3TYTA

Crystal structure of a heterogeneous nuclear ribonucleoprotein l (hnrpl) from mus musculus at 1.60 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
204
structure length
204
Chain Sequence
b'ADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heterogeneous nuclear ribonucleoprotein L
publication title Crystal structure of a Heterogeneous nuclear ribonucleoprotein L (Hnrpl) from Mus musculus at 1.60 A resolution
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 59
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2011-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tytA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tytA01
1WHYA 2MZSA 2OSQA 2KU7A 4LIRA 3UD3P 3TYTA 4C7QA 1VBYA 2LKZA 1WF0A 4IO9Q 2RU3A 1NJIT 2UP1A 2KG0A 2DIVA 2LEAA 5LSLA 4QPTA 3MUTP 2DH8A 3CCLS 2DHAA 5CA5A 4OZ0A 4CH1A 2E5IA 1Q86T 2K3KA 3FEYB 4ED5A 2KXNB 4QU6A 1CVJA 4CH0S 4WCEQ 2QFJA 2OIHA 2YKAA 3BEGB 1Q82T 3CMAS 3S01A 4LJMA 2QA4S 3S8SA 1X4DA 3LQVA 3EGNA 5GMKa 2CPXA 2MKIA 4ZKAA 2DO0A 1RKJA 2MJNA 2DK2A 2KT5A 2KRBA 2DNLA 2XS5A 1OO0B 2KN4A 3HI9A 1VBXA 1M5OC 1VQ6S 1OWXA 3L3CA 2G0CA 3MUMP 2JX2A 3MI7X 2VOOA 1M5VC 2XNRA 2CPYA 2DNMA 1QVFR 2DNHA 1JMTA 1VQPS 2DNKA 2CQ4A 2J0QD 3VF0B 1X4EA 4PKDB 2CQGA 1L3KA 1FJCA 2M9KA 2DGTA 2LEBA 1H6KX 5HL7Q 1YJNS 4F02A 2N82B 1HL6A 5LXYA 5GVQA 2YH1A 2RNEA 1K8AT 5IQQA 3N9UC 2AYBA 3DLLQ 3CC2S 1KOHA 2OJ3A 1FXLA 3R27A 3MDFA 2N7CA 2MGZB 3VAMA 2KFYA 2Q79A 3UCZP 1X5PA 2J0SD 2LQ5A 2N3LA 2DGSA 2MSTA 2YH0A 5EN1A 1NU4A 1VQLS 2CQ2A 1FNXH 1U1RA 1N52B 2MGZA 4W92B 1WG4A 1FJEB 4TLQA 5GAEU 1BY9A 5LSOA 1H2UX 3CCRS 1N54B 3G8SA 2CQ1A 4P6QA 3UD4P 1JJ4A 3NNCA 1SJ4P 1QM9A 1YIJS 2AYEA 1K9MT 1XN9A 5D78A 4CIOA 1X5TA 1OIAA 5MLCV 2VONA 4FXWA 2VOPA 2HGLA 2WBRA 2BZ2A 5DETA 2XB2D 2OSRA 2MZRA 1RK8A 2RRAA 5GADU 2DNPA 2DNZA 1X4AA 1PO6A 5LJ5Y 2M2BA 2FC8A 3G96A 2KHCA 2KVIA 2DH9A 3DXBA 1Q7YT 1VQNS 2E44A 3CC4S 2FPHX 2MKKA 4TU8A 1VQ4S 4WF9Q 2X1AA 1X0FA 1N88A 2OTLS 5FJ4A 1JJ2R 2RVJA 3MD3A 5DDRC 5DM6Q 2AYGA 3P6YC 2HYIB 2MZJA 2DHXA 1HD0A 3VAFA 4TU7A 1YJWS 1X4HA 2AD9A 3THPA 2CQ3A 3V4MA 1U1KA 2DGWA 1SJ3P 2DB1A 2MB0B 2DNYA 1YHQS 2CPIA 1IQTA 1M5KC 2K8GA 1UP1A 2FHOB 3S6EA 2MKJA 3I55S 2BOPA 4BS2A 1ZZFA 3CUNA 3PIOQ 1FT8A 2MQMA 4A8XA 2M4MA 1M5PC 3OW2R 1SXLA 2HGMA 1D9AA 1F9FA 3SMZA 2DITA 2FY1A 4Z2XA 1DRZA 2X1BA 3MURP 2RS2A 1WEXA 3CC7S 2D3OR 2JRSA 4WFBQ 2ZJPQ 1VC5A 1DZ5A 2SXLA 3CTRA 3BO3A 2RT3A 2KRRA 1WEYA 1WTBA 3H2UB 5CYJA 1AUDA 1YTYA 2CPHA 1ZZNA 3SDEB 2I2YA 1U6FA 3I56S 2CQDA 2O3DA 3R1HA 3VAJA 1WELA 3S7RA 3TP2A 2DHGA 1NO8A 4PRFA 2B0GA 5D77A 5ITHA 3VALA 3CF5Q 3US5A 5JVGQ 1N8RT 3VAKA 2QEXS 1KD1T 2MQNA 3Q2SC 2DIUA 3SDEA 3CCUS 1HA1A 3J7YU 1SJQA 2ERRA 4Y0FA 2MKCA 3LPYA 4WIIA 3FEXB 4OZ1A 1U1LA 3ZZZA 4IOAQ 2N3OA 1A9NB 3U1LA 1P27B 2DGVA 1KQSR 2CPJA 2DNRA 4WFNQ 4YOEA 2D9OA 2RQ4A 2HGNA 4QU7A 1ZH5A 3NS5A 2E5GA 4C4WA 2KXFA 2V94A 2DGUA 1R8HA 4RU2A 4J5OA 3MUVP 1D8ZA 1U1MA 3G6ES 2G1DA 1WF2A 1VQKS 3CXCR 2CQIA 2DISA 2CQCA 1U1PA 3UCUP 1WEZA 2NZ4A 2EK6A 1WI8A 1U1OA 2CQHA 1H2TZ 2DGQA 2RS8A 2MXYA 2LA4A 2XNQA 2KH9A 2LECA 2DH7A 2LXUA 2MQLA 1O0PA 3VAIA 4Y00A 3CCMS 3MXHP 2DO4A 2PE8A 2XSFA 3PIPQ 2L08A 1H2VZ 2U1AA 2F9DA 5BJRA 3IRWP 2F3JA 3R1LA 3P5TL 2DGXA 4ERDA 2M7SA 1YWXA 1WHXA 3MD1A 3NNAA 2CPEA 3CCQS 1S79A 2CPZA 2MZ1A 2MZTA 2F9JA 3ULHA 2MKSA 3G4SS 1M1KT 3EGZA 1HD1A 2XS7A 3NNHA 2LMIA 3CCSS 2M88A 4LMZA 2YWKA 3B4DA 3CULA 2KI2A 1VQ8S 2NLWA 2XS2A 2VODA 2L41A 1VQ7S 2RQCA 2LCWA 3BO4A 1YJ9S 5CXTA 2U2FA 4IOCQ 1WHVA 1WI6A 4YUDA 1WWHA 2MZQA 1U1QA 3EX7B 2M8HA 1URNA 1VQ9S 2LXIA 3JB9k 1S72S 1VQMS 2CJKA 3HHNB 3RW7A 2FC9A 1U2FA 3J7ZT 3D2WA 3NS6A 4C0OC 1UW4A 2J8AA 1SJFA 3RW6A 1FHTA 3P3DA 4QQBA 1G2EA 3MOJB 1SJRA 2E5JA 2YTCA 1X4GA 3H2VE 2J76E 5GAGU 3P49B 2MSSA 2LYVA 2X1GA 2CPFA 2G4BA 2CQBA 5IFMA 3CMES 2CPDA 4FXVA 3G9CA 1VC0A 1U6BA 1P1TA 4U67Q 2KM8C 2MY8A 4UY8T 1WG1A 2HZCA 2JVOA 2DGOA 5LJ3Y 3NMRA 2KYXA 1VBZA 2D9PA 2MJUA 3UWTA 1DBDA 1QVGR 3UCGA 3Q2TC 3G71S 3CPWR 4IUFA 3UE2A 2M70A 2OTJS 2CQ0A 2RRBA 1FO1A 2E5HA 2EVZA 1JJHA 2ZJRQ 4YB1P 3K0JA 2M8DB 3BO2A 1YI2S 2JVRA 1KOOA 4EGLA 5LXRA 1X4BA 4M5DB 5DDQC 2X1FA 4F25A 2DHSA 2DNOA 2RUGA 2KG1A 3TO8A 2I38A 2MKHA 3G8TA 2MQQA 5HO4A 5GAHU 3B4MA 2L9WA 3BS9A 5DM7Q 3VAGA 2ADCA 4WKRA 3CD6S 1K73T 2MPUA 2MQOA 1VQOS 1FJ7A 2KXHA 1B7FA 3CCJS 1WG5A 3CCVS 1M90T 2MMYA 2MYFA 2PEHA 4TU9A 4F26A 5DDPC 1DHMA 5IM0B 3VAHA 1YITS 5JVHQ 1R8PA 1X4CA 2ZJQQ 4CQ1A 2EK1A 1KC8T 2ADBA 2DNNA 2LA6A 1X4FA 1W2BR 1PGZA 1X5OA 1X5SA 2GO9A 2M0GB 2JWNA 5IM0A 1U1NA 4PR6A 1VC6A 1WHWA 3THTA 2M52A 1OPIA 2DNGA 3U1MA 2CQPA 5H1SV 2DNQA 2A3JA 5DDOC 1A7GE 4WFAQ 2HVZA 1VQ5S 2GHPA 2MY7A 4V19X 1WF1A 3IWNC 4W90B 1Q81T 2AYMA 3SXLA 3CCES 2KM8B 2MHNA 4UQTA 3ZZYA 1UAWA 2MQPA 1UFWA
chains in the Genus database with same CATH superfamily
3H0PA 5AE1A 3I31A 2OSQA 4EFAC 3UD3P 1U0HB 1ZBTA 1FXDA 1WF0A 2VA3A 3LGNA 2VA2A 2CFXA 1RZMA 5F8GA 2BJ9A 2P6SA 4RO0A 1IKVB 4JUZA 4KB7A 4LSLB 4ED1A 4OX9J 1ZM9A 2C42A 2H5JB 2KRBA 3HI9A 2G0IA 1OWXA 4HTIA 4O4GB 4Q0BB 1JMTA 3D6FB 1CC8A 2F63A 1K0TA 1LK5A 2DGTA 4ITSA 3P96A 2HFUA 3MECB 4F02A 4HACB 1MMDA 2OAUA 4RW9B 2RNEA 1KNZA 4TLRA 3WDOA 3MZIA 5D8HB 5KT3A 3VQSA 5K8OA 4X64J 1KKHA 2N7CA 1S77D 1VQYA 4RW4A 5F8JA 1WC5A 2YH0A 2IM1A 4WKYA 1TVRB 4I1TA 2EXUA 3DYAA 4H4MB 2BM0A 2QSWA 2PO4A 5D78A 2FGCA 3KJVB 2FJDB 2E9RX 4G6VB 2RRAA 1VIXA 2WVBA 2BE2B 4JI7J 5E7OB 5HQMA 4LVOP 4M94A 2J7WA 2KVIA 1F1BB 2IIHA 1IKYB 2CDQA 3KLIB 4XDDA 1JLAA 2JSXA 1JJ2R 5GAEI 1H38A 3CVKA 3FQKA 4AE5A 2P8IA 3GP9A 3AQOA 2AD9A 4E8UA 2B7BB 5LMNJ 4LF5F 2ZOFA 5L9XA 3POTA 4O0NA 3T1HJ 1S97A 4MAKA 5K8NA 2MQMA 3I0SB 1X7VA 4WIQA 2VKZG 1RWWB 2EFVA 2J9DE 1AZSA 1BHNA 5J1EA 1SQGA 3OR1B 3BN4A 1RAFB 1BE4A 3D6TB 4R8UA 3W2VA 2RDIA 2HFNA 4DUTA 4I7FA 2KHDA 4DHVA 1O8BA 4QWBA 3UR3C 3M9MB 3DM2A 2CQDA 4RNOA 1FK9B 4PRFA 3VALA 4KKOB 1KD1T 2ZVIA 4Y0FA 3HVWA 1RP5A 4IOAQ 1JXLA 2L48A 2ZEJA 4C6AA 1CQNA 1P27B 2UXCF 2D9OA 1S1UB 3TJ9A 2YKNB 3VQTA 2DVIA 3BGLA 4K7QA 2R7SA 4DUZF 2FJWA 1YJUA 1KFSA 3FBFA 4K4ZA 4W4MA 3H2LA 3IGVA 3U1NA 3R6LB 4O3SA 1T11A 3JYTA 4LSNB 5LT5A 4JI2F 4ZDNA 2D3O1 3DC2A 2R2SA 2Z0GA 3PIPQ 2W4PA 5E5NA 4GO7X 1VJWA 2MQ8A 5KOXA 3IM8A 1QAYA 3ENQA 4ERDA 4PG4A 2M7SA 3IBWA 1RDRA 2M88A 4EMDA 4CLSA 3QAUA 4FBUA 3CCZA 2N4DA 2YX4A 4CWBA 2YNIB 4CM2A 1WWHA 4GO5X 4IDKA 4CI0B 9RUBA 4PPZA 1KQGB 4ELVA 1VFJA 5FLXU 2FC9A 1IBLF 2CVEA 4KGMA 4C0OC 1MWYA 2PIIA 2ZNZA 4C8OA 2W2MP 1X4GA 1WC4A 1K0VA 4ZVHA 3DOLA 2FZCB 4DQQA 1D3WA 2VG7A 1UKUA 5ETLA 5KFDA 2ZWOA 8RUCA 5LSRA 4UY8T 1JLQA 2KFNA 1SB6A 2QLFB 3CPWR 1XTZA 1Q78A 2C22A 4YB1P 1S9EA 1G7CB 1J5EF 1PBAA 3NGKA 2CYYA 2VDIA 3DLKB 4QCLA 1HNIA 3X3UA 3ENAA 1IWGA 2V9KA 1RAAB 2MQOA 1DTQA 1FJ7A 2AV5A 3L09A 3OLBA 1MN9A 3N01A 5KFHA 2LDIA 1CPZA 2GO9A 4DV7F 2YWEA 3GJQB 4A47A 3NXZA 1FRMA 3UVJA 1N4LA 4X4SA 2R2RA 2O1PA 3D1OA 1FE0A 2HVZA 3ETMA 1LNQA 3TAMB 3C6UB 2W2PP 5CQGA 5ETPA 1VRTB 4L72B 2YWFA 2ALYB 1RE1B 4KYZA 1EQMA 3I9V9 3EZ5A 2LLZA 4JV0A 4ECVA 2RIJA 1HW8A 4N8NA 4RPFA 1RWXB 2UZAA 5A8WA 4MFBA 3EJMA 2BQ3A 4B9NA 2D74B 4DSKA 2HFSA 3MMCA 3OXFA 4BWJA 4J9PA 1FERA 2YPZA 4U7UD 3OSNA 4A8WA 3QMQA 2QRRA 3TQEA 1N33J 4OZ3A 3OTOJ 3M8YA 4I56A 3WC2A 1FEHA 4DFKA 2XNRA 2HWHA 1L3KA 1HBOA 1S7HA 4CT9A 5B0GA 3PNIA 3FSIA 3JSMB 2V8HA 1X8DA 1P6TA 2H4YB 2YY3A 1HHSA 4P10A 3BV8A 3M8WA 2MGZB 1QDUB 2C2KB 3OL9A 1U25A 2OFHX 3CCTA 2N3LA 3KFWX 1FNXH 4QR0A 4N56A 4ZN1A 1YJRA 3UD4P 5IXUA 5D0GA 1XMQF 2PC6A 2ZOMA 5ETSA 3D0IE 1RTHA 4KQZA 3RGIA 3OSPA 4WE1A 3TX0A 2HNDB 2QIFA 2COLA 4O3QA 2OTLS 4IO1A 1Z2LA 2DGWA 3M8SA 3KKFA 1SJ3P 4PXCA 4KE5A 4YB5A 4JI0J 5KFPA 1DURA 2VFSA 5M2UA 1UP1A 4F3OA 2IJNA 2PN6A 2V4JA 1FF2A 3JQMA 1CULB 3HK2A 1ICEB 5EWGA 2GQQA 1C2PA 4Z2XA 2EG1A 3Q24A 4J9SA 3EZOA 3H7HB 1GMWA 1GMVA 4EYHB 2RMLA 1NSQA 1SUQB 5KFUA 4U7UK 2ZITA 2RD5C 4JI6J 3IBFB 3ZZRA 4FF3A 3KK3B 4JI8J 2ACYA 5KG3A 3OL6A 1FRJA 2F40A 3Q2SC 4M63A 4MIAA 3FMBA 2RF2A 2P5VA 2MKCA 2R42A 3QO9B 3HVTB 3C6TA 3I9ZA 1B64A 1UVIA 2IBOA 3IRXB 3MMBB 3ZO7A 4KC5A 1SQEA 2O5DA 2VU5A 4URSA 5L46A 2QTWA 1S6QA 1WEZA 3B8HA 4TQSA 3GWCA 4B3RJ 2LA4A 2DH7A 1Q95G 2MQLA 4B3OA 2HQGA 4J9KA 1WC1A 4YS2A 3HULA 5IV3A 3IS9B 4FP9A 4K0KJ 1NSAA 5IZHA 4ED4A 3NS7B 2NPFA 2LCWA 3LANA 1LW2B 2HHTA 2XTJP 1U1QA 5AXNA 4MYUA 3FBCA 5AE2A 2GIFA 2J9CA 3HXMA 3LAMA 3R97A 4JI2J 1QTNB 2EBGA 4QQBA 2XGPA 2E5JA 4E0DA 2XMVA 4C97A 1I3OB 2ZD1B 3B82A 1R31A 3OVSA 2D9PA 3G71S 4IUFA 3A1YG 1N5SA 1FRXA 4ZLJA 2NXJA 4LR8A 3JS9A 1XMBA 3GYGA 1UEVA 1LWEB 5BYSA 2ZDOA 2P6TA 2R8HA 2LQ8A 3G8TA 5A8KA 1LWFA 3FEZA 5DM7Q 2IRUA 2PMHA 1K73T 4NXNJ 4K2XA 2MMYA 4UOCA 1OY8A 2HNYA 3GTYX 5JVHQ 2RHSB 4OZNA 3KLEA 1X4FA 4M5LA 4ZS6A 4TVAB 2K1RB 4IRKA 5B0CA 2V2KA 1B3TA 4DL6A 5H1SV 1J5OA 1LWCA 1EETA 3GFYA 3TUPA 3IWNC 2R7QA 3ZTQA 3O6QA 3MAAA 5E3QA 2I6WA 3MMAA 9ATCB 5D4OA 1WHYA 1VRUA 3C16A 3JTNA 2WAQD 4KRWA 3VGUA 4EK2A 1QUVA 4MIWA 5CA5A 1JLGB 2XYGB 1SCJB 2YKAA 4K2JA 3S01A 3EDRB 4OJGA 3DM2B 2OHDA 1SJ1A 3GSDA 3PG9A 2MJNA 1BQNB 4KGXB 4O3NA 4OYIA 2HQCA 3VR1A 2DYAA 1TTHB 1JLBA 4ZITA 2WBMA 3U27A 1TV6A 3AODA 3QWPA 1HMVA 4EBDA 3CB4A 1FXLA 2VQFF 3IA0A 1RQ0A 3LP2A 2W2QP 2LQ5A 3TZYA 1UWBA 5EN1A 1NU4A 1IKXA 1LFWA 4QOTA 4X2BA 4LBHA 5GAEU 1ZA2B 1URRA 2J6UA 3KJFB 2H54B 3KJNB 3F41A 3ILLA 1YBUA 4DCPB 1HBUB 1RXOB 3W60A 3SYZA 3BGOP 2AYGA 1FA0A 2YKQA 3JAMU 2DKOB 3AOCA 1SVDA 3K2YA 2ZM6F 3VVTA 1JXVA 1L5UA 3H5UA 1QAXA 3MURP 4DDFA 3DOLB 2MDAA 1RAHB 1W7WA 3K7RA 4PQUA 4LF7J 1U6FA 4EUVA 4DU7A 2DHGA 3OUYB 1QE1B 4OHVA 5ITHA 3CF5Q 3LH2S 1N36J 3N5FA 3TEGA 2XEXA 3UDVA 3TZZA 5HROA 1IVZA 3BGUA 5C2GA 4LRAA 3D9BA 1KQSR 4PWDB 5F0WA 1GX6A 2HGNA 3PXGa 4LR7A 2W9CB 3B78A 2ASJA 3PW5A 4ZCKA 4L3NA 1WSVA 1HNVA 4RBVA 5A2QU 1XMOJ 4HHJA 1Q4RA 3Q8RB 4P9SA 2P9EA 1NSPA 3ZXWA 2AT1B 4B3TF 4ZPAA 4PUOA 1ZM3A 1H74A 3G86A 3BQ0A 3PM9A 3MPWA 1HWKA 1UJ6A 4ES3A 1MWQA 3CIZA 5HBMA 1HD1A 3QSIA 1NUEA 1RHMB 2F4VJ 4F36A 1R0CB 2R7WA 3ZZ0A 2NLWA 2ZBQA 1VS3A 3OPKA 2HBZB 3E51A 2BANA 3VGTA 3Q22A 2UUBJ 5F3ZA 1V5VA 3IAS9 3ADAC 4CNYA 3RW7A 3J7ZT 2GVZB 4FS1A 2J8AA 3BR9A 3K5NA 3V81A 3DFEA 1F6TA 3P49B 3AJ2A 2WSEC 2CQBA 1F3VA 2K06A 1WOOA 2C2EA 4BLGA 4U67Q 3GQCA 1REVB 2XGQA 2RB7A 5KTQA 2ZJRQ 3MEGA 3T1YJ 4B9UA 5D0RA 4C3KA 1S4EA 4AQYJ 4HDGA 3BS9A 1YRXA 2VG5A 2Z8QA 4F7VA 1FNMA 2BDPA 4TU9A 4DFMA 2WSFC 4X66F 2BBEA 3Q83A 5F8LA 1RTHB 2I1RA 2NXUA 1HI8A 1I94F 2FLOA 3OFHA 1NJXA 2V4RA 3EUNA 1F60B 4PG5A 1AFJA 1HQUA 2ILZA 1WF1A 3V2UC 2Z30B 4DR4J 4DZ6A 3RUBL 2Y1LB 1CJVA 3CJRA 2AHOB 2H51B 1UAWA 3MM7A 4U8VA 4YQWA 2MZSA 2DEIA 4DQRA 2IJRA 3N6MA 5HQLA 3FK4A 4DR6F 5HVFA 1VBYA 4K50A 2GIRA 4ZJOA 5A8RB 4WFZA 4B3SJ 2LEAA 1DFDA 3R2CJ 2B4UA 1XR6A 2KXNB 4Y2IA 3Q8UA 2GQCA 3UPFA 2GJIA 1KFDA 3D66A 2X3DA 4ZVUB 3BPDA 2HHPA 4LJMA 1GNKA 3LQVA 1REGX 1UWAA 3SFGA 1L3VA 3OTBA 4DV6F 2AWZA 2XG8A 3HHLB 3L3CA 3MI7X 5KFVA 1Q5VA 3WQPA 5I3QA 1M5VC 2RF2B 2XMUA 4ZVOB 4UTGA 3MGJA 3G87A 3TR5A 2XMKA 3GIIA 1IJFB 4WZQA 2KTQA 1N56A 3TVKA 4ZVPB 2UVWA 2HHQA 4B9TA 2V68A 2IJFA 1T05B 2IYGA 1NKEA 3A3NB 2W1BA 4YB6A 5CH7B 1FRIA 4NXMF 3ZNUA 1DTTB 1PYSB 5H9FK 4IRDA 2NPIA 2AYEA 1OIAA 2XZWA 1SIWB 3J80Y 1T9YA 4HR2A 1J27A 3FNNA 1GH8A 5SUHA 1WUUA 4OYBA 5DZ7A 4TU8A 1N88A 1MU2A 2W4DA 2AGOA 4Q2LA 2BM1A 3ZTPA 4NMXA 1ZPVA 3MF5A 4B08A 4TU7A 1X4HA 2XWXA 2Y0SD 4URQU 3DRXA 2RQKA 1ZZFA 1FT8A 1HLWA 4A8XA 4HHUA 4USTA 3O5TB 1S0MA 5DO2A 4H4OB 4GMKA 1PYOB 2Q1LA 2EC2A 1WEXA 1LW0A 4WU2A 4HH1A 3H2UB 3OR2A 2QLXA 1IM6A 1S4FA 4X65F 2LQBA 2PT0A 2XZDB 2CJ9A 2MQNA 4KH1B 2ZM6J 4EZ6A 2R8GA 1YX2A 4QU7A 3NS5A 5KFNA 1BLUA 3T6JA 3PO4A 4X4PA 1XR5A 3ZZUA 3CE8A 1XEZA 3JSBA 1DY3A 2A1BA 2B4VA 2DT9A 3G6ES 5BYQA 4J9LA 2DISA 3KLGA 1U1PA 1EB0A 2EK6A 1JJCB 3AD7C 5JUMA 2YKMA 4I0WA 4KGVB 1WC0A 4Y00A 3G6YA 4ECXA 4NCGA 2XSFA 1TL1B 1S9GA 3WBZA 4J91A 3ILJA 3P5TL 1DJ0A 3OLAA 2CPZA 2MZ1A 2UXDF 5EGYA 3QYYA 4PAAA 4X4RA 5U47A 5HQ8A 4ID5A 2W2NP 2UUTA 4KPCA 2POKA 3B54A 1PJ6A 1U24A 5CCLA 4GKKF 3VHQA 1I51B 2RQCA 2U2FA 1WI6A 2JEGA 4OI0A 4DV2F 3ZTSA 4YY3F 4B3TJ 5CD4H 3PEJA 2UUCF 3OL8A 5DQGA 4DFJA 5AJ3F 2A6OA 3U7JA 1Z4UA 1BQMB 4LF6F 3R7NB 5HP1B 2GO8A 3IM9A 4NLTA 2HHXA 1UPMB 1NPKA 4NLOA 4M95A 5CZXA 1SL0A 4F50A 1HW9A 3NBPB 2HZCA 2XSJB 4F4XA 5LJ3Y 2VV5A 1RTIA 2GMLA 5J2QB 4KTQA 3E01A 3I4HX 1B0VA 3OQ2A 2JVRA 3KLFB 3LP2B 1S1VB 4KR0B 2ZWPA 3MPYA 4MKVA 3O8WA 2C2OB 3EVWA 1R43A 2HZAA 2R8JA 3CCJS 1HNZJ 2Y9HA 3ZC4A 2G2OA 3VAHA 1VYAA 1YITS 5A76A 2KKHA 5HJXA 2QLBB 5C7PA 2DNGA 3U1MA 2WOMB 1F5AA 1CEZA 5L1KA 1YDLA 1KHWA 3OHAA 4G3IA 2L3MA 2JHEA 4NX9A 1FX4A 3GE9A 2UU9F 1R8BA 4F0HA 2RU3A 2Z57B 2HBQB 3RZAA 1RT1B 5HMWA 1Q86T 4GC7A 1H7WA 2C2MB 1YBAA 4PWUA 2QFJA 4DG1B 3DOKB 4Q2MA 1B0TA 3H20A 3PX0A 2W01A 4NLVA 3V5RA 2H1YA 1U49A 3PTWA 2GMHA 2G0CA 2UXBF 5HI7A 1JLEA 2J0QD 2WONA 1FJCA 5HROB 4ZVEA 5HL7Q 4NCBA 1YJNS 2E5LF 4DR7F 2PMWA 4MYTA 2JC0A 5CD4A 2C2RA 2AU0A 4J9RA 5DJBA 5KFWA 1NEEA 2ZH5A 1NAQA 2ZE2A 1S1XA 2QX0A 2J0SD 4C48A 2R7XA 1U1RA 1R7IA 4CH7A 4DL4A 1QJHA 3KNGA 2EFQA 4TKTA 4ANEA 1QM9A 4ICLA 4ZPBA 3CDUA 2XULA 2WBRA 2A2CA 3K5LA 4DWIA 3M2RA 2DNZA 5J1NA 3UR0A 4JYAJ 1N34J 4Y3CA 1YSJA 1SL2A 4OV1A 5AXKA 2H65B 4NRTA 3THPA 2CQ3A 1I6JA 4Q44A 3S6EA 3W3SA 1J2VA 3CCWA 3I55S 4C0HA 2FZGB 4B9VA 1GQEA 1ELOA 3W9IA 5KFLA 3LTOA 5ETMA 2HGMA 4DL2A 3SFUA 5JMNA 1WD6A 4C11B 3PKYA 2Z2ZA 3O1LA 2D3OR 3V6DA 1EAYC 3CDWA 3NCPA 3BGRA 1ULRA 1AXQA 3CTRA 1B70B 4ZP6A 3PKMA 2QZ8A 5HN0A 4FDFA 4YHHF 1I5OB 2OKQA 7FD1A 4NOHA 4IYQA 2KB2A 1XC9A 1U45A 1R0AB 5JVGQ 3RB3A 2L9NA 1S0VA 2VBZA 3LPYA 2D3ZA 4WIIA 4ANCA 1DAXA 2OUGA 1M5HA 4QIEA 2XLKA 3EPGA 1TL7A 4QIFA 4ECWA 5GAGI 3M1VB 4J9MA 4UOFA 3FDSA 1VISA 2I5JA 4OX8A 2C3MA 2R4FA 3TZWA 3TOQA 4C98A 2RS8A 1C0TA 1MLAA 4YDDB 2QV6A 4OFZA 1Y0HA 1H98A 1APSA 2L08A 4KHPJ 3HF5A 2F7VA 1C0UA 4A8KA 4DL5A 3J7Z5 1BUXA 3G2XA 1M1KT 5M2RA 3CCSS 2CRLA 1NK9A 4LMZA 1CJVB 2O67A 2W7OA 1VQ8S 4DR5J 4CLLA 3AAWB 2L41A 4P7VA 1WHVA 5K5MA 1FKPA 3KNAA 3SBMA 3DLJA 4Y2CA 1FHTA 2GCFA 3FBEA 2AX1A 1GAOA 3H2VE 1RHQB 2HHUA 2GGPA 5DLGA 3DGPB 1D9DA 2UXDJ 1OPZA 2OMLA 3T9NA 2OMOA 3EPIA 1VC0A 2HVHA 2WZ1A 4KH0B 8ATCB 1QUPA 2ZVSA 3TVYA 3T41A 5C42B 2PGCA 1TAUA 1XQIA 1A0OB 2CNNB 1S6UA 4IG3A 1G3OA 4FYVB 5AJ3J 4QWEA 5GAHU 4ENOA 2IC3A 2ADCA 3NLCA 4K4TA 2IBKA 3W9HA 1B7FA 3TQ1A 2OPPB 1FX2A 5F8NA 2PEHA 2IDEA 1DHMA 1NDCA 1RB0A 4YR3A 3PW0A 1BWVA 2ZJQQ 2ZC3A 1EKRA 2CA9A 2QE5A 2IDLA 1PG5B 1HWJA 3BBCA 4X4TA 1VLYA 3CJ2A 4C8YA 1A7GE 1VQ5S 1CJTA 3UDEA 2EPIA 4MJKA 2BE7D 2VD3A 3Q8PB 4IFVA 3LAKA 1JLFA 4DX7A 2MQPA 1UFWA 1QAIA 3CD5A 1S6PB 4J9UE 4LF8F 3CJTA 3MR5A 4QPTA 1RT2B 1U0HA 5B0DA 4BC9A 1Q8KA 2DJWA 4DV5F 4ZCMA 3BEGB 3H5SA 4LFBF 5E0OA 3PR5B 2W8KA 2BQRA 1YVFA 3KWMA 5IOLA 5GMKa 1HBMA 4RKUC 4JBCA 3AJDA 1IKVA 1CLFA 5D15A 1TKDA 4JI4J 5F3TA 4LSLA 1H3DA 4M5IA 1FDAA 1FRHA 2HSEB 4RW8B 2NCKL 2E1RA 4LQ3A 1YG0A 4O4GA 4Q0BA 4DS5A 3SEOA 2QMWA 5IQQA 3N9UC 2E7WA 2XHCA 4HACA 4NZ6A 4RW9A 1O6XA 3NGRA 1PC5A 1VBKA 3CGIA 4RWWA 2CIMA 2GZOA 2ATCB 4A4JA 5IC4B 5LSOA 4OI1A 2GNKA 1SJ4P 3QLHA 3EGVA 5KFBA 3NGDA 2GMJA 1TVRA 2HGLA 1NM2A 3C3LA 2B6AB 4DX6A 4ILMA 3GYXB 1RAJA 4DR7J 3KJVA 3ZZTA 2FC8A 2NXCA 4B9SA 3CW2C 5EWFA 2F5GA 3D3BJ 3EE3A 2BE2A 3L4BC 4CO3A 1VR6A 2NQPA 2X1AA 8AT1B 2MZJA 4K8RA 5HANA 3CJSA 3PX6A 5E3AA 3KLIA 1D09B 2CPIA 2XMWA 2K8GA 3W5ZA 3V6JA 3TA2A 3AY0A 3CUNA 3PIOQ 3NGTA 1VCTA 2LU1A 1NJYA 4GVLA 3N6NA 2IVYA 3CC7S 1R0BG 3BZQA 3AXKA 2FGOA 3I0SA 2IM3A 4HI2A 1T3OA 2F8HA 3OR1A 3F73A 3OT9A 5DQHA 2WHOA 3VGSA 1RTIB 3FQLA 4A8MP 4C2MA 3N28A 3T6BA 5L1JA 4EO8A 2BA9A 3BH6B 2B56A 2WRMA 1FK9A 4WXOA 3ZZZA 2N3OA 4KKOA 3Q8SB 5DS7A 4I6AA 2FJXA 1L3TA 4ETZA 1P8GA 1D8ZA 1H73A 1S1UA 1IJEB 2YKNA 1RHUB 4TY9A 3PHEA 4CDIA 1VHIA 2CQCA 3J7YI 1RJJA 3OFGA 3I87A 1KLNA 3LWLA 1C1BA 3SCKE 1H2VZ 2RSQA 3LUYA 3NG8A 4YEAA 4LSNA 2ZH8A 2DGXA 2VBYA 4P2MA 1WHXA 2CPEA 4CO0A 2WVEA 2R2UA 2YVSA 2MKSA 2HLUA 3FSXA 4K4XA 3HP6A 1FFGB 2N7YA 2XS2A 3GV7B 3MEDB 1VQ7S 1YJ9S 5CXTA 1IQZA 3HSZA 4ZPWR 2RDDA 3JB9k 1T7PA 3IR7B 4RW7B 5C5JA 4DV4J 5JXSA 2YNIA 4WXWA 2P2CB 4F04B 1WNEA 1KVIA 2YQ3A 3HHKA 4UUWA 4B3MJ 2BKPA 4X64F 4JOUA 2XC9A 1SKSA 4QWAA 3EMTA 3H40A 1RABB 3UDLA 1U48A 4W98A 2RRBA 1RT7A 4K5RA 4XK8C 6FD1A 2VF3A 5ETNA 2RE1A 1ZPWX 2RUGA 2FUG9 1HNWF 2XYPB 3SV3A 4X4VA 2L9WA 4X4NA 2GS8A 2V2ZA 3HZGA 2IFXA 2V67A 3DLKA 2XMTA 5HMZA 2QFIA 1YGYA 2IMWP 1TK5A 2BJ3A 4Y28C 4LRFA 5LMNF 4OJ3A 1EZZB 2D69A 1KC8T 4A8QA 1PGZA 2XWYA 3T1HF 1VC6A 1NSKL 4ZK7M 5IWAF 1BGXT 3K89A 2FHJD 4LF2A 4ECZA 5HMXA 2E1PA 3CDEA 3R2DJ 4DPXA 2MY7A 2RJZA 4DPUA 5KFIA 4DX8H 4PZVA 1YK9A 2FVPA 3HKZD 3ZZYA 3TAMA 3C6UA 3M32B 3C2PA 3QJPA 3TYTA 5HK4A 1VRTA 2WB4A 2LVWA 2X7IA 2HLTA 4DL0C 4HVZA 2V4QA 2OP5A 3CO0P 3FEYB 5EDWA 5CYMB 1YKWA 2FVCA 4CH0S 2C3YA 3M8RA 3FSYA 1K44A 3V6DB 1Q82T 3BGRB 4ILRA 3ETOA 5IV4A 2GIQA 2BJ8A 4D3HA 3LGMA 3HFVA 3AFGA 1PCAA 5E3RA 3OJSA 3R5GA 2YX7A 3MUMP 4OZ2A 1VQPS 4PKDB 3K58A 2Z4PA 4LRDA 2EI5A 3AHPA 4LF8J 2NYHA 4U8YA 3CC2S 2NXEA 2H5IB 3JSMA 4LQ9A 4RNFA 1SC6A 1XERA 4ZPDA 2PMZD 3I32A 3A12A 2MGZA 4W92B 5KFTA 4ZVQB 4P6QA 4AL7A 4CIOA 4RJVA 2DR9A 1HWLA 4FXWA 2CG8A 2HS3A 2GHWA 5DETA 1S9FA 2CZVC 1RK8A 3QAEA 2CJQA 3IN5A 1X4AA 1KLMB 1OS5A 2LQJA 4LUBA 3SQOP 4DPOA 3D28A 3AT1B 3AA9A 3C15B 3MTKA 3P6YC 2HNDA 5T14A 1FKPB 2W24A 3CJKB 5HLFB 4C8ZA 1S59A 4OI2A 3C66A 1RYSA 3PRBA 3IR6B 2FJBB 4OZJA 4RX6A 4BS2A 4P71A 2M4MA 3FVYA 4DJBA 3H4BA 2VIHA 5LMUF 1CULA 4WFBQ 2HHHF 3BQ2A 4CLZA 4Y34A 3IGNA 4DPWA 3QT5A 5CABA 5C2CA 1SUQA 5D6GA 3M4XA 4PCQA 5HVGA 2BRLA 3KK3A 1AFIA 2HMIA 5KT6A 1S76D 2YNFB 1XNRJ 5HSPA 4ZLPA 1N0UA 4I2PB 4LREA 3QO9A 1S49A 1LQ9A 3HVTA 3P8BB 1NBEB 3IRXA 3MMBA 1VOMA 2J6TA 5CHCB 4DN9A 4JV2A 2HFVA 6AT1B 4OJHA 3P4UB 3QZ8A 2H4WB 2MXYA 5J2NA 4RW6B 2QYGA 1FWPA 2Q43A 2FJAB 2ROGA 3K5MA 2ZZNA 2B5JB 4WTYA 3DNCA 2C3PA 1YLXA 1RTDB 2VC0A 4FPRA 2F9JA 5DGAA 3G4SS 2YWKA 4EU0A 2GAGC 4HT7A 1SIZA 4NA2A 1MMNA 2IVFB 1UEUA 3IS9A 1N33F 2ZC4A 5ETRA 3TX8A 4IOCQ 1NDPA 3QNWB 4YUDA 3A4TA 1M1GA 2B9XA 3MEKA 4NLWA 1PIEA 2CJKA 4NZ7A 1LW2A 4ZPCA 1T8EA 3RB0A 1N5YB 3QT7A 2OGUA 1UW4A 3RW6A 3T19A 2D1CA 2CJXB 1UMJA 4UZBA 5HMYA 1JNRB 3HSDA 2UUAF 1F9HA 1HBMB 1UW9A 4NLDA 4X4UA 1R8CA 2ZZTA 2E7VA 5ETKA 3SCLE 2OTJS 2ZD1A 1IXKA 4K5SA 2ZH4A 2YNHB 4V1Ak 1KOOA 4PXDA 1XJWB 3PCOB 4O44B 3TO8A 2MQQA 1PKUA 1T03B 2J0WA 1C4CA 1LWEA 1Y3JA 3PYEA 1JX4A 1VQOS 2QGFB 4J7CA 3CCVS 2UVUA 2HS4A 2MYFA 3QLHB 2HURA 3BSAA 4QWDA 2VDHA 3PEHA 2UVVA 1F5CA 4JI0F 1Q8BA 1QY7A 3THTA 4DI6A 1N6QB 4DV0F 2V8PA 3RR7A 4H4KA 4LBPA 2K1RA 1HNWJ 4M5MA 1OY9A 3JSYA 2QT7A 3VZIA 2FHJA 2AGPA 4UQTA 4NLSA 4JI6F 4IFYB 4JI8F 3PJXA 2KU7A 5DG9A 3KHGA 3CEDA 5J2PB 3W65A 3GILA 1GMWD 5IWAJ 2FIUA 5A0YB 2RDJA 4F4WA 3SCIE 1JLGA 3NMAA 4MH8A 2DO0A 2DK2A 3HHLD 2DD8S 1HWUA 1OO0B 2KN4A 2AW0A 2JX2A 4CLPA 1ZETA 1BQNA 4B3RF 1RHJB 4RUCA 2AEMA 1ZAWA 4FKYA 4ED8A 3MAHA 4UOHA 5KOWA 2PI5A 3R27A 2XCPA 1TKZA 2OPRA 4KGZB 4EWTA 4IH5A 4K0KF 4ECRA 2YWWA 1NJZA 4DQIA 2FVQA 3CCRS 3F0NA 4JB8B 1YIJS 1W26A 1X5TA 1C1BB 3RR8A 1HIYA 4JI1F 3NOGA 2OSRA 3EDQB 1HWIA 5D3GA 3KHHA 2V50A 2ROEA 4X4OA 4QIGA 3FCVA 4HH0A 2E44A 4J90A 1TFYA 3WIUA 3TW0A 2VKRA 3BYPA 3K5OA 1X0FA 4JI3J 4USJC 4RZRA 1HD0A 2VFRA 1HBUA 3V4MA 1U1KA 4OZLA 3AJ1A 1MSWD 3VVUA 1MW7A 2PFDA 3DI6B 3QGPA 3LP1B 1RWVB 1YRTA 1HR0F 1SXLA 1DQ9A 1D9AA 4C8NA 4C3MA 5D0HA 3M6XA 3RTVA 2SXLA 3BR8A 4J37A 4NXNF 1C4AA 3T5KA 1C1CB 1JWWA 1UVNA 1RT7B 1U26A 3RBXA 2KO1A 1RA6A 1HA1A 3J7YU 2YKOA 3TA0A 3OUYA 3BJYA 5H9EJ 1QE1A 5B7WA 3TUZC 3RBDA 2DGVA 3G8QA 3GFXA 3ZTOA 2CPJA 4C9DA 1QTMA 2E5GA 5LMUJ 1P9QC 2V94A 3TA1A 1R8HA 2DR7A 2AEFA 4RU2A 2HRTA 3T5HA 4PWDA 3PW7A 2HHHJ 5KFOA 3IG1B 3QWUA 2W9CA 2DHHA 3DU5A 1SV5A 2NZ4A 4DSEA 2VH7A 2KFZA 4DQPA 3VAIA 3GIJA 3QFWA 1S99A 1HYSB 5BJRA 3EM1A 3ISZA 3CDAA 3J80U 1UVJA 2FY8A 1X9MA 2BKNA 1NZ8A 1HI0P 3IO1A 3M6UA 3I6PA 1F5BA 4OHXA 4G65A 1VRQC 1NLKL 1UA1A 5B0EA 4L76A 1R3NA 2XO6A 3OTDA 4OI6A 3O2IA 4F0KA 1S72S 1G6BA 4DU8A 1VQMS 2JLGA 1RA7A 2VZ9A 2KL8A 2CNOB 2V63A 4USIA 3KMSA 1G2EA 1AYEA 2GVZA 4PQAA 4DLGA 4I2QB 3KJQB 4QPXA 4NASA 2G4BA 4B9LA 2GVDB 3JQKA 3CJQA 3PY8A 1WG1A 2DGOA 4OIXA 1HFEL 2KYXA 2J5AA 3UCGA 4P7TA 3UE2A 3I5AA 2FLLA 4CTAB 1REVA 1FTRA 1Q8LA 4M5DB 1ZM2A 2W4CA 1NK7A 1BC6A 2VPZB 1RT3B 2Z2YB 4L6V3 3VAGA 2E66A 4J9NA 2UUAJ 1EHWA 4Q43A 1Y3KA 3BF4A 4YP3A 2W2OP 4IR1A 4ZP7A 5A6WA 4USKA 1RTJB 2HBRB 3M2UA 1PBUA 4AFFA 1LEOA 4M5HA 2IRYA 2EFOA 4ID8A 1X5OA 2AKWB 2M0GB 3N6LA 1T9WA 4USMA 2HVIA 3DRPA 2QMUB 4X62J 5DDOC 1V3SA 1WSRA 4F0MA 4O4RA 2V2VA 1TL3B 1SKWA 3DN9A 4ELUA 2ATLA 1GXUA 3MWBA 4LF7F 1TMJA 5F0UA 1OJ4A 4OZ5A 4C8LA 1XNQJ 4QR2A 1N36F 4U6PA 4MK8A 1KTQA 2ZKTA 1PAEX 3KUHA 4YR2A 1NCLA 2DHAA 4Q8FA 1U2CA 4DV0J 4ECSA 5A8RA 1M0SA 1LFPA 4OLPA 4AL6A 1FJGF 4CLTA 4CO4A 3K57A 1UA0A 2CZ4A 1TAQA 4DXLA 2JFKA 5HAOA 2GAHC 2KT5A 1XMOF 2BV3A 2DNLA 1VBXA 1M5OC 1B99A 2DNMA 3AOBA 2HMIB 3HHLA 2IHR1 1H6KX 2NSCA 2V8GA 5DQIA 4CLKA 1MROA 3NEKA 4I68A 2K7KA 2QN6B 2Z2MA 1DQAA 3ELHA 4RNNA 3QJLA 1F2GA 4NYPA 4Z7YA 4ZIVA 3I5CA 3M30B 1S7IA 2FJVA 2F4VF 3MCSA 1U8WA 1T05A 1GEHA 4PXBA 5J2NB 3FFIA 4G1PA 2OD4A 1DTTA 5MLCV 2VOPA 3NP5A 2UUBF 2VUGA 2LU2A 2ZBIA 1WOPA 4NI2A 2VL1A 3H25A 3KUEA 2KHCA 5I4MA 4FBTA 3MOZA 2HG4A 2MKKA 2BW2A 2C28A 3D1HA 5J2MA 5F8HA 2XCAA 2OLWA 2BJ7A 1N32J 2XY7A 2I0XA 3VAFA 1IBMJ 1YHQS 1U47A 2GFFA 1UPPA 1JLCB 2CNLB 4JI1J 3ZNJ1 3T1YF 1HARA 1Y11A 2V69A 1DRZA 3THVA 4H4KC 1WORA 2ASYA 4ZVSB 4WFXA 4Y65A 2RKIB 4AQYF 4H4OA 2P9CA 5FDLB 4EO6A 3IXQA 4N7TA 2JFDA 2O3DA 3D3CJ 1RT5B 3WHIA 2EKYA 5I3UB 1WTFA 1SJQA 5KT4A 3MR2A 3MM5B 4C8MA 4PPDA 3G6VA 1HR0J 1KEKA 4RBTA 4RNMA 5L39A 2F65A 3T5LA 3D6HB 4J5OA 5KFRA 1BWEA 5IQ6A 1RBLA 4HLBA 1X9SA 2R7UA 4LT6A 3RBZA 3UO0A 4DR4F 4ZCIA 3H42A 2KJVA 4LRCA 4YR0A 4RU9A 5K8PA 4AT1B 4URGA 3BPSP 2CQHA 3KHLA 1D1UA 4P52A 4DF4A 2AX0A 2V0NA 4B3SF 2Q6CA 3R1LA 2M3DA 1X0PA 3EGZA 1TL1A 4FYWB 5AE3A 2FQQB 1IKWB 1V5IB 1OYDA 2DEJA 3BO4A 3Q8VA 1RKIA 4I64A 1YJTA 3M6WA 4MK9A 2AP6A 2ZNYA 4M1KA 2B9EA 3HHNB 1RGVA 1W25A 4IG0B 1ACMB 4O3OA 1CC7A 3GG0A 5HJYA 4IQXA 2C1EB 4BWMA 4CLFA 4USWA 2XZTB 2DY9A 2OPSA 1S48A 3JQJA 5KG6A 3P45B 3CMES 5E3PA 2UVRA 1BQMA 3PR4A 3PV8A 5HP1A 3RB6A 2DRDA 3EWGA 2JVOA 3NMRA 1KN6A 1QVGR 1JXEA 2ZH3A 1S0OA 4CYUA 2I8EA 3CJ5A 3NBPA 5L1IA 2XSJA 1JJHA 3HKWA 5J2QA 3WIVA 4QWCA 2RU9A 1KTVA 1GTHA 2Q3PA 4H54A 1Z2ZA 2B51A 2BOAA 5DZ6A 2X1FA 2DHSA 4C0BA 1OQ3A 4Z7CA 4KFBB 1TKZB 2OPRB 4PXEA 4ZJQA 3W1YC 2AMCB 4F2RA 4PYAA 3BGFA 3KLFA 3W9JA 3BDEA 1S1VA 1VK3A 3TUIC 4MIBA 4R5PB 4USUA 3KXDA 4MKBA 5FIIA 2XLIA 1LXNA 5D3GB 1FD2A 2JEFA 1UL3A 4DBQA 2MKYA 3TAPA 3A8IA 3MEEB 5KFZA 1YBTA 2KYZA 1RACB 2WK4A 3I4PA 3OV7A 4RL1A 2CWKA 4W90B 2WOMA 5C25A 5DRKA 2HIQA 2LEPA 2V2QA 1FD8A 1H72C 3D5MA 4OHZA 2PEBA 3MUTP 3GJTB 4OZ0A 2K3KA 1RT4B 4B17A 3UN3A 1CVJA 2VJUA 3L7OA 3LALA 5KAKA 1S1WA 2PA3A 2BJ1A 3MTJA 1SC4B 1RT1A 4DV1J 3KMQA 5CZVA 3S8SA 3PW4A 1WOSA 3EGNA 2CPXA 2ZDPA 2OO4A 4DG1A 2J9DA 2V9WA 2PDAA 1TKTB 4IOBA 3DOKA 4WWSA 1OSCA 4HTJA 1QVFR 4OQJA 2CQ4A 4I67A 2B43A 4IH7A 1NKCA 2LEBA 1EARA 1EQ0A 3QIDA 4KHMA 1BQXA 1HL6A 1YJVA 2YH1A 1SKRA 5F9LA 3D0GE 5KFSA 2FTRA 1FJGJ 1XIQA 2W7AA 3TWZA 1SV5B 5KFJA 4XO0A 3HO1A 2Y0BB 5B0BA 1BY9A 2W7PA 1H2UX 2CQ1A 3JSRA 2J7UA 3KLHB 1UVMA 3JTPA 3M7VA 3E8OA 1ZAVA 2B7CB 2DY1A 5LJ5Y 2BX6A 5EX0A 5B0FA 1S12A 4DEZA 3RJMB 1NMEB 4JV5J 1VQNS 2K2PA 3DU6A 3BN7A 3BSNA 3D4JA 4AUKA 2ASLA 2VC1A 5DM6Q 4I6YA 2HYIB 3IR5B 4M5GA 4HDHA 1EP4B 2MB0B 1HPZA 5GADI 2PD1A 3J7A1 4ECTA 4FYYB 2BOPA 2HQIA 5FD1A 2BW7A 2X3GA 3SMZA 2FY1A 5EUHA 5F8IA 1CS4A 2W9AA 1X9WA 2CVIA 3M6VA 3SIPB 3H4DA 1PILA 4QIVA 4WYLA 1NKBA 3HHEA 4C11A 3DMJB 3K8WA 3T5JA 5D0EA 3SDEB 2BJDA 1WELA 3KHRA 4WU3A 1HNZF 3ITHB 3US5A 4Q45A 3N4WA 1SKUB 1T9UA 4HYKA 4A8YA 4A8SA 3AOAA 3TZXA 4WBFA 3FCWA 1TQLA 3Q89A 4EBEA 1R0AA 2MEWA 4HHHA 1E6VA 2DNRA 4ED6A 1Y5IB 3QIPA 2DGUA 4NWBA 1IR2A 3MUVP 3KDOA 3NCQA 3GONA 2W9BA 3M1VA 3IFEA 3M2UB 2BKOA 1NPPA 3HFKA 5B09A 2KH9A 5L1LA 3HHLC 3PRDA 1N5TA 3MR6A 2R8IA 2F9DA 3DRPB 3I0RB 3LWMA 3CCQS 5GAHI 2Y1JA 2XY6A 1WC6A 1SQFA 2VQEJ 3RRKA 3CDBA 3VZHA 1FKAF 3E2EA 4CO1A 1F3FA 3NS6A 4IKAA 3SSRA 1S10A 4NA3A 4C3LA 3MOJB 4FS2A 2YTCA 3C14A 2MSSA 4ZCLA 5EHHA 5C24B 1U6BA 3N79A 1P1TA 5KFCA 2XBPA 2KM8C 3DGPA 3ET6A 3HVAA 4NLYA 2HPUA 4I69A 5K14A 1MROB 3BREA 2E5HA 2BEFA 4F4ZA 5C42A 1A6LA 4JYAF 1N34F 2MKHA 5HO4A 3RB4A 3DLEA 3CIMA 3ONQA 4BBYA 1NH8A 4WKRA 1YRUA 3CD6S 2MPUA 3FMWA 4S0MA 1NNDA 1KVKA 1IR0A 3FFIB 3MM9B 4F26A 3WX4A 4LF4J 4CT8A 1QLNA 2OPPA 2LA6A 4R0JA 1X5SA 1XK8A 3GV8B 2JWNA 4NI2B 3V4IB 3HMJG 4PR6A 1FKOB 3FBBA 4ED3A 3EGWB 5DG8A 3CWJA 4TY8B 4RUBA 1MWZA 3R7BB 2XMMA 4JP8A 1FESA 5J2MB 1Q7LB 2GHPA 3GJSB 3NAIA 3GIRA 2KM8B 2MHNA 1RSCA 1U4BA 4ECUA 1LKZA 4G1QB 3PACA 4XPCA 4AXIA 4C7QA 5L9NA 2OI2A 2LKZA 1NJIT 3MFIA 5LSLA 1T9TA 3CCLS 1S6PA 3VTIA 1TUWA 2ZH6A 4WCEQ 2GA7A 1RT2A 2HNZB 3TVZA 3GYNA 4ILLA 2BE9B 2F8MA 1R89A 4FVMA 2XS5A 3TEHB 1VJQA 2WVFA 4ZHRA 1RUSA 3ZFVA 5ETTA 4LFAJ 2VFVA 1N5VA 4NLGA 2ABYA 3OJUA 4N77A 2N4CA 4KHPF 3DLLQ 4RW8A 2K3IA 1VI7A 2R7VA 3OHBA 2OPQB 2HKEA 4ECYA 3MHYA 2KFYA 2Q79A 5D4NA 2KT3A 4DR5F 1DLOB 5IT9Y 4FYDA 4DR3J 1HNXJ 1N54B 4UF4A 4KPYA 2E1CA 2DRBA 1XN9A 2HK3A 2VONA 3AQPA 3AH6A 2H9ZA 1T9XA 3ISNC 4BCAA 4OV6A 2DNPA 2ZH9A 2EEYA 2E1MC 4NYOA 4DFPA 1PO6A 1VQSA 2M2BA 3G96A 2B6AA 3MM6B 4AYBD 2X51A 2R2TA 4WP8A 3M8QB 1T0TV 2MLYA 3NWGA 5KFGA 4WPAA 4P75A 2GC8A 2HW3A 2DCUB 2RQMA 2XO7A 2V8VA 4QYRA 3G82B 2AGQA 4WK1A 5KFXA 1F9FA 1SPBP 2OPSB 3P5BP 1GTEA 3BKUA 4EYIB 2NS1B 4UW2A 3KK2A 1Q0NA 3DDKA 4X4QA 3M8ZA 4LF9F 2XM3A 2YQ0A 2I2YA 2DPJA 2QA1A 3R9LA 3S7RA 4CYUB 2QO3A 4FNHA 2C2ZB 3NGSA 4ZVRB 4CZCA 2VB6A 2F8EX 1ZH5A 3MCNA 2AJ0A 4ZA1A 3R5JB 4P72A 4KGKA 5EX3A 4YB7A 1N5QA 3D54A 2JNJA 2VFUA 1TKXB 3HSGA 4M8LA 1U1OA 1RWPB 2YWHA 4WTOB 2VG6A 1AROP 4MK7A 5MAOA 1HHTP 4NMLA 5T41A 3HT0A 1OYEA 1UFLA 2PE8A 1S5ZA 2M5YA 2ZH7A 1RWMB 4LF1A 5CYQB 2G0JA 3N0VA 2ZH2A 2MZTA 1YZ6A 5C25B 2QL9B 1AT1B 4DCOB 2R3VA 4UUXA 3AB2B 5BYRA 1UVLA 2E9TA 5B0AA 3MCMA 5T7LB 4JI4F 3DDNA 2M8HA 3M9NB 4L73A 1GX5A 3BKFA 2XMAA 3MEDA 3NOCA 2V6AA 3M8PB 1NB7A 2FVRA 4QYZK 5IT4A 1S1WB 1KRPA 1SJFA 4RUHA 4IQMA 4RW7A 4PG8A 2R7OA 2EFGA 2XI2A 2ACMA 2X1GA 2BRKA 2FVSA 2CPDA 3G9CA 1RI7A 5KG4A 1RBAA 4LF5J 1RCXB 4XTTA 1G1XA 2M70A 5J1PA 1CQMA 1EIYB 2WVDA 4MKAA 4NA1A 3Q86A 2EVZA 4MMOA 3D6MB 4DN0A 2PI4A 1KDNA 3E3XA 2C3OA 1HBNB 5DDQC 4E2FB 3LP0B 3FJ2A 1RAGB 2DR8A 2JDJA 3TJ8A 4A8OA 3DLGB 3U02A 1M90T 2ZHOA 3T9ZA 3DRSB 4K4UA 4F3MA 4J9QA 5IM0B 6FDRA 3DRRB 2ZHBA 3EYZA 2EK1A 4CLWA 2FLNA 4NPOA 5DGBA 2R7TA 4ZP8A 4OMFG 3OTEA 1WHWA 2UXCJ 3EXYA 1N0VC 4K4WA 2VBWA 3FZ2A 4KY3A 1U2RA 1NZAA 4DUZJ 2E7XA 1RADB 1WDDA 2AYMA 4NE9C 1S6OA 4LRBA 2EBEA 1HPZB 2YX1A 3GCWP 2JOQA 1M1HA 4N5SA 1RLDA 4KV8A 2GW8A 3M32A 4ED0A 2DH8A 1CS4B 4WP9A 2VHGA 2YBVA 5CYMA 3BBBA 3F44A 4DSFA 4ATNA 1RKJA 3T1AA 2AF6A 5RUBA 1V3ZA 4OI4A 1F0XA 3GR0A 1ZAXA 1TFWA 2W25A 2DNKA 2GJFA 2JZ5A 1IBLJ 1E6VB 2N82B 5D4LA 5GVQA 1K8AT 4RW4B 1RAOA 3QIPB 3ILOA 5KFQA 4ES2A 3R8YA 2W9BB 3VAMA 3DYAB 4OYWA 3UFCX 1VQLS 4OYZA 5KFKA 2KVQE 5E3CA 4WYWA 3QSYB 1NJWA 2B9YA 5A6PA 1GMUA 4OHWA 2HEKA 4KT0C 2RRNA 2XB2D 2A10A 1M5SA 4DV4F 2FB0A 5GADU 4UQGA 3CO9A 1J5EJ 1AA1B 2MHEA 1JLAB 1Q7YT 3DLBA 4B3MF 3CC4S 2FPHX 1U02A 1KLMA 2CDRB 1FWLA 4WF9Q 3POTB 2IAJA 2WCXA 3J81j 3NAHA 1TU0B 4Q5VA 5BXIA 1VGYA 2DNYA 3C15A 1GT8A 2NUHA 3PYGA 1AZSB 5J1EB 4DV7J 2GJ2A 2WTFA 2CUYA 4R8UB 3W2VB 3CJKA 5HLFA 4AL5A 5DLFA 1HI1A 1JK9B 2R7RA 4I7FB 1R8AA 4LBIA 2IA0A 4CM0A 3C14B 2RS2A 2A2DA 4YN3B 4WZMA 5LL6d 3R5CA 5KT5A 2HAFA 5CYJA 2J0XA 2BACA 3QFHA 3QT6A 1YTYA 3ET6B 3R1HA 3TP2A 3HJVA 5K14B 5KG7A 4RWXA 3VAKA 2QEXS 2QJ3A 1D8YA 3FEXB 1U1LA 1A9NB 3QGGA 4AD6A 1FDNA 3J81Y 2ZHAA 3W8GA 3DLEB 2WVCA 4DUYF 4ZOSA 1LOUA 1QAJA 4C4WA 2GV1A 2KXFA 3A3PB 2IM0A 4DQSA 5ETQA 4NLPA 7AT1B 1ITPA 2YNFA 2AQ4A 2QMXA 4I2PA 1PJ7A 2KJWA 4ZLNA 3JYTB 4XAKA 4LF9J 2IPOB 4OX6A 1WKLA 1WI8A 2YPYA 4O3PA 2DGQA 1NK8A 3DXSX 1JQGA 4I6WA 3AD8C 2C3UA 3SQGA 1YQHA 2DBBA 2J6SA 4J9OA 2U1AA 3DHWC 4Q7AA 3IRWP 4RW6A 4LIWA 2FZKB 1TK0A 2HFOA 3R5BA 4RLEA 2LMIA 4ZN3A 5F9NA 4IDKB 2B5JA 1KBRA 1RTDA 3GG1A 4DCJB 1IM4A 5GMEA 2DPIA 2QA2A 2UV8G 1XMQJ 1URNA 3GLJA 3FRZA 1FTCA 3D2WA 3UQSA 4XIUA 4UT4A 2VG7B 2J76E 1N5YA 2BQUA 2EWHA 1JLQB 1NDLA 2HHWA 2OH2A 1NDKA 2E29A 4FXVA 2OD6A 2E9ZA 2QYCA 4ZHRB 3MCOA 1TR0A 2MJUA 3UWTA 1S9EB 2VPWB 3A8EA 1NK4A 3PJWA 4P74A 5SZTA 5KG5A 1FO1A 4CO2A 3H5XA 2D3UA 1D9FA 1HNIB 4EEYA 3ILIA 2FJEB 1KQKA 3H5YA 3EVMA 1ZA1B 5LXRA 1MNEA 2HRYA 4WP3A 2KG1A 1DTQB 2YNHA 1S1TA 3RG6A 2ALZA 4O44A 4HI1A 3GJRB 1T03A 2YNGA 5DDPC 1HQEA 3MPUB 3BM7A 2JC1A 3ENVA 5KT2A 4CLYA 1UETA 3UVJB 4DL7A 1K1SA 1V6HA 4M5KA 3QRQA 4F8RA 1NK0A 4TYAA 1OPIA 1NRKA 2A3JA 1X31C 3DOMA 2BUNA 2ZKUA 4WFAQ 4JI5F 3NL0A 4QW8A 1NB2A 1N6QA 4DR2F 4A8FA 3IWXA 3SXLA 4ZVTB 1MMLA 1Q5YA 5A8WB 4MFBB 4UY85 3MMCB 4CCHA 4IO9Q 2DTJA 2CZ9A 4IFYA 3I5BA 4ZVGA 4F3QA 2J9EA 1RBOB 4HEA9 3NCRA 4CH1A 3O3LA 4QU6A 2C2NA 2RH3A 1XNRF 5J2PA 2OIHA 2YXLA 3KK2B 5LOQA 5H9EK 1Q79A 3PDNA 2NZCA 2MKIA 1G4CA 5KT7A 5A0YA 3H8YA 1VQ6S 1HBOB 3CJ8A 3ENWA 2VOOA 5F8MA 4Y2KA 4F4KA 1T02A 3GU0A 5I42A 3R6GB 2JJ4D 4ED7A 3LPEA 4B9MA 2IM2A 3M9OB 3WX8A 3CSKA 1CG2A 3W66A 2LXFA 1DQ8A 3TUJC 1NHKL 1X5PA 5D4PA 1FEEA 2DGSA 4KO0A 1CJKA 4YMEA 1FJEB 4TLQA 5LM7E 2VG6B 1JJ4A 3NNCA 1VK8A 3RAXA 1Y10A 1K9MT 3DGVA 1T3NA 2QC3A 3GMGA 3W8PA 5KFMA 4WE1B 3H59A 4ZPVR 3KYLA 1R27B 4F4AA 1TUGB 2YKPA 3NWRA 1FFSB 4C8KA 2DH9A 3MM8A 1VQ4S 2EW9A 1WC3A 4PG6A 5DDRC 1U09A 3GIMA 3QGIA 4DSJA 2V4JB 3L7UA 5FLXY 1Z1ZA 4IRCA 4MTPA 5GMDA 2HS0A 4L3KA 2ASDA 1AUSL 3AA8A 5THWA 2NXNA 2B4PA 2XHWA 3DI6A 3PJ9A 3LP1A 2VJVA 3HVRA 3BSOA 2XLJA 3D0HE 1VC5A 3HFZB 2JH3A 1DZ5A 3BO3A 4ZIWA 3RRGA 3CJ4A 1U7LA 3W63A 3I56S 3C6TB 1GFWB 2B0GA 4L75A 3A8KA 3PYDA 1KS2A 1JKHA 3KTQA 1C1CA 5DG7A 1RHKB 4PEOA 5F41A 2GHVC 5G0RA 3A8JA 2B8QA 2JEIA 3M2VA 2IRXA 4YOEA 1S6QB 3A13A 1R6VA 4V19J 4LFCF 1Y4ZB 2B8PA 1Q1KA 1H7XA 3D67A 3KOAA 2MTLA 3D7SB 5L38A 4GKJF 2G1DA 2MLZA 2JL9A 2G2ZA 4ANDA 4BHQA 3K8VA 1NH7A 4GC6A 3CJ0A 3IG1A 4B3OB 3MMJA 2XNQA 3GV5B 3G6XA 1O0PA 2HVDA 3CCMS 1UJ5A 3MXHP 2DO4A 1CSJA 2O66A 4QZVB 2K7JA 3MD1A 2VQFJ 1S79A 3BBFA 4XPEA 3ULHA 1HYSA 4DUYJ 2XS7A 4FF4A 1R6YA 1JIHA 3B4DA 3W2WA 1TELA 1Y00A 4N47A 4D3GA 4KV8B 1AW0A 3EX7B 4DSLA 2LXIA 2XI3A 1F2HA 4QBUA 3CMQA 1JB0C 3R5AA 1IBKF 4DSIA 1SJRA 2G1HA 1U8SA 2ZFHA 5KG0A 1RAIB 3UI3A 2Q66A 2FYXA 2XY5A 4I2QA 2MY8A 2P9GA 3PFEA 3LO3A 1ZM4A 2GVDA 1RLCL 3Q2TC 4QYZJ 2CQ0A 2QSFA 5A8KB 1LWFB 3KK1A 4EGLA 3JTOA 1X4BA 4CTAA 3OFFA 4DMZA 1FE4A 4M5DA 2HNYB 1FVQA 4JI3F 3KLEB 4DPYA 1RT3A 3L9ZA 1LWXA 1PSDA 1Y5LB 5G4DA 4U9RA 4DPTA 2Y8YA 1R8PA 4AXJA 3GFZA 4LR9A 4TQRA 2ADBA 1RTJA 1NK5A 1KHVA 2H3EB 2CG4A 1VLOA 1J5OB 1LWCB 1EETB 4WFYA 3MR7A 2G2YA 2HQ3A 3MAAB 4GVBA 5L8RC 3MMAB 1IN0A 3QZ7A 3VCDA 3VWSA 1RU1A 1VRUB 2IAJB 1U6ZA 3C16B 3EXCX 4LSZB 3CCES 1SH3A 1BMQB 3SV4A 1T9VA 2HHVA 1TL3A 3HHDA 1WDTA 4LIRA 4E98A 2AJFE 4Y6IA 1NPRA 4FVCA 2UP1A 1TL5A 2CJBA 3TI0A 1V9OA 3QPIA 4USVA 4B02A 4K4YA 1ZTWA 4CP5A 4JI5J 4MKYA 4KSEB 4DR2J 3TARA 1XBWA 3OFEA 2Y3YA 3CJ3A 1JLBB 1TV6B 4OHYA 2DNHA 3VF0B 2AZ1A 1GXLA 2CQGA 2M9KA 4OYMA 1HMVB 3MFHA 3MAQA 2HQFA 1O5JA 1IUJA 5LXYA 3NGUA 3OBIA 2AYBA 1KOHA 1UWBB 1IKXB 2FD2A 3HLUA 5CCMA 3W62A 2OELA 3AXMA 2HIYA 2CQ2A 3CNQP 2EKNA 3PYFA 3M30A 4OX7A 3SSQA 3SQGB 2DXDA 1KQFB 4FPIA 1KVJA 1HQ2A 2QLJB 1FI4A 3RYLA 4OYPA 3S1TA 2VASA 3T3FA 3FC9A 2ZOGA 2RVJA 4NLUA 4DR1F 2RHQB 1GK8A 2B3TB 2LQ9A 4X66J 2DB1A 4KAIA 4FYXB 3KG4A 3HSJA 2WW4A 2Y1RI 1I94J 1RWOB 3OW2R 2DITA 4PQUB 3UW1A 1JLCA 2X1BA 3Q23A 1UCNA 3C46A 1AB8A 2JRSA 1QD1A 1WEYA 2KRRA 2L9DA 3TJAA 1WTBA 2PSZA 1IR1A 3VAJA 3HM9A 2RKIA 5FDLA 3BSCA 4DR6J 1SL1A 1D0EA 2DIUA 3OXGA 4FF2A 3GFHA 4OZ1A 1RT5A 1XWLA 5I3UA 3LOUA 1FNOA 1KP6A 2AJ1A 1HNVB 1S1TB 1HKAA 4R0EA 2KDOA 3QT8A 3MM5A 4OYOA 1FWKA 4X62F 3JXOA 4DV6J 4ZJLA 2YNGB 3CXCR 4PUOB 1HQEB 3W5XA 4NLXA 3KUGA 3K59A 1Q16B 3GZ7A 4OI3A 1H2TZ 2XYHB 3R5DA 1XNQF 2HBYB 3BYRA 1LK7A 5AXMA 3GCXP 3QJJA 2PFFB 5AXLA 5HBMB 2F3JA 3QGHA 2A18A 3DOMB 1LV5A 3LGHA 1FFWB 1YWXA 1SH2A 3FCHA 2C2DA 3FGVA 1VHFA 1W2IA 3BB5A 4LFCJ 3UN2A 3CULA 2KI2A 2BANB 4NXMJ 4ZLLA 2DR5A 3CD0A 2D7SA 3PX4A 2VODA 4NL5A 4GKJJ 4M5NA 2FDNA 2WB1D 1VQ9S 1RWNB 3IC1A 1IKWA 1Y9OA 1FRLA 2J7KA 3V81B 1KWMA 3I82A 5E33A 2IMOA 3W61A 1SC3B 4ELTA 1X60A 2CJAA 3Q0AA 1WKKA 4EZ9A 4ECQA 1GXTA 4IG0A 3D1QA 2A6MA 2LYVA 2H5EA 1RYRA 5CAAA 4FN5A 2QLWA 4QJVA 4K59A 4RNHA 1VBZA 4F67A 3MEGB 3DDIA 4P2XA 1UZHA 5I42B 1KSPA 3V6KA 2KZMA 4OL8A 3B6BA 1YI2S 3HD1A 4NCAA 1IBKJ 2I38A 2EC0A 2VG5B 3L7PA 7FDRA 4KO0B 2CNKB 1H0HB 2NR0A 3W64A 1CJKB 1RT6A 4KFBA 5K9FA 4KHRA 4X65J 4P2FA 1N32F 3DRYA 1IBMF 1EX8A 2GQ2A 4YDXA 5IT0A 4CNZA 2DNNA 1W2BR 5KFYA 3Q8QB 4R5PA 3M05A 4DV3F 2EG2A 3QBCA 4FF1A 2HAIA 5AT1B 2M52A 1HQUB 3MM8B 3MEEA 2AJ2A 4KJIA 4NRUA 4V19X 3MM7B 3QQCD 3LA0A 2H48B 3JAMY 3MR3A 4TNOA 2HQDA 2QL7B 2WW8A 4TN2A 5K20B 1UZDA 3FRYA 5E41A 1K1QA 2V34A 1TUVA 2KG0A 2DIVA 2CJYB 4LVNP 3GR1A 2E5IA 4ED5A 3C19A 1UFKA 2OEJA 1CJUA 3CMAS 3MPVA 1RT4A 4U96A 2QA4S 2Y8WA 4PYDA 4WK3A 1X4DA 4GKKJ 1RTZA 4U95A 4ZKAA 1E6YA 1MG7A 1V3RA 3X1LB 4DV2J 2VFTA 2CPYA 1JKHB 4YY3J 1X4EA 4Y2MA 4J9VA 1OSDA 3RAQA 1TKTA 1QSSA 2UUCJ 5G0RB 3K5PA 3M2VB 1FDBA 2BMBA 3PVXA 2G13A 2D41A 4LF6J 2OEKA 1ROFA 5A2QY 4USHA 2RUSA 3TANA 3HJFA 2F1FA 2B9WA 4RUAA 3UCZP 4XDCA 4K4SA 1F9EB 3L95X 2MSTA 1ZOTA 4ED2A 2CXEA 1WG4A 1FDDA 3HZEA 4IH6A 3PRVA 4NLQA 2BABA 2NUUG 2HRUA 1IWAA 3KLHA 3QATA 3HT3A 1MU2B 3DXBA 4ER8A 3W2WB 3IWLA 5FJ4A 3TAQA 3MD3A 2AJ4A 1YJWS 4M5JA 2ZZMA 2RILA 4Q8EA 2QA4G 2LP4A 1M5KC 4Y2AA 4X84A 3GIKA 4ALZA 1EP4A 2HVEA 5KFFA 3W7BA 1LW0B 1PC4A 4RBUA 3OR2B 5BR8F 2A0FB 2QG9B 3V6HA 3UNYA 4O3RA 1B4SA 1Q53A 3AB4B 4CRJA 4DR1J 1NO8A 3DMJA 2UU9J 2VICA 5D77A 3ISND 3PZPA 3SDEA 3CT9A 2ERRA 3DLHA 3KK1B 3ITHA 3RAMA 3U1LA 1FCAA 3MECA 3PHTA 3DCAA 4WFNQ 3R7SB 1B7YB 3VGVA 3KLGB 2BVZA 3O44A 2Y1IA 1U1MA 2GX8A 2BJEA 4K4VA 2UV8A 1WF2A 1VQKS 3ZZOA 3LW5C 2YKMB 4DOZA 2UXBJ 2LFVA 2Q6BA 4NCGB 1S9GB 4H4MA 5IT9U 2E5LJ 2CADA 2VPXB 4NZ0A 2BR0A 4GVBB 4ID5B 5HATA 4UOGA 3NNAA 1RWUA 3VV2B 5H9FJ 3FZBA 4DV1F 4DS4A 3I0RA 1WACA 2HWTA 1PAUB 1IKYA 1P1LA 1RHRB 3OL7A 2CKWA 3HD2A 3H98A 1EJ7L 2IVMA 4NEZA 2MZQA 3WZ0A 1WJ9A 4HT5A 2F4FA 3HCXA 1U2FA 2FHKA 1VMBA 3TRGA 2FLPA 4F4YA 3BKTA 3PO5A 3A3OB 1ZS6A 4WJBA 1N48A 5E2QA 4N76A 2DRAA 2DXFA 3E01B 4ZP9A 4PG7A 1BD6A 2HHSA 1DBDA 1PJ5A 2IY5B 1RISA 2EFPA 5C24A 1IBCB 1BXNA 2IYIA 2ROPA 2VPYB 2DXEA 4N41A 2M8DB 2Z56B 3UDCA 4PABA 3BQ1A 2AIRB 3B4MA 4YFUA 4JV5F 3DHXA 4OJ1A 3SZ2A 4YHHJ 4N8OA 3OXLA 1VDHA 3FUYA 1WG5A 3WC0A 2QL5B 3ICLA 1X4CA 3D68A 2V5HG 3MM9A 1O51A 4GRSA 2ZUGA 2DR6A 4NYZA 2LDYA 2FHMA 5K8MA 2DNQA 3V4IA 3IP0A 1FKOA 1T95A 1FXRA 5EWEA 4TY8A 4OX9F 4A48A 3Q8YA 5KFAA 1P9YA 4ZPTR 3KDNA 3UD5A 4I4BA 1ZYQA 3OD2A 5IC6B 3KLVA 1FRKA 2AZ3A 1UVKA 4R25A 2HZVA 2EFNA 3W5YA 4DX5A 2DCLA 4G1QA 4DV3J 2OEMA 2IA6A 3GSIA 3HPOA 4ZMMA 1SBRA 1JLEB 2JEJA 2YWGA 4FKXA 2HNZA 1RU2A 2JLEA 2WONB 5IS2A 3IBCB 4A46A 4BDPA 4DF8A 4BC7A 3IAM9 4EI2A 4JI7F 2ZE2B 1S1XB 2W8LA 1HHQA 3BDPA 5B08A 3MPDA 3UNGC 3KG0A 4CO5A 2OJ3A 1YZ7A 3AD9C 3MDFA 2V8DA 3GPAA 1OY6A 2VQEF 4ICLB 1WKJA 4TXSA 2OPQA 1N52B 3G8SA 4OYXA 4JV1A 3M2RB 2NREA 1DARA 3RRHA 3HX9A 2APOA 1DLOA 1TK8A 2BZ2A 2PA8D 4KBIA 2MZRA 3CD7A 1TP7A 1L3UA 4HL9A 2ZUAA 2HFZA 4QW9A 4DL3A 2Z58B 2XMJA 3H90A 4DZDA 4ZVFA 1L3SA 2HK2A 3SSSA 3PFOA 1UJ4A 3IMQJ 3MM6A 1RWKB 2DHXA 3R3TA 1XR7A 3FKBA 1Y5NB 2J8SA 4FZVA 1IQTA 2FHOB 2MKJA 2I9SA 4O0IA 1M5PC 3M8QA 1QSLA 4G1IA 2UUWA 4CLUA 4EBCA 3G82A 3DKDA 2NYIA 2ZJPQ 2RT3A 5KG2A 1AUDA 2CPHA 1ZZNA 4F2SA 1JNZB 5KG1A 2RAQA 4LF4F 1N8RT 1KONA 3CCUS 3PW2A 1TL7B 4U7CA 4P73A 1FVSA 2ILYA 4P2SA 4DV5J 5M2PA 3F56A 2RQ4A 2ZBPA 4LFBJ 2I5JB 2HWIA 1QSYA 4KIAA 5BR8J 1EKSA 1RT6B 4TYBA 1RCOB 2BXJA 1C0TB 1TZ0A 2AEJA 5KFEA 4O23A 2CQIA 4PWWA 2JLFA 4Z37A 3UCUP 2R9LA 2KZZA 3K17A 2LECA 3OVBA 2LXUA 1PYTA 1C0UB 1TKXA 3LF0A 3ZZPA 1YJ7A 1Q8IA 2B4OA 2R8KA 2ZH1A 4MT1A 2NSBA 2MLXA 1B0PA 3NNHA 1VIOA 2AJQA 4HKQA 4DLEA 4ETXA 4OLOA 5CYQA 3OVAA 3KG1A 3EZUA 3RBEA 3I96A 4QIWD 1SI9A 4L74A 1S57A 5JJBA 3TNVA 2CWXA 1TL4A 1OQ6A 4LFAF 5T7LA 2GGPB 1T94A 3C8YA 3HDSA 1CJUB 3P3DA 5ETVA 3M8PA 3NKYA 5GAGU 1OMSA 3NY0A 3SCJE 3EICA 1UEKA 2CPFA 2CAJA 1E6YB 4ES1A 3J7AN 3BH7B 5IFMA 1TMMA 4UZCA 3NRBA 2XQCA 2YQ1A 4DR3F 2E1AA 2KT2A 1HNXF 4IG3B 1S0NA 1RAEB 4QR1A 5I3PA 4IR9A 3K0JA 3BO2A 3EVOA 1SC1B 2OFGX 2IC3B 3OTCA 2WSCC 1I1GA 4F25A 2DNOA 1NHUA 1NK6A 2O01C 3J81U 1U0SA 1HBNA 2Z2LA 1ZTTA 1UTAA 4NEYA 3LP0A 2KXHA 3UN5A 2ZBRA 3SI8A 3QRPA 3DLGA 3ZTRA 1NXIA 4CQ1A 4FNIA 3DRSA 3N5BA 4NLRA 3QRRA 5IM0A 1SH0A 2G9OA 1U1NA 3DRRA 1Y7PA 5HVHA 1CJTB 3RU0A 5ADZA 2CQPA 1LXJA 1NHVA 3GB0A 4IFVB 1JLFB 1MN7A 1CBKA 1KR4A 4OYAA 2VBXA 4FXDA 3OTOF 1Q81T 2BYCA 2ZBCA 1K47A 5ETOA 4RR5A
chains in the Genus database with same CATH topology
5AE1A 3I31A 4OZ5A 4C8LA 2OSQA 4EFAC 3GE9A 3UD3P 4QR2A 4UY85 1ZBTA 2UU9F 1FXDA 1R8BA 3MMCB 1N36F 4U6PA 4MK8A 1WF0A 4CCHA 4IO9Q 2DTJA 2VA3A 3LGNA 4IFYA 3I5BA 1KTQA 2RU3A 2ZKTA 4ZVGA 4F3QA 2VA2A 2J9EA 4YR2A 3RZAA 1RT1B 2DHAA 4Q8FA 4HEA9 3NCRA 5HMWA 4CH1A 2CFXA 1Q86T 4GC7A 1H7WA 3O3LA 5F8GA 4QU6A 1YBAA 4PWUA 4ECSA 2RH3A 1XNRF 2P6SA 5A8RA 1M0SA 2QFJA 5J2PA 2OIHA 1LFPA 4OLPA 3KK2B 4AL6A 4DG1B 1FJGF 1IKVB 4JUZA 1Q79A 3PDNA 3DOKB 4CO4A 3K57A 1UA0A 2CZ4A 4KB7A 1TAQA 4LSLB 1B0TA 3H20A 4Q2MA 3PX0A 3V5RA 4NLVA 2JFKA 4ED1A 2MKIA 1ZM9A 2C42A 5KT7A 1U49A 2KT5A 5A0YA 2BV3A 1XMOF 2GMHA 2KRBA 2DNLA 3H8YA 3HI9A 1VBXA 1M5OC 1VQ6S 1OWXA 1HBOB 2G0CA 3ENWA 2VOOA 5F8MA 2UXBF 4HTIA 5HI7A 2DNMA 1JLEA 4O4GB 4Q0BB 1JMTA 1CC8A 2J0QD 4Y2KA 4F4KA 1T02A 1LK5A 1K0TA 2WONA 1FJCA 2HMIB 5HROB 5I42A 2JJ4D 2DGTA 4ITSA 3HHLA 3P96A 4ZVEA 4ED7A 2IHR1 2KFZA 1H6KX 2NSCA 4B9MA 5HL7Q 4NCBA 3MECB 2V8GA 5DQIA 1YJNS 2E5LF 4DR7F 4F02A 2IM2A 1MMDA 2OAUA 4MYTA 2JC0A 1MROA 4I68A 3M9OB 2C2RA 4RW9B 2K7KA 2RNEA 2Z2MA 3CSKA 1KNZA 2AU0A 1CG2A 2LXFA 4TLRA 3WDOA 3MZIA 1DQAA 4J9RA 5DJBA 5KT3A 5D8HB 3VQSA 1DQ8A 5K8OA 5KFWA 4RNNA 1NEEA 2ZH5A 3QJLA 1F2GA 1NAQA 2ZE2A 4NYPA 1S1XA 2N7CA 1S77D 1VQYA 3I5CA 3M30B 4RW4A 3TUJC 1X5PA 2FJVA 5F8JA 2J0SD 5D4PA 2F4VF 1FEEA 2DGSA 4KO0A 2YH0A 2IM1A 3MCSA 4WKYA 2R7XA 1U1RA 1T05A 1R7IA 1TVRB 4YMEA 1FJEB 4PXBA 4I1TA 4TLQA 2VG6B 4CH7A 4DL4A 5J2NB 3DYAA 1JJ4A 1QJHA 4H4MB 3NNCA 3KNGA 3FFIA 2BM0A 1VK8A 2EFQA 4TKTA 4G1PA 3RAXA 1QM9A 4ICLA 2OD4A 4ZPBA 1K9MT 2QSWA 2PO4A 5D78A 1DTTA 2FGCA 3KJVB 5MLCV 3CDUA 1T3NA 2FJDB 2E9RX 3GMGA 3NP5A 2XULA 2WBRA 4G6VB 2A2CA 5KFMA 2UUBF 2VOPA 2VUGA 4WE1B 3H59A 4ZPVR 3K5LA 3KYLA 2RRAA 4DWIA 1VIXA 1R27B 2LU2A 2ZBIA 2BE2B 3M2RA 2DNZA 5E7OB 5J1NA 2YKPA 3UR0A 2VL1A 4LVOP 3H25A 4M94A 2KHCA 4Y3CA 4C8KA 2J7WA 2KVIA 2DH9A 5I4MA 3MM8A 4FBTA 3MOZA 2HG4A 1YSJA 1SL2A 2MKKA 1VQ4S 4OV1A 1IKYB 5AXKA 2EW9A 2BW2A 2CDQA 2C28A 3D1HA 3KLIB 4XDDA 5J2MA 5F8HA 1JLAA 2JSXA 1JJ2R 5GAEI 4PG6A 5DDRC 2XCAA 1U09A 2OLWA 1H38A 3CVKA 4NRTA 3GIMA 3FQKA 2XY7A 2I0XA 3QGIA 4AE5A 3VAFA 3AQOA 2AD9A 4E8UA 3THPA 2CQ3A 2V4JB 2B7BB 4DSJA 4LF5F 2ZOFA 1I6JA 5FLXY 4Q44A 1YHQS 5L9XA 1U47A 1Z1ZA 3POTA 4IRCA 4MTPA 2GFFA 2HS0A 3S6EA 3W3SA 1J2VA 3CCWA 3I55S 1JLCB 4C0HA 2ASDA 1S97A 4B9VA 1GQEA 1ELOA 4MAKA 5K8NA 2MQMA 3AA8A 3I0SB 1X7VA 5KFLA 5THWA 2VKZG 2HGMA 4DL2A 3SFUA 2EFVA 1WD6A 2B4PA 2XHWA 2J9DE 3DI6A 4C11B 3T1YF 1HARA 3LP1A 5J1EA 3OR1B 3HVRA 1DRZA 3BN4A 3THVA 3PKYA 4H4KC 3BSOA 4R8UA 2ASYA 3W2VA 2XLJA 2RDIA 3D0HE 2HFNA 3O1LA 2D3OR 1VC5A 4WFXA 4Y65A 3V6DA 2JH3A 2RKIB 3CDWA 3NCPA 4AQYF 3BGRA 1ULRA 1AXQA 2KHDA 3CTRA 4I7FA 1DZ5A 3BO3A 4H4OA 2P9CA 2QZ8A 1O8BA 4ZP6A 4DHVA 5HN0A 3RRGA 5FDLB 4QWBA 4EO6A 3CJ4A 3IXQA 3UR3C 1U7LA 3M9MB 4YHHF 2JFDA 3DM2A 3I56S 2CQDA 2O3DA 2OKQA 4RNOA 7FD1A 4NOHA 4IYQA 2KB2A 1RT5B 1XC9A 1U45A 1FK9B 4PRFA 3C6TB 2B0GA 2EKYA 3VALA 1R0AB 5JVGQ 4KKOB 5I3UB 3RB3A 2L9NA 1KD1T 1WTFA 1S0VA 1KS2A 1SJQA 2VBZA 4Y0FA 3LPYA 1JKHA 5KT4A 3MR2A 2D3ZA 4WIIA 3MM5B 1C1CA 5DG7A 3HVWA 3KTQA 4C8MA 1DAXA 1RP5A 5F41A 4IOAQ 4PPDA 1JXLA 2L48A 2GHVC 3G6VA 1CQNA 1P27B 5G0RA 1M5HA 4QIEA 2XLKA 1KEKA 2UXCF 3EPGA 2JEIA 3M2VA 4QIFA 2IRXA 4YOEA 2D9OA 1S1UB 1S6QB 2YKNB 4ECWA 4RBTA 4RNMA 5GAGI 3VQTA 2DVIA 4V19J 3M1VB 1Y4ZB 4LFCF 5L39A 4J9MA 3BGLA 2R7SA 3T5LA 1Q1KA 1H7XA 4J5OA 5KFRA 1BWEA 3FDSA 4DUZF 2FJWA 5IQ6A 4HLBA 1YJUA 1X9SA 5L38A 3KOAA 2R7UA 2I5JA 4LT6A 1KFSA 4GKJF 2G1DA 4OX8A 2JL9A 4ZCIA 4DR4F 4K4ZA 2C3MA 2R4FA 2KJVA 4BHQA 3K8VA 4YR0A 1NH7A 3H2LA 4GC6A 3IGVA 4RU9A 5K8PA 3TOQA 3CJ0A 4C98A 4URGA 3IG1A 4B3OB 2CQHA 2RS8A 3U1NA 4O3SA 3MMJA 1C0TA 2XNQA 3JYTA 4YDDB 2QV6A 3GV5B 4LSNB 3G6XA 5LT5A 4OFZA 3KHLA 1O0PA 4JI2F 4ZDNA 1Y0HA 3CCMS 3DC2A 4DF4A 1D1UA 1H98A 1UJ5A 2AX0A 3MXHP 2V0NA 2DO4A 1APSA 2R2SA 1CSJA 2Z0GA 2L08A 2W4PA 3PIPQ 5E5NA 4B3SF 4GO7X 2Q6CA 1VJWA 3R1LA 3HF5A 5KOXA 1QAYA 2F7VA 1C0UA 4A8KA 2O66A 3ENQA 4ERDA 2M3DA 4PG4A 4DL5A 1X0PA 2M7SA 3J7Z5 4QZVB 2K7JA 3MD1A 1S79A 4XPEA 3ULHA 1HYSA 3EGZA 3IBWA 1TL1A 1M1KT 2XS7A 4FF4A 5M2RA 1R6YA 3CCSS 1RDRA 2CRLA 1JIHA 2M88A 1NK9A 4LMZA 3B4DA 2O67A 2W7OA 3W2WA 5AE3A 3QAUA 4FBUA 1Y00A 3CCZA 1VQ8S 3AAWB 2L41A 1IKWB 4P7VA 3BO4A 2N4DA 1WHVA 2YX4A 4N47A 2YNIB 5K5MA 4D3GA 1WWHA 4KV8B 1AW0A 4GO5X 4IDKA 1FKPA 3EX7B 4DSLA 4CI0B 3KNAA 2LXIA 1RKIA 2XI3A 4PPZA 1KQGB 4I64A 1YJTA 3M6WA 4ELVA 4MK9A 2AP6A 2ZNYA 4M1KA 1VFJA 4QBUA 3HHNB 1RGVA 2FC9A 1IBLF 2CVEA 1W25A 4IG0B 4KGMA 4O3OA 1CC7A 4C0OC 3DLJA 1JB0C 3GG0A 3R5AA 4Y2CA 1MWYA 1IBKF 4IQXA 1FHTA 2PIIA 2ZNZA 2GCFA 4BWMA 4DSIA 4C8OA 1SJRA 2AX1A 1GAOA 1U8SA 2ZFHA 1X4GA 3H2VE 3PKMA 5KG0A 2HHUA 2GGPA 1K0VA 4ZVHA 2OPSA 5DLGA 3DOLA 1D9DA 1S48A 4DQQA 1OPZA 2OMLA 5KG6A 3UI3A 3T9NA 1D3WA 2OMOA 2VG7A 5E3PA 1UKUA 3EPIA 2UVRA 3CMES 2Q66A 5KFDA 1BQMA 3PR4A 1VC0A 2HVHA