2XWJB 3E0GA 2J8UF 4Z7UE 5FAAA 5IF0B 3RQ3A 4MXVF 4PJ8A 2ZNXA 4MAUH 1MFAL 3LH2H 1T66D 4G9DB 2P46B 4H26B 4CDHA 5L6YH 3ZTNL 1AGEA 1UGNA 2XZZA 1M7XA 4R7DA 1IQWH 4RFNC 3ZKSD 2NY6D 1J8HE 1FO0A 2BHZA 3QUXC 3SDXE 4HCRL 2B4CL 3ARGC 5HVHB 2EDHA 3QULA 4L8SC 1I1AB 4F58H 1NAMB 4XWOD 3QXDB 4X7DC 3HNVL 4F15B 5IEHB 3WL9A 4XP1L 3TT1H 4GQPH 2I07A 4ELME 2FCBA 3ULVH 3WFCL 3DUSA 1RUKH 3WXVL 1E27B 1JNLH 4MX7B 3C5ZA 3FKUS 4WY7H 3FZUD 3VW3H 1CFQA 3O8XC 1UJ3C 1MVUA 4G42B 1KELH 3MJ6A 3HR5B 4Y1AA 4TVPD 2GCYB 2YD9A 4DN3H 4X8JB 1HEZA 3U6RB 3MV01 4AJ0A 5HDQH 4ODHL 3MGOB 4LIQH 4NPYA 5ICYB 1V7ML 3FOMB 3UTOA 4WUUB 3VDBA 3MRNB 4MJ2A 4QOKA 1WIPA 1G6RB 5IB3B 1BQSA 4K9EL 4M03A 4YGVA 5F9AC 3RTQD 3UYRL 4P46D 4PJ9A 5FHBH 1JTTA 1JZ4A 3B9KD 4N0CC 1MQ8A 5DJXB 3D6GA 4KFZC 4N5UA 1AO7A 5LG1A 4AEIL 5DYOA 2XA8H 3MV11 2UYLA 3ZKXB 4GRWB 3SCMA 5FDYA 5I75C 1GGBH 3T1FA 3NFNA 4P3WA 3D1MC 1R3HB 1CXEA 3LSOB 5EH1A 3MO1B 4HH9B 1LWRA 5FO9A 1G7PB 4PJGE 1NC4A 2OL3H 3RVXD 4P3CL 3SDYH 2JB5L 2PR4H 1INQB 4PJFB 4LRIA 4W4NA 3W5MA 5D2LF 1MCQA 1W0WB 3EYOA 5T3ZL 1MFBL 2IALA 1RZJC 1WBYB 1FPTH 2V2WB 1NANH 3LKOA 1S3KH 1GPOL 3WFBL 4R9HA 4XXCC 2D4FA 2NY0C 4H5SB 1RIUL 4M6AA 1G0YR 5ALCH 3GMPA 3MLXH 4Z76A 4NT6B 2E6PA 5IOPB 1KT2A 3H9SB 4Y4HD 5EUOB 5E6IA 1BFOB 1NCWH 3DV6A 3FOLA 3FT4B 3TN0C 1PQZA 5FUCE 1FL6B 5HHQA 4NHCH 5IT2H 4NZJA 2CXGA 4H0GA 2OZ4A 1DVFB 1NUFA 3UROR 1CBVH 2AJXH 3ES6B 1KC5L 2ZG1A 1IEBA 2O5XH 4XPFL 5MP6L 1OTSC 1BQHG 9CGTA 2P8LA 4F7CB 2AVGA 3UZEA 3DUUA 1NFDB 1JF6A 1YEKL 1RURH 1MFNA 1J10A 5DMJB 3MLUH 4L8CA 1I8IA 5DZNA 3QUZC 5KBNC 2FECI 1LEKA 1JRHL 1SBSL 2YEZA 3U79A 5L2KA 5FIEA 3K8MA 3FQNB 4XNQA 1I8KB 5EU6B 1A9EA 3BP4B 4YHPB 1BM3H 1T4KB 4WCYH 5C0CB 5IFJB 1I9IH 1YEDB 1J7VR 1T2QH 1QVOA 4P99A 5DUBA 4TOYH 5EZOL 1WFTA 3T09A 4W4OA 4P5KA 3U9PH 1RZJH 4HZLB 3FQTB 2B0SL 2FDBP 4PJCB 3WXWL 1L9NA 5F7DA 1VFOA 4PJ7A 4LLDB 5TH2B 3C5JB 2FEDC 4LPTA 3TA3A 2DAVA 1C7TA 1JL8A 5GISH 1AI1H 4HXBL 4GO6B 3QUYA 3UTTE 4KV5F 3DOSA 1QEWB 1IGFL 5M95B 4JKPH 2EECA 5HYJE 4JHWL 2VQ1B 4Y89A 3F8UB 4O58H 3QJFA 2BVPB 3P11L 4YHLL 4WWKC 4WU7B 4HS3A 1V3JA 4OFYA 4IJ3C 5KS9B 2DS4A 1AXSA 1JHLL 2R39A 1DN0A 3ARFD 2ZOKB 4UOW0 1TCRB 3G5XA 3K4ZA 1OOAA 3KLDA 2X1WL 5EPMA 3KWWA 4I48A 5D7SH 2RB8A 1RFDL 1QSFA 2NY5C 2ERJC 3OZ9L 2IGFL 1OGAA 4MAYB 1JN6A 4NQXB 3DGCR 5JW4Q 5IHBA 4PRBB 3O3EB 3OJDB 1UZ8A 4MZ2A 1Q1JL 3GKWH 4L3EA 2BJMH 4DQOH 5C1MB 1FNAA 5LCVH 1TLKA 1B0RB 5KVMC 5GRJL 1XZ0A 5DLMH 4OZGB 3SE4A 3BP7A 3P4LA 3F62A 5F9OH 3H3PH 4J8RB 3VGBA 1UZ6F 5KSBE 1U3ZA 4MQXD 3RGVA 2OBGA 4J3OC 5K59E 4ZG1A 3WHXB 4HJ0D 4QTHA 4N0FB 3L5IA 4AH2A 2Z0BA 4LSSH 4RWYL 4P5MB 4HGWA 3HG1A 5T3XE 4X4ME 2UWEF 4NO0A 3H3KA 4DJMA 2VERN 4APQA 5E8PB 1OHQA 1ROWA 2X70A 3FB7A 5DJCB 3L3IA 3D85A 3RWDA 4ETYA 2H2PC 3RL1B 1VB9A 1M7IA 5EBWA 3KPNB 3O4LE 3HA0A 4UIMB 2X9YA 4PJAA 4L1DA 1FFPA 1JWMA 3BN3B 4JKLA 1DEEA 1XIWB 5EIIA 4LSPH 2OR7A 1R3KA 4X9IA 2FYYB 4FFYL 5CCKL 5BO1L 3W9DA 2ITCA 3VFOA 1BIIB 2D2OA 2GW5A 3DXAB 4M7LT 5L0QC 1NFKA 5FYLE 1SY6A 1FC1A 3QG6B 4Z7VB 4OLVH 3BWAB 1IGIH 4LEXH 2W0LA 1TQCC 3EW3B 1D7FA 4YO0B 5FOJA 2NY5H 2W9DL 3VI3E 2W59A 4M7KL 2XKSA 4JFDA 4HJGA 1YEEH 4RGNB 1U91B 3C08L 2GJZB 2EYTB 5IROA 1ZV5A 5K9OA 2YK1H 3LB6C 5IQ7L 5K9JL 1I1CA 2M1KA 1G0XA 4A6YA 1NAML 4P3DA 1K6QL 5GRZA 1Z5LA 5ESQA 2JLLA 4AIXA 4HK0B 5MENE 4ZSOE 4N9GA 1J1PL 3OKOB 4KROD 2P5WB 5E08L 2GY7B 1MHPL 5A3ID 5C0IA 3FT2A 4QRPA 2N1KA 5ILTL 4TSAH 5DUMH 3B9AA 5EO9B 5B22A 1H5BB 2ZUQC 2EKSB 2J8HA 2AXJA 4GG8B 1BZ7B 2J8UB 3D39A 5E2VH 5FCUL 4D8PA 2XKNA 5DJ8A 5DJAB 4E41E 2WIIB 3CK0H 3EO1A 4NKDA 5DD6B 4O9HH 1G6RL 4TUOB 3VWKD 2BNQB 5CS7A 1H3WM 3OV6A 5F7FA 4IEFB 4IDJH 3TPUB 3UDWA 3FFCE 1S5IH 4ZTOL 2H2SC 1ZKAA 4G6KH 2R4SH 3CZFA 2D0HA 4IRZH 1CF8H 4HUWA 5E8DH 3V5KB 3PL6D 3V6OC 1S7QA 4U2ZA 4KVCH 1LE5B 1YN6A 4UDTB 3GM0A 3HTLX 5E5RB 4PBVC 1DQJB 1MIEH 4JR9L 1FDLL 5GS3A 1MFDH 2X40A 3CFBA 3GI9L 3HE6C 5IMLB 1JGDA 4JGJA 4FA8A 3VG9C 3JUZA 1H3UA 5J1TC 4A2MA 2H45A 3PGDB 1FZKB 1HCFX 3IXAB 1DJSA 4Y2DA 3ZDZE 2Z4QA 3NIGE 5HHPA 3TESA 2VISA 2YBRB 3VFVB 1HSBB 2X4RB 4YFLI 2DICA 2VXSH 1J18A 5F7YC 3JWOL 3PWPB 1S7XA 3PQYA 3RA7H 2X9WA 3DO7A 4JRYE 3BKYH 5C07B 4AL8L 3L7EA 2I27N 4RAVA 5CSZA 3LKRA 1NMAH 3ZL4H 3RWGB 4L4TB 4EQ3A 2IADA 3VFRA 4PJHA 5D2LB 3VU2A 3CFDA 4RFEB 3MRMB 1OTUD 4NQCD 3S36L 4WGWB 4NO2B 2M26A 1JZ2A 1JGEA 4XVJL 5GSRB 2KPNA 2OTPA 3QHFH 5DD3L 1IM3B 2EIBA 1Y6NR 4OT1L 3KPSB 4U1SB 3EDKA 3IJYB 1BOYA 3QWOB 4XBEH 1PZ5B 2AGJL 3I3DA 1TZHA 4LLUB 4OBSA 4NUJB 1K2DA 4B7LA 3ILQD 1ND0A 3GHBH 4PB9L 4FABL 5JPMA 3TJHC 5C7XL 3L1OL 3M45A 4WENB 3B6SA 2NY1D 3HZYA 4NWUH 2FZ3A 2EXWC 1S9KC 3ILPA 4LCWD 1KULA 3HZMB 2PKDA 2CIIB 3S35L 3M1BA 1MFEH 1QRKA 1JBJA 4U1IA 4FFVD 3LQAL 4V1DE 3MBXH 3Q3GB 1IKFH 5DI8B 2NR6D 3QRFM 3OKDA 1G9NC 3WS3B 1PSKL 1LK2A 1P4IH 1OAUL 3BKCL 1W72B 4JPVH 1L0QA 4HUNB 1FJ1A 1U3HA 2BNRA 3C60C 4ZAKC 1A3QA 1YEIH 5LGJB 3OPZL 3NA9H 3IDMB 5DD1H 3LEYL 4ZXBD 1JPSL 1ZHLB 3IETB 3CDGA 1PD6A 5EU7C 3UXFA 3HZVB 1X7QB 3HLAB 4OSUL 4UIKH 2O5ZL 2D0GA 1RMFL 1JF5A 2P8MA 1T2XA 2NCMA 4BQ8A 4YDJA 5J13C 2D9CA 2CUHA 4RX4A 1DP0A 1Q72H 4I0PD 2YZ1A 3VXNB 4MNQB 3TJEH 3QAZB 4FQQA 1R5IB 5C0FA 1BLNB 2BSRB 2WBJA 4GS7B 5D1XA 2R23B 3R06A 4HCRA 4MSWA 4R90L 4GW4B 1OGTA 5D7IF 5B8CB 5GRXG 1J1XH 4PV8B 3SE3A 1OSPH 2XWBA 4M62L 4N8VA 4PG9A 4Q6IA 3NCEB 5E00B 3NCMA 1EPFA 4L4VA 5EFIB 4YHOL 1QG3A 1CICD 3VH8B 3L7FA 3MOBL 5T1DL 3BW9B 4P23D 4LNRA 2R1YB 4OIBA 3NFSL 4Y5VC 3F5WA 5JHDB 2ZKHL 3L3JB 3KS0J 1BVKA 3PP4L 2EE3A 1L0XA 2CLZA 3OAYH 2ZWLT 2FGWH 4P57B 3RWIA 2BY1A 1Q38A 1G9NH 4LFHG 1P9MA 1QSEA 3TZVD 4BSJA 4Z5RB 4I2XE 1BBDL 1NC2D 4NGHL 3CVIH 3ROLA 5HJ3A 4MQ7A 3OSKA 4KAQH 4F7MB 5C0AB 3ARXA 1U2CA 4FQPA 4MQSB 5FYJL 1T6VN 3WN5B 1CDUA 2VDKH 2Z31C 2P43B 4WNQA 3FRUB 3UTQB 1RZGA 4ONHA 1UM5H 1NFIB 1VEMA 3FO2B 5GGRA 1P4LB 1UQSB 2R29H 2LFGA 3S4SB 5L6YL 1FV1B 5IJVA 3CU7A 2UWEB 3BZDA 2IBBA 2WNGA 3OGOE 4PIRF 5SWZA 1H0DB 3WNKA 1A7OH 3BPOC 4XCCH 4PRPB 4WW2C 4F58L 2XOTA 5IBTH 3QQ3A 4G6AC 4BH8B 1IT9L 3CSPA 4OCRL 2AJ3B 2VSDA 3ULVL 1LP9F 1RU9L 4LHQB 1EEZA 2NW2A 4X0KB 5J1SC 3JVGA 4WY7L 4QRUA 3V6FA 4U1LB 2R0KH 3BIBX 4PRAA 1E4WH 1FORH 4OGZA 1KELL 3C6LD 3L9RB 4ETQB 2UZIH 4DN3L 4F7PB 2KH2B 1L6XA 1MCEA 1E4XL 2D9QB 4U7MA 3WUWA 3BQUC 5HDQL 4YIQB 3AB0C 4LIQL 5JXAL 1AP2B 4PR5A 1XGQB 1CTOA 5SX4H 4ZPTB 3IDYB 1CGVA 1LO0L 3K80A 3H7BB 1XF4A 2ZP0T 3BFOA 1QLFB 5EC1B 1D9KD 5DS8B 3MRCB 1EEYB 3K7UA 1FAKT 3LRHA 3QDMD 2HT4D 3VXSE 3NZ8A 2BVTA 3RWFB 1A4KB 1GGBL 4XNZC 1ACYL 2DWEB 3P9MA 3T2NH 3VRLE 4U3HA 3NCCB 4ZTPH 3ULUC 1KJVB 4LNVA 2V2XB 2PR4L 1KLGB 4IRSC 4BZ2H 1KJ2H 3IU4L 4Y4KC 5KSAA 2AK4A 4PJEF 1FPTL 5EZIL 1OWRM 1S8DB 4PRIB 4TVPE 1S3KL 1JUFB 3L5JA 2FSEA 5FA3A 2HLFC 2CLRB 4UILH 3KYNB 3UJIH 1ZHNA 3GGWA 3SY0B 3S97C 3QSKB 3BWUC 3NVQA 4WU5B 1HE7A 3Q2CA 4PP1D 1AH1A 1NCWL 4D3CH 2FH8A 4LMQI 2VLRB 2W9EH 3SDDB 4EN3D 5ID1A 3LCYA 2XKUA 2DQUH 5AEAA 3VRJB 4NHCL 4YH6A 5DQ9A 5ERWB 5IT2L 1X5LA 4YAQB 3U36B 1IEAB 3PABA 3QUKB 3I6GB 1WTLA 1RUML 3D25A 1EUTA 2AJXL 1YNTB 4X6FB 1WGOA 3QJHA 1INDH 4DEPB 4RZCB 1HKLH 4JZJA 2R2HA 4KKAD 2IANB 1XMWA 2CK0L 3E6HB 2XN9D 1ZA3A 4PJDA 5IMOA 2Y4SA 5B3NA 1RURL 4FQLH 2GT9B 5GS1B 4RAUA 1G7JB 1N6UA 2HRLA 4XPTH 1TVDA 4HXAH 3ROOA 3O6FA 4WTXA 3W81A 1RUPH 1IGMH 5E0QA 3ULUH 5I1HL 1H9VA 1Q9LA 3DECA 2EDOA 3MJ9H 4JY5H 4WCYL 4ZO8A 2EEBA 1I9IL 4BA8A 1YEFH 1S9XB 4M7ZB 3HNTH 5E5UB 4G8GA 3I3BA 1YN7B 3KJ4C 4PJIB 3GMQA 4MA1C 3GSQA 1CDIA 3PHSA 3U9PL 4LHUG 2V5RA 2XXMB 3CX5K 2GSIA 3BPNB 4JG0H 4MQTB 5J56B 2D0FA 5ESVA 1AI1L 3OXSA 2VLLA 3HMXH 1F00I 1YYLL 5HHMB 3O4OC 2ATPB 3F65A 4RNRB 5LWYL 4O58L 4BH7A 5I1AB 1PVHA 1W8NA 4ZD3L 1I7TA 2HWZL 1JHKH 4OB5L 4G7VH 3IKCA 2QADC 2X4TA 3E3QC 4DK3A 3MV8A 3JTTA 3ULSA 5CEXB 3RWEA 5BV7C 2GYSA 4N8PA 3PIQB 5D7SL 1S7TB 3ARYA 4UT6H 2X4UB 2XWJA 5FF6B 3K4DA 5IF0A 3GSXA 3MROB 4Y19D 3TM6A 5BS0A 5FB8A 1OP5H 3GKWL 2BJML 3EUUA 3BGAA 2RCSL 4H26A 4JRXB 5D96C 3ME0A 5DEGB 5DC0A 1TVHB 4AZ8A 5FECB 1CLOH 4MJIB 3BH9A 5F9OL 2DJ4A 2Q3AA 4KJWC 4CGTA 4JRWA 1MFCL 4JZOB 3KYOB 1FYTE 5CEZH 1I1AA 1FVEB 1NAMA 4I18C 5IEHA 4LSSL 4LSUH 4KTEL 4XP4H 2JTDA 2X1XR 3QDJA 4AG4H 3U82B 1T1XB 1AHWB 3WLWD 3INUH 4WDIA 4JFFD 1FNFA 2NX5B 3V8OA 1E27A 4MX7A 3ULVD 4TUJB 2OXHA 5D7JB 1Q0XL 2FRGP 4PGDB 5CMAB 4LCCC 4WGVB 4YHML 4K8RL 4G42A 2A6IB 2MQ3A 3HR5A 1EHLH 2GCYA 4OTXH 4X8JA 3N85H 3U6RA 1I8MB 1ZT4B 3LKSB 3D9AH 1CGTA 3MGOA 5ICYA 1S78D 3FOMA 3GBLA 4WUUA 3MRNA 2NY3C 4NIKB 1G6RA 3QHTC 5IB3A 1S9YA 4OLVL 1IGIL 1YPZE 4LEXL 5F1NB 5T1KA 5BV7H 2FHBA 4OFIA 4WEUD 4L9LB 1N4XH 5DJXA 3SDCC 1A6AB 5BOPA 5LQBL 5HGGS 5D7IB 1YEEL 2E8YA 5A16A 3TEUA 1LEGB 2X09A 3KPRD 4WFFD 1EVTC 2YK1L 1PYWB 2F9BT 4X9HA 1R3HA 43CAB 3MO1A 4HH9A 2OI9B 2NXYB 3Q48A 1EO8H 5AZEH 4EDXA 1FYHB 2IEPA 1INQA 4PJFA 2ICWJ 3QUXD 1X5ZA 3Q1SH 3ARGD 4N0RA 3KYMB 1W0WA 3E8UH 4TSAL 4AYFA 4H5SA 3PG2A 4XGZB 1BFSA 3EYVB 2HFEB 4NT6A 4TSBH 1WFOA 4PJBF 5E2VL 5AUMB 5IOPA 4R7NB 5EUOA 3H9SA 2EDQA 1BFOA 3O8XD 1IAKB 3G9VA 3FT4A 2CIKB 3OAZK 4FS0A 5F8RC 1A6WL 2ARJB 1FL6A 3GMLB 3W2DH 3Q6FB 3EOTH 3U0WH 3M17B 3ZTJH 4YK4B 1DVFA 4KU1A 5E2WH 3L3DB 4ZO9A 2MKLC 2D31B 4RMQA 4G6FB 3ES6A 3JV6A 4M6OH 2A9NL 5HD8C 4KKLC 3HUJE 1FZJB 2Y23A 2EDKA 2YD4A 5FHAH 4F7CA 2N4IA 3TV3H 1DEDA 1CF8L 1LP9B 1NFDA 2QQLH 2CLVB 4N0CD 3IDGB 4JFHE 3H9HB 5FM5M 5DFVC 1B0WA 3D3VD 3WIHH 4S1SH 1NGWB 3EBAA 4OFVA 3D69B 3TO2A 1MIEL 4BZ1H 1BGXH 2VDOH 2X44D 2HFGH 4L8DB 3FQNA 5EU6A 2I26N 3BP4A 4YHPA 5C0CA 1T4KA 2FJFB 3MR9B 1YEDA 3WMSA 2PXYC 3MLTB 5DD0L 1XF1A 4OUUB 4Z77B 1QPXA 1DQQB 2WK2A 1FZMA 3VMPA 3I6KB 4LLVB 4HZLA 4YHKH 1FG2B 4LCIL 4NQEE 5LGHH 1XIWC 4PJCA 2WMPA 1U8PB 3D18A 4LLDA 1J0YA 3C5JA 3CJJA 4CADB 1BVLB 2FO4B 3TO4C 2NY0D 1I7ZB 1INEL 7FABH 1C08A 2VQ1A 3QB7C 2BVPA 2UY6A 1WWBX 3HFML 4WU7A 1FAIL 3ZDXE 4GKOA 4QHNB 3TN0D 5KS9A 3MODH 1VA9A 4HWBH 2ZOKA 3RVWC 3ZL4L 1TCRA 5EU5A 5DTFB 4Z7NE 3DVIA 4PJEB 1QD0A 3Q5OA 3OJMB 3QI9B 1OTSD 3ZLQC 3WEXB 4MAYA 4M3JA 1U8QA 4R8WL 2W65B 4PRBA 4N0YH 3O3EA 3OJDA 2VN7A 3SJVD 3QIBB 1LO2L 3IJSB 1HHJB 4LEOB 1A1MA 4XBEL 2R1XB 1B0RA 3QUZD 4ZFZB 4KI5E 4OZGA 1MJ7H 5T1LB 3CFEB 4J8RA 5B4MC 3WHXA 4N0FA 4NC2B 1CCZA 2V9QA 1C7SA 2VJXA 1N26A 4RBPH 4H88H 1QRND 1NMBL 2YMXH 1I1RA 8FABA 3O41A 3U4EB 3LS5L 5DJCA 1R6VA 1MFEL 4JCLA 3MBXL 3RL1A 1IKFL 1CFSA 1OM3H 3KPNA 5C0DB 4WTZA 2FEDD 2WV3A 5ELIA 1S9WB 4WO4B 2Y07L 1JF1B 2FB4H 3D0LB 4JPVL 4XBGB 4CU6A 1NEZG 1RUAL 3P0VH 1YEIL 3MXWL 2FYYA 1KTRL 5E6ZA 4WWKD 4B5EA 1CD0A 4FXGB 4H0HB 5SWSB 1BIIA 1KCSH 3DXAA 4OD3L 2GFBB 5HDBF 4AEHH 1PX3A 2LAAA 4HS8H 3QG6A 4Z7VA 3BWAA 5ANMB 1YYML 4UIKL 4KDTA 2XG4A 3MUHL 4QTIH 5CILH 1Z3GH 2MPAH 3ZSSA 3BSZL 4YHYC 1JWSB 2DTMH 4JO2L 1U91A 5IFAL 2EYTA 4O2FB 4X6CF 3WO4B 1OVZA 1PKQE 4F7TB 5FO8A 4XAWH 4YZFF 4LCWE 2WUCL 5JPNB 4HK0A 1EMTH 4UDUB 5EBMB 1KJMB 2A6DA 4PLKC 2BMKB 1W0YT 3OKOA 3QIUC 5D6DC 2P5WA 3U4AA 5FO7B 2JF1A 4NM8H 2A1WH 5EO9A 3DRQB 4ELKB 1RIVH 1H5BA 5INDB 3HPLB 1JGLL 2EKSA 5CHNB 3RAJL 4NN7B 1TIUA 4GG8A 3AROA 4EUPH 1BZ7A 2J8UA 2H2PD 3QFJB 2QKIB 4FTVD 1HXMB 5DJAA 1DZBA 1NCCL 1WZ1H 5DQDH 2WIIA 3CVIL 3MUJA 1MI5D 4KAQL 5DD6A 2Y1VA 4K3EL 3ECBB 3WJJC 1JZ3A 5JIHA 3ARDC 4DGYH 1MRDL 2VDKL 4R6UA 1UM5L 3TPUA 5CWSA 1G0DA 2P47B 1KB5H 5BRZB 2ICES 4DCQB 4LCYB 4OZFH 3V5KA 4HBCH 5A2IH 2B39A 4X9GA 2DI7A 2J88L 5DHVH 4DN4H 1LE5A 4XCCL 3NAAH 4UDTA 4JO4H 1DQJA 3LB6D 3AC0A 4KRLB 5IK3B 1WAAE 1OAXL 4Z7NF 5IMLA 1I85A 1JP5A 1AFVH 4TNVF 3VG0H 2PNDA 3CD4A 3HC3H 1ZT1B 3PGDA 1FZKA 3IXAA 2UZIL 3J8F7 1QFOA 1LEIB 2WLZA 1WT5C 3A6CH 2YBRA 3LZFL 2Y06H 1HSBA 2X4RA 3V0WL 2WWKO 5T33L 2OP4H 4YJZL 3EJZC 4LLMB 5D7LB 1QZ1A 1SYSB 4M00A 4XHQA 1R0AH 3OKMB 4W81A 4LSRH 3DTXB 2ILLA 2VIRB 4GXVL 1IQDB 3R4DA 1NGYB 5C07A 4OKVA 2E7BA 4QGYA 3MLYL 3N1GC 1K8DA 1T04B 4L4TA 5GHWH 2JELH 5D2LA 3VXMD 4RFEA 3MRMA 2H2SD 2ESVE 3T2NL 1D5ZB 4KHXH 4ZTPL 2D3VA 5GSRA 4MS8C 4PJ5B 5C71A 5B8CC 2E9BA 3W0WB 4NQDB 3B3IB 3VD9A 1NANI 3KPSA 2R9HC 2I24N 1CDYA 4PJBB 3IJYA 3QWOA 4BZ2L 1PZ5A 3D2UD 2PTUA 1ZS8A 2J4WH 4L4JA 2H26B 3PHQB 3NCYP 4NUJA 4J6RL 2E9IA 1DANT 5TF1H 4LP4A 3CUPB 4PRHB 5GGTH 4UILL 3UJIL 3G6AB 2XG5A 3VFWA 1GOFA 1ODAA 3HE6D 5JQHC 3HZMA 3FMGL 4HHAB 4D3CL 1DBJH 3SBWC 2F5BH 2CIIA 4B0MM 2W9EL 4P5TD 3V4UH 3ZHDA 3U7WH 5I1DB 2DQUL 3WHE1 3WS3A 2CH8A 3AM8C 1DR9A 1XGPB 2VLME 2X1QA 1IKNA 4YE4H 4OZHF 4GMTH 5LGJA 1HKLL 1DQTA 5BMFH 3MLSL 3DX6B 4NC1E 5GGSA 1DBAH 1NGQH 4EVNB 3GSNB 1TETH 5JW3L 3IETA 3RP1A 3BI9X 3RWJA 3HZVA 2XPGB 4NUGH 4HXAL 3HLAA 2I9LB 1XAUA 1P4BH 1UG9A 2BY2A 2CSPA 1RUPL 1BF8A 4OCSH 1IGML 2AQ2A 4ODSH 3ULUL 1T1WB 5IVXE 3P4MB 2R69H 3QG7H 3MJ9L 4JY5L 2D7PA 3VXNA 4DWHA 4MNQA 1R5IA 1BLNA 2BSRA 3VXTB 3MREB 4FMKA 3H42H 3EYUH 5CGMA 2HFFB 3VDAA 4PV8A 5F96L 2Z8WC 5E00A 2NPLX 3TVMB 2BXYA 3VH8A 1MHCB 5KVEH 5MHSD 1F11B 3LN5B 2GI7A 3TJHD 4Z7QE 3BW9A 2BSTB 2R1YA 3IDYC 5FUCC 1ZLWK 2JJSA 5JHDA 2AJZB 3L3JA 4OV5B 3MRIA 3ZT7A 3DSFL 4P57A 2CUMA 4G7VL 3VXQB 1LE9B 2XN9E 6CGTA 3UTSE 3KDMB 1UYWH 3IJHB 4Z5RA 5JORB 2A0LC 2HVKB 4F7MA 2AEIT 2F54B 4BUGA 1MQKL 3QEQB 5C0AA 1CDGA 3C60D 4ZAKD 1BJ1J 1MRFH 3T0EE 3WN5A 4MD5A 1O0VA 1V3LA 2Y7QB 4UT6L 3FO0H 4Y4FB 3ZE0E 3FRUA 3UTQA 4IIQA 3WJLA 1GOHA 2BFVH 1F4HA 3TFKC 3FO2A 2FX9H 1D5MB 3RY6A 5K9KB 1E0OB 1UQSA 5GSVA 4LBEB 3G6JF 1AQKH 3HKFA 4FQ2L 5CIPB 3S4SA 4LCUB 5C9KA 1FV1A 4QRRD 2XTJB 3D5OF 2C1PA 4FQXB 5E94B 5EU4B 1H0DA 5B39A 4LDOB 1SM3H 3QPXH 4M4PA 2P49B 2P45B 5BQ7B 1AD0B 2CQVA 4PRPA 4TRPH 2DQTH 4UZGA 4BH8A 4JFYA 4YHNB 2AJ3A 5ADOH 3INUL 3BH8A 3NCFB 2YD3A 3SDDC 5C08B 1MCKA 3B5GA 4XP9H 1VGKB 1T7YA 3LN9A 4U1LA 4C55A 3CFKB 5IHLB 5IB4A 3MNWB 2QV2A 3L9RA 2CD0A 1EHLL 4OTXL 4F7PA 2VO5A 3C2SA 4DEPC 4OAWB 5I1KL 3TBTB 1MSPA 3D9AL 4YIQA 1U9KA 1XGQA 4C54A 4JQIH 3QR2A 4P2QD 4DUXA 4GAFB 1NCTA 1HH9B 4ZPTA 5GPRA 4MDJB 4Y19E 1LO4L 4K07A 4MA3B 4X6CB 5BV7L 1QLFA 1XF2B 1N4XL 5TDNB 4YHZH 4ZNEA 5DS8A 3MRCA 3MV9B 3S37L 5DJYB 5LBSH 1EEYA 1I9JH 1HIMH 1YMMB 2Z31D 2XRAL 3ARBB 4M7ZC 1RVFL 3RWFA 3BEWB 4U7KA 1A4KA 2DWEA 4NKMB 3MA7B 4V2BA 5GGVL 1KJVA 2BHUA 1DQLL 1G9MC 2B1AL 5AZEL 1JHTB 3T3ME 4Y1AE 5CP7A 4E9LA 4OM1H 1KLGA 4I3RL 4XMPH 1MWAB 5T5NG 1S7WB 2E3VA 1S8DA 4RGMB 3QCUH 4G6AD 4D9RE 3H8NA 4EXKA 1JUFA 4QOKE 4KUCD 1ED3B 3QO0A 3SY0A 3VDCA 1KB9J 5E4EB 2YN3A 4TSBL 5CJQH 2NTSP 5IHUH 3HMWH 5CJ5A 4XC3H 1KPVB 4MMZC 1XFPA 3ARZA 2UZYB 1CL7H 1PY4A 1A7NH 2VLRA 3QDGB 3AREC 1KIQB 3RX8A 4CJ0A 3EOTL 3U0WL 4YAQA 1IEAA 3BQUD 3QUKA 5TJWK 3I6GA 1HINH 3KR3L 4JGUA 1KTDB 1YNTA 3GSOA 4X6FA 4X7EC 2Q20A 4M6OL 4XCEB 5HHOD 3U46B 1QBAA 2J8OA 3NACL 2IANA 3TV3L 2H3NB 4OLUH 3E6HA 3K1KC 4ZFFA 4LLYA 2YUZA 3MZTA 2IBZY 5DVNA 2GT9A 5GS1A 4UT9L 5HI5C 2UVEA 1OP5K 4YBHA 2AJSL 4XZUB 3WIHL 2ADIB 4ZS7L 4XHJC 2EE9A 3NIFF 2OTWB 1BGXL 2VDOL 3EGSB 4RSVA 4BZ1L 3V6OA 1G9MH 3BO8B 5H8DA 4UQ3B 5FGSA 2P48B 3ULUD 4RIRB 3FB5B 2D7TH 1S9XA 5T3XH 3BPLC 3NPSC 1MCOL 5D6CB 5AAMA 2G5BB 1YN7A 4NCC1 4PJIA 5GXBB 3MNVB 4QXGH 4HG4J 3R0MA 1OP9A 1N8ZA 4Y4KD 4YHKL 2YXMA 5LGHL 1F3DH 4LLWB 2K1MA 1IC1A 1CQYA 3VE0B 4XVUC 2AXGB 3C8DA 2OR8A 4WFEE 5JW5B 5IVNA 2HLFD 3U30B 7FABL 2D7OA 4P59H 4XNYH 3BT2H 2ATPA 3AU1B 4DKDC 5I1AA 4GG6F 3MC0A 3OAUL 1TENA 1ZVHA 3T65B 5EO1B 1RIHH 4KZEH 4P4KC 4EEEA 3MODL 4CBPA 2DDQH 2DTSA 5L2KE 2XZQL 1KXQE 1QOKA 4D9LH 4YXKH 1CI5A 3PIQA 4U31A 3TIDB 3WFHB 5I1LB 1S7TA 4PTUB 2EH7H 3WKMH 5DHYB 3EO0A 2X4UA 4KHTH 3SGDH 4X7SH 4R0LA 3UP1A 1YQ2A 5DZLA 1S7VB 4UT7L 1I8LA 4JRXA 3VFSB 2EDLA 3AS0A 3FFDB 5DEGA 1TVHA 2CKBB 5FECA 4OQTH 5DD5H 4MJIA 4JN2B 4B41A 3T4YB 4Q58C 3NZHH 4JZOA 3KYOA 2EDJA 5C0BB 4YHIB 1FVEA 2HA1A 2PTTB 5E8EB 5CEZD 3EOAA 3JTSB 1G7QB 2R0ZH 1T1XA 1AHWA 1U8OA 4OF8A 5EOQH 2YPLD 4OZHB 1CN4A 4O2CB 2NX5A 1T89A 5BVJB 2J2ZA 2DKSA 4TUJA 1MLBA 3K81A 5D7JA 1P7KB 4PGDA 5CMAA 5KANG 3GSVB 4QRQB 5IVZB 3QDAA 1QSFE 2IH1A 3RHWF 5IQ9B 1PG7X 2A6IA 2FB4L 1I7RA 4N8CH 4F37F 4KQ3L 3MRRB 1I8MA 3P0VL 3IAGC 3S6CA 2FATL 4E5XB 1A6PA 1A14H 4N1HB 5T5NF 1J12A 4L3EE 3KPPB 5JUEH 2OK0H 1GVIA 3DMMC 2BXZA 1GHFH 3ZHLA 1JVKA 4AEHL 5KVGL 2QADD 3S34L 2VYRE 2F53B 3IF1B 5F1NA 4HIIB 2DQGL 1ZTXL 4RCAA 3H7LA 4JFQB 4EOWH 3VFNB 4L9LA 1YQVH 4RMTA 1HQRB 3WS6C 3EOBB 1X44A 4QTIL 3WSQL 3I75B 3HG1E 2CR3A 1J0IA 2DTML 4K7FB 3K8KA 1LEGA 2YA0A 3VI4E 4FFWC 1RZ8B 1T22A 5IVOA 4XAWL 3DX7A 4UNUA 1XT5A 1CXIA 1P53A 1MJ8H 5IWLC 4PJAE 3BD5A 1CFNB 2GUOA 2JIXB 4FP8H 4JFOA 2P5EB 4KJWD 4KPHH 3KYMA 1TVBA 3V4PH 4NM8L 1IAIH 2A1WL 4KXZH 4IMKC 5DVLA 2VDMH 2I60L 3T0BA 4XGZA 2ADJB 2GIYA 2HFEA 5AUMA 4P2OB 3HE7C 5CSBA 3HI6H 5DQDL 4MB4A 1IAKA 3DJ9A 3G6JB 2CIKA 3GO1L 3GB7B 4JFDE 5C09B 2ARJA 3GMLA 2BVOB 4DGYL 1QBLL 3Q6FA 3SEPA 1Y18B 3M17A 4Z7OF 4MDIB 2VL4A 3FN0L 4S10A 5JZ7C 1XCTB 3L5XH 4KKNA 2IH3B 3QIBC 3U0PB 2NY3D 3WNNA 4JB9H 1LHZA 2AK1H 2DYPB 3W39B 1U41A 5ISZB 4CNIB 1LP9A 2IAMA 4WV1C 4M8VA 4F9LA 2V2TA 2J1KA 4Z8FH 4HPYH 3SDCD 3MV7A 1H3GA 5IJKC 3IDGA 2LVCA 3H9HA 3WO3B 1GYAA 4PUBH 1NGWA 3D69A 4DZ8B 4KI1A 2X2YA 4L8DA 1FIGH 3D39E 5I18L 1GH7A 1QA9B 4BFIB 3MR9A 3IDJB 2DLHA 4OUUA 2NLJB 5IIEB 1DQQA 1H8NA 4BJLA 2K9UA 3I6KA 4XB7A 4LARH 1FG2A 2NZ9C 1MI5E 4JFEA 1CGSH 1NDMB 4NQVB 3QQNA 4QXWA 1WUNT 1OPGH 5H2BB 2OYPA 4PJ7F 4CADA 5I17B 2FO4A 3JWNC 1I7ZA 5JDSA 2Y36H 3LN4B 3SKJH 4POYA 4IOIB 1BJ1H 5FK9A 3JWDC 4LKXB 1AGBB 4AY0A 2B7DT 4LPWA 4GW1B 1J1OH 2LAGB 3SPVB 4P2RA 1Q94B 2COQA 4DW2H 1BMGA 1GGIL 5F9WB 5D71L 4GQ9H 4BFEA 2JELL 3OR7B 2X4PB 5DTFA 4JFPB 2P24B 1GGCH 4JN1H 3WFDH 2ZSWA 3QI9A 3QP3A 4KKLD 5HD8D 1EXUA 3WEXA 4KHXL 3UPRB 2EC9T 1OP3H 5I74B 4HV8B 2W65A 4O4YH 4C57C 3ZE2E 4ORGB 1B2WH 3IJSA 4LEOA 2PW1B 3IKKA 4R4FH 2R1XA 2J4WL 5DFVD 2Q7NA 4F2MB 5T1LA 3CFEA 3CCHB 5KG9A 5TF1L 2PO6B 3FT3B 1X4XA 3GK8H 1QSZA 2VLJB 5C3LD 4IRSA 1KCKA 2AEQH 4NN7C 4QF1B 4NFBA 3DO3A 3D0VB 1AXTH 3QUMB 3SE8H 1NGPH 1IGJB 2PXYD 5SV3A 1Q9KA 3KJ6H 4N90E 4C56D 1DBJL 3WD5L 3U4EA 3RDTC 2DQIL 4JREC 3UBXI 4WI8A 2VDNH 5EN2B 1XIWD 2H6PB 2IFFH 3F12A 5C0DA 4PJHE 5ICZB 5TPWH 3LKQB 1S9WA 2NY2C 3TO4D 4WO4A 1BD2B 1JF1A 1VENA 1AJ7H 4XBGA 4YE4L 3JWDH 4W68A 2QHLA 5I6XC 2FNBA 5E9DB 4PFEA 4JQXC 1B4RA 2HJLB 2VLKD 4U1GC 2PYEB 1DBAL 4FXGA 1A6VH 5EO0B 5SWSA 2GFBA 1TETL 5AD0A 4Z78B 4PGJA 3B4NA 5ANMA 3RUGE 3RVWD 4RGND 3VFGH 3O0RH 5B3JF 1SJVA 3DUHA 3PF2A 1P4BL 4WHDA 5GRUH 4RDQG 5C2BH 2Z91B 5B21A 2CKBL 2P1YA 1KN2H 1MOEA 5MEPB 4QNPF 2R69L 3QG7L 1JWSA 4M5YH 4OLXH 4L5FH 4TSCH 5DRZB 1DDHB 3O9WB 2DQHL 4F7TA 1LILA 3IFPB 1G7MA 3SGJC 4ACPA 3EHBC 4M93B 4PGBB 1WIOA 2YC1B 2N7AA 4Q2ZB 4GG6B 5EBMA 4JM2B 2UY7A 2BMKA 4PB0L 5I1IH 2BNRE 3RVTC 3QEHA 5FO7A 5B4MD 2EDWA 5KVEL 1BFVH 4D9QD 5I1CH 1REIA 2VXQH 3QIWC 2XTLA 5IFHH 1UCBL 2CXKA 3B8SA 4ELKA 3MRBB 5F3HB 5INDA 5CHNA 4FQCH 1QBML 1FP5A 5EIVA 2UZXB 2Q8BH 4F33B 2GJ6A 2GEEA 3QFJA 2EICA 2QKIA 3IRPX 2BNQD 5ITBH 1UYWL 3NCJL 1D5IH 1I7UB 1GC1C 4HUUB 4M7LH 5JOPD 3ECBA 1SBBA 1WJ3A 3AVEA 2A6JA 3LDBC 3FO0L 4R7DB 3I02B 1V5JA 1WWAX 4LLQA 1XF5B 1N7MH 5CLWA 2LE9A 2L4OA 3F7YB 3C87A 4N8VG 3QYCA 4YFLF 5BRZA 1DFBL 4DCQA 1A5FL 2VDLH 4L4VE 3O11A 5SV4A 1RZKC 3O3DB 2I07B 4LCYA 2V9RA 4QYOB 3MOQA 3C5ZB 1SM3L 3CH1B 2BVEA 5D8JH 5IUSA 4TRPL 2DQTL 2Q7YB 4TVPH 4Y5XB 5D93B 5BCAA 1QSEE 5F9DC 4PPTA 3GIVB 2RIKA 1PGRB 1W0VB 1QLEL 4I18A 4XP9L 5FEBA 4MHHG 4PLKD 4NPYB 1A47A 5J9PB 3QIUD 4BSWB 4HWUA 2AJVH 1ZT1A 4J3VA 2R2EB 4MXQC 3QFDA 5A1AA 4BFGA 1LEIA 1BZQK 4PJ9B 4BQCA 1WCBB 3PWPD 5I15H 2Q86B 1AO7B 4RFOH 1UA6H 4JQIL 2NY4B 2X1PA 2YRLA 1PX4A 1Z0NA 4NKIL 5HYFA 3WNPA 2NW3B 4LLMA 5D7LA 5IV2B 1OTTC 2VXUH 1SYSA 2ENYA 4HLZG 5DYOB 5F7MC 1GC1H 3OKMA 4UAOC 1F4YH 3DTXA 1R3LB 4I9WE 4J23A 4QXUL 2C3WA 3U1SL 1IQDA 3NFNB 4QRRE 3ORJA 1NGYA 4YHZL 2Y5TB 3ARDD 1HIML 3H9YA 1LNUB 1T04A 4XVTL 1NCAL 4BZYA 4OZIF 1IC7L 1UCTA 1F4WH 4X5XB 3T4AB 1CGYA 3V6ZB 1B0GA 1D5ZA 4M5ZL 5T3ZE 2DQEL 4PY8J 1RZKH 5CP3A 1TPXC 4WI5A 1T0PB 4NQDA 2APWA 4G9FD 4OM1L 4XNMA 3WUWG 4XMPL 4PJBA 4DGIH 2ARJQ 4O00A 2BSSB 2H26A 3PHQA 3I6LD 1UH2A 3QQ9C 2B8OT 3QCUL 5EOCJ 3FB6B 2ITDA 3MZGB 1FVDB 4PRHA 5E2UH 4YPGB 4EIGB 3G6AA 4X5WB 3VXRD 2I5YH 3RIFF 5KOVC 4RDQF 2Y72A 4XC3L 4HHAA 4NRXB 4UINL 1GRWA 2Z8RA 3PDOA 4JHAH 1IEBB 3GI8L 3K1DA 1JPST 5J12B 3TYGL 5I1DA 5CINH 1B4JH 1F2QA 1QYGL 1TQBC 3DUUB 2IBZX 4XNXH 4N9OB 1XGPA 1HINL 5HPMB 1IC5H 4NRYB 3NCBB 1BBJB 4L8CB 4OGAC 3EJZD 1I8IB 4PG2A 1LEKB 4Z95L 4U6XB 3DX6A 1IAMA 3AUVA 4LSVH 3DYMA 1ZLUK 4HJ0C 2AK4E 5AZ2H 4XNUH 5J0BA 1YEJH 5DUBB 1ORSB 2AERT 2XPGA 2X4NB 2I9LA 3LOWA 1F4XH 1T1WA 3QCVH 1ZLSH 1G9ML 1J8HD 3P4MA 4G5ZH 2O26U 1EFXB 4PJ7B 2CGRH 3PXHA 2D7TL 3TA3B 2R2CA 4MS8D 1C5BH 3QUYB 1WEJH 3I2CH 5KTEL 3CSGA 3MREA 4PD4K 3VXTA 5F6IB 3FQXB 35C8H 1OQOA 3BIKB 5AWNH 4X99B 1VPOL 4FQJH 1FFQA 1IFHH 1ZGLP 1EEQA 4GH7B 2D03H 3TVMA 1MHCA 3LN5A 1TJGL 3S5LG 1CIDA 3IDIA 1ZANH 1YEHH 4PJDE 2AJZA 5EPMB 3KGRA 4OV5A 3MRPA 4I48B 4C4KO 5FYKU 4TPRH 3DHJA 3VXQA 1HOCA 4GRLC 1LE9A 2CDEB 5FYLL 1OGAB 1RIHL 3IJHA 2YOCA 1JFQH 5JORA 1UZ8B 1HH6B 3MA9H 2F54A 1VGEH 1IAIM 4YDIH 5JOFB 3QEQA 4DUVA 2EH7L 5JIKA 1A7QL 2Y7QA 4Y4FA 4G8GE 4ZUVA 3MXVH 3BP7B 4LASH 5DK3A 4J4PA 2YHGA 2HJFB 3JXAA 4LOUC 1R3IH 1D5MA 4KH2A 5K9KA 4LBEA 3KHOA 4O02L 1YNKH 5CIPA 3LHPH 3HG1B 4FQXA 5E94A 5EU4A 4BYHA 3OMZA 1MCDA 5FUZH 5IBUG 4N5EC 5BQ7A 3ARRA 2WP3T 1AD0A 4IHOB 4NQSA 4XCYB 1QFUH 1TFHA 2ICCA 1U8MB 4JPIA 3DSNA 3IAPA 2R0ZL 4YHNA 3WDJA 1IGYB 5IR1B 3UMTA 1WZLA 4MCZB 4P49A 5C08A 4YDKH 1FSKB 1VGKA 2E9JA 4G3YH 2FIKB 2ORBL 3W9DB 3DVFA 5JO5B 4DKFL 3CFKA 4HUXA 4S1QH 3WFEL 1Z9MA 5KJRL 5D1QB 5K9QG 4LGSB 4N8CL 4F80A 3VFTB 3VGHA 4K71C 4OAWA 3TBTA 1G84A 1I1YB 1A14L 2OK0L 1C5CH 2ZCLL 3MJGX 3OF6D 1BVZA 1HH9A 2F19H 2E27H 4MDJA 4NO3A 1J05B 4X6CA 2NY6B 3ZE1E 2QQQA 2A0LD 2HJKB 4TQEH 1XF2A 2ZSVB 5TDNA 3MV9A 2AI0L 4NP4H 4JQVA 3TC9A 1K4CB 1KSRA 5F7EH 4M43H 3ARBA 5HGAB 2XZAH 3CVHH 3KXFA 3TFKD 3BEWA 4KI5C 5C0IB 2C4XA 2OCFD 3FT2B 4OZFA 4QRPB 1Q0YL 4NKMA 2YWZA 3MA7A 4JY6B 1OL0A 3DYPA 3VD4A 1JHTA 4PRID 2ENSA 3PNWB 2PTVA 4K94C 4QT5B 1UWGL 1MWAA 4P0DA 5GRVK 2XICA 1WBXB 4IRJA 1IAIL 1F58L 4GOSA 2VR5A 2VDML 2YN5A 4WUUE 4GAGH 2HH0L 1ED3A 1HYRC 4H25B 3VXUA 3SDDD 4X98A 3PV6B 3RTQB 4P46B 4GFTB 1PLGL 3HI6L 1FFNA 4MA7L 2FWOB 1KPVA 1VERA 4HULB 3IAQA 5HYJD 3MBEC 4ISVB 1OTUC 4M1GH 3QDGA 43C9B 4FQ1H 3QHZH 1KIQA 1F3RB 3G5ZA 3BUTA 2Q76B 3SDAC 4GRWE 3THMH 1LVEA 1QNZH 3B5TA 4BELD 2WUBL 3HAEB 4KMQA 2IQAB 4XWGH 5E4IA 4XCEA 4U0RC 1YN6B 4JB9L 2AV7B 4PJFE 4OCWH 3TP4A 2AJYH 3RWHA 5D2NB 4Z8FL 3CFBB 2IG2L 3W82A 2NTFA 4PUBL 1JGDB 3QNXA 5HI4C 4OCYL 3LRGA 4XZUA 3TWCH 2OTWA 3EGSA 1NKOA 1FIGL 1HWGB 3IFLL 3H9SE 5EUOE 5J4MA 4UQ3A 4RIRA 3FB5A 4Y4HB 3CGTA 3CX5J 3OWEA 4HFUL 4K94H 5HPOA 5D6CA 2AAVA 2G5BA 5T3XD 3MNVA 2EDNA 5E1HB 4LARL 4K2UH 2MHAB 1CGSL 4LLWA 1O7VA 1MH5B 2VZ3A 5HHMD 3PQYB 4ZXBC 3DO7B 4HGMA 3BIAX 5JW5A 4X4YA 4JFZH 3Q5TA 2HTKC 1FBIH 4RAVB 4HPOH 4NN6B 3SKJL 1NQBA 4FN0A 4H1LB 1NFDE 4MNGB 1WT5A 4OZIB 5FYKE 1BEYH 2VN4A 3ARED 5AG9A 2VQUA 5ALBH 1JGEB 4OCLC 5EO1A 2B5IB 3RNQA 1J1OL 4DW2L 2PYFB 3I3EA 5EU6E 3P0YL 5C0CE 4Z7UA 4M1DL 3WFHA 5I1LA 3WFDL 5DHYA 3HI5L 1K2DB 4KQ4H 1Z2KA 1KPUB 2E7MA 2QR0B 2NXZC 1B2WL 4PJCE 2X89D 3SDXA 3VFSA 5HI5D 4R4FL 3FFDA 2CKBA 2HKHH 5GGUB 1N64H 4JN2A 4OLZL 5MEND 3QEGL 4XHJD 5E7FA 3T4YA 3M1BB 4GBXC 3GK8L 1HZHH 4U1IB 3VWJC 5J11C 2AEQL 4U1HB 5C0BA 4MWFB 4YHIA 2RAMA 1MLCB 1Z9OA 3QNYB 1XGRB 1T0NB 1B6DA 2OX5A 5E8EA 3JTSA 1TNMA 3QWRD 1RUQL 3CXDL 5KS9E 3ZT6A 4CN6A 4EI5C 4O2CA 2MSPA 5BVJA 1T1YA 1JI2A 3ARFB 5KOMC 4GW5B 2IFFL 1P7KA 2C1OA 3GSVA 4QRQA 3GSRB 4HBQA 5IVZA 4XVUD 5TPWL 4HKZA 5C0NC 3HRPA 4POZC 1ZGLB 4F7EB 3OGCA 5KSUA 5IQ9A 2VUYA 2HG5B 4FXLA 3JWDL 3MRRA 4E5XA 2H32B 4ODTH 3KPPA 1KCUH 3ETBF 2AEPH 4YDJB 1L7IL 2D4DA 3MUGB 4OF3A 5GJSH 1HSAB 4Q9QH 3FFCD 4OZGE 4F57L 2F53A 4GAJL 1DN2A 2ICWI 4P4KD 3IF1A 4FQQB 2ZUXA 4M61B 4YPJA 3VFGL 4JFQA 3O0RL 3VFNA 1L9MA 1HQRA 2A2QT 1CLYH 3EOBA 3R06B 3NOIA 3I75A 4X5LA 4MSWB 2FD6H 1KN2L 1OGTB 1YY8B 2OMNA 1VFAB 2HVJB 2GQHA 4NYLA 4XP5H 4Q6IB 5HHXH 1B6UA 4TSCL 2P8PA 1RZ8A 2RJMA 3BEVB 5EOCH 4P9MH 4WTZG 1YC8A 5D1ZA 5I8KH 2DM2A 1DUYA 4WI3A 5BVPH 4IOSD 1T03H 4DGVH 4ERSH 5DHXB 1KENL 1CFNA 3J7HA 2JIXA 1X4YA 5I1IL 2P5EA 4PJFF 5TQ0H 4FQIH 3U0TB 2APTA 1BFVL 2Z35B 2VXQL 4MQ7B 5DT1H 3DXAE 4Z7VE 4NKOB 3N1MC 4G8FB 2Q8BL 5FYJE 3T3PE 3LAFA 4GKNA 4P2OA 5ITBL 1D5IL 5CUSH 5EUOF 5GGRB 5ACZB 1D5BA 1UENA 4NNYB 4NC1C 1BAFH 3DX8B 4RGNE 3VD7A 2BVOA 4G6FD 5IJVB 1DLHB 4IM8A 1Y18A 3B5HA 5SWZB 4MDIA 1X6LA 1F5WA 2MCPH 5A2JH 1N7ML 1XCTA 3IDXH 4I77H 3VGAB 3S36X 2JJTC 2IH3A 3DMMD 4KZDH 3NA4A 3U0PA 4K23L 2DYPA 4KTYA 3W39A 5ISZA 4M8QB 2F8XC 4H20H 2P5WE 3C8KB 2VB5A 3E2HB 4CNIA 4KROB 5CD5C 4K7PY 1X5KA 1EEZB 1EGJA 2WWMC 3K2UH 1MIMH 3V6FB 3QO1A 3F7VA 3LEVH 1YNLH 5CJXC 4PRAB 4TVPL 4WEBH 1IBGL 1A7RL 4FFWD 4HZAA 4DZ8A 2J8UE 2WQRA 3TBWB 4MXVE 2NY7H 4Y5YC 3MLVH 4BFIA 5IP4A 1XGUB 1DQDH 3IDJA 5JXEC 1S7RB 4ZUSB 4YXHH 1T2JA 4I3SL 1JNJA 3N1QC 2NLJA 5HYQB 5IIEA 1QLRB 3NTCH 3S35X 2BNQE 4ZPVB 3RGHA 3EJYC 3HRZB 2WINB 3NGBC 3RZCC 1NDMA 3UTTA 5JOPE 4PJCF 4HKJB 3V0VB 5I17A 1J0JA 5F70A 2Q8AH 3S7GA 1CK0L 3HC4H 3MLRH 5I15L 1X9QA 3QXUA 4F3FA 1EUUA 2IPTH 3HE7D 3T0EC 3WIFB 3NZ8B 1AGBA 4EBQH 2GKIA 3AY4A 1CG9A 3PL6B 2DLIA 2ZUVA 1V05A 2QJDA 4GW1A 1Q94A 3A6OA 2ZPKH 5I9QB 3P30L 3LMJH 3OR7A 2X4PA 5MEOB 4HWZA 4WWID 3O9WC 2P24A 4JFPA 1F4WL 4KKCC 3QIBD 2ADFH 1KIPA 5J06A 3UPRA 1I4FB 2VWEE 5DJ2B 1PEZA 5FA3B 1KNOB 1HHIB 4ORGA 3GGWB 1MUJB 3QUMH 5D70H 4DGIL 5KSBA 1ZEAH 1YEGL 1KBGH 3ALXA 4TVSa 3ZYIA 5I8OH 1RULH 5J57B 2A74A 4F2MA 4YDLB 2YKLH 1KB9K 2PO6A 1XH3B 3FT3A 4Y2OA 5L88H 1CL7I 5E2UL 4AIZB 4QF1A 3NIDF 3D0VA 4DKEL 3PWPE 4EJ1C 1PAMA 2WIMA 4UU9A 3PABB 1K5NA 5I1EL 5C07E 3U2SA 4PJ8C 4DVBA 3O4LA 5TGBB 5KW9L 4L4TE 2NZ9D 5CINL 5EN2A 2H6PA 3MACL 3STZB 3GJFB 1T6WA 4FZEL 5ICZA 5D2LE 5ABDE 2DL9A 1JTPA 4K3HA 4HGKC 1BD2A 1U8HB 4NQCB 1IC5L 2GK2A 4RAUB 4QHLB 4WIQA 2B2XH 5GZOC 5E9DA 3KPSE 2HJLA 3EZ8A 4PS4H 1CWVA 2CR6A 1ES0B 2PYEA 5EO0A 5I0DA 2XXCB 5AZ2L 3N9GH 4XNUL 1PJ9A 4Z78A 1NL0H 3C5ZC 2BDNH 1U95B 2QBWA 1X5IA 2O5YL 1CDBA 4Y8AA 2A77H 1CXLA 1HILA 2Z91A 3V52L 3WV0A 1ZXQA 2NY1B 4G5ZL 1MAMH 2CGRL 1A1OB 1QHOA 1MNUL 5JIIA 5DRZA 4HG4K 1DDHA 1C5BL 5ESVB 1PG7W 4ZSOA 4CMHB 1P7QD 1WEJL 35C8L 1IGCH 4LRNH 1MCJA 5IGXH 4PGBA 2YC1A 2DMBA 4Q2ZA 1CT8B 5AWNL 3SN6N 1WISA 4GG6A 4JM2A 2EDRA 2YD1A 1IFHL 4PJ9C 4FHBD 2D03L 3MRFB 1FGNL 5DUPH 3BJ91 1ZT7B 3MV8B 3JTTB 3ULVF 5FM5O 3MRBA 3RWEB 5F3HA 3SCMC 1FRGH 4E41A 3UTPD 4TPRL 3GRWL 1IILE 3RDTD 3FO1B 4F33A 1FO0H 1MJUH 4GXUN 3GSXB 1I7UA 1NLBH 1X5AA 2NY2D 5BS0B 5F72S 4HUUA 3SGDI 5FB8B 5EOTB 5IMKB 3LQMA 1JMXA 3AS3A 4KRPC 4LRIC 4I0PB 4MNQE 3RX7A 1OSZB 2G60L 4KV5E 3MLWH 3MXVL 4LASL 4WEMB 3BH9B 3I02A 3BDYH 3ZYZA 1G9EA 1XF5A 1I1FB 3F7YA 1R3IL 3VXSD 4UTAH 6FABL 3LHPL 3QDJB 3VH8G 5E6IC 4X9FA 3DHMA 3LS4L 3O3DA 5E99H 5L2JB 4WDIB 1CICB 3LEXB 5MERB 4QYOA 1OAKH 1N6QH 5FUZL 1WC7A 3LD8B 3CH1A 4P23B 2CJUH 5JHDE 1T7ZA 4G43B 1QFUL 1FGVH 2Q7YA 4Y5XA 1ZHBA 1I3GH 4AMKH 5I71B 1UFUA 3WCYA 3UJJH 5CAYB 1PG7H 3TZVB 3GIVA 3EHBD 5J12C 5JQ6H 1W0VA 3VFPB 5BZWB 2R15A 5C0AE 5J9PA 4X6BA 2WSKA 3RVTD 4BSWA 4E42B 4HUMB 1FLRH 5F7NC 2R2EA 1S9YB 4R26L 1UZ6E 3X14B 5FKPB 5T1KB 2DLTA 4N0UB 1RAMA 1M05A 3QIWD 5D72H 3S4SG 1WCBA 2Q86A 2UWEE 2NW3A 4JRYA 2E27L 5B39G 5IV2A 5A16B 4UQ2B 1HHKA 2DIJA 1R3LA 3X3FH 2DOCA 4W4OC 1U8LA 4PRPE 4AT6B 2Y5TA 2X41A 3O3UN 4NP4L 1LNUA 2A6KA 4EDXB 5ICXB 4M43L 5I19L 3TA3C 4PJ5D 2XZAL 3CVHL 3W0WD 3GKZA 3KNBB 4X5XA 2KUTA 3QUYC 4FFZL 4XTRC 3T4AA 5I8CB 3V6ZA 2FX7H 4ZOEA 5J6GB 1DL7H 3CC5A 1AKJD 1IAII 4KXZI 4P2YA 3BKJH 2DQDL 4JE4B 3C6LB 4LU5L 2FGZA 4LPXA 3AFLA 3NN8B 4DOHB 2BSSA 2F8OA 2OZ4H 3HC0B 3VGDA 4LHUD 3FB6A 5F93C 4KUZL 1NMCB 1FVDA 4GAGL 3GMMB 2J12B 4HIXH 4YPGA 1NCBH 4X5WA 2Y25A 3KPMB 3L3KB 4LSTL 4Y16A 4V1DA 4NRXA 4ZNEE 1D9KB 2CDGB 1U8JB 3JZ7A 3JV6B 4NZUH 5AYUH 3KG5A 4MXQD 3SGKA 4MB3A 3NBNA 3QDMB 4YBQC 3THML 1NBZB 3SE4C 4JO3L 1UWEH 4XBPB 5HPMA 1T83A 4NRYA 3RGVC 1CFVL 1BBJA 2OJZH 4QRTB 3BRDA 4LLAA 1OTTD 4U3CA 4U6XA 2P42B 2AJYL 3TO2B 3EDDA 4APQC 1FVCB 2FEEI 4PRIE 4X7CC 4Z0XA 1ORSA 3PGFL 1JNNH 2X4NA 1MCCA 1FZMB 1N0XH 1KFAL 1OAYL 3TWCL 5EDXA 4AEFA 1NDGA 1T5WB 5E2TH 12E8H 1EFXA 3D18B 5EBLB 1FYTD 1NBYB 3U7YH 2VLRE 4K94L 4H8WL 2GITA 3EDFA 2JK5B 4EN3B 3GMNB 4L3CB 3FQXA 4AQ1B 1C08B 2VSCA 4L1HA 2YD5A 5ACLA 1RJLA 3O2DL 3O2VH 3BIKA 4X99A 3OAZH 4LQ1A 5D7KE 3QQ9D 2J5LB 1A3RH 4WI4A 4D0DB 1FH5H 4JFZL 1NBVL 1L7TL 4HQQH 4RMUA 1UACH 4N68A 4P48A 3BGMB 2IANE 5EU5B 3G5YB 1AE6L 4Q9CA 5IROC 1TMCB 5D5MF 5TE6H 2EEAA 5ALBL 2CDEA 1U8QB 3SE9H 1HYSC 5DJ0B 1NUNB 1HH6A 2YD6A 5CJOH 3AAZA 5ADPL 5JOFA 1A1MB 4HKXA 4OGAD 4WI6A 5D9SA 4NKQB 4ONGH 2KL6A 1T20A 5K93A 2VZUA 4PJIE 2DRUA 2HJFA 4K3JH 5I1JH 1D6VL 5EZLB 3M8OH 2HKHL 8FABB 3O41B 4R97B 5HHME 1CFSB 4IHOA 4J3UA 4XCYA 2QSCL 5I76B 1U8MA 5F1KC 5GGVY 3UDWC 1IGYA 5EORH 1SY6H 3C2AH 5IR1A 4MCZA 3ARVA 3W9EA 4LVOB 2FIKA 5HGBB 5JO5A 4YUEH 3I50H 4PLJC 4JO1L 1U3YA 1MCNA 5D1QA 4HMCA 1BIHA 1CE1H 3VFTA 1DBBH 3MJ7B 4UV7L 1I1YA 4A6YH 2N56A 1KCUL 4JRXE 2AEPL 1DBMH 1MF2H 4GRLD 1AD9B 5GJSL 4ODWA 4WFGE 4MJIE 3B2UC 3FO9B 1J05A 4ZUTB 1BF2A 1F42A 4YC2C 1YMMD 5DO2C 5FO8B 2HJKA 1NGXA 2ZSVA 4J3WA 5IESL 3GHEH 3MCLH 2C3VB 1IRAY 1K4CA 4Y2DC 4JFHD 2A6DB 4XP5L 5HHXL 2AP2A 5HGAA 2MFNA 2NX5E 4LP5A 1D5XB 4JFFB 4LOUD 2ADGB 4KWUA 5EOCL 1J0ZA 3C9NB 3JUYA 1DE4B 4JY6A 1UM4H 4XPBH 5DWUH 4U05A 2V5YA 3EYQC 5BVPL 4XRCB 4XMKL 1NLDH 2EH8L 2DBLH 2MOVA 3PNWA 5JHLH 2VABB 3DRTB 4QT5A 5TQ0L 4PBXA 5LJYH 2ZCKH 4N5ED 5JR1H 1WBXA 4NN6C 5KVDL 4DVRH 5DT1L 4NQED 5JW4M 3CLEH 1AXIB 1RQ5A 4H25A 5HVGB 3BN9D 3PV6A 5FA4A 3RTQA 4P46A 4M6ML 2FWOA 4HF5H 2V17L 5CUSL 3B9KA 4ZYKB 5CWSB 3TPKA 3LPFA 5D7IE 3O6KH 4ISVA 43C9A 5BOZG 2Q76A 2UVFA 1RZ7H 3DX9B 1CE6B 3MRGA 4K7PX 5HHVH 2DM3A 5TQ2H 1RV6X 3KPRB 3RY4A 1MELA 3HAEA 4KZDL 3WKNA 1AY1L 2IQAA 3BGFC 2AV7A 1EJOL 4RFNB 2OL3B 3QUXB 5D2NA 3P9WB 3ARGB 2OSLB 4L8SB 3FAWA 3BZEB 2MTPA 1GZPA 1YNLL 1U93B 4WEBL 2EDFA 4P5TC 4KI5D 3C5SB 1XGYL 4Z0BH 1U3HC 2NY7L 3MLVL 1U6AH 1H3XA 1MCPL 4Y4HA 2VDRH 3O8XB 1UJ3B 4YXHL 4CKVX 1NAKL 4HUVA 4KTDH 4RISH 4PJIF 1G1YA 1CFTB 2MHAA 1J5OH 3BDBA 3MRDB 1MH5A 3TGXA 2E7LC 3BZ4B 2BRRL 3BAEH 1GAFH 2C4FT 4OKVB 5JIPA 3HC4L 4O51B 1MY7A 15C8L 1K8DB 4H1LA 2F58H 1LP9E 4MNGA 4PV9B 4OZIA 1F13A 1OAZH 3A6BH 3G04B 4EBQL 1XR8B 3MBED 2IF7A 2WBJC 1MAKA 2YRPA 5D1XC 2AABH 2VDPL 3SDAD 2B4CC 3ARSA 3D3VB 3SE3C 3HS0A 5C70A 1MEXH 3O2WL 2PYFA 4KGJA 3LMJL 3O6MH 1MREH 4AK1A 1JMZA 1ZS8B 3GIZH 2ADFL 2JKXA 1LK3H 5E70A 1HNFA 2K3TA 1KPUA 2QR0A 1IC4H 3VCLA 5DMIH 2ZZUT 1P9MC 3VFWB 3T0XA 1KBGL 4KVNH 5GGUA 5HI4D 5I8OL 1RULL 2IPUK 3SO3C 5LVEA 2DLFH 2YKLL 3FQUA 5TE7H 1F90H 5L88L 4HIEB 4ZUUA 3MLZH 4U1HA 4Y88A 4MWFA 1YJDL 1MLCA 3QNYA 4JHZA 1XGRA 1T0NA 4KDVA 4NJ9H 5I73B 4K9EC 4OJFH 3TN0B 25C8H 3ARFA 4YNYB 4CL7A 2W1NA 4GW5A 5GGSB 3GSRA 1ZGLA 2GSGB 4PJEE 4F7EA 4DZBB 1RZIB 2HTKD 2HG5A 1MFAH 2VE6B 5KAQF 3RWJB 5BW7A 4HC1L 5F6HJ 3AMKA 3GRWA 2B2XL 3ZTNH 2YPVH 4PS4L 1FCGA 2H32A 3SJVB 2LTQB 3VJ6B 2B4CH 3MUGA 4YR6B 1HSAA 3QUZB 1NL0L 3F7RA 4NO5A 1ZVSB 3HNVH 4M61A 3UC0H 3MJ8B 4XP1H 4NM4L 3WFCH 4LGRB 3MRJB 3WXVH 2DN7A 1YY8A 2JJVA 1VFAA 2BC4B 2HVJA 1QRNB 2WAHA 1KCRL 1PEWA 3BEVA 2NXZD 4OGYH 3Q6GH 1IGCL 4LRNL 5E8OA 5IGXL 5JTWA 1SJXA 5D5MB 4PJXF 3MRIB 4ODHH 5LAXB 3T77B 1ZE3C 1BHGA 4QHUA 4GBXD 2V7HB 5DUPL 3VWJD 3BRFA 5DJ6B 1VFBA 3U0TA 1JK8B 4ZDHB 5FGCB 4RA3A 3DI2B 2Z35A 4WW1A 4K9EH 4WWKB 5SWSE 2KBGA 1JJUA 1SYVB 2C4FU 2HLAB 4XVSL 2MKWA 4IJ3B 4EI5D 1ULVA 4G8FA 4NKOA 3T2OA 3ZDYF 5ANME 4OFKA 2F8VA 4MD5B 5C09D 5TE4H 2WM0A 4IIQB 1JGUH 4HLZH 1FO0L 1MJUL 5C0ND 1NLBL 4POZD 4MAUL 5ACZA 5GSVB 3G6DH 3LH2L 4NNYA 4R2GC 3DX8A 2KQMA 2G2RB 1DLHA 3CZJA 5KSAC 2C1PB 4F9PA 1DLFH 2LU4A 4P3CH 1IQWL 5B39B 2HMIC 3BDYL 3PDDA 2V9TA 4GAYA 4DUWA 3VGFA 1DCLA 5SX5K 5T3ZH 1CU4H 4M8QA 2ESVD 3TT1L 4JFYB 3C8KA 2H41A 3BH8B 1OAKL 1RUKL 1RIUH 5DA0B 5MI0C 1JNLL 1N6QL 1NJ9B 1P6AB 2CJUL 3VW3L 1JV5B 5C0RH 4NWTH 3BOVA 3WDHA 4QRSB 1MCBA 5IB4B 2YSSA 3TBWA 1ZLWH 2HT2C 3QFJE 3UJJL 2VZVA 4XPAH 1XGUA 1KCLA 4U6HB 4FTVB 5JQ6L 3BISA 1S7RA 3TH4T 3UTPE 4JZJC 4ZUSA 4WW2F 5HYQA 5E95B 1QLRA 4ZPVA 4K3DH 3VWKA 3HRZA 4OQ1A 1KC5H 1RK1B 4XPFH 5MP6H 2WINA 4NNPH 1CVSC 4HKJA 3V0VA 5FHBL 4IS6B 4CU7A 3BHBB 1QFHA 3O6FC 3RWCA 3I84A 4LKCB 5BRZE 5L0QB 1YEKH 4MLSA 2C3XA 2B1HH 2EYSB 5JA9A 2XWTB 2VLMD 1TQCB 4EQ2A 2XA8L 4GMSH 1OQXA 3WIFA 1JRHH 3X3FL 3PL6A 1F2XK 3U7AA 3V95A 1IM9D 2A73B 2NNAB 1KACB 2BK8A 4DKAA 1AGDA 2OL3L 3SDYL 2W9LA 5CP7B 2W38A 3MRLB 2M8XA 3OR6B 5MEOA 4CMHC 4Z18A 1HI6B 4U6TA 2BRQA 1ZHKB 5KZCD 3RL2B 2B0SH 1I4FA 5DJ2A 4U33A 5E5MA 1KNOA 1XCQB 3BKJL 4HXBH 5CD5D 1HHIA 3DETC 3QO0B 1MUJA 2VQTA 3KLSA 5ALCL 1FE8H 3MLXL 2VLJD 3UYOD 1IGFH 2YD8A 2WWMD 4X83A 3VMOA 1L4IA 4UUJB 4NSKB 3ULUF 4JHWH 3P73A 2ZUQB 3P11H 4YHLH 3OHXA 1XH3A 5D7LE 3BYTA 3EFDH 3WNOA 4AIZA 3CH8A 3KPOA 5JXED 2UV3A 4HAFA 2CPCA 4L3AA 3O2DA 1V7NH 4BQ9A 5DMKB 1CBVL 3GSOB 4G7YH 2O5XL 5TGBA 3EJYD 1HXYA 1Z9LA 5AYUL 5TDOB 1HDMA 3RZCD 2IGFH 2R56H 3STZA 3GJFA 4ZFFB 1OW0A 4LLYB 3UTSD 1EIBA 4HIHB 3VXMB 3IFOB 1U8HA 1UWEL 4NQCA 3L6FA 5F8QC 1Q1JH 3MLUL 5HVHC 4QHLA 4PJ5E 5I8EA 3W0WE 1I1AC 4NQDE 4F15C 4X4XB 3T0ED 5GRJH 4YFEA 4U1NB 4PJBE 1ES0A 5A2KH 4GXUM 1FN4B 1BM3L 3G5VB 5DJZB 3OKEA 1T2QL 1U95A 4RWYH 4TOYL 4UNTA 4PRHE 3RHWK 1OB1B 2OLDA 3QXAA 1RZJL 3O9WD 3WLBB 1N8ZB 4KKCD 1BJMA 4RWHA 4F37K 3HE6B 1A1OA 4LCWA 1EK3A 4ODXB 1VCAA 5GISL 2BY0A 3EJJX 2IJ0C 1DUZB 5IKCB 1OLZA 4JKPL 2SEBB 2BVQB 3B8YA 3FTGB 4N1EA 1CT8A 4MZ3A 5AG8A 5CCKH 1A3LH 5BO1H 3MRFA 1YUHB 1FH5L 4ALAH 5HGDB 1UACL 1ZT7A 2WANA 2XI9A 1QBBA 1CDHA 2NYYC 2X7LA 4ZXBA 3ZKXC 4PJ8D 2W9DH 4D94A 2ED9A 5TE6L 3FO1A 3EO0B 2BNUB 2QL1A 4FRWA 4YBLB 1UXWA 4R0LB 3X12B 1KEMH 3C08H 4QEGA 1UEMA 2VOTA 5IQ7H 5EOTA 5IMKA 1HHGB 2CDFB 4S1DD 3S37X 3O3BB 4DQOL 1NAMH 5LCVL 4G8EB 4I0PA 2W0PA 1OSZA 5DMGC 4LQFH 2X4OA 5DLML 4ONGL 5GZOD 5FGBA 1J1PH 3H3PL 1IMHC 1I1FA 4XCFH 1YMHB 1KIRB 1HWHB 5E08H 4K3JL 5I1JL 3C5ZD 2F5AH 2JJWA 3EOAB 3M8OL 4HKBB 3ZKQD 1U8OB 5L2JA 1BWWA 3DGGB 3KPLB 1CICA 3LEXA 5MERA 3O45B 3DIFA 1MLBB 4Y1AD 4P23A 3OTTA 4S0TD 3P3YA 4G43A 3MCKA 4HWEH 3TLRA 1G7LB 4OD1H 4PTTB 3P4NA 3K74B 1II4E 3X3GH 2IH1B 5B38B 3BESR 1A02N 1DVFC 3JWOC 1G6RH 1I7RB 1SY6L 3GMOB 4WHYG 4D9RD 3TZVA 1HN1A 3KHQA 4LSPL 4QOKD 1NC2A 3VFPA 2Y6SC 5BZWA 5HSFA 2F54E 3QEQE 4PJ9D 4YUEL 3I50L 3A0OA 4E42A 4ZTOH 3C60B 4ZAKB 1AO7D 3X14A 5FKPA 4N0UA 2O93L 4GRWH 3PGCA 2FR4B 5HXMA 2FLBT 2NY5L 4A6YL 5GJTH 4PY8I 3SCMD 4LSQH 2XTJE 3WIIH 5T5FH 4GKSB 4X6DF 2OQJB 1IARB 4UQ2A 2ZOLB 1NC4D 3CSYA 1T22B 3DX7B 2XFXB 2JCCF 4JR9H 1R3JB 4AT6A 5J13B 4KRPD 1FDLH 4RMRA 3GHEL 3GI9H 3MCLL 4PJXB 3BPCB 3ABZA 5JA8B 4NQTA 5ICXA 3BUYB 4UTBH 2GUOB 1NCUA 4JFOB 3O6LH 1EAJA 3EFFB 2BERA 5C08E 1SJEB 3KNBA 1TVBB 1U8KA 5I8CA 1NGZB 5DJDB 2GHWB 5DUML 5J6GA 1UM4L 4XPBL 5L8LB 1G6VK 5HDBE 4ZO6A 1K9TA 5E6ID 2J5LC 2DBLL 3C6LA 5JHLL 5TF0A 4P4RB 3NN8A 3G08B 1UVQB 4Y5VB 3HC0A 3JWOH 5KN5B 4DVRL 3CK0L 5DVOA 4O9HL 4ZOCA 4P2QB 2AW2A 1X3DA 1FNHA 3GMMA 4X6CE 4WFED 5ACMA 3KPMA 4IDJL 3L3KA 3DWTA 4MAYC 4YZFE 4HF5L 4C58B 2WQ8A 5FYKH 1D9KA 2CDGA 3MV9E 1SHMA 1U8JA 1S5IL 4WI2A 1OF2B 3PP3K 4G6KL 2R4SL 1YMME 3S36H 2C5DC 3RFZC 1RZ7L 2Z31B 4BK5A 2OTUA 5C6TH 5HHVL 1ZMYA 4IRZL 2IAMB 3QDMA 3GSWB 5E8DL 1NBZA 3OQ3B 3RRQA 2V2TB 5DD3H 2L7UA 4ESKA 3MV7B 4NC0B 4OT1H 4XBPA 2F74B 5L2KD 4KVCL 4QRTA 4KMLB 1AGFB 2CRMA 4NRZB 3R8QA 4PGCB 5DK0B 5I16A 1MFDL 2JJTA 4FABH 3BPOB 5C7XH 1FVCA 1GIGH 5GQBA 3BP6B 4WW2B 1KJ2B 5IVXA 4AENB 4X80H 4JDVA 3TA3D 1E28B 4OCMC 1DTUA 3KS0H 1PY9A 3S35H 3QUYD 4XTRD 4JFEB 3QQ4B 4Z0BL 3UAJD 1T5WA 1FNGB 4PD4J 1A6ZB 2W0KA 3TF7C 5EBLA 2GAZA 1NBYA 2PF6A 1Y0LB 3QDGE 1FLTX 2JK5A 5CLTA 4KTDL 5H94B 5JDSB 1OAUH 4EN3A 3GMNA 2VXSL 4L3CA 4OFYD 3IXTA 1J5OL 2YD2A 1A6UH 5FK9B 4ZODA 3LPWA 3BQUB 1B9ZA 1XF3A 4D0DA 3RA7L 3BAEL 1OD7A 3KPTA 3BKYL 1JPSH 2C7UB 2J7LA 4KDTC 3UBXB 3REVB 1QSFD 3RY5A 3V8CA 5C9JB 5HHOB 1NMAL 3BGMA 1YY9C 1MHEA 4P2RB 1TITA 3G5YA 4RGNC 1OGAD 1G7HB 2CO7B 2XN9A 1OAZL 3A6BL 3NABH 1RMFH 2WBKA 3ZYOA 3ZHKA 4M7JH 2ZSWB 3IVKB 2AABL 4L3ED 1EXUB 4NFDA 3UTZB 5ETUA 4CRPA 3ZO0A 3QHFL 4YBQD 1FIEA 4HC1A 1Y6KR 1MEXL 1UWXK 5DJ0A 4PRNA 2X4SB 3RGVD 3O6ML 1MREL 3GIZL 1H8SA 1MPAH 3HI1B 4R90H 4OLWH 1LK3L 3HG1D 3TBSB 5I30H 5KG9B 3GHBL 1OT2A 4M62H 1H5BC 1JPTH 4XCNB 3H9ZA 4NO0D 1ONQA 4IRSB 2FBOJ 4YHOH 4OZ4B 4APQD 3L3GA 4Y4KB 1R24B 3D85D 5EZLA 2AS5M 5T1DH 4NWUL 3RI5K 1Q9KB 5LKNA 3OG4B 2BCKA 3PP4H 5GRWA 1YA5A 5ENWB 1U92B 2OXGA 2DIBA 2E5EA 3F12B 5HYEA 5E2JA 5I76A 4LVEA 1KXVC 4NGHH 4Z7WB 1P4IL 4NJ9L 5EUKA 4OJFL 4P2CG 4NN5B 4C59B 1M6OB 5FYJH 4PYGA 1F6LL 3MYJB 3NA9L 4I0CC 4V2CB 5HGBA 5IW6B 5DD1L 1MJJB 4OI7A 2AXFA 2YWYA 5AD0B 1FNEB 2EIZB 3DYOA 5JMOC 4YDVB 4JFDD 4LDEB 3I9GH 4J1UB 3SKMB 1V3MA 3MJ7A 1EV2E 3N50A 4NBXB 2YPVL 4Y19A 4FZ8H 3HCVB 1W8OA 3IRZA 1Q72L 3IDNB 1AD9A 4EIZC 3FO9A 4KK6C 4ZUTA 3TJEL 3QNZB 2DLGA 2VNCA 1JZ8A 3UC0L 1I85C 1HYSD 1FZOB 1IT9H 1G7MB 5C0BE 1OY3B 2VWEC 4OCRH 4OFDA 1RU9H 3JV5A 2C3VA 4QRPD 1A0QH 1J1XL 1OSPL 3HNSH 4OZHE 5FKAB 2YPLB 3KJ4B 1D5XA 3QEHB 4JFFA 2ADGA 4MA1B 3C9NA 3VMNA 4OGYL 5DK2B 1DE4A 3Q6GL 2EDYA 5EC2B 3D39D 1E4XH 3H3BC 2WWKT 4XRCA 2C9AA 2EEDA 2FGWL 5JXAH 2VABA 3DRTA 3F7QA 4LSDA 1G9NL 5CJBA 2GJ6B 2Z9TA 3BJLA 3O4OB 1LO0H 4WI9A 2HKFH 1URLA 1M71B 4YFDB 1X5XA 2YPKB 3MX0A 1C5DB 1CFBA 2F53E 4ZOBA 2QADB 5CKAA 2A6JB 3MGTB 5TE4L 3QCTH 1JGUL 4LLQB 1VHPA 4ZYKA 5BV7B 1QR1B 4PLJD 2R29L 8CGTA 3G6DL 1ACYH 3T1WA 4U6YB 2EIEA 3UO1H 3DX9A 1CE6A 2FJGB 5FFLA 1DLFL 3O11B 2L7JA 3KPRA 1A7OL 4OI9A 5C2UB 1LO5B 5D96B 3IU4H 3AXLA 3B2UD 1CU4L 3OXRB 4PREA 3RIFK 4CJ1A 5EZIH 5IBTL 2XT1B 5GS0C 2P5EE 5DO2D 2OL3A 3QUXA 1OLLA 3ARGA 2OSLA 2IPUG 4L8SA 3V5HA 3MGAA 3SQOH 4I18B 3BZEA 4Y2DD 1NBQA 2R0KL 5CGTA 5C0RL 4NWTL 3N1FC 1U93A 1IL1B 4ODBD 4ONOA 1E4WL 1FORL 5CBAA 4HEPG 5I73C 3C5SA 3L3HB 3QFDB 3U4BH 4XPAL 1IKNC 5GS2H 2VAAB 1BREA 1WBZB 3EYQD 3CLFH 3G6JE 4G80B 3O8XA 4LCCB 1UJ3A 1E4JA 5C09E 3NH7H 3PQYD 4JPWH 1MCFA 4TUKH 1RUMH 4K3DL 4X6DB 4N90D 4ZFOL 1CFTA 2IFGA 4NNPL 1AC6A 3EIFA 4NZRH 3MRDA 3BZ4A 3FAXA 2JCCB 4JANA 2CK0H 1P2CB 4L29B 4O51A 5DRNA 2LTQC 2NY3B 4O5LH 4E0RA 5ISZE 1K3ZA 2B1HL 4MB5A 3LV3B 4GMSL 4PV9A 3G04A 3VRIA 1FCCA 3QAZC 3U9UB 1M1SA 1XR8A 3SDCB 5HYIA