3TYTA

Crystal structure of a heterogeneous nuclear ribonucleoprotein l (hnrpl) from mus musculus at 1.60 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
204
structure length
204
Chain Sequence
ADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a Heterogeneous nuclear ribonucleoprotein L (Hnrpl) from Mus musculus at 1.60 A resolution
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein L
total genus 59
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2011-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tytA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tytA01
2L9WA 3P5TL 1WHXA 2MZTA 3MURP 1M5PC 2MSSA 2J0QD 3IRWP 2KXFA 2ZJQQ 2CQHA 2MSTA 5H1SV 2D9PA 1VQ4S 1N52B 3U1LA 1OO0B 2MHNA 3CF5Q 4ZKAA 2M52A 3DXBA 1VQ6S 3VAHA 2KU7A 5D78A 4WFAQ 2ZJRQ 1DBDA 2DGOA 1Q82T 1VC6A 2KFYA 1FJCA 5MLCV 5D77A 1WI8A 2CQPA 3U1MA 2RQCA 2CPEA 3FEYB 2EK6A 3B4DA 2D9OA 3CCUS 2LYVA 2MKHA 2NZ4A 2F9DA 2CQDA 4RU2A 2DHAA 3R27A 1P27B 1VC5A 1WG1A 3IWNC 5GMKa 1HD0A 2MGZA 2MZRA 1HD1A 2MQLA 1YTYA 1YJWS 2RS8A 3CCQS 2MQPA 1AUDA 2MZQA 2VOPA 3THTA 2HGLA 2CPYA 5FJ4A 3CUNA 2XNRA 2VODA 4CIOA 2X1GA 2NLWA 2MYFA 3H2VE 4PRFA 3CC4S 2EVZA 2DGWA 2DNLA 3P49B 2EK1A 1A9NB 2OSRA 3SDEA 2E5HA 3J7ZT 3ZZYA 2X1FA 4YOEA 4EGLA 2AD9A 1VQNS 3UWTA 4QU6A 3TYTA 2K3KA 2LECA 1YJNS 1WF2A 2MMYA 3UD4P 4Y00A 3MD3A 5CXTA 2ADCA 2RUGA 1VQLS 4WFBQ 2KRBA 3VAIA 4TLQA 1HL6A 1URNA 2LKZA 3BO3A 1PGZA 3VALA 2WBRA 2BZ2A 4YUDA 2A3JA 2XNQA 5GVQA 2MQOA 3CCES 3I55S 2QFJA 4WFNQ 2XS5A 4TU8A 2LQ5A 2J0SD 3ULHA 1UW4A 1X5PA 2ZJPQ 1NO8A 1JMTA 2MY7A 2U2FA 1O0PA 1X4GA 2KM8B 1ZZNA 3UE2A 2YWKA 4C7QA 1X4AA 1SJQA 2DGSA 2DNQA 2U1AA 5DDRC 2CPDA 2N82B 1M5OC 3S6EA 2CQIA 5JVGQ 5EN1A 3ZZZA 2CQ4A 1OWXA 2L08A 2DIUA 2E5JA 2DH8A 2VOOA 1WG5A 3S7RA 5LSLA 2CQGA 3I56S 2N3LA 1Q7YT 2DO4A 3VAKA 4CQ1A 2V94A 3CD6S 4ED5A 1BY9A 2SXLA 1SJ3P 1YITS 1YI2S 5LJ5Y 1VQ8S 1SJRA 2YTCA 2MKJA 4PKDB 3SXLA 4TU9A 4ERDA 1X4EA 1VBZA 4QQBA 1X4HA 2FHOB 1HA1A 1K8AT 2YH1A 1FXLA 1DZ5A 5GADU 1W2BR 2LXUA 3FEXB 1X5TA 2E5IA 1UAWA 3S8SA 3CXCR 3J7YU 1NJIT 1FO1A 2DHGA 2KXHA 1ZH5A 1JJHA 3G9CA 4C4WA 2LEAA 4W90B 4F25A 5IM0B 1X4DA 2DGTA 1G2EA 2CPFA 5DM7Q 1KD1T 3CCRS 1WG4A 2OSQA 1U1OA 3Q2TC 3N9UC 1WEXA 3G8SA 3VAMA 2DNPA 1P1TA 5DM6Q 2M88A 4OZ0A 1FJEB 2DNNA 1FHTA 3G6ES 1YIJS 3D2WA 4Z2XA 2DGQA 2HZCA 2DGXA 4V19X 1FJ7A 2DNGA 3H2UB 3MUTP 2CQ0A 2MQNA 2F3JA 2M7SA 1A7GE 5IFMA 2O3DA 1RKJA 1KQSR 1Q86T 1R8PA 2RU3A 1JJ4A 3G71S 3RW6A 3PIPQ 2AYEA 3NNAA 2L41A 4IOCQ 2JRSA 4PR6A 1VQOS 1B7FA 2DNRA 2N3OA 2OJ3A 2LMIA 2Q79A 3VAJA 2DH7A 2QA4S 2M0GB 2MJNA 4LMZA 4IO9Q 2MKKA 1VC0A 1U6BA 3R1HA 2DHXA 1X4CA 3CCSS 1SJ4P 1JJ2R 1VQ5S 3EX7B 1WHYA 3NMRA 1X5OA 3G4SS 2RT3A 3CCMS 1X5SA 2KG0A 2KH9A 1N8RT 1M5VC 2OTJS 1IQTA 2MGZB 1U1RA 2AYGA 1VQKS 4UY8T 2M9KA 2DK2A 2CPZA 2E44A 2DNMA 2M8DB 1YJ9S 1QVFR 1U1LA 3L3CA 2MZ1A 3MXHP 3PIOQ 2X1AA 3TO8A 1H2VZ 2I2YA 1U1MA 3EGZA 3BO2A 1QVGR 3CCLS 1VQ9S 1WTBA 3UCZP 4LJMA 1S72S 2M2BA 1PO6A 3CMAS 1Q81T 2LA6A 4CH0S 2HVZA 4C0OC 2AYBA 4QPTA 2CQCA 3UCGA 2XB2D 1L3KA 2RNEA 2RS2A 2HGNA 2KVIA 2FC8A 1VQMS 1VQ7S 1F9FA 2DIVA 2PE8A 2RQ4A 3V4MA 2JVRA 3G8TA 4WKRA 2B0GA 5IM0A 5LJ3Y 3K0JA 2DNKA 2F9JA 2G0CA 2K8GA 2CQ3A 3CULA 4UQTA 4QU7A 3UCUP 3MUMP 1X4BA 4F26A 1U1NA 1QM9A 4FXVA 1VBYA 2KN4A 1S79A 3DLLQ 1VBXA 2M4MA 2D3OR 1FNXH 4IUFA 2CQBA 3P6YC 2KM8C 2AYMA 2DGVA 1ZZFA 3B4MA 2XSFA 1WF1A 1SJFA 2FC9A 2DNHA 1WEYA 1WWHA 2CPJA 1N88A 1H2TZ 2LXIA 2FPHX 2MQQA 3R1LA 1M90T 2DNYA 2MKIA 2ADBA 2KHCA 2N7CA 5BJRA 1WI6A 1N54B 2LCWA 4CH1A 2FY1A 3MOJB 2VONA 5GAGU 2MPUA 1OPIA 3MUVP 3UD3P 3EGNA 3MD1A 3BEGB 3CCVS 1U1PA 2I38A 3NS5A 1KOHA 2MQMA 1WF0A 2KG1A 5LXYA 2MZSA 4FXWA 3NNHA 5CYJA 4U67Q 5GAHU 1D9AA 3CTRA 3JB9k 2CPHA 3OW2R 4F02A 1VQPS 3P3DA 3LPYA 1KOOA 5IQQA 1H6KX 3NS6A 4A8XA 2KXNB 1YWXA 2RRBA 4WIIA 2CPIA 1D8ZA 1DRZA 2LA4A 3Q2SC 3RW7A 5DDPC 2BOPA 1R8HA 4TU7A 1U2FA 3MI7X 3CC2S 2CQ1A 5ITHA 4WF9Q 2DISA 2DB1A 4LIRA 1SXLA 4OZ1A 2QEXS 1OIAA 3G96A 1M5KC 1RK8A 2RRAA 2KRRA 4P6QA 5DDQC 3SDEB 2OIHA 2MXYA 2RVJA 1U6FA 1YHQS 4IOAQ 5LSOA 4WCEQ 1U1QA 2DGUA 2X1BA 2CQ2A 2MY8A 2UP1A 2HGMA 3LQVA 4BS2A 5DDOC 2YKAA 2HYIB 1WHWA 2JX2A 3CPWR 2GO9A 3US5A 2MB0B 2KI2A 2M8HA 2MZJA 2JWNA 3CC7S 5JVHQ 2MKSA 1K9MT 1X4FA 3BO4A 2E5GA 2DNOA 2DHSA 1XN9A 3MDFA 2J76E 3VAGA 3THPA 1M1KT 1X0FA 1WEZA 2MJUA 1UP1A 1WHVA 2ERRA 2CJKA 5HL7Q 2DO0A 4M5DB 2J8AA 5CA5A 1DHMA 1WELA 2DH9A 3S01A 1FT8A 2KYXA 3VF0B 2DNZA 2YH0A 3NNCA 3SMZA 2XS7A 4J5OA 1KC8T 4W92B 1UFWA 2KT5A 2XS2A 1K73T 3CMES 2G4BA 2GHPA 4YB1P 1U1KA 3HI9A 2PEHA 3HHNB 2LEBA 2DITA 3TP2A 5DETA 4Y0FA 2OTLS 2MKCA 2CPXA 3BS9A 1H2UX 1NU4A 2JVOA 5HO4A 3VAFA 5LXRA 1CVJA 5GAEU 2M70A 2G1DA 3CCJS
chains in the Genus database with same CATH superfamily
2V8VA 2GVDA 3AAWB 2R7OA 5HMWA 5C25B 2EKNA 3FZ2A 3KKFA 2MZTA 4X62J 3OLBA 3AA8A 4BC9A 4ELTA 3Q8QB 3LOUA 3W2VB 1RCXB 2KXFA 2RILA 4DPYA 2FGCA 3KG4A 3TUZC 1XWLA 4ANCA 1LW2A 1U6ZA 3A8JA 5KFXA 5DG9A 2D9PA 1QDUB 1TL5A 2LXFA 4KGMA 1NK8A 4J7CA 3P4UB 4QW9A 4RUHA 1OO0B 1QUPA 4YY3J 3IA0A 3OLAA 4FVCA 3LANA 3M9OB 1BQNA 1MROA 2HS0A 3LPEA 4CT9A 4J9RA 4UQGA 4HACB 3J7Z5 1GMVA 5GADI 2AJ4A 4Y2IA 3ISZA 2HHPA 1FK9A 3I87A 1N5YA 5K8OA 1S0VA 5F41A 1KQGB 3R2CJ 3N28A 4DLGA 3MEEA 5CZXA 4KO0B 4FPIA 3PX6A 1Y5IB 3R97A 2KFYA 4UOHA 5J1NA 3LP0A 5EX0A 2BACA 1TMMA 4JBCA 1FEEA 2J6TA 5M2PA 2JLEA 4LR9A 4CLPA 2F8HA 2W7AA 3BGRB 4DV4F 1SKWA 1FFGB 3R5CA 3PVXA 2G0JA 2D74B 2VD3A 2VPZB 2ZH2A 1ZETA 4C8OA 2UXCF 2MKHA 4O0NA 4NLPA 4ZOSA 4LBHA 2B7BB 5K8NA 4EMDA 1N0UA 3BKTA 1ZAVA 3I0RA 4RU2A 1RTDA 1VC5A 1YVFA 3K5NA 2V5HG 3TQEA 2F1FA 4B08A 1WC4A 3JQMA 1HD0A 2MGZA 1D1UA 4ZVSB 3LALA 2NYIA 2XMKA 4X66J 2K1RA 3JTPA 4MMOA 1YTYA 1YJWS 4FNIA 2I0XA 2XZDB 4I2PA 5IWAJ 3QT8A 4RO0A 1H38A 4WFZA 3GFHA 2BEFA 5CCMA 3TA2A 2FHMA 5E2QA 4CNZA 3MPYA 3X1LB 2CPYA 5FJ4A 2XCPA 4GC6A 3IP0A 4RBTA 3W1YC 2X1GA 3GIKA 2BMBA 3UN2A 2R9LA 3QPIA 4WYWA 2PN6A 2B6AB 2IIHA 3N79A 4RNHA 1FKOA 3O6QA 4DR4J 3VQTA 2QV6A 2XQCA 4AUKA 1AT1B 1CJUA 2DNLA 4M1KA 1JLAB 2EK1A 1PYSB 1A9NB 3C15A 2YWFA 3J7ZT 2DPIA 3LH2S 4X84A 2H1YA 1R31A 2X1FA 5C2GA 2V0NA 2AD9A 4OFZA 2XCAA 3WC2A 3I0RB 4ZS6A 1GX5A 2B4VA 3SFGA 4NEYA 1VRUB 3MR6A 1RP5A 3DRRB 3MM8B 3M2RB 3KLHA 3PW5A 4ZVGA 4JI6J 3UD4P 3KNAA 4J90A 1IQZA 4DWIA 1T02A 4JI6F 4ECWA 3CJ4A 1HNVA 4RW7B 4JUZA 5KG1A 1RWPB 3BGUA 1HL6A 4IFYA 1PGZA 3NEKA 2DEJA 2EG1A 4EBDA 3RAMA 1RAJA 1MG7A 2F65A 1R3NA 2V4JB 2XNQA 2C3MA 3FRYA 4AYBD 1E6YA 2CIMA 3D6TB 4RWWA 1FRLA 1RBOB 2HKEA 2VASA 3AXKA 4MKAA 5HQLA 2KYZA 3BBFA 4ZJOA 4F3QA 1H0HB 3VGVA 4TU8A 3R7NB 1JB0C 4OI0A 2CJAA 1S97A 1N56A 1WACA 1R89A 4HTIA 1UW4A 1HBOB 1NH8A 3MAHA 1RQ0A 4LF1A 1MU2B 3K57A 3PYDA 4M63A 4PXEA 2Q6BA 1JMTA 1FRJA 1K44A 3QFHA 3PR5B 1O0PA 4DPXA 1APSA 4ELVA 2EWHA 2GAGC 3PX0A 2DR7A 1SBRA 2JOQA 2WCXA 2FZGB 1ZZNA 1RCOB 3UE2A 4YS2A 1JQGA 3CGIA 3Q8VA 2WZ1A 5D0HA 1HHSA 3KOAA 2ZZTA 2ZM6J 4LF4J 2QMXA 5K14A 3K89A 3J7YI 1NKCA 3C16A 1JK9B 2BDPA 1MW7A 1HQEA 2QGFB 1JLGA 1HNVB 4RW7A 4XPEA 4OL8A 1FWPA 3KNGA 5JVGQ 1NHKL 3HO1A 5EN1A 4NXMJ 3W66A 3ZZZA 1SL1A 2CQ4A 3VGSA 4LF7J 1S12A 2L08A 2WSFC 4NYOA 1N4LA 1ZBTA 1UL3A 2DH8A 2HPUA 2KT3A 3RB4A 4JYAF 1EP4B 4TN2A 1EJ7L 3R9LA 2HHTA 1TFYA 1YK9A 3I56S 1I6JA 1FKPA 2BABA 3J80U 2OPSB 2LQ8A 4MKBA 3KDNA 3VAKA 2IYIA 3FCVA 2XC9A 5CCLA 1UTAA 1SJ3P 1J27A 1DARA 3E8OA 2HNZB 5AXLA 3ZC4A 5LM7E 5J2NB 1VQ9S 4U7UD 2HMIA 2DJWA 1SJRA 3NCPA 4NLXA 3SXLA 3J80Y 4TYBA 4C8MA 2YWGA 1Q53A 2Y0SD 4OX9F 3ICLA 4DUZF 2B7CB 2V50A 2B9XA 1JLCB 1QUVA 4UZCA 4WP8A 3MECB 4O4GA 4QQBA 3MFHA 1X4HA 4DS4A 3A3NB 2UUAF 1M1GA 1V3ZA 4O23A 4OV1A 2YH1A 1FXLA 4YHHF 2LXUA 3FEXB 1SKRA 1UW9A 1X5TA 1HARA 1Y0HA 2E5IA 4NLSA 2W9BB 3M1VB 1RA6A 2LQ9A 1NPPA 2VH7A 3BKFA 3J7YU 1X7VA 3KUGA 1RACB 4H4KA 4I4BA 2KHDA 3C6TA 2KXHA 3M2VB 3PTWA 4RL1A 3PACA 3EPIA 2J9CA 1FESA 4F25A 3G6XA 2CZ4A 2DGTA 2EBGA 2EFNA 1IBKJ 1G2EA 5F3ZA 4NLGA 1YBAA 4CNYA 5KT2A 4LF7F 2CJ9A 3TJ9A 1XR5A 2JLGA 4MTPA 1KD1T 3SYZA 4WJBA 2UVRA 3ZZUA 1U0HB 1TKTA 3PJXA 3QIPB 1RTIA 3VAMA 1XMQF 1JXEA 5DM6Q 3M2UA 1OSDA 2M88A 3K5MA 5F8GA 2AJFE 1Z2ZA 2IM0A 2XEXA 3BGRA 4I6AA 3M05A 2OPRB 2VFSA 2VKZG 4KSEB 4CO3A 4YDDB 2JFKA 2YKMA 2H65B 2CQ0A 3KK1A 2WRMA 1RAGB 2JEIA 2E7WA 2M7SA 3BGLA 1A7GE 3I5AA 3ZTOA 2B51A 1G3OA 2FVRA 2DEIA 4YN3B 1SC1B 1IJEB 1S1TB 1S48A 1FK9B 3G71S 5IC4B 3BZQA 1NK4A 5L38A 3NNAA 4ZIVA 2QL9B 2JRSA 4NZ7A 3MEDA 2W9CB 3BJYA 1B7FA 1HBNA 2N3OA 3CVKA 3GSDA 3FFIA 2Q79A 5D15A 3DOLB 2R2SA 2OJ3A 1XBWA 2M0GB 2VG5B 4OYBA 4DR2F 2EEYA 1UA0A 4ECUA 2GGPA 2H51B 2UV8G 3DOMA 2DHXA 1X4CA 4K4ZA 5E5NA 1LW2B 1DTQB 3L7UA 3EZ5A 3O3LA 2W25A 3HZEA 2HZVA 1LWXA 2F8EX 3NGSA 5HAOA 2EG2A 2LU2A 5J2MA 2P6SA 2V34A 2IBKA 3I9V9 5KG4A 4DI6A 3K58A 4I0WA 2RT3A 1QAXA 3EDQB 2O1PA 4GVBB 1SIWB 1IWGA 2KT2A 3GJSB 3T1HF 1HWLA 2YNIB 3IR7B 5L1KA 3DNCA 2NXEA 3HSZA 2ATLA 3MAAA 4FP9A 3GP9A 3KG0A 2HHXA 4GC7A 3PFOA 3VV2B 3O8WA 4UY8T 4PWDB 2NXCA 2VIHA 1VJQA 2J7KA 5LMNJ 3QYYA 2OPPA 4Z7YA 4OI6A 4NPOA 2BXJA 4OI1A 3X3UA 4FKYA 3GG1A 4I7FA 2CPZA 5HANA 3UDLA 4CYUB 3BSCA 4DX5A 2DNMA 4CO5A 4WE1B 4DUYJ 2M8DB 5A8KB 1MMNA 3QGHA 5CD4H 2CWKA 1UZHA 3L3CA 1S1WA 2MZ1A 2LVWA 4DUYF 1KLNA 3BN7A 3TW0A 1Q8LA 2GIFA 2PEBA 4DV0J 4JV5F 2BOAA 1H2VZ 3N5BA 3H40A 1PC4A 4DR5J 3NXZA 4YR2A 3ZZOA 2HHVA 1CJTA 3K7RA 2ROPA 2DCUB 3CCLS 1VCTA 1WTBA 3UDCA 2ZH8A 3KJQB 1XK8A 4E8UA 3BSNA 5J2QB 1S72S 2M2BA 5ETLA 1PO6A 1Q81T 3DRXA 3LWLA 1JKHA 1T9WA 1IKXB 1O6XA 1YJTA 3M6WA 1JLGB 1YRUA 4CM0A 1GX6A 2VA2A 1FJGF 1S5ZA 5F8JA 3VGTA 5L39A 3FRZA 4LF9J 4HH0A 5DQHA 1RWVB 1JLFA 4DFKA 2C2KB 4J91A 4F4WA 1IR2A 3TAPA 1FE4A 6FDRA 3PO4A 2RNEA 1FCAA 4NX9A 2Z57B 3QSYB 2UU9J 3I4PA 3IXQA 3I4HX 3R3TA 4NRUA 5CYQA 3UQSA 2HGNA 2KVIA 4RUCA 1S0OA 2PC6A 2OELA 1VQMS 5B7WA 1NJXA 2GHVC 2RQ4A 3AFGA 1KR4A 2JVRA 1NEEA 3BBBA 1Q1KA 6FD1A 4X4SA 3G8TA 2B0GA 4KHMA 3DGPA 3DM2B 3E01B 2Y1LB 4ECQA 1M5SA 2R4FA 3RBXA 5M2RA 4DCPB 3NBPA 5IM0A 2H9ZA 2O5DA 4KGXB 2G0CA 3WHIA 3IFEA 1R0AB 4B3MF 3QMQA 4UQTA 2ZD1A 4IFVB 3TVYA 5T7LB 4ZLNA 5C7PA 1HHQA 2UUBF 5KOXA 2FLOA 4A8SA 1U1NA 5EX3A 3ZFVA 1H72C 2OMOA 5LOQA 3DLKB 1T3NA 1FJGJ 5A2QY 4IUFA 2B56A 1LWEB 2V63A 5KG0A 2AYMA 4KAIA 1NK0A 4LF8J 1B7YB 4ZPDA 2OFHX 4DX7A 4J9LA 1XR7A 2FC9A 2P5VA 3JS9A 2RUSA 3TAMA 2DNHA 1C4CA 1CJKB 1WC0A 3EJMA 4HDHA 4U96A 3N6MA 2D3ZA 2VQFF 3MMJA 1A6LA 2ALZA 5AE3A 1H2TZ 2B8PA 3GR0A 1XTZA 2LXIA 2FPHX 3MEEB 2OMLA 2PA3A 3BYRA 2QA4G 3GPAA 2XY5A 3I96A 2MKIA 1XJWB 2R7SA 2KHCA 2N7CA 2VBYA 4M5NA 2FLPA 4F0KA 4DDFA 1WI6A 3MOJB 3SBMA 1NSKL 3HKWA 2FY8A 1PYTA 2VBWA 1RE1B 4ED3A 2V8PA 2GX8A 4ZCIA 1JNRB 2MPUA 3GR1A 3M2UB 4IG3B 4ZLJA 1OPIA 4KO0A 1RT3B 1HQ2A 2VBXA 1NSAA 2CRLA 4ID5B 3M6XA 5KFDA 2W2NP 1LKZA 3A8KA 2HFUA 3D0HE 1RISA 4KT0C 4NL5A 3UNYA 1PAUB 1REVB 2P6TA 2RH3A 3NS5A 4MFBB 4NLRA 5HLFB 1ZM2A 1KP6A 2LLZA 2EKYA 2XYHB 4KPYA 1F2GA 3HFKA 5KG6A 1MN7A 2VL1A 3AA9A 3D66A 3JQJA 3FJ2A 3KK2A 2UXDF 3S1TA 3NNHA 4ER8A 3UFCX 4ZVOB 1UVIA 5E0OA 2UXCJ 1MSWD 2YVSA 2YWWA 3NGUA 4QPXA 4LSLA 4QIGA 3JB9k 4DQSA 4F02A 2EI5A 4CO4A 2YNGA 2YNHA 1ITPA 2GV1A 3LPYA 4EK2A 2E9RX 4X4QA 1U48A 4LF8F 3NS6A 2YNFB 1MNEA 3GE9A 1YWXA 2RRBA 4NI2A 4CI0B 2IAJB 3M8QB 2KXNB 1S76D 3PKYA 4PCQA 2AQ4A 1UFKA 2J0XA 5F9NA 1WOPA 2B3TB 4PWUA 2ZZNA 1R8HA 1QTMA 4N77A 3QQCD 3R5BA 2F4VJ 2CQ1A 2R2TA 4JI3F 4ILRA 2AJQA 3MR7A 4EBEA 2DISA 4MJKA 4ETZA 1SV5B 3D5MA 4DL6A 4DR3J 2CJYB 1ZAWA 3EDRB 2QEXS 3R5DA 2W7PA 1OIAA 2GJ2A 2IC3B 3SDEB 3KLIB 1U24A 4AE5A 4B02A 5KFJA 2AKWB 2CFXA 3KHGA 1TK0A 4LFAF 5K14B 4ICLB 1RT6B 1XMOF 3FK4A 2OP5A 3ZTSA 5LSOA 3K5LA 2BM1A 2DGUA 1Q5YA 2CQ2A 2UP1A 3CE8A 1S49A 4MYTA 1D3WA 2HGMA 4FDFA 4Q0BA 2OD4A 1T3OA 3CJSA 3LGMA 3NGTA 5DDOC 5T14A 2HYIB 4KH0B 2JX2A 4U8VA 5F9LA 1WSVA 2UUBJ 1NHVA 1RBLA 2G9OA 5J1EA 3KLEA 4NXNJ 4JI2F 3NL0A 2VG6B 3MM9A 3W65A 3KLVA 2VG7B 2KI2A 3HXMA 1FKPB 1CQMA 4B9SA 4B3SJ 1VRUA 4B9LA 1S7HA 2R3VA 1HBMA 4QYZJ 2MKSA 2J8SA 4OHVA 1X4FA 3V6KA 1SKSA 5D4LA 4F3MA 1GH8A 2DKOB 2PI5A 4RW8B 2J76E 4USMA 3GV5B 2EBEA 3DHWC 4P9SA 1IKYB 4DG1A 1M1KT 1S6QB 2AX1A 1SCJB 1SUQB 4WXOA 5KFWA 4FF2A 2RDDA 1WEZA 1WC5A 2XMJA 2C2OB 3DMJB 4YHHJ 1CULB 1KQKA 2F63A 1S6QA 3T9NA 2EC0A 2GO8A 2DO0A 3D1HA 4DL0C 3JAMU 4M5DB 3G87A 1SC6A 1NHUA 5CA5A 4I7FB 1RJJA 3ZNUA 5B08A 2HRYA 3J81Y 4OZ5A 3QZ8A 3RAXA 4JV1A 5KFLA 3BDEA 5HQMA 1GMWD 2DH9A 4ZCMA 2VG5A 4EI2A 4GVLA 3T5LA 3HVTA 2FIUA 3V81B 1W25A 1LW0B 3GFXA 1YZ7A 2DNZA 4UUXA 5RUBA 5L9XA 4X4PA 1RAFB 3BQ1A 1AZSA 1V5VA 3GCWP 3SMZA 1QSLA 3QGIA 1XQIA 2RHQB 5G0RA 3Q89A 4NXMF 1RLCL 4JI8J 2AMCB 4J5OA 1HQUA 2B4UA 4RNOA 3A13A 4S0MA 1KC8T 4NXNF 4CDIA 5J2QA 2HVIA 5M2UA 9ATCB 3D0IE 2DBBA 4U6PA 4W92B 1KQFB 1TL1A 2J5AA 3CIMA 1JLEB 4M5KA 1UPMB 3AJDA 3JTNA 2JNJA 4Y28C 5IC6B 8ATCB 1K73T 3CMES 1IBMJ 4B3TJ 4NCBA 2XS2A 4ZJLA 4HI2A 2G4BA 1RXOB 3R6GB 4YB1P 1VHFA 1CJVA 4KYZA 1RTHB 2LEBA 2DITA 2KJWA 4Y0FA 2X3DA 4OLOA 4WIQA 1RTZA 1B0TA 1VYAA 3T19A 3BS9A 1VS3A 2V6AA 5L1LA 2HHHJ 4C8ZA 2HLUA 3CSKA 5HO4A 3W60A 3JXOA 2V68A 3VAFA 5J1PA 3ADAC 2K7KA 5GAEU 1EX8A 4XPCA 4LSLB 3OL8A 2G1DA 2WVDA 1LXJA 1RSCA 4IG3A 4M94A 2HFOA 4QYZK 2RSQA 5KT5A 2V4RA 3FMWA 2BJ9A 2A18A 1M5PC 1REVA 4DU8A 2J0QD 2CJQA 3IRWP 2ZJQQ 4Y2MA 3LTOA 2D41A 2BE2B 3DGVA 2OLWA 3QWUA 3ENVA 1FX2A 4ZVHA 2OFGX 1GEHA 5KAKA 3M32A 5H1SV 1JXLA 1HWIA 3MEGB 1CJKA 2RB7A 4KPCA 3MCMA 3DRYA 1VQ4S 1IKWA 4H4KC 3U1LA 2R8JA 1ZYQA 2YKMB 1NDKA 4RLEA 1NAQA 4OHWA 4IDKB 2G1HA 2NUHA 3MEGA 3H4BA 1ZOTA 2GJIA 3Q8UA 3W64A 3CF5Q 4DV6J 3HD1A 2NXUA 3PYFA 2IRXA 2BQRA 3OR2B 4OHZA 5JXSA 3D67A 5LMNF 4DN9A 4UW2A 3AH6A 5BYQA 1EP4A 2DCLA 2J9DA 1WDTA 3GJRB 4IH7A 5D78A 3W9HA 1P9YA 3IBFB 5JUMA 4ATNA 2AF6A 2QA2A 3C14B 4IH5A 4MK7A 4DX8H 2ZHBA 2C3YA 4Q43A 2RKIB 3KXDA 1VC6A 1FJCA 3QRQA 2HWIA 4WU2A 2HIQA 2ZBPA 4TVAB 5THWA 2CQPA 4AL6A 2RQCA 2CPEA 3AD9C 3IG1B 1SPBP 3B4DA 2VKRA 2L9DA 2OPRA 2OPQA 5DS7A 1XEZA 1WUUA 1S1XB 3V5RA 4CRJA 4MH8A 3KHLA 3CCUS 3THVA 1N32J 2W4DA 1Y11A 4G6VB 2NZ4A 2IY5B 2HURA 2CQDA 1PKUA 5FLXU 1FWLA 3R27A 1P27B 4F4XA 2WVCA 1IBLJ 2H54B 3D4JA 3IWNC 4HTJA 5GMKa 4USHA 5KFFA 2MZRA 1HD1A 3DLGA 4GKKF 2QMWA 3SQGB 2PSZA 5E3QA 3OVAA 5L46A 1WJ9A 1VFJA 3F0NA 4Q2MA 1JWWA 5E41A 2PI4A 1X8DA 2FLNA 1S6OA 4J9PA 1HHTP 1AUDA 4JB8B 2HBQB 3HHEA 3UVJA 2W1BA 3T1YJ 2OHDA 2HS3A 2NLWA 3T1HJ 3M8YA 2BRLA 1CLFA 2Q6CA 2QL7B 1C1BB 4DV2F 4PRFA 3OSNA 3DRPB 1C0TB 4CLFA 1Y9OA 1EIYB 3QRPA 2EVZA 2F40A 2QE5A 3MM5B 5ETNA 1C1BA 4BWMA 4RX6A 4I1TA 4CO2A 5D0EA 5ETRA 3HM9A 3SDEA 5AE1A 1G4CA 3W9JA 2JC0A 4YOEA 3DRRA 4EGLA 2AZ3A 4Y65A 4QU6A 1BQMA 4A46A 2K3KA 3G2XA 3M30A 2BX6A 3OL6A 1N6QB 2QSFA 2LECA 1TVRA 3GYXB 1YJNS 2XMUA 4Y00A 1FRIA 1MMLA 4DFJA 4LRFA 5A8KA 1F5AA 1X9MA 4QZVB 2LKZA 1JKHB 2WBRA 3PHEA 4KGVB 1RHUB 1WTFA 2IPOB 4FYDA 5I4MA 1IKYA 2A3JA 2DR6A 1FD2A 2K06A 1FRMA 1MN9A 5DGBA 4ZP6A 3CCES 2XYGB 4F50A 1AUSL 1HMVB 1B3TA 1G1XA 2QFJA 2NQPA 1HBOA 3NLCA 4QJVA 2ZBIA 1CULA 1B0VA 1F5BA 1X60A 2QO3A 2HQGA 2LQ5A 2J0SD 4YB6A 3ULHA 5J1EB 3KLEB 5GMDA 3MR5A 4RW4B 3TUJC 1X5PA 2PDAA 2J0WA 4M8LA 4CLLA 2DXEA 1S1WB 4X65J 2ZJPQ 3T1YF 2VFUA 4LRCA 4DSKA 3DI6A 1X4GA 3NMRA 5KFAA 2UVUA 1Q5VA 4ILLA 2HFVA 2UV8A 8RUCA 2YWKA 3B6BA 3HFZB 1FFSB 1I5OB 2GHWA 1X4AA 1EETB 3TQ1A 4QR2A 3OUYA 3VHQA 2WONA 3A12A 1DQAA 2IA0A 2IHR1 2VPWB 2C2MB 5ETQA 2YX1A 1KWMA 5CH7B 4C11B 5DDRC 4JOUA 1EQMA 5KFIA 2AV5A 5KT6A 2CPDA 2GMJA 4UUWA 4ZLLA 4R0EA 2ZDPA 2YKNB 4ZPBA 1LXNA 3S6EA 4PG8A 4KB7A 4LF5F 1TFWA 4NA1A 2NSCA 1YX2A 2C2RA 3Q83A 2W7OA 1EB0A 3FDSA 1OWXA 3D6MB 4NCGB 4USJC 1SL0A 2E29A 2DIUA 2NPIA 2YNHB 3OJUA 2W8LA 2W2MP 3NY0A 1WG5A 4IYQA 3LP2B 2CQGA 4LVNP 1XMQJ 1Q7YT 1HNXF 1HNIB 2RKIA 1H73A 1CQNA 3LP0B 2D7SA 3HX9A 3L7PA 4CQ1A 4C8KA 4O3SA 2R8GA 5ETSA 2ZH5A 4R8UA 1O8BA 4ITSA 1RAEB 1PBAA 3MMAA 4YY3F 4MFBA 1HI1A 3PM9A 1JLQA 2LEPA 4PKDB 4TU9A 4RNMA 1SL2A 2W24A 1X4EA 4CLSA 2VQEJ 2W2PP 2ZZMA 2NYHA 1OY8A 1S59A 2FDNA 3KJVB 3D9BA 4LRBA 3W2VA 4C11A 2R7TA 3D3CJ 4NLWA 2FJDB 2YKQA 3O5TB 5KFCA 1Y4ZB 3SSRA 5DG7A 3K5OA 4KKOA 1KEKA 1P8GA 2A0FB 3W8PA 2BQUA 3VTIA 1WORA 3S8SA 4LSNA 3KK2B 4C8YA 3DLEB 3CXCR 2YKPA 1K47A 4LBIA 1NJIT 4FF3A 4A8FA 1CS4B 4TY8A 3OHBA 4JI7F 1ZH5A 2Y3YA 3TJ8A 1JJHA 4GKKJ 4C4WA 3PW4A 2FUG9 2E1AA 5IM0B 4DPWA 1PIEA 1X4DA 2IFXA 4N8OA 2ZBRA 4H4MB 1B99A 4WBFA 5C25A 4IKAA 1P6TA 2QMUB 3TA0A 2OPSA 2QLXA 4ES3A 3T3FA 2ZBCA 2C28A 1TAQA 4LSZB 4XIUA 2I1RA 3FCHA 4KH1B 4P2FA 1HNZF 1WG4A 1YJUA 2OSQA 4I68A 2Y1RI 3G8SA 1T7PA 2WHOA 3MMAB 2VICA 4C8NA 4HACA 4OZ0A 3KFWX 1S4FA 4K2JA 5A8WB 2V4QA 2C2DA 1FJEB 4DBQA 1IKVB 4ZCKA 1KTQA 5KFSA 4Z2XA 3D2WA 1O51A 2ZDOA 3L09A 3MM7A 2ZVSA 5F8MA 1J2VA 3PG9A 3H2UB 3PR4A 3MUTP 3H25A 1TVRB 1FJ7A 2QFIA 3TAMB 4FS2A 3OVSA 1U25A 1RKJA 3CCZA 1HYSB 3GLJA 5C24A 3PW2A 1RTJB 4FPRA 1T9YA 3ILJA 2XMMA 1UA1A 1T9XA 4BBYA 4WE1A 2NPFA 4QIWD 1MMDA 4CM2A 3BSOA 1GT8A 3DCAA 5KFGA 2JJ4D 3R7BB 2L41A 1VQOS 3H8YA 2R7QA 2HQCA 3HHLB 2LMIA 2VZ9A 2DH7A 4IR1A 4RBUA 2QA4S 1KNZA 2MJNA 2GC8A 3IS9A 4IH6A 4IO9Q 3U1NA 3OXGA 4HDGA 2OAUA 3HHLA 4UTGA 3R1HA 1JJ2R 1VQ5S 4DSIA 3O1LA 4B9NA 1SI9A 1VI7A 3G86A 2EFOA 2HVEA 1I3OB 4G1PA 4ZCLA 2I6WA 3W5YA 2XMAA 1WHYA 3ITHB 5F3TA 4OMFG 1FWKA 3BGOP 3QNWB 4PG5A 4E2FB 4CLYA 1KSPA 5HMZA 2KJVA 1BLUA 5B0EA 1G7CB 3RGIA 4CLTA 1X5SA 2KG0A 3G4SS 4FS1A 3CD7A 5KFKA 2KH9A 4IFYB 1N8RT 3DLBA 3TUPA 4FXDA 4QR1A 4X4TA 1U1RA 1VOMA 1WOOA 1U2RA 4PWWA 1KHVA 1UVKA 1L3TA 1OJ4A 2CNLB 1V3RA 4RW8A 1HMVA 1KONA 3AQOA 8AT1B 1ACMB 3GTYX 1T8EA 5CD4A 1R8BA 3FSIA 2DY1A 3NP5A 1Z2LA 7AT1B 3D68A 4ZITA 2HSEB 1Y3JA 3LW5C 4EEYA 1NBEB 2W9AA 4JI5J 4TY9A 2A6MA 5MAOA 1QVFR 3C15B 1U1LA 2UXDJ 3MXHP 4ED4A 2RMLA 4Q44A 1G6BA 4KIAA 1TV6A 4CLKA 2NXNA 1U1MA 4LFBF 4ED6A 5EWFA 3BO2A 1SC3B 3DYAA 3RUBL 3KMSA 3OPKA 1XMBA 4NWBA 2FZKB 1QLNA 3IM9A 3MPWA 4M5IA 2HQIA 1KBRA 5D3GB 3R6LB 2Y8YA 3HHLD 1HNXJ 3JSBA 1C2PA 3JTOA 4USWA 5E33A 2IVFB 1HBUB 2RDJA 2YQ0A 4DSFA 2CJXB 3MTKA 4K8RA 4K4UA 4ZVEA 3PZPA 4C0OC 3KHHA 2QLWA 2WVEA 3D1OA 4NLVA 4EUVA 2GVZB 5AXMA 3N01A 3KJVA 4CT8A 2MHEA 4DV6F 2E5LF 2XSJA 3JYTA 2XB2D 3SV3A 4F3OA 1L3KA 1N5TA 1SH2A 3UVJB 5BXIA 2MQ8A 3GIIA 1QJHA 4QWDA 5EHHA 2RS2A 4ZVTB 3L4BC 3ENQA 1LEOA 2GCFA 3WQPA 3MM6B 4DSJA 3MR2A 5A8RB 1F9FA 2DIVA 2Q1LA 3V4MA 5E3RA 3OTOJ 3HT0A 2EC2A 1HPZA 2EFPA 3PFEA 5EUHA 1H3DA 1RBAA 3IM8A 1N5SA 7FDRA 3K0JA 7FD1A 1FTCA 2W2OP 2F9JA 2K8GA 2CQ3A 1TKXB 3MZIA 3CULA 4J9NA 1U49A 4QU7A 1R0CB 4XO0A 1JLBA 1X4BA 1YLXA 1JLCA 3GJTB 3W7BA 1S9EA 2Z58B 4FXVA 4A8OA 1C4AA 3BPDA 1U0HA 3WC0A 1UKUA 2KN4A 2YKNA 3IR6B 4USVA 3M6UA 4LBPA 4ED7A 1FNXH 1CPZA 4M5HA 4HT7A 3P6YC 5C42B 2KM8C 3B4MA 3CDWA 5HBMA 1WF1A 4N56A 3MCSA 4DV7F 3A3PB 5IWAF 2GVZA 2HG4A 3PW7A 2XWYA 5HJXA 5C42A 3OL9A 1WEYA 4KY3A 3D0GE 4ED8A 1N5YB 1N88A 1T9TA 3DLJA 3NOCA 4FNHA 4RKUC 4IR9A 1M90T 3SCLE 2DNYA 4C8LA 3DRSB 1UVLA 2IDLA 2W9BA 2ADBA 1RZMA 2QRRA 1ZAXA 1VR6A 2WW4A 3QBCA 1N54B 2BVZA 1S1VB 2VONA 3HZGA 2CADA 2CNKB 2GVDB 2OGUA 2HRTA 1GQEA 3EM1A 2VA3A 3EGNA 3OBIA 1WC3A 3BEGB 3IGNA 2XI3A 3CCVS 1U1PA 2FHJD 1FA0A 3IMQJ 5BYSA 1KOHA 3CMQA 4IQMA 3PRVA 3W5XA 3CO0P 1XNRJ 1WF0A 2KG1A 2B5JB 3I0SA 3UNGC 2FLLA 4MK9A 1I51B 1OSCA 3CWJA 4K5SA 1VDHA 5CYJA 1GMWA 5CZVA 2BR0A 4OX8A 1FE0A 1D9AA 1QE1A 2V8DA 3G82A 4OI4A 1NSQA 5KFVA 4EO6A 4U95A 1LWCB 1WKLA 4Y3CA 5B0CA 3OW2R 2KO1A 2AZ1A 4AL7A 1GNKA 1VQPS 3AD8C 4L75A 4DR2J 1IM4A 3P96A 2EW9A 1ULRA 2OI2A 3QZ7A 4WIIA 2R2UA 1W2IA 5IV3A 4Z37A 2CYYA 5ETPA 3ILLA 2HFZA 3TWZA 4CP5A 4B3TF 3K8VA 1HYSA 5A6WA 2JDJA 1B70B 2PFDA 4NLDA 1U8SA 1YGYA 5KFYA 1U2FA 3MI7X 3W63A 3CC2S 1AROP 1UEKA 4L6V3 5IXUA 2H4WB 4G1QB 4WF9Q 3V2UC 1RWOB 2F4VF 1VLYA 4JV2A 4J37A 3RZAA 5KFPA 2JC1A 2WW8A 2GQ2A 1NSPA 4OZ1A 1B64A 4WP9A 2VJVA 2E66A 2XLKA 1M5KC 4EYIB 2BANB 1S10A 4QYRA 4OZNA 3HSDA 2MXYA 3N6LA 1BHNA 1TKZA 2ZOMA 4USUA 2V67A 2IC3A 1WDDA 3PEJA 3T5JA 1YHQS 5KG3A 4BLGA 2GA7A 4WCEQ 1U1QA 1RHQB 3TX0A 1N6QA 2X1BA 2QA1A 4LF5J 3AJ1A 1NB7A 1CS4A 4PG6A 4X66F 1E6YB 2AX0A 2WBMA 1UWAA 4ZVRB 4KBIA 3HCXA 1WHWA 4C48A 2GO9A 1BQXA 2ZC4A 1S1UB 4RUBA 1GAOA 2HHSA 2BV3A 5DO2A 4BDPA 2MZJA 3HULA 2JWNA 4DCJB 1UVMA 2E9ZA 1HW9A 2VFTA 2XG8A 3CC7S 3MMBB 4FZVA 4TKTA 2DYAA 1KVJA 2ZOFA 2AU0A 3TRGA 1SH3A 3NCQA 4PXBA 5ADZA 3Q8SB 2E5GA 3H5YA 3OTOF 5AT1B 1ROFA 1PC5A 2DHSA 2V2VA 4X4OA 3IBWA 3U02A 4DR6J 2V4JA 2K1RB 3LA0A 3ET6B 1S9GB 3PYEA 5DG8A 2UVWA 3NMAA 2FJEB 2YNIA 5BYRA 3J81U 4I6YA 2FJBB 1WHVA 2N7YA 3KJNB 4MK8A 5EGYA 3G6YA 3RRGA 4LFCF 2BW2A 4F4YA 4OZ3A 1LWFA 3OFFA 2J7WA 3M6VA 2ZH1A 3QJLA 1AFIA 1K0VA 1T05B 2XGPA 4DL5A 1RT7A 2W2QP 2H5EA 4LSNB 4KV8A 3MPVA 2GIQA 4O3RA 3PKMA 2R42A 3EXYA 3JSYA 1TKXA 4OJGA 4A47A 1FT8A 2POKA 3FVYA 5L1IA 3BQ0A 1REGX 3WIVA 2DRAA 3WX4A 5HROA 2WK4A 3MM6A 4F04B 1PAEX 1V9OA 3SZ2A 5A8RA 2I8EA 3GG0A 2V8HA 1DURA 4DUTA 1IUJA 2F8MA 3QT7A 2ZKTA 5K8PA 4EWTA 3GQCA 1UFWA 3D54A 4OLPA 3OSPA 2ZD1B 4IFVA 5IS2A 1DLOA 4HEA9 2VQFJ 1RGVA 4B3OB 2CVEA 1FF2A 3LP2A 4ZJQA 1DLOB 4TQSA 1QD1A 2OTLS 2MKCA 2X51A 2LP4A 3MHYA 2OD6A 4JV5J 5JJBA 1T05A 4XDDA 1CVJA 1FX4A 3MTJA 2M70A 2P9EA 4DR1F 2HMIB 3OTCA 1U47A 1LNQA 1S6UA 2Y8WA 3CJQA 2L9WA 1TV6B 2G2OA 2Z0GA 3P5TL 5BR8F 4RUAA 3K59A 3J7A1 1EHWA 1BMQB 1YJRA 2IRYA 1U09A 4EBCA 4U7UK 5I3UA 5LJ3Y 3MURP 2MSSA 3M2VA 4NRTA 2AJ0A 1FTRA 2N4DA 2RD5C 2AHOB 3TAQA 5CHCB 2DR5A 1PJ5A 2CQHA 2MSTA 4X2BA 1RHJB 2XLIA 1S57A 2HQ3A 5KFHA 3CDEA 1BQNB 2QG9B 4OYOA 1N52B 5AXKA 5A0YA 5B0BA 4K4XA 5AJ3F 1F3FA 1OY6A 3LF0A 3CJ3A 1I1GA 3GSIA 2ZUAA 5D0GA 4CWBA 5DQIA 2MHNA 4OJ3A 5AXNA 2MLZA 4OX7A 1TKZB 3CD5A 1EZZB 2D69A 3TVZA 4AQYF 3KHRA 2FVQA 4NCGA 3HHDA 5KFRA 3VAHA 2NUUG 3MFIA 1HWUA 4ECZA 1TU0B 1YQHA 3PXGa 2Z56B 1DBDA 1KVIA 2K2PA 4RJVA 1T03A 5F8NA 1C0TA 3FSXA 3BR9A 3M8WA 1W26A 3BREA 5E7OB 4G1QA 5MLCV 3TARA 5L8RC 4A8MP 3U1MA 1R0AA 1Q7LB 2K3IA 3OFEA 2VG7A 2EK6A 2WOMB 2D9OA 4YB7A 3IWLA 3HVRA 2KZMA 4JI5F 2LYVA 3QFWA 2DXDA 1ICEB 1HI8A 2VF3A 3M8PB 2DHAA 4HHHA 3CCTA 5C24B 2ZHAA 4Y6IA 5CYMA 1WG1A 4ICLA 2MTLA 1YKWA 1M0SA 3D28A 3C8YA 2YQ3A 1SB6A 1U45A 5F0UA 2MQLA 2HRUA 1TMJA 2BA9A 2NSBA 2RF2A 4PUOA 1IKVA 3FBEA 2HHQA 3SSQA 1HBNB 3EMTA 1R6YA 3GWCA 3DHXA 4Z7CA 4CLWA 5HSPA 3KUEA 2MZQA 4FF1A 2Z2MA 2VOPA 2HGLA 4AXJA 2FD2A 3POTA 3CUNA 4LF6J 3ZZPA 2XHCA 5KFNA 4F8RA 4CIOA 5H9EK 1NJZA 2XNRA 3TNVA 2HIYA 2MYFA 3H2VE 3HP6A 3T5KA 1RI7A 1FERA 2AGQA 3CC4S 3ILIA 1Q4RA 3W3SA 2DGWA 1NM2A 2GJFA 2YX7A 4GVBA 3P49B 3WBZA 1FVQA 3DRPA 1SVDA 2E5HA 5A2QU 3QJJA 3ZZYA 1TTHB 1EAYC 4F7VA 4X64F 1VQNS 3JQKA 2PMWA 1FXDA 3TYTA 3UWTA 4FKXA 2BBEA 3RAQA 3ETMA 3KK1B 2MMYA 1PJ7A 4DQIA 5E3AA 2BM0A 2G0IA 4P10A 5CXTA 4CCHA 2HBZB 2RUGA 4PXDA 3C6UB 3KLGA 2ADCA 2KRBA 3I31A 5KFUA 3MM8A 3KLHB 2C3PA 3EWGA 5HBMB 1D0EA 1URNA 1HNZJ 3VALA 1PCAA 2BZ2A 4YUDA 3TJAA 4K4VA 1TAUA 4FYYB 5GVQA 4E0DA 1F5CA 4FVMA 2MQOA 4DSLA 3GJQB 2ZWPA 2V9WA 3DXSX 3HDSA 3D7SB 1RHRB 3KK3A 3M8SA 4DL7A 2C22A 4HR2A 5H9FJ 2VQEF 4PYDA 1M5HA 3FEZA 1OS5A 4XK8C 5I42B 3Q8PB 1IM6A 3LAKA 1NO8A 5IZHA 3KK3B 4TYAA 1U26A 2U2FA 1S9EB 2Z2ZA 4GRSA 4FYWB 5FDLA 3H0PA 4ZIWA 1TZ0A 1QAYA 2B4PA 2LDYA 4K0KJ 4Q8EA 2WSEC 1SJQA 1RKIA 2VU5A 3N5FA 4USKA 2OEMA 1IR1A 1CC7A 3IWXA 3OXLA 3V6DA 2U1AA 2Y9HA 4OHXA 2CA9A 2HQFA 3N6NA 4NOHA 4JI7J 1F1BB 1FD8A 2WONB 2GQQA 1FI4A 4NA2A 3KLGB 1EKRA 3V6DB 2GZOA 1VQSA 2QYCA 4X64J 1I94J 2OH2A 2CQIA 2LDIA 2ROGA 3EGWB 1I94F 4DV5J 4ETXA 4PPZA 4BHQA 4JI2J 3IC1A 2ZH6A 2E5JA 3BPSP 3L95X 5K9FA 2P8IA 1JLBB 4DV1F 1RTHA 3S7RA 5B0GA 3KDOA 4DU7A 2Q43A 3H20A 4DZ6A 2N3LA 2HFSA 4C6AA 4X4NA 3EXCX 3EUNA 2DO4A 3DYAB 5HI7A 2V94A 4ED5A 1AFJA 1BY9A 1R8CA 2CNNB 1YITS 2VDIA 4LR7A 1ZTWA 5CAAA 4C0BA 5IOLA 5LJ5Y 3OJSA 1P9QC 4EO8A 3RB0A 2DR8A 2YTCA 5D3GA 1RTIB 2HBYB 1ZM4A 1TL7B 4A8YA 4P7VA 2H4YB 3HHKA 4DS5A 2WVFA 3QWPA 4P73A 4RNFA 1SUQA 1HR0F 1S6PA 1YJ7A 4OV6A 4Y2KA 2HWHA 2CVIA 2FHOB 5DZ7A 4HKQA 1JLFB 1ZPVA 2HAIA 1VK8A 5K8MA 4KQZA 1DJ0A 1DZ5A 4UF4A 2L9NA 3UI3A 3MMCB 3IRXA 5ETTA 1KHWA 3C6TB 4WK1A 4HHJA 5K20B 3CNQP 3PRDA 4TLRA 4P75A 1B0PA 1P1LA 4OI2A 4FBUA 1AW0A 1JNZB 1LK5A 3H59A 4W98A 4U7CA 4R5PA 2FHJA 3ZZRA 2HEKA 4EU0A 2JLFA 3EYZA 5DGAA 1F60B 2MEWA 1TKDA 1L3VA 3G9CA 4W90B 4Y2AA 3VVTA 5DJBA 1H74A 5KOWA 2JFDA 2RDIA 4KHPF 4HI1A 2KZZA 1AZSB 4MT1A 2NS1B 4C98A 2ZNZA 2J9EA 1U4BA 2ZH7A 4KFBB 1UEVA 3HSGA 3OTDA 1NJYA 3HF5A 4I56A 3TUIC 3ZTPA 4WPAA 1U1OA 1VRQC 3Q2TC 2Q3PA 3GZ7A 5J2PA 5SZTA 2RE1A 2DNNA 1AA1B 3UD5A 5KT4A 3G6ES 1YIJS 3I6PA 4QR0A 1LFPA 2DGQA 4M5JA 4F4AA 2WTFA 4AFFA 3R2DJ 4V19X 3ZTQA 2DNGA 3RRHA 2P9CA 3JAMY 2HHHF 2MQNA 3PX4A 2HFNA 4O3QA 2F3JA 3RBZA 3SV4A 4DQQA 1IXKA 2O3DA 2V69A 1F3VA 4N8NA 2IM1A 2QSWA 2BJEA 5GMEA 1Q86T 1UWBA 3BH6B 5CYMB 4QIEA 2RU3A 2JEGA 1JJ4A 2EFVA 1FNOA 3CJ0A 3IR5B 2QZ8A 2XZTB 3O2IA 2IJFA 4XTTA 3VZHA 4K4WA 1RTJA 4DL2A 2JH3A 2OPQB 4ZPCA 5J2NA 4IOCQ 4ECXA 2GGPB 2O67A 4OJHA 5FIIA 3HMJG 1GXLA 3VAJA 4O4RA 1UJ6A 1VBZA 2QJ3A 4NI2B 2EFQA 3GU0A 3NCRA 3W5ZA 2AYBA 4LMZA 3UO0A 3FFIB 3CCSS 5A76A 5ETMA 5HK4A 1UPPA 4G65A 4M5GA 2UUTA 5KG7A 3LGNA 3EX7B 4QWBA 1RT2B 4DV3F 1PSDA 3B78A 4WP3A 4KHPJ 2ZVIA 1X5OA 4C3MA 1SIZA 3CDBA 3RBEA 3AD7C 3EICA 2I5JB 4PQUA 3SIPB 2BE9B 4ZPTR 1GFWB 1M5VC 2OTJS 4URSA 2MGZB 5K5MA 1IQTA 2ZE2B 1FDAA 4YEAA 1JXVA 3C66A 3DLGB 4DL3A 3HJVA 3LP1B 1SKUB 1VQKS 2A2CA 3H5SA 4OYXA 5HMYA 2W01A 1F0XA 3M2RA 3GYNA 4YMEA 3EPGA 4X4VA 2DK2A 4U8YA 1IJFB 2IRUA 4M5LA 1DFDA 2K7JA 4P2SA 1ZS6A 4N47A 1YJ9S 2KVQE 3MPUB 5I3QA 2BRKA 3D6FB 4DR1J 2BJDA 3OQ2A 1LQ9A 2H5JB 4K4YA 4YP3A 3TX8A 2COLA 2I2YA 3GYGA 5HROB 4OX6A 4RW6A 3CT9A 2ZH4A 1HNIA 2H3EB 2QC3A 4QWAA 5F0WA 5HVGA 3MR3A 1EETA 5D0RA 2DVIA 2G13A 4X62F 2ZM6F 3UCZP 1UFLA 1RTDB 4IRKA 3P8BB 1CSJA 1YSJA 2RAQA 3MCOA 4UOCA 3T6JA 1FXRA 1AB8A 4CH0S 1QSSA 3HJFA 2HVZA 2ROEA 3IGVA 5FLXY 2XLJA 1CJVB 1XNQJ 1NJWA 5D6GA 1N5QA 1JX4A 3Q86A 4K5RA 4H54A 4J9UE 2BQ3A 1WOSA 1D09B 1HR0J 4ILMA 5KFOA 2NREA 3F41A 3I32A 4UOFA 4DR4F 1S4EA 2ZBQA 2BJ1A 3KWMA 1VQ7S 4B9VA 1RU1A 2UZAA 4ID8A 3UR3C 3HT3A 2Q66A 4L3NA 5E3CA 4P7TA 3UN5A 3NGDA 2XMTA 4NLQA 5ETOA 4ES1A 4V1Ak 5KFEA 1SC4B 1V3SA 3I5CA 4Q8FA 3U7JA 1ZM9A 2P9GA 3DM2A 3DLKA 1RWWB 2IYGA 3E01A 3GONA 2C3OA 3PNIA 1C1CB 2R7RA 1BQMB 1NKBA 4OQJA 4I6WA 5LL6d 1QM9A 3BGFA 5LMUF 1VBYA 2V8GA 3ILOA 3T41A 1S79A 1FNMA 3DLLQ 3M8PA 2KKHA 3QT5A 2H5IB 3M7VA 2PMZD 2J6SA 1NZ8A 1HQUB 1RADB 2CQBA 5KFQA 3HLUA 4ANDA 2DGVA 2DPJA 3D3BJ 3MF5A 2XSFA 4L74A 3C16B 2LU1A 4DPOA 3KLFA 3QAUA 3TA1A 1WC1A 1H7XA 3G6VA 1YRXA 4ZVUB 2CPJA 1RT1B 1CC8A 2FVSA 1GXTA 1OQ6A 2C42A 3MWBA 1UWBB 1RT4B 4BWJA 5CYQB 2AJ1A 1IBKF 1Q79A 3TZXA 2PIIA 3W2WA 4KR0B 3WX8A 4ENOA 3R1LA 4ZP9A 4CTAB 4C9DA 1F9HA 3RB3A 2UXBF 3DOKA 2MKYA 1PILA 3A8IA 3UPFA 2RHSB 5BJRA 1MU2A 2PO4A 2LCWA 3LAMA 4FYVB 3EVMA 3CJKA 3TR5A 2R8HA 1SH0A 4DFMA 2XYPB 5GAGU 2YPZA 1NDCA 3T5HA 4ZP8A 4GKJF 1H98A 3UD3P 1D8YA 4OI3A 3MD1A 2OKQA 2ZNYA 2LQJA 2QLBB 3PV8A 2I38A 1N5VA 4B9MA 2HVDA 2DTJA 2LQBA 2MQMA 4F2RA 1EQ0A 3PYGA 3LO3A 2Y1IA 3BB5A 5LXYA 4Q45A 1NNDA 1XNRF 4ZDNA 2XBPA 2C2NA 4J9OA 4J9SA 1KVKA 1HQEB 1TL3B 4DOZA 1XR6A 1UVJA 2KL8A 3NG8A 3TVKA 5GAHU 1K0TA 4DXLA 3R5AA 5A0YB 1E6VB 4R0JA 4YQWA 2ZKUA 4LT6A 4DQRA 1V5IB 3EE3A 4QIFA 4PEOA 1RHMB 2BKNA 4DCOB 3P3DA 1RABB 1KOOA 3POTB 2OPPB 1LWCA 1RT4A 1DY3A 4GO7X 2Z8QA 1HW8A 4RWXA 1EARA 1UEUA 3CJRA 1D8ZA 3ZZTA 2LA4A 3EVWA 3RW7A 1Y5LB 1HIYA 1RU2A 1T9VA 5DDPC 3VVUA 1N36J 2BOPA 5L1JA 4H4MA 3DDIA 3KUHA 4JI3J 2G2YA 3NRBA 3EVOA 4NE9C 3OD2A 4DSEA 3IBCB 5ITHA 2CZ9A 2DB1A 4LIRA 1SXLA 3UN3A 1TKTB 3QIPA 4ZA1A 1OY9A 2R2RA 2W4CA 4DV2J 3MM5A 4H4OA 3FGVA 1RK8A 5DRKA 4F0MA 3DOMB 1RT6A 4P6QA 1O5JA 5DDQC 1Y10A 2VHGA 3SCJE 2OIHA 3L9ZA 4PWDA 4WZQA 1U6FA 4Y34A 3NWRA 4JI0J 4IOAQ 5ETVA 3RG6A 2HVHA 2W4PA 3OXFA 5U47A 4C3KA 1BC6A 5SUHA 4IG0B 2IDEA 2QLJB 3JSRA 3MPDA 2MY8A 4KJIA 2NXJA 3MAQA 4DV0F 2B9EA 3QSIA 1S1TA 3LQVA 5GAHI 4XAKA 3ZZ0A 1XNQF 2HNDB 2YKAA 3CJTA 3IAM9 4B3RJ 1DTQA 3US5A 3ZXWA 4JV0A 3VQSA 2MB0B 3M8ZA 4CZCA 3IG1A 2M8HA 2DY9A 4DR6F 3R5JB 3CEDA 2A1BA 2CG4A 4DZDA 2B6AA 3GCXP 2L48A 1D9DA 2ZUGA 4FF4A 1TUWA 4QW8A 2Y1JA 1VHIA 1K9MT 2GNKA 3BO4A 2V2QA 1BGXT 1PYOB 1XN9A 4C97A 1N36F 1JLQB 3VAGA 5I42A 4USIA 3THPA 4DF8A 1FHTA 3JYTB 5B0AA 3MECA 1OYEA 1VK3A 2N4CA 4O4GB 4LIWA 4WTOB 4ECRA 4DUZJ 3OTBA 1UP1A 2BE7D 4MYUA 4OX9J 1PJ6A 2CJKA 3SCKE 5E3PA 3W8GA 3QATA 4YB5A 1GXUA 1TR0A 1RAOA 3OUYB 2ASLA 2GMLA 2VDHA 2YX4A 3H90A 3PW0A 1DTTA 2HNYB 4EYHB 1IWAA 4N7TA 4MKYA 3HVWA 1IBLF 1DHMA 1WELA 5D4OA 2CJBA 3S01A 5F8HA 5KG5A 2CWXA 2GW8A 1UETA 3VF0B 1ZPWX 4F2SA 2YH0A 4OHYA 1TL4A 4NLUA 4HH1A 1HBUA 3NNCA 1NDPA 4P2XA 1YJVA 3HVTB 5IT9Y 4RR5A 3PDNA 1GMUA 2BE2A 1X0PA 3ITHA 2E7XA 1LWEA 1RYRA 2AEJA 3FBCA 2FVPA 1FDNA 1N48A 1HFEL 1RAHB 2AW0A 3D6HB 3E3XA 3K5PA 4X4RA 4K4SA 3AOAA 3Q8RB 2HNZA 3GFYA 1Q0NA 3LGHA 2ZE2A 1N34J 4R8UB 2E7VA 3AOBA 5IT9U 3C2PA 3T1AA 1MROB 4W4MA 1S9GA 2JEFA 1U1KA 2CKWA 2PEHA 1TL3A 2L3MA 3HI9A 3RB6A 4UT4A 1FKAF 3CCWA 3FKBA 5DETA 1RWKB 1TK8A 1QAJA 4ZPAA 2JVOA 4M5DA 2KFNA 5LXRA 4RU9A 1RT7B 1HKAA 1VGYA 4LR8A 2R8KA 2YQ1A 5T7LA 4V19J 1CG2A 3CCJS 4L72B 1PBUA 4A8WA 3GFZA 2BYCA 2ZC3A 1VRTB 3UR0A 1WHXA 3DGPB 2VJUA 4DFPA 2FJWA 1FRKA 2PD1A 1LW0A 2B4OA 4I64A 3A8EA 4P74A 2D3O1 3B54A 4DHVA 1VLOA 1QSYA 5EDWA 4P52A 3BV8A 4A48A 3QGGA 5C2CA 3A1YG 4F67A 5J2PB 1IKXA 3IRXB 1XIQA 2HWTA 3I82A 2D1CA 4E98A 3M4XA 4ZHRA 2XY7A 1NH7A 1QE1B 3G82B 1LV5A 2G2ZA 5D8HB 2DRBA 4ED1A 3SQGA 1Q8IA 1J5EJ 2FHKA 1MWYA 4K4TA 4ZMMA 3Q23A 2IJNA 1LK7A 4ZKAA 2R7VA 3OL7A 4OYMA 2M52A 2WSCC 3CJ8A 3DXBA 1VQ6S 4ZK7M 2KU7A 2E1CA 2RQKA 4Q0BB 1RUSA 4WFAQ 1VQLS 4KFBA 2OO4A 4ZN3A 4UY85 2PMHA 2ZJRQ 4JI0F 2C2EA 2DGOA 5DZ6A 5L9NA 1NKEA 1UMJA 3W61A 2A6OA 2WOMA 1ELOA 1Q82T 5HJYA 5T41A 4ED2A 3CB4A 4DMZA 5B0FA 3IS9B 1WI8A 2OEJA 2CNOB 1TUGB 1RT5A 2XMVA 1JLAA 2CDQA 3H42A 3PJ9A 4P2MA 3CJKB 3FEYB 3SSSA 1U2CA 1OMSA 4ANEA 3BN4A 3MEDB 2W9CA 1EKSA 2BANA 5AE2A 1KLMB 1TQLA 2KB2A 1FDBA 5C5JA 3I9ZA 2F9DA 2BW7A 3M30B 4OYIA 4LFAJ 1W7WA 4ECTA 1N33J 4DV1J 4FYXB 5CABA 2YNGB 1N33F 4PPDA 2E1RA 2PA8D 4ZVFA 3MAAB 3D1QA 4KKOB 3FNNA 2ZITA 4PG7A 2RS8A 3CCQS 1Z4UA 2IAJA 3M8QA 3MM7B 4CLUA 4DV3J 4IRCA 2R7WA 1R7IA 3RRKA 3FBFA 1J5OB 4B3OA 3DOLA 2MQPA 2FGOA 3FUYA 2DR9A 5FD1A 4JI8F 3G8QA 3K17A 3P45B 3GIJA 2FJXA 4LF9F 4NEZA 3THTA 4N76A 2HBRB 4M5MA 3T6BA 3GILA 2VODA 3PO5A 5F8IA 4J9KA 1GTEA 4RW9B 2ILZA 3NGKA 2YKOA 1T03B 4MKVA 4IG0A 2ABYA 3OR1B 4NMLA 2JEJA 4K0KF 4LQ9A 2AP6A 1AYEA 1VMBA 1HPZB 1TUVA 4TQRA 1IVZA 4TNOA 1KN6A 1FKOB 3SI8A 2OSRA 5HVFA 1BWEA 5ETKA 2JZ5A 1UZDA 3F56A 5HLFA 1XC9A 1SV5A 1F6TA 1YZ6A 4F4ZA 1RYSA 3IAS9 4R25A 4NMXA 3SEOA 2QIFA 1R0BG 3CDUA 3MGJA 1U0SA 4G3IA 3BSAA 3OFGA 1WF2A 2ILYA 3KTQA 2VBZA 3MD3A 1OYDA 2VPXB 3UW1A 1YRTA 1Y00A 3DC2A 3AB2B 4JI4F 4WFBQ 1UVNA 1Q95G 1R43A 3VAIA 4TLQA 2AIRB 3NKYA 1SQFA 5KFZA 3BO3A 2MLYA 2QYGA 3GMGA 1TP7A 2QN6B 3TEHB 2YXLA 2ZWOA 3WIUA 3B8HA 1KDNA 4DPUA 3I55S 5IQ6A 1XERA 4WFNQ 4ECSA 4O3NA 3CJ5A 2XS5A 2UXBJ 3OFHA 3EGVA 4DR3F 3OR1A 2WAQD 4DX6A 4AL5A 3H5XA 1GK8A 3KMQA 2VFRA 3KJFB 2E1PA 2HLTA 3VCDA 2NZCA 4USTA 3L7OA 2FYXA 2HS4A 1RT2A 2MY7A 1NLKL 5G4DA 2KM8B 2XO7A 4GKJJ 1WD6A 2HHUA 1JLEA 3BQ2A 3TOQA 1NK9A 4ID5A 1A0OB 4JP8A 3UDVA 1Q78A 2FJVA 1CBKA 4F0HA 5A6PA 3ZNJ1 4C7QA 4LFBJ 2AT1B 2ZEJA 4PABA 2DGSA 2V2KA 4WK3A 2DNQA 4LF4F 9RUBA 1D9FA 3CO9A 4KGKA 1ZM3A 2EPIA 5CQGA 2VC0A 5D4PA 4NLYA 1M1HA 2WVBA 2XULA 4OIXA 2N82B 3AQPA 1FRXA 1XMOJ 1M5OC 1URRA 4LUBA 3T9ZA 2ACYA 3DU6A 2FB0A 1N32F 3EZOA 3RJMB 4L3KA 5KTQA 5KT3A 1T0TV 3DN9A 3E2EA 3SFUA 1Q8BA 1S7IA 4ECYA 4LQ3A 3PRBA 5G0RB 2VOOA 3TEGA 1WKKA 3Q24A 2B9WA 1ZA1B 1T11A 5LSLA 4YR3A 3CDAA 1TK5A 3V81A 3CW2C 4DPTA 2HK3A 3AY0A 4JI1F 4RW4A 1NRKA 3CD6S 2SXLA 1NXIA 2VPYB 5LT5A 2Z2YB 1X9SA 1YI2S 3W2WB 4BCAA 2D3UA 2PFFB 4GO5X 1VQ8S 2FY1A 3SCIE 4URQU 2XM3A 2MKJA 5HATA 3RYLA 3HPOA 4QWEA 2OEKA 4ERDA 3BH7B 4BC7A 3AHPA 4NZ6A 1C1CA 4LRDA 2RRNA 3GB0A 3VGUA 4WYLA 1KFDA 2ALYB 4OYWA 2ZH3A 2A10A 4HT5A 1HA1A 2VFVA 3QIDA 6AT1B 1NK6A 4Q2LA 1K8AT 3KLIA 1E6VA 1FDDA 1UJ5A 5GADU 2ASJA 1W2BR 3QAEA 3RW6A 2LFVA 1MLAA 2IMOA 3ISND 2XGQA 1UAWA 3HD2A 4ZVPB 1KKHA 4ZHRB 3F73A 3Q8YA 4ED0A 1BWVA 3PHTA 2AEMA 3MMCA 5EWGA 1FO1A 5B0DA 2DHGA 2W8KA 4DV7J 5EWEA 3Q22A 3QJPA 1WSRA 1RT1A 2FZCB 5KFMA 2F4FA 4NYPA 3H98A 1SJ1A 2LEAA 3DLEA 3PY8A 3GIMA 4B3RF 3M8RA 3HKZD 3DFEA 4UZBA 1RWMB 1WKJA 2HZAA 3QO9A 4PQAA 2V2ZA 4P71A 4CTAA 4OZJA 3VZIA 4YR0A 4B9UA 2CPFA 5DM7Q 3J81j 3CCRS 3BDPA 3A4TA 1NZAA 3N9UC 1HWKA 1WEXA 4AD6A 5JMNA 2DD8S 5IT0A 2DNPA 1P1TA 3B82A 4UOGA 2UUCF 4B3SF 4JI1J 2C3UA 1IR0A 3BKUA 4DLEA 5DLFA 4PYAA 2UUCJ 4PG4A 2HZCA 1HLWA 1ZA2B 2DGXA 3E51A 3BBCA 4D3HA 4IQXA 1S77D 1GTHA 4C3LA 4K50A 1RB0A 1DQ9A 3ENWA 3KLFB 3OT9A 4IDKA 5IFMA 4WXWA 4LF6F 1Y7PA 2YBVA 4IO1A 4NYZA 1L3SA 1KQSR 3M9NB 1R8PA 1T9UA 3N4WA 3LUYA 4OZLA 3R7SB 3NAHA 2BKOA 1R27B 3DDKA 1HWJA 2AYEA 3OTEA 4I69A 4MIWA 3DKDA 3PIPQ 4X4UA 2J7UA 1Z1ZA 4PR6A 2I9SA 1QAIA 2DXFA 1Q8KA 3ELHA 2DNRA 1S1VA 2JL9A 3UDEA 3ISNC 4C0HA 2XO6A 2QT7A 2CZVC 3ETOA 2MKKA 1VC0A 1K1QA 3A3OB 1RWUA 3TZZA 2CXEA 4FBTA 2OUGA 3H2LA 5KT7A 3QLHA 1SJ4P 2IMWP 1U6BA 2HAFA 4QCLA 3NAIA 4DJBA 4ELUA 5F8LA 1SQGA 3V6JA 3AODA 2ZH9A 2X3GA 2CDRB 4OYAA 3V4IB 3NOGA 3CCMS 5HMXA 2XMWA 2AGPA 1K1SA 3I5BA 4ZP7A 4O44B 4URGA 4OYZA 3MMBA 4RPFA 3TZWA 1AXQA 3KYLA 2B9YA 2XHWA 2I5JA 2AYGA 4PQUB 2AWZA 1X31C 4O44A 5D77A 4RW9A 3VWSA 2M9KA 4KGZB 2HK2A 3PJWA 4PAAA 2UVVA 5HP1B 3RBDA 4B9TA 5D4NA 2YNFA 3ZO7A 4IRDA 2E44A 4KV8B 5H9FK 4F4KA 4I2QB 3IN5A 2QL5B 4CLZA 3MCNA 4OYPA 3H7HB 1LWFB 3PIOQ 2X1AA 3O44A 3NWGA 4K7QA 1IN0A 1OQ3A 3TO8A 4DR5F 1R6VA 1VJWA 2Z30B 4LFCJ 3EGZA 3OVBA 1FVSA 3MEKA 3WDOA 3ET6A 5GAGI 1QVGR 2FQQB 3VR1A 2XTJP 3H4DA 2E1MC 1R8AA 3HFVA 1NCLA 1IBCB 1YBTA 4LJMA 4KTQA 2PT0A 2WB1D 4U9RA 4AXIA 3CMAS 2JSXA 1HBMB 2YPYA 2LA6A 4K2XA 3ONQA 2Z4PA 4DN0A 2R7XA 1BXNA 1NDLA 3IO1A 4WWSA 3DI6B 1C0UA 3EZUA 1KFSA 2AEFA 2RF2B 4PUOB 1FFWB 2CAJA 3FQKA 4QPTA 1UCNA 2CQCA 3C6UA 2O01C 1H7WA 2QTWA 3LP1A 3MOZA 1FRHA 3DLHA 3UCGA 4X65F 2M5YA 3FCWA 1MWZA 1VBKA 1TL1B 4MAKA 3V6HA 4NASA 2IM2A 1JJCB 2BKPA 1WC6A 3M1VA 4MIBA 3RR7A 2FC8A 3FBBA 4MIAA 3W9IA 1U02A 2UUAJ 1TELA 2GQCA 3BM7A 1N34F 2VV5A 2PE8A 4HL9A 1S99A 2IVYA 1MWQA 2MDAA 1KTVA 2B43A 2GAHC 4A8QA 4KE5A 4DF4A 4N41A 3TI0A 2DNKA 1RWXB 2KFZA 4Q5VA 4DL4A 1F2HA 1YDLA 2EXUA 4TXSA 2GMHA 4KC5A 4AT1B 4J9QA 3MUMP 2O66A 4F26A 2MLXA 3UCUP 3TZYA 1KLMA 1T95A 2VUGA 1LFWA 3HVAA 3AOCA 1VBXA 4EZ9A 5BR8J 5LMUJ 2M4MA 2D3OR 3DDNA 4JYAJ 5DQGA 5GAEI 5KG2A 4NA3A 2J9DE 1ZZFA 2KDOA 3C3LA 4OJ1A 1SJFA 3FC9A 4YDXA 4TY8B 5H9EJ 2QX0A 2CG8A 1WWHA 1S9FA 4YFUA 1IBMF 2PGCA 4A8KA 3NGRA 4P72A 3OHAA 1HNWF 4ALZA 2MQQA 1N0VC 2DHHA 5AJ3J 4LVOP 2RIJA 4QBUA 3QT6A 1HNWJ 3NS7B 4NLOA 3OR2A 2IA6A 1S0MA 1U8WA 3AB4B 4CH1A 1BE4A 1Y3KA 4CO0A 3Q0AA 4NCAA 3DRSA 3PEHA 4R5PB 3H5UA 1L5UA 1VRTA 3MUVP 2B5JA 1RHKB 3I0SB 1T94A 2ASDA 3CD0A 2JHEA 2QLFB 1TL7A 1DAXA 3GIRA 1RT3A 4G1IA 5J2MB 1VIOA 4PZVA 2APOA 1S1XA 4EZ6A 4Y2CA 2MZSA 1S6PB 4FXWA 4WKRA 3RU0A 4DV5F 4U67Q 1NPKA 1Q16B 3FQLA 4I2PB 2ZHOA 2C1EB 4XDCA 3BF4A 1IKWB 4B17A 3CTRA 3FSYA 2F5GA 3BR8A 4WTYA 2CPHA 4O3OA 1LOUA 5A8WA 2ATCB 2M3DA 4RNNA 1S0NA 1JIHA 3ENAA 5IQQA 4M95A 4WKYA 1H6KX 5HP1A 2XZWA 2GS8A 2RJZA 4A8XA 4CYUA 1RDRA 2VB6A 4ZPWR 2XY6A 2CPIA 2HW3A 1DRZA 3Q2SC 4O3PA 1UJ4A 3QLHB 4IOBA 2Y0BB 3HSJA 4A4JA 4QOTA 4TU7A 3C14A 3J7AN 2E5LJ 2XWXA 4L73A 3V4IA 3C19A 1SQEA 1J5EF 4H4OB 2BJ8A 4J9VA 2R8IA 3M32B 5I3PA 2FVCA 2IJRA 1Y5NB 2V9KA 5FDLB 3K8WA 4HVZA 3K2YA 3CJ2A 3G96A 1CJUB 1J5OA 4LF2A 2BJ7A 2RRAA 2KRRA 2NCKL 4HLBA 3QGPA 4F36A 4C2MA 5HN0A 2KTQA 2RVJA 4RBVA 2YWEA 4D3GA 4HYKA 1NMEB 4WFYA 1HI0P 2YWHA 3C46A 2GIRA 1BD6A 4OZ2A 4I2QA 4I67A 1YBUA 2HNDA 5LSRA 2HNYA 1DTTB 1RA7A 2BUNA 2RQMA 5HQ8A 5IT4A 4DV4J 2X7IA 4ZVQB 3GV8B 2AGOA 4BS2A 2EFGA 4Q7AA 4CH7A 2XI2A 1X9WA 1KRPA 3AT1B 4RW6B 1QY7A 3CPWR 1QTNB 1RT5B 3AJ2A 1U7LA 2NR0A 1BUXA 1OPZA 2CUYA 4HHUA 3SQOP 3U27A 4ECVA 3R5GA 2UU9F 4AQYJ 2DRDA 3RR8A 4DR7F 4NZ0A 1V6HA 2P2CB 3R8YA 3W62A 5JVHQ 2IM3A 4DR7J 4DG1B 1NB2A 4ZLPA 1RWNB 3QRRA 2DNOA 3M9MB 1RLDA 2RU9A 2ACMA 3MDFA 3OV7A 5DLGA 3LWMA 4FN5A 4NLTA 4WZMA 3DMJA 4CO1A 3N0VA 1X0FA 4QWCA 4ZN1A 4PXCA 2FTRA 4EFAC 2MJUA 1RAAB 2ERRA 1NPRA 4L76A 2IBOA 3WZ0A 4WFXA 5IV4A 4LREA 5KFTA 2ZFHA 5HL7Q 2J6UA 4RZRA 3JSMA 2HQDA 2A2DA 2ASYA 2J8AA 3HK2A 2UUWA 3GV7B 2BJ3A 1RAIB 1VISA 4KHRA 1ZTTA 1WNEA 1CJTB 2FJAB 1NUEA 2XSJB 4O0IA 1KS2A 2KYXA 3P5BP 3DOKB 1S1UA 2VG6A 3MM9B 1NK5A 4LRAA 2DT9A 3BYPA 3QO9B 1L3UA 1F9EB 4KRWA 3ZTRA 2XS7A 3CIZA 4JI4J 2E9TA 2F7VA 1PG5B 1B4SA 2C2ZB 2ZOGA 4N5SA 2B8QA 2WB4A 3NBPB 4WU3A 1NK7A 3PCOB 1CEZA 2KT5A 5B09A 4ZPVR 2VC1A 1C0UB 2GHPA 3FMBA 4ES2A 5HVHA 1VQYA 2R7UA 2Z2LA 3HHNB 1DQ8A 3TANA 3TP2A 4B3MJ 1VIXA 4QIVA 2IVMA 1YG0A 5KFBA 4DQPA 2CPXA 3RTVA 4GMKA 1H2UX 1NU4A 3AXMA 3DU5A 3FZBA 3KG1A 3JSMB 4J9MA 3HHLC 2YY3A 4DEZA 2HHWA 1FEHA 2H48B 3F44A 2GFFA 2AJ2A 5I3UB 4K59A
chains in the Genus database with same CATH topology
2V8VA 3AAWB 2R7OA 5HMWA 5C25B 3FZ2A 3KKFA 2MZTA 3OLBA 3AA8A 4BC9A 4ELTA 3Q8QB 3LOUA 3W2VB 2KXFA 2RILA 3TUZC 2FGCA 3KG4A 1XWLA 1LW2A 1U6ZA 5KFXA 5DG9A 2D9PA 1TL5A 2LXFA 4KGMA 1NK8A 4QW9A 4RUHA 1OO0B 1QUPA 3IA0A 3OLAA 4FVCA 3LANA 3M9OB 1BQNA 1MROA 2HS0A 4CT9A 4J9RA 4UQGA 3J7Z5 5GADI 2AJ4A 4Y2IA 3ISZA 2HHPA 1FK9A 3I87A 1N5YA 5K8OA 1S0VA 5F41A 1KQGB 3N28A 4DLGA 3MEEA 5CZXA 4KO0B 3PX6A 1Y5IB 2KFYA 5J1NA 3LP0A 5EX0A 2BACA 4JBCA 1FEEA 2J6TA 5M2PA 2JLEA 1SKWA 2F8HA 3BGRB 2W7AA 4DV4F 3R5CA 3PVXA 4C8OA 2D74B 2VD3A 2VPZB 2ZH2A 1ZETA 2UXCF 2MKHA 4NLPA 4ZOSA 2B7BB 5K8NA 1N0UA 1ZAVA 3I0RA 4RU2A 1RTDA 1VC5A 1YVFA 3K5NA 2V5HG 4B08A 2F1FA 1HD0A 2MGZA 1D1UA 3LALA 2NYIA 2XMKA 2K1RA 3JTPA 4MMOA 1YTYA 1YJWS 4FNIA 2I0XA 4I2PA 1H38A 4WFZA 3GFHA 5CCMA 3TA2A 2FHMA 5E2QA 4CNZA 3MPYA 3X1LB 2CPYA 5FJ4A 2XCPA 4GC6A 4RBTA 2X1GA 3GIKA 2R9LA 3QPIA 4WYWA 2PN6A 2B6AB 4RNHA 3N79A 1FKOA 3O6QA 3VQTA 2QV6A 4AUKA 2DNLA 4M1KA 1JLAB 2EK1A 1A9NB 2YWFA 3J7ZT 2DPIA 3LH2S 4X84A 1R31A 2X1FA 2V0NA 2AD9A 4OFZA 2XCAA 3WC2A 3I0RB 4ZS6A 1GX5A 2B4VA 3SFGA 1VRUB 3MR6A 1RP5A 3DRRB 3MM8B 3M2RB 3KLHA 3PW5A 4ZVGA 3KNAA 3UD4P 1IQZA 4DWIA 1T02A 4JI6F 4ECWA 3CJ4A 1HNVA 4RW7B 4JUZA 5KG1A 3BGUA 1HL6A 4IFYA 1PGZA 2EG1A 4EBDA 3RAMA 1RAJA 1R3NA 2V4JB 2XNQA 2C3MA 3FRYA 4AYBD 1E6YA 2CIMA 4RWWA 1FRLA 2VASA 4MKAA 2KYZA 4F3QA 1H0HB 4TU8A 1JB0C 4OI0A 2CJAA 1S97A 1N56A 1WACA 1R89A 4HTIA 1UW4A 1HBOB 1NH8A 3MAHA 1RQ0A 3K57A 1MU2B 4M63A 4PXEA 2Q6BA 1FRJA 1JMTA 3PR5B 1APSA 1O0PA 4ELVA 2EWHA 3PX0A 1SBRA 2JOQA 2WCXA 1ZZNA 3UE2A 3CGIA 1HHSA 3KOAA 2QMXA 5K14A 3J7YI 2BDPA 1JK9B 1MW7A 1HQEA 4XPEA 1JLGA 1HNVB 4RW7A 4OL8A 3KNGA 5JVGQ 3HO1A 5EN1A 3ZZZA 1SL1A 2CQ4A 2WSFC 2L08A 4NYOA 1N4LA 1ZBTA 1UL3A 2DH8A 2HPUA 2KT3A 3RB4A 4JYAF 1EP4B 4TN2A 2HHTA 1TFYA 3I56S 1I6JA 1FKPA 2BABA 2OPSB 4MKBA 3VAKA 2IYIA 2XC9A 5CCLA 1SJ3P 3ZC4A 1DARA 3E8OA 2HNZB 5AXLA 5J2NB 2HMIA 2DJWA 1SJRA 3NCPA 4NLXA 3SXLA 3J80Y 4TYBA 4C8MA 2YWGA 1Q53A 2Y0SD 4OX9F 3ICLA 4DUZF 2B7CB 4QQBA 2B9XA 1JLCB 1QUVA 1VBZA 4DR6F 3MECB 4O4GA 3MFHA 1X4HA 4DS4A 2UUAF 1V3ZA 4O23A 4OV1A 2YH1A 1FXLA 4YHHF 2LXUA 3FEXB 1SKRA 1Y0HA 1X5TA 1HARA 2E5IA 4NLSA 2W9BB 3M1VB 1RA6A 2LQ9A 2VH7A 3J7YU 1X7VA 4H4KA 4I4BA 2KHDA 3C6TA 2KXHA 3M2VB 3PACA 3EPIA 2J9CA 1FESA 4F25A 3G6XA 2CZ4A 2DGTA 2EBGA 2EFNA 1G2EA 5F3ZA 4NLGA 1YBAA 4CNYA 5KT2A 4LF7F 2CJ9A 1XR5A 2JLGA 4MTPA 1KD1T 3SYZA 4WJBA 2UVRA 3ZZUA 1TKTA 3PJXA 3QIPB 1RTIA 3VAMA 1XMQF 1JXEA 5DM6Q 3M2UA 1OSDA 2M88A 3K5MA 5F8GA 2AJFE 1Z2ZA 2IM0A 2XEXA 3BGRA 4I6AA 3M05A 2OPRB 2VFSA 2VKZG 4KSEB 4CO3A 4YDDB 2JFKA 2YKMA 3KK1A 2CQ0A 2WRMA 2JEIA 2E7WA 2M7SA 3BGLA 1A7GE 3I5AA 2B51A 1G3OA 2FVRA 1IJEB 1S1TB 1S48A 1FK9B 3G71S 1NK4A 3BZQA 5L38A 3NNAA 4NZ7A 2JRSA 3MEDA 2W9CB 3BJYA 1B7FA 1HBNA 2N3OA 3CVKA 3GSDA 3FFIA 2Q79A 2R2SA 3DOLB 2OJ3A 4K4UA 1XBWA 2M0GB 2VG5B 4DR2F 1UA0A 4ECUA 2GGPA 2UV8G 3DOMA 2DHXA 1X4CA 4K4ZA 5E5NA 1LW2B 1DTQB 3EZ5A 3O3LA 2W25A 3HZEA 5J2MA 2F8EX 1CEZA 2EG2A 2LU2A 2P6SA 2IBKA 3I9V9 5KG4A 3K58A 4I0WA 2RT3A 1QAXA 2O1PA 1SIWB 2KT2A 3T1HF 1HWLA 2YNIB 3IR7B 5L1KA 3DNCA 2ATLA 4FP9A 3KG0A 2HHXA 4GC7A 3PFOA 3O8WA 4UY8T 4PWDB 2J7KA 3QYYA 2OPPA 4OI6A 4NPOA 2BXJA 4OI1A 3X3UA 3GG1A 4I7FA 2CPZA 3G6YA 3UDLA 3BSCA 2DNMA 4CO5A 4WE1B 2M8DB 5A8KB 1MMNA 3QGHA 5CD4H 3L3CA 1S1WA 2MZ1A 2LVWA 4DUYF 1KLNA 3BN7A 3TW0A 1Q8LA 4JV5F 3N5BA 1H2VZ 3H40A 1PC4A 4YR2A 3ZZOA 2HHVA 3K7RA 3CCLS 2ROPA 2DCUB 1VQ9S 4O3SA 1WTBA 3UDCA 2ZH8A 3BSNA 1XK8A 4E8UA 5J2QB 1S72S 2M2BA 1PO6A 1Q81T 3DRXA 3LWLA 1JKHA 1S0NA 1IKXB 1YJTA 3M6WA 1FJGF 1JLGB 1YRUA 1GX6A 5F8JA 5L39A 3FRZA 4HH0A 5DQHA 1JLFA 4DFKA 4F4WA 3TAPA 1FE4A 6FDRA 3PO4A 2RNEA 1FCAA 4NX9A 3I4PA 3IXQA 3I4HX 3R3TA 4NRUA 5CYQA 3UQSA 2HGNA 2KVIA 4RUCA 1S0OA 2PC6A 1VQMS 5B7WA 1NJXA 2GHVC 2RQ4A 1KR4A 2JVRA 1NEEA 4X4SA 1Q1KA 6FD1A 3G8TA 4ECQA 2B0GA 4KHMA 3DGPA 3DM2B 3E01B 4WKRA 1M5SA 2R4FA 5IM0A 5M2RA 5LJ3Y 3NBPA 4B3MF 2H9ZA 2O5DA 2G0CA 3IFEA 1R0AB 3QMQA 4UQTA 2ZD1A 4IFVB 3TVYA 5T7LB 5KOXA 2FLOA 4A8SA 1U1NA 5EX3A 3ZFVA 2OMOA 1T3NA 3DLKB 5A2QY 4IUFA 2B56A 1LWEB 5KG0A 2AYMA 4KAIA 1NK0A 4ZPDA 2OFHX 4J9LA 1XR7A 2FC9A 2P5VA 3TAMA 2DNHA 1C4CA 4HDHA 3N6MA 2D3ZA 2VQFF 3MMJA 1A6LA 2ALZA 5AE3A 1H2TZ 3GR0A 1XTZA 2LXIA 2FPHX 3MEEB 2OMLA 2PA3A 2QA4G 2XY5A 3I96A 2MKIA 2R7SA 2KHCA 2N7CA 2VBYA 2FLPA 4DDFA 1WI6A 3MOJB 3HKWA 4ED3A 2VBWA 2GX8A 4ZCIA 1JNRB 2MPUA 3GR1A 3M2UB 4IG3B 1OPIA 4KO0A 1RT3B 2VBXA 5KFDA 4ID5B 2CRLA 3M6XA 1LKZA 3D0HE 1RISA 4KT0C 4NL5A 5HLFB 2P6TA 1REVB 3NS5A 2RH3A 4MFBB 4NLRA 1F2GA 1ZM2A 2LLZA 2EKYA 4KPYA 3HFKA 5KG6A 2VL1A 3AA9A 3KK2A 2UXDF 3FJ2A 3NNHA 3S1TA 3UFCX 1UVIA 1MSWD 5E0OA 2YVSA 4QPXA 4QIGA 3JB9k 4DQSA 4F02A 2EI5A 4CO4A 2YNGA 2YNHA 2GV1A 3LPYA 2E9RX 4X4QA 1U48A 4LF8F 3NS6A 2YNFB 1MNEA 3GE9A 1YWXA 2RRBA 4CI0B 2KXNB 2IAJB 3M8QB 1S76D 4PCQA 2AQ4A 2J0XA