3TYTA

Crystal structure of a heterogeneous nuclear ribonucleoprotein l (hnrpl) from mus musculus at 1.60 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
204
structure length
204
Chain Sequence
ADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a Heterogeneous nuclear ribonucleoprotein L (Hnrpl) from Mus musculus at 1.60 A resolution
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein L
total genus 59
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2011-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tytA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tytA01
3SDEB 2FPHX 2CPIA 1YI2S 4CH0S 1A7GE 1OWXA 2CPDA 5DETA 3B4MA 4P6QA 3L3CA 1ZZFA 2DISA 2KVIA 4PR6A 3BO4A 1VQPS 4LMZA 2M2BA 1U6FA 1X5PA 3BS9A 2GHPA 2CPEA 2DGOA 4WIIA 2AYEA 1WF0A 5DM7Q 2NZ4A 3CC7S 3G9CA 1X5TA 2MYFA 3MD1A 1X0FA 3CCLS 1YIJS 1VQLS 1WEZA 3US5A 2OJ3A 2DGQA 2EK6A 1UAWA 3LQVA 3H2VE 3V4MA 1VC6A 1VBXA 2KRBA 1WWHA 1VC5A 3CC4S 1H2UX 1H2TZ 3P6YC 2CPFA 1YITS 2DGWA 4M5DB 3CPWR 1D8ZA 2ADBA 1KOOA 3FEYB 2AYMA 4QU6A 5GVQA 3ULHA 2D3OR 2OSQA 3NNAA 3CC2S 2RS8A 2XS2A 2KXFA 4LJMA 2VOPA 4WF9Q 4C7QA 3CF5Q 2YH1A 2QFJA 4WKRA 4FXWA 2MZRA 2DNOA 1NJIT 2LCWA 3I56S 4QPTA 3SDEA 1QM9A 1WI8A 2U2FA 2DO4A 1RKJA 2OSRA 2X1GA 2DNLA 2E5JA 3LPYA 1R8HA 2PE8A 4C0OC 1U1NA 1VC0A 2HGMA 4OZ0A 1FJCA 2DNNA 1YWXA 1VBZA 2ERRA 2LA4A 1Q86T 3R27A 3VAJA 2MZTA 5LJ5Y 3J7YU 2KM8B 2I2YA 2MZ1A 1WF2A 1CVJA 2CPYA 5HO4A 2KG1A 2X1BA 3CD6S 1JJHA 2MGZB 4IUFA 2KG0A 2MY8A 3CCJS 3S8SA 4TU8A 4BS2A 2LEBA 1WG1A 2HYIB 1KD1T 1WF1A 1HA1A 1U2FA 5GMKa 3S6EA 1R8PA 2M0GB 2DGXA 2K8GA 1VQ7S 5DM6Q 1X4HA 1K8AT 3TP2A 1X4BA 3R1LA 1S72S 1JJ4A 2DNRA 2DNMA 2DHAA 5FJ4A 4W92B 1Q81T 3PIOQ 2KH9A 5LXYA 2N82B 3N9UC 3UCUP 3P3DA 3NNCA 2MJUA 2CJKA 2KYXA 2RRAA 1YHQS 5LSOA 1SJ4P 4FXVA 1OO0B 2MKKA 1VQMS 2G0CA 3SXLA 1U1LA 1L3KA 1N52B 1F9FA 2CPXA 3U1MA 2BOPA 2KXNB 1VQ8S 4WFNQ 2MKIA 3PIPQ 1WHXA 1SJFA 2M4MA 2MKJA 3G4SS 2SXLA 2CPZA 1UFWA 2KFYA 2DNHA 1YJ9S 3EX7B 2DNQA 5MLCV 1Q7YT 3MD3A 5IFMA 2QA4S 2OTJS 2MKHA 1K73T 4YB1P 2KM8C 2EK1A 1X5OA 3UCZP 1P1TA 1O0PA 1U1RA 2M7SA 2ZJPQ 2YWKA 2MQMA 2LYVA 5LXRA 1PO6A 1M5PC 2DHXA 3UE2A 1QVGR 5GAEU 2DNPA 1VQ9S 5IM0A 3S7RA 2DK2A 1IQTA 3MURP 3CCRS 2MB0B 1DBDA 1VQOS 3BEGB 2XNQA 3HI9A 1D9AA 1URNA 2MKCA 2HGNA 2RQCA 3CCUS 2CQBA 5DDOC 2CPHA 1WI6A 2JVRA 3TO8A 1FHTA 4J5OA 2MGZA 2VOOA 2A3JA 2G1DA 2RU3A 2I38A 2KU7A 1N8RT 4LIRA 2QEXS 1U1MA 2KHCA 5ITHA 3G6ES 2M70A 3I55S 4WFAQ 5CA5A 2AD9A 1WEYA 2VODA 4C4WA 2E5GA 3P49B 2DGUA 3UD4P 2O3DA 1U1OA 4TLQA 1KQSR 5GADU 2LMIA 1WTBA 3VAIA 2V94A 2LQ5A 2CQ2A 3CULA 2DIVA 2FC9A 2MQOA 2M88A 2N3OA 3D2WA 2F9DA 2HZCA 1YJNS 2MY7A 2KT5A 2DIUA 2DH9A 3IRWP 2UP1A 2ZJQQ 1SJQA 1PGZA 2DNZA 4OZ1A 3Q2TC 3NNHA 1U6BA 1ZH5A 2MSSA 2MQPA 2DGTA 3MUMP 3R1HA 4ED5A 2LXUA 1XN9A 2J76E 4PKDB 3ZZYA 2U1AA 1W2BR 2DB1A 3MUTP 2LECA 4YUDA 5LSLA 2EVZA 1X4FA 1X4CA 2L08A 2RRBA 2OIHA 2CQHA 1DHMA 2FHOB 3G96A 3MDFA 3ZZZA 1VBYA 1ZZNA 2LEAA 4WCEQ 3CMAS 1FO1A 3Q2SC 5D78A 2DITA 2RS2A 2ADCA 1HD1A 1U1QA 2MMYA 1SJ3P 2J0SD 3MOJB 2E44A 3G8TA 5DDQC 1M5VC 3MI7X 1X5SA 2FC8A 4TU7A 2CQGA 2JWNA 2DH8A 2ZJRQ 2M8HA 3CUNA 3J7ZT 1YTYA 3RW6A 2DO0A 4QQBA 1KC8T 2L9WA 1KOHA 2XS7A 1JMTA 2MZQA 4CQ1A 5D77A 1M90T 1WEXA 2NLWA 3VAFA 3VAMA 2CPJA 1M5KC 3CCQS 3CCSS 4IOAQ 3EGNA 3G8SA 3MUVP 1VQ6S 3CCVS 3BO2A 1FT8A 2BZ2A 2N3LA 2RVJA 4A8XA 3OW2R 5BJRA 3CTRA 5GAGU 2MZSA 2D9PA 2CQPA 2L41A 4F02A 3VAKA 1DZ5A 5H1SV 4TU9A 3VF0B 5JVHQ 2DNYA 3B4DA 2MHNA 1P27B 1M1KT 2CQCA 1S79A 2CQ3A 2RUGA 2KXHA 2J8AA 1X4EA 3CMES 2YH0A 2DNKA 2DGSA 2HVZA 5CXTA 3NS6A 5CYJA 1SXLA 2E5HA 2K3KA 4IOCQ 2WBRA 2MSTA 2AYGA 4QU7A 2CQ0A 2HGLA 1OPIA 2YTCA 2F3JA 1OIAA 3CXCR 2VONA 1SJRA 2MQLA 2OTLS 2JRSA 1N54B 2KI2A 1H2VZ 3DLLQ 3THPA 1WHVA 2M9KA 2Q79A 2CQ1A 3S01A 2MPUA 3JB9k 2B0GA 4F25A 2DNGA 3CCES 2RQ4A 5JVGQ 2XNRA 1UW4A 2J0QD 3VALA 2KN4A 4Y0FA 3NMRA 1G2EA 4CIOA 3SMZA 2M8DB 1K9MT 2XSFA 3G71S 1B7FA 2D9OA 1WG4A 5GAHU 1DRZA 1QVFR 3NS5A 4UQTA 1N88A 1NU4A 1WELA 2N7CA 1Q82T 4EGLA 2LA6A 5EN1A 3RW7A 4PRFA 2KRRA 5DDRC 1VQ4S 3UD3P 2E5IA 4W90B 2XS5A 3EGZA 2XB2D 2MQQA 5LJ3Y 2PEHA 3IWNC 1AUDA 4Z2XA 2MKSA 4WFBQ 1NO8A 3DXBA 3H2UB 2LXIA 1X4AA 2CQDA 3UWTA 3THTA 1RK8A 4U67Q 2X1AA 2FY1A 1A9NB 2CQIA 2AYBA 4RU2A 2X1FA 1WG5A 5IQQA 3K0JA 3VAHA 1UP1A 2CQ4A 3HHNB 1VQNS 3MXHP 2DH7A 2MJNA 1X4DA 3CCMS 2DHGA 1YJWS 1BY9A 5DDPC 1H6KX 3FEXB 1M5OC 1HL6A 1FXLA 1VQKS 2MXYA 1U1KA 4ERDA 3U1LA 2GO9A 2RNEA 3P5TL 4YOEA 2MZJA 3TYTA 2JVOA 4IO9Q 1JJ2R 2F9JA 2LKZA 1HD0A 2YKAA 2M52A 2MQNA 2G4BA 1U1PA 4CH1A 1FJ7A 2DHSA 1FJEB 3UCGA 5HL7Q 1VQ5S 4F26A 1FNXH 2JX2A 3VAGA 3BO3A 1X4GA 2RT3A 4UY8T 4ZKAA 5IM0B 4V19X 2DGVA 1WHWA 4Y00A 1WHYA
chains in the Genus database with same CATH superfamily
3O2IA 3FSIA 1JNZB 4F3OA 1IVZA 4ZP7A 3I5BA 4HKQA 2CPIA 4ZIVA 4CH0S 2IDEA 2V69A 4CNZA 2B8QA 3R9LA 1N5SA 4DJBA 3CJKB 4AL6A 4P6QA 1FRHA 4R0EA 5E2QA 1ZZFA 2C2DA 3W3SA 3GMGA 4CLYA 2RDIA 3BO4A 4LMZA 2EC2A 1HNVB 2R7UA 1U0HB 4MMOA 2N4CA 2E1MC 2PI5A 2D41A 2CPEA 2GHPA 2DGOA 2K2PA 1EHWA 3JTNA 3UR3C 5MAOA 4DUYF 3CD5A 1WC3A 5DM7Q 3DDKA 1ZM2A 2EG1A 3PW2A 3NRBA 2ZH2A 3UI3A 1X5TA 1RTDB 3MD1A 3RUBL 3A1YG 3H59A 3CCLS 2BW2A 4ZHRA 3EZ5A 1VQLS 1VRQC 1KR4A 3MCNA 3US5A 4ILLA 4BWMA 2HIQA 3EGWB 2KZMA 2C2KB 2W9CA 3VQSA 1IBKF 2XZWA 1IBMF 4OX9J 2AZ3A 2RF2B 2E1RA 2XNRA 3BGLA 4M5HA 2J7UA 5J2PA 5HMZA 1SJ1A 1WWHA 1D3WA 3I6PA 5HJXA 3FK4A 1Q4RA 2XHCA 4RW9B 3CC4S 1NSAA 1RUSA 4KV8B 1GAOA 3P6YC 2CPFA 4NLQA 3MEKA 3DLGB 5CH7B 5M2UA 3TUPA 1ZA1B 2BV3A 4JB8B 3PXGa 3VV2B 2HNYA 1YVFA 4Y2KA 5CYMA 3BYRA 2XMJA 4IH7A 3U27A 3FEYB 4KKOB 4DMZA 6FDRA 1MMNA 4CO2A 3MR5A 4EEYA 2AYMA 2NUUG 1NK8A 2HFUA 2NXJA 2YNGB 3CDAA 1PAEX 1RLCL 2OSQA 3N0VA 3ULHA 1LK7A 3M6UA 5C7PA 2RDJA 4Y2CA 3NNAA 4H4KA 4X4NA 1FRLA 1YDLA 4ZVQB 1VR6A 2XS2A 3A3OB 2KXFA 1RXOB 1DURA 1VRUA 2VV5A 4W4MA 2DXEA 4WE1B 3KLGB 2WW8A 2YH1A 3ETMA 2W7AA 4OYZA 3AAWB 1RACB 2R8KA 1T3OA 2RQMA 3VGVA 4DV5J 2Y1IA 4B3SF 4E0DA 1CPZA 4OMFG 2PO4A 3D28A 3I32A 5IV4A 4GC6A 4TVAB 3UPFA 4YQWA 2U2FA 1RKJA 1Y3KA 3BR8A 3ET6A 1JLBA 4EU0A 2GHVC 2X1GA 4ED3A 1S1XA 3MPUB 3PX6A 2XMUA 1JLBB 3GJTB 2DNLA 2C2NA 3DI6A 5GAGI 3PO4A 2VG6A 1NB2A 1DTQB 2K1RA 4FF1A 3DI6B 4NXNJ 2DNNA 3TNVA 2M5YA 1VBZA 2JLFA 2V5HG 4Z7YA 5I42A 2LA4A 2ERRA 4X4VA 8AT1B 1TZ0A 2HG4A 4ZVTB 3VAJA 3V81B 3A4TA 2MZTA 4LFAJ 5LJ5Y 5DG8A 4KHPF 1JJCB 2I2YA 3DRSB 2G2YA 2DCLA 4V1Ak 3E3XA 5IT0A 2O66A 4NI2A 2O1PA 5HO4A 4HHHA 2X1BA 1W26A 4A8MP 1JJHA 2VFTA 4TY8B 2YKMA 4FPIA 1V5VA 5J2MB 4LF6F 3CCJS 3KUHA 3LH2S 2Q1LA 1FRXA 2ZBPA 2LEBA 2HYIB 2OGUA 2OFGX 2DR6A 1FXDA 3BBFA 1FK9B 3NEKA 4ZVUB 2ZH9A 4X4SA 1R8PA 4K8RA 1FDNA 4CM0A 1M5HA 4URQU 3E51A 2YQ1A 3GJQB 1F5CA 2I5JB 5DM6Q 4UW2A 1S77D 1UVKA 1X4HA 4BWJA 1KTQA 1NKEA 4JI6J 4JV2A 3OJUA 2CWKA 1VBKA 4LVOP 2DBBA 3TP2A 3RBEA 1JKHB 1UETA 1X4BA 2UXCF 5I3PA 5L9NA 1WORA 2D74B 2DNMA 1V3SA 2DHAA 1R0CB 2HNDA 1U24A 3AB4B 3BYPA 3I5CA 3LP0B 3MCOA 4FYYB 4IOBA 3M8PA 5M2RA 4J9SA 2RQKA 3I9V9 4DV3J 4CLWA 2VKRA 4RX6A 2KH9A 2VQFJ 2FJAB 1X31C 1N5VA 3JSBA 1CS4A 1XWLA 4F4KA 2KJWA 2YXLA 3HHDA 5CQGA 3HF5A 1FERA 4K5RA 3T19A 1U26A 4HR2A 4KRWA 4IFVB 1IWAA 3P3DA 3NNCA 2MJUA 1JLFA 4ECXA 1YHQS 1XMQF 2AIRB 3MEGA 3MM5A 1RTDA 1TVRA 4ZMMA 3PV8A 3PVXA 3WC2A 1PYSB 2V6AA 1S6QA 3AQPA 3HDSA 4KH0B 3MMAB 2MKKA 2OFHX 1GTHA 3MM5B 3IN5A 1RYSA 2G0CA 3EUNA 3FZBA 4WP8A 4FVCA 1L3KA 4DBQA 2HKEA 1R3NA 2RF2A 3JQJA 5K5MA 3UR0A 1Q5YA 3CJQA 2VICA 3QFWA 3LP2B 4ZVEA 2ZC4A 3CCTA 3TRGA 2GJIA 2OD6A 1KP6A 3DMJA 5AXNA 3CDBA 3KLEA 1NKBA 5JMNA 1Q78A 2A18A 2KFNA 4DSKA 4ZITA 3PIPQ 2WVFA 2FLNA 3TI0A 1O6XA 4MK8A 1MN7A 3IC1A 2M4MA 3R6GB 1T9VA 1TL5A 1KLNA 2SXLA 4EO8A 4BBYA 2HHXA 3NCRA 2CPZA 2V2ZA 3POTA 2NS1B 1YJ9S 4ZVFA 3EX7B 1U0SA 3KJNB 2I0XA 2K7KA 3J7A1 3F73A 3QGHA 3DRXA 5AXLA 3TVYA 3KDOA 2KZZA 3WDOA 1XEZA 1SQEA 3CD0A 3R97A 5IWAF 5IFMA 4F4YA 2OTJS 4XAKA 4TQRA 2MKHA 1VCTA 1N5YA 1B0TA 4ZJLA 1REVB 4PPZA 3ZTRA 3OLAA 5KTQA 2KM8C 2V9WA 1T03B 3GFXA 4J9NA 5GMDA 3U1NA 3ADAC 3HSZA 2E7WA 4WIQA 1P1TA 2XMMA 5IV3A 2YWKA 3RAQA 3F44A 6AT1B 3QT8A 2ZHBA 4IKAA 1IKWA 1LK5A 4I6WA 3KLHB 4DR1F 1M5PC 2NCKL 2Z57B 4RNNA 1QVGR 4OYIA 5GAEU 3BJYA 1H73A 2ZE2B 3S7RA 1BE4A 1QTMA 2DK2A 3CW2C 1KLMA 4U8VA 3ZTOA 4WTYA 2CJBA 1C1BA 2ZE2A 4G1PA 4J7CA 4DL7A 2MB0B 2HMIA 3OHAA 1JXVA 5J2NA 1DLOA 3QIPB 3CD7A 1B64A 2CZVC 1YX2A 3ZTPA 3RR8A 1VJWA 2C42A 3A13A 3OSNA 1Y0HA 4I1TA 3SBMA 4FS1A 2IAJA 1RJJA 3PM9A 2JVRA 1HNVA 2QTWA 5AT1B 3TO8A 2PT0A 4F2SA 1S76D 1VHIA 3DLHA 1VISA 3BH6B 2I38A 3D1OA 1U48A 4LIRA 3QJJA 1WSRA 1N33J 1V6HA 1NJYA 4ZCKA 5ITHA 3G6ES 3I55S 2JNJA 4DXLA 5FLXU 4C4WA 2IBOA 4C8OA 2OMLA 3TVKA 1N5QA 4NCGB 1SIZA 4QW9A 4F4ZA 3SQGA 4WZQA 3POTB 4FXDA 3LGMA 2BYCA 4O3NA 1CJKB 1AT1B 2ABYA 1H98A 2ZBQA 4XPCA 4TLQA 2LMIA 3CJ5A 4B08A 1RT7A 5KG7A 4ECQA 1WTBA 3FVYA 1U45A 5C25B 1T05A 4LIWA 2B4UA 2V50A 2MQOA 1IBLF 3ETOA 4F3MA 2N3OA 2F9DA 1YRTA 4IG0A 2V4RA 4FS2A 3V6HA 3KK2A 2MY7A 3M8PB 1B7YB 2DH9A 1JLGA 5KFIA 4CH7A 2ZHOA 2YWFA 3QATA 5E41A 2YPZA 4DUZF 2R8JA 2E5LF 2WSCC 1CS4B 4OZLA 3UNGC 1NXIA 4OI0A 3NNHA 2KL8A 1K0VA 1NMEB 4NXNF 1JXEA 3BKFA 2JSXA 2DR8A 2BKPA 3AODA 1YJ7A 4ZP8A 3ILJA 1ZAXA 2MSSA 2MQPA 3MEGB 1LEOA 3GR1A 4XK8C 1RHKB 2JH3A 1M1GA 2PA8D 2ILZA 4H4MB 4PQAA 3MUMP 3M4XA 4M5GA 2QLWA 4QWEA 2IYGA 4NEYA 3H25A 3D54A 4PWDA 1IQZA 4E98A 2R42A 1HQEB 1DTTA 2EFNA 2GMHA 2LQJA 4FYWB 2GAHC 4P2XA 3MUTP 1F1BB 5C5JA 1FDBA 4ZK7M 2BE2B 2RRBA 5A6PA 1JLQB 2QSFA 2FJEB 3A3PB 2B4PA 1NZ8A 4LR9A 3CWJA 3W60A 3R7BB 3G96A 1JLQA 1Q79A 2KHDA 3C16A 3DU5A 4QYZJ 2VBXA 1I3OB 3ZZZA 4DOZA 4ZN3A 1S1TA 2HHHF 4LFAF 5A2QY 2Z2MA 2R8HA 2LEAA 1PIEA 2RD5C 2DKOB 1FO1A 2GGPB 4USJC 2ZZNA 2XLIA 2QLBB 2OH2A 1XNQF 1RWUA 3GSDA 3V4IB 3AH6A 3BKTA 1NDLA 4Q5VA 4IDKA 1IM6A 2J0SD 3H5YA 2VQEJ 1WJ9A 4C8NA 2BX6A 4ZLJA 1Q53A 1IBCB 2VG5A 4LR8A 1HNXF 2WOMB 1X5SA 4TU7A 1NK9A 2CQGA 3IAS9 4MKBA 4ES3A 1RT5A 2ZJRQ 5D8HB 4O44A 2K3IA 3CGIA 3I4PA 1NSPA 4EWTA 1D0EA 3ENVA 1F9EB 1VLOA 2IJRA 1KC8T 3M7VA 5KT6A 5GADI 4J9QA 1REGX 4B3RJ 2Z0GA 3MAQA 2B8PA 2YNHA 3VR1A 1HNXJ 1HBUA 2YKNA 4X4TA 1HWIA 3PG9A 5KFMA 4DR5J 5A8RA 2CZ4A 4KGXB 3RAXA 2PMHA 1J27A 4I2PA 1WKKA 4USTA 1NSQA 3T9ZA 5J1EB 3MMBA 3Q0AA 1RTIA 1CLFA 2BACA 4YEAA 2UVRA 5GMEA 1LWCB 2HURA 3R7NB 3CCQS 2DRAA 2WB4A 2XM3A 3T1YF 8RUCA 4CTAA 1VQ6S 3D0HE 3CCVS 3T1HF 2BZ2A 2CG4A 2HHHJ 1S6QB 2CWXA 3GIKA 2W2MP 1NEEA 4A8XA 4ECSA 1JLFB 1Y4ZB 3CTRA 3T9NA 4DF4A 3QJLA 2UVVA 1E6YB 1HMVB 1WUUA 4JI2F 5HP1B 3QAEA 4DQQA 4DN9A 1T95A 2JDJA 4TU9A 3P4UB 3IGNA 4P10A 1SI9A 1UPMB 2EWHA 5A2QU 3HVRA 3HFKA 2CJAA 3TAPA 4RZRA 3R2DJ 2CQ3A 3DN9A 3DOLA 3DFEA 2RUGA 1QJHA 3AY0A 4P74A 2W4CA 4QR1A 2XGPA 3HCXA 3MR6A 1YBAA 2XHWA 1APSA 1Q1KA 1TK5A 3CMES 2H4YB 2YH0A 2W9BA 4U7UD 2JOQA 2DNKA 1WC6A 4CM2A 1C4AA 2GJFA 4IDKB 2HBZB 2FJVA 2I1RA 2DGSA 3N6LA 2XY5A 3NS6A 4JI2J 2Q6BA 4NRTA 4OI4A 1OMSA 2OLWA 5KFBA 2E5HA 1C1CA 3PR4A 4LBIA 1F9HA 1UWAA 4IOCQ 1J5OB 3FC9A 3TZYA 4DQIA 4LBPA 4TN2A 1EAYC 4DR5F 1NKCA 2KT2A 1ACMB 2YWHA 1KTVA 4IFYA 1RT4B 2VONA 1LQ9A 4QYZK 3F41A 3QIDA 4F0KA 3BR9A 3DLJA 2ROEA 4ETZA 5KFFA 1LV5A 1H2VZ 3EXCX 4PWDB 2JEIA 4HHJA 2UXDJ 3L7OA 2YWEA 1WHVA 2Q79A 1S0VA 2VDIA 2CQ1A 4Y2IA 1HWUA 5D0RA 3S01A 3HT3A 1RT2A 2KJVA 4JI1J 4ZVHA 1U09A 2EPIA 4CZCA 3JB9k 2DNGA 3FEZA 3UN5A 2ZH7A 1U4BA 3TA2A 1SH0A 4ZLNA 2RUSA 4L3NA 2B3TB 3GILA 5JVGQ 4F2RA 1UW4A 4X66J 4NLGA 1CULB 2AX0A 1BQXA 2IC3B 4LREA 3DHWC 3I82A 2RIJA 2EBGA 1XIQA 3EZUA 1FE4A 3OR2A 4DF8A 2FJXA 4EK2A 4X4UA 1MLAA 1HI1A 2Y0SD 3LW5C 3QLHB 1UEKA 4H4OB 1SIWB 3H90A 4Q8FA 4KH1B 4LSNB 3NS5A 3GV8B 1N88A 4F0MA 1WELA 2Z56B 1Q82T 4NASA 2LA6A 4EGLA 3DU6A 5A8WB 2ZHAA 4DPWA 3PJWA 2C2OB 4OYMA 5DDRC 2XCAA 1EIYB 2IYIA 4DSLA 3UD3P 3W65A 3M2VA 4I69A 3KXDA 1FCAA 5KFVA 2XQCA 1NK5A 4K4VA 1GEHA 2BW7A 3OUYB 2NSBA 1ZTWA 2R7QA 1NPRA 5LJ3Y 3CDEA 2PEHA 3C2PA 4NLWA 4QIVA 1XMOJ 1DQAA 3QWPA 1TUWA 1TKDA 2A2CA 1RTJB 3IR7B 4NLOA 1NO8A 4WFBQ 1S1VB 2W1BA 3DXBA 2NQPA 5AE3A 3WC0A 3M2RA 4G65A 1Q0NA 2OMOA 1FDDA 2R2UA 3MAAB 1X4AA 2J7KA 1FESA 2J9EA 3GFYA 5KFUA 2LP4A 3EM1A 5KFNA 4UZCA 5ETLA 3RTVA 1LWCA 2R7WA 1IWGA 1A9NB 1JLAA 4ETXA 1FF2A 5EHHA 2A10A 3RYLA 5E5NA 2MLZA 2CNNB 2X1FA 1SV5A 1EQ0A 3MM7B 3KLGA 1UP1A 3J7AN 2CQ4A 2FHMA 3DLKA 2B56A 3QBCA 2XC9A 3HZGA 3HHNB 3KG0A 3HZEA 1DAXA 1DTTB 3KJVB 1E6YA 1HMVA 4DUZJ 3IS9A 2HQIA 4KSEB 1VQSA 3LAMA 1S0MA 3BGOP 2X3GA 1FEEA 1RLDA 1HHQA 1RTHA 3IS9B 5THWA 3OLBA 1BY9A 1SC4B 2FHJD 2WCXA 4IH6A 3VHQA 3EPGA 4ED8A 3W5ZA 3NGRA 4XDDA 4X64J 1M5OC 4NRUA 5GAEI 1VQKS 2DHHA 1U1KA 5B0FA 3EYZA 3OR2B 4OHZA 2QGFB 2RNEA 1EX8A 2C28A 2MZJA 2VFSA 3TYTA 2JVOA 3MF5A 1P6TA 5E7OB 1VQYA 2IJFA 2LKZA 1KQKA 2MQNA 1YRUA 3SSSA 2VU5A 3M30A 4A4JA 1J5EJ 4RW4B 5FLXY 3JSMB 1TUGB 1UWBB 3HKZD 1LOUA 4E8UA 3DYAA 3QAUA 3OXGA 4PQUA 3BO3A 2FHKA 4UY8T 2EKNA 4ZKAA 1FJGJ 5IC6B 4V19X 1FK9A 1S57A 2FZKB 4P7VA 3B6BA 1RWNB 3SDEB 5HMYA 2W8LA 2MQ8A 1Q8IA 2FPHX 4K0KF 2PDAA 3NP5A 2VG5B 5IXUA 3UQSA 3BSAA 1S1VA 1BD6A 1NNDA 3EDQB 1LW0B 4FNIA 2IBKA 4YB5A 3QYYA 2WVEA 2IM2A 2OPQA 3B4MA 3DOMA 3FBFA 4WKYA 3MM6A 2PIIA 3KK3B 2KVIA 4OYAA 1VQPS 4NMXA 2QT7A 2M2BA 1FRIA 4F50A 3EZOA 3DOKB 3SSRA 4EUVA 1NPPA 3DDIA 2EFVA 4L72B 2FIUA 3I87A 4K50A 3KJFB 4BCAA 2W7OA 1YIJS 5B08A 3WZ0A 3V6KA 2BANB 4AD6A 2DGQA 3L4BC 3OTCA 1UAWA 1Y5LB 4OJ1A 3MR2A 1FXRA 3C14B 3M9NB 4B3MF 4NLSA 4KC5A 3V4MA 1VC6A 1EQMA 2XBPA 2BKNA 4DDFA 4FF2A 5LT5A 2KRBA 3BPSP 4CO5A 1H2UX 3T1YJ 1NJWA 3HFVA 4PG5A 1QSLA 3OL6A 4ELTA 3LGHA 2MHEA 1TKXA 2OP5A 3PHEA 2DGWA 2AV5A 5DJBA 4F67A 3GQCA 3G6XA 1TFWA 2P8IA 2FD2A 3CSKA 1ZAVA 4DV4J 2R8GA 2ADBA 2Y9HA 4OHXA 3QZ7A 4DFJA 4KHMA 2HFZA 1HLWA 3BV8A 2PEBA 5JXSA 4FF3A 3KNGA 4OJHA 3H4BA 3CC2S 2HNZA 3LWLA 2VBWA 3OTOJ 1VMBA 1OYEA 1MWZA 1RAEB 4PXCA 2FY8A 4Y6IA 3OJSA 2VOPA 4WF9Q 2K06A 4WKRA 1NK6A 3CMQA 4PPDA 3VTIA 4CNYA 1CJVA 1U2CA 3C6TA 4ED0A 4C8ZA 3AJDA 4MAKA 4AE5A 4DI6A 2F4FA 5HK4A 3OL9A 1OY8A 1QM9A 3SDEA 1WI8A 2DR9A 1OQ3A 2FZGB 1TKTB 2HWIA 4RUHA 3RB4A 2LFVA 4P2SA 4Z37A 1SL2A 2OSRA 4ZJQA 4GKJF 3SEOA 1F2HA 1B4SA 3G8QA 3HULA 4DSFA 2RMLA 1S48A 4C0OC 4ZPVR 2FLOA 1VC0A 2HGMA 2LLZA 4ZOSA 1FJCA 1NZAA 5E3PA 2Z2YB 4KR0B 3LGNA 2OTLS 1MSWD 3TWZA 2ASLA 1FWKA 1WC4A 3PX0A 3UN3A 2CFXA 4Q0BA 2B7CB 1NBEB 2MEWA 4USHA 2GNKA 2AW0A 1PC4A 3FBEA 1D8YA 4P9SA 1MWYA 1RT3A 1UW9A 1SQFA 3DM2A 2AT1B 5LMUJ 2KVQE 4DR1J 4IUFA 1I51B 5EDWA 4UUWA 2MY8A 2KG0A 1T11A 3S8SA 4TU8A 1Q8LA 1WG1A 4BC9A 3Q8UA 3GR0A 3GFZA 4G1QA 1KD1T 1WF1A 3MEDA 1EARA 2FDNA 1U2FA 3E01A 3PFEA 4NZ7A 4OZ2A 4QPXA 2M0GB 4B9SA 3VGSA 4DR3F 4RW9A 1VQ7S 1YLXA 1HNIB 2APOA 1OSDA 4MIAA 1XMBA 3OVSA 4X62J 2RILA 2IDLA 5BYQA 3SFGA 3V5RA 3WHIA 6FD1A 1K8AT 2UUBF 4F8RA 1EKRA 1S72S 2BA9A 3EGVA 1QTNB 2HQDA 2DNRA 2CJYB 3MTJA 4LFBJ 2E7VA 4DR4J 4FBUA 2X7IA 1E6VA 2HLTA 3UDVA 3J80U 5HMXA 1FNMA 1HBOB 2H1YA 1PSDA 4C97A 3OPKA 1JXLA 2GQQA 5FJ4A 1Q7LB 2BMBA 2FTRA 2NUHA 2V63A 4O4GB 1C0UB 5KG0A 1R0AA 1VGYA 1RT1A 3DC2A 2XGQA 3SV4A 3N9UC 2XULA 5DGAA 1N5YB 4FF4A 5ETMA 2KYXA 1RT1B 2EKYA 3Q8VA 2RRAA 1MNEA 4ED5A 4NLYA 5LSOA 1CSJA 7FDRA 1SJ4P 4FXVA 4MIWA 3BN7A 1HHTP 4ANCA 4AXIA 1PC5A 4B9UA 2LU1A 5DQGA 4YS2A 2QA4G 1XTZA 2CPXA 2AEFA 4PYAA 2CADA 1GH8A 4ELUA 1VQ8S 2I6WA 2E9RX 2MKIA 3RAMA 1RDRA 2F65A 4YR0A 4GVBB 5RUBA 2OPPA 5LSRA 1YKWA 4LR7A 2ASJA 4J9PA 2J8SA 1NDCA 2B7BB 3QJPA 3PTWA 4LF9J 1CQNA 3AOBA 3H5UA 2KFYA 3H4DA 3HM9A 2PN6A 2HFVA 1RTHB 1FI4A 4WXOA 2CXEA 2YNFB 4N5SA 3BQ2A 4ED1A 3NG8A 1JNRB 3PNIA 2AHOB 4DUTA 4USIA 2YVSA 2KO1A 1WSVA 2V8HA 4DPUA 2UUCF 3NMAA 1VK8A 3P8BB 3VGUA 2JEFA 1FDAA 3GWCA 3VQTA 4K4XA 4USKA 3M2UA 1KRPA 2ZUGA 3J80Y 4LF7J 4JI1F 3QRRA 4I4BA 2HHUA 5HVHA 4JYAF 2CYYA 4NLVA 3KNAA 3ZO7A 4RPFA 1RWKB 2QMUB 4MT1A 4P72A 5LXRA 3TQ1A 4LF2A 2FVSA 5IWAJ 3HKWA 3NOCA 1PO6A 4QCLA 3BH7B 3F0NA 3LPEA 3OXLA 3OV7A 4P75A 5KFRA 1N32J 2DNPA 4RUAA 1VQ9S 2V8GA 4ZP9A 1YJTA 2WRMA 1IKXA 4U7CA 3KWMA 4FPRA 3MURP 1HBNB 3CCRS 3OR1A 1GMUA 5HVGA 5IT9Y 1TL1A 2FJBB 5A8RB 4UT4A 2J9CA 1F6TA 3QWUA 1HBUB 2YKNB 4FP9A 5HVFA 1YJVA 5C24A 1NM2A 1YK9A 3RG6A 2MKCA 4OIXA 5DDOC 5C42B 1TVRB 3G6YA 3O5TB 3JSRA 5LL6d 2BBEA 1EKSA 2RE1A 4M5IA 4PCQA 4WU2A 4DV0J 2JEGA 1SQGA 1UJ5A 3K8VA 5A6WA 5C42A 5K8PA 2FVPA 4LFBF 2VOOA 4Q0BB 2V2QA 2A3JA 1OPZA 3AJ2A 4DR2F 3DHXA 1N8RT 1GX5A 2VDHA 1LWFA 2HWTA 3DKDA 4NYZA 1QAJA 4M5LA 1XNRJ 3EMTA 5L8RC 3UVJB 2VD3A 4GVBA 4RLEA 4WFAQ 5HLFB 4HT5A 2AD9A 1KWMA 1OSCA 3BDPA 3P49B 2DGUA 4NA3A 4PG8A 5I42B 5CABA 2RHQB 1NDKA 4Q2MA 1L3SA 4IQXA 2JFDA 3IM8A 4IRCA 4A8FA 2Y8YA 1BQNB 5GADU 1NK7A 4DSIA 2RKIA 5CHCB 5ETSA 3MZIA 3V6DA 2CQ2A 1XR6A 1CQMA 2DIVA 2OHDA 1FKOB 1RZMA 2M88A 2UUWA 5L39A 3D2WA 4YHHJ 3BF4A 1YJNS 1U49A 1LWXA 1L3UA 2DPJA 3I4HX 2DIUA 3VVTA 3D6HB 2C3MA 2ASYA 4NI2B 2ZJQQ 1HHSA 1SJQA 2DNZA 4OZ1A 3TR5A 4M94A 4YY3J 5I3UB 1C0UA 2RRNA 1W2IA 4DN0A 3QT5A 1CG2A 4DX5A 3NLCA 2YKMB 3RZAA 1RAHB 1AYEA 4B3RF 2B6AB 1LW2A 3BBBA 5D4NA 3TOQA 4HTIA 1TMJA 3CIMA 5AJ3J 4QWAA 1VOMA 4HHUA 4O3QA 3R1HA 2YX1A 3NY0A 3MFIA 1CC7A 4PKDB 3LO3A 4F4AA 2CVEA 4XDCA 3UDEA 2VFUA 2B9WA 3O3LA 3AFGA 3M6WA 3A8EA 4BHQA 5KT5A 4UQGA 4A8SA 1JB0C 3AT1B 2GIFA 4DV6F 2B5JB 3WX4A 2P9EA 5B0GA 4YUDA 5LSLA 2L08A 2XMAA 4DR2J 3KLHA 2UXBF 2KFZA 3I0RB 4DG1B 4M5KA 3EVMA 2HWHA 1HWKA 2CQHA 1HNWF 1N6QB 5EUHA 4I2PB 3WX8A 2FLPA 4ECZA 1VS3A 3PEHA 5KT7A 4KE5A 4I7FA 4GKKJ 2IAJB 3QO9A 3JAMY 2BE9B 1BXNA 2E9ZA 3O1LA 5EX0A 3W63A 2ILYA 4DV4F 1L3VA 3ZNUA 2ADCA 5E3CA 2JZ5A 4AL5A 2ZFHA 1WKJA 4DR4F 1AFIA 3FMWA 3HVTA 4ZPBA 2F4VJ 3MOJB 1HIYA 3QGIA 5HN0A 1TV6A 2WHOA 3N6MA 2CZ9A 3Q8YA 5A8WA 5DDQC 3G8TA 1ZTTA 1HWLA 4JI7F 3K5PA 4C8LA 2ZKUA 3MI7X 4ZPAA 3DDNA 5J1PA 1TV6B 3FCVA 1M0SA 2WSFC 3CJ3A 3N01A 4RW8B 5DZ7A 2JWNA 3KK1A 4ER8A 4KFBA 4CLZA 3ZNJ1 4YR2A 2UUAJ 1VK3A 4WFZA 1MROA 4ZN1A 4DLGA 4B3MJ 1YTYA 3TJAA 5F0WA 2DO0A 3R3TA 2BQUA 4U7UK 3DLBA 5ETKA 1U8SA 1SL0A 1JMTA 2MZQA 2XS7A 4HDGA 4ILRA 2IMOA 1F3VA 1R6VA 2NLWA 3OR1B 5IQ6A 1I5OB 2BQ3A 2QA2A 4LF5F 3FNNA 5KFZA 1ZETA 2DJWA 1UMJA 4DL4A 1VRUB 3H20A 5HBMB 2DEIA 4X84A 2UXCJ 4CCHA 2C22A 3MEEB 3EGNA 1SC3B 3CCWA 3MUVP 3BO2A 1FT8A 1UZHA 1NB7A 4U96A 1U47A 3FRZA 4ZPWR 5EX3A 5IZHA 3OW2R 2R3VA 2ACMA 2HEKA 2YNIA 1RU2A 4J9LA 1HNWJ 4MK7A 2RDDA 2Q6CA 2CQPA 4LQ9A 3PHTA 3W61A 1BMQB 2QC3A 2G2OA 1D9FA 3G87A 1N4LA 3VAKA 3OTBA 4DU8A 1PBAA 2YWGA 2DNYA 2K1RB 1DTQA 1V9OA 2MHNA 3W5XA 1P27B 4FDFA 5AE2A 1FKAF 5JJBA 1S79A 3BGRA 3GV5B 5DZ6A 2KB2A 2KXHA 3SI8A 1KLMB 3ZXWA 2NYHA 2C2EA 1MG7A 1CJUB 3KKFA 1X4EA 2GFFA 3QT6A 2XLKA 4I6YA 4ANEA 4U9RA 1DLOB 2B43A 5A76A 2VJVA 3SCLE 2MDAA 3R5BA 2Z2ZA 2BOAA 1IM4A 1YZ7A 3A3NB 3IR6B 3ZZUA 3HPOA 4CO0A 4UOGA 4N8NA 1GTEA 3JS9A 1TL7B 2HVZA 4NE9C 2DXDA 4AYBD 1SXLA 3Q8SB 4F4WA 4DLEA 1SKWA 5CXTA 2K3KA 2GGPA 3M05A 1TP7A 1NRKA 4PXEA 3TANA 5F8LA 2HGLA 2VASA 3M2UB 3X3UA 1FE0A 4QWCA 2LEPA 4I2QB 2ZM6J 1RWPB 4H4KC 5J2PB 1LW2B 1UJ4A 2BJ1A 3CXCR 4AT1B 5J2MA 2W9AA 1HKAA 1S6PB 3K89A 1CJTB 4L6V3 3BQ1A 1KDNA 4F04B 2OKQA 4JI8J 5FD1A 4GO7X 3DLLQ 3CEDA 3CO0P 2V0NA 3KG1A 4Y65A 3J81U 1SB6A 2B9EA 2V67A 1AA1B 2GMJA 1PJ6A 1YSJA 3GIJA 2B51A 4AQYF 4ECYA 1FFSB 1G3OA 4WPAA 2LVWA 4AFFA 3WBZA 2HK3A 3RBZA 1RBOB 4L74A 1S6OA 1T0TV 3I96A 2EFPA 3FBCA 4M5DA 3PKYA 3KK3A 1Z1ZA 2HRTA 2L9DA 3M32A 1N34J 4X4PA 1JLGB 1KHWA 4L76A 2VIHA 1X9WA 2AF6A 4TY9A 4YN3B 1MMLA 5J1EA 3SMZA 3R8YA 1K9MT 2XSFA 4WYWA 5KFLA 2DEJA 1UEUA 1B7FA 3IM9A 3B78A 3GP9A 3HHKA 1QUVA 3RBXA 1WG4A 2W2NP 3D6TB 5IC4B 3KFWX 3M9MB 4DV1F 4LFCJ 1TAUA 1R43A 1NU4A 2N7CA 2VJUA 1H72C 1R8AA 3DLKB 3RW7A 5HP1A 3LA0A 1YBTA 2GJ2A 4K4TA 1G6BA 2KRRA 3K2YA 2BE2A 2QE5A 4F4XA 2HHVA 4X2BA 4G6VB 4W90B 4I67A 1X60A 4DL6A 2YKOA 1HW9A 3MMAA 2HS4A 5KFAA 4C2MA 1TK8A 2V8PA 1HYSB 2B9XA 3JAMU 1K47A 2VUGA 3K5NA 2MKYA 2BQRA 2XB2D 1EZZB 2NXCA 2W4DA 1RBAA 1TR0A 1O8BA 4URGA 5CYQB 5HAOA 2MQQA 4PUOB 3IWNC 4ZJOA 4CO1A 4N56A 2FQQB 3DRSA 5DRKA 2FVQA 4JI5J 3FSXA 3ZZTA 3PRDA 1VQ5S 4QWBA 3NGUA 4J9OA 3NWGA 2KKHA 3PJ9A 4LSZB 3V6DB 1VDHA 2CQDA 2EC0A 5B0BA 4IYQA 4E2FB 2JC0A 3TARA 1RP5A 2CRLA 4U67Q 2AQ4A 2VB6A 4I68A 4YMEA 4ZCMA 3M8ZA 2ZBCA 4UZBA 3GCXP 4M95A 3B8HA 3KLVA 4PQUB 2PFDA 1PKUA 3H40A 3IBFB 5IOLA 2AYBA 2E1CA 4RU2A 4DL2A 2FZCB 4LSLA 4WZMA 2I5JA 4Q7AA 4XO0A 4LF9F 3K0JA 1TAQA 2H65B 2FUG9 4OX8A 4HTJA 2WOMA 5LM7E 2DY9A 1UJ6A 2HSEB 2GVDB 1S9FA 2AJQA 3PW7A 4IFYB 3LUYA 4NLUA 4JV1A 1Y7PA 1FTCA 3CVKA 5BYSA 4KGKA 2BM0A 2HNDB 1GNKA 3LP0A 1FJGF 1IKWB 4Q43A 5DDPC 3FEXB 3H0PA 4YP3A 1XNRF 1FXLA 2F4VF 3MECA 3W66A 4ERDA 1X7VA 3U1LA 1D09B 1DARA 3HP6A 4U95A 4YOEA 2BJ8A 3CDUA 2HK2A 1RTIB 4IO9Q 1RABB 4ZVRB 4DPOA 1LXJA 5KFJA 1JJ2R 1HD0A 2IC3A 3GJSB 4NA1A 2G4BA 1U1PA 4CH1A 1TL7A 2GC8A 3T6JA 1GMWA 3HVTB 1Y9OA 2C3OA 4ES2A 4DQSA 2Z2LA 5E3RA 3UCGA 5HL7Q 2AJFE 3KLFB 1I94F 2ACYA 1GT8A 2AMCB 3MM9B 3MM8B 5F0UA 2QL9B 5KG6A 4F26A 1FNXH 3QQCD 1S5ZA 1L3TA 2DGVA 1WHWA 3V6JA 2OPSB 2F8MA 3BREA 3PRVA 2OPSA 2R2RA 1FKPA 1Q8BA 1HWJA 1OWXA 2RHSB 2CPDA 5D0HA 4C3MA 1GX6A 2IFXA 1J5EF 4EZ9A 3R7SB 1AFJA 5GAHI 4DV5F 2XZTB 5C25A 4KFBB 4C0BA 3L9ZA 4B3SJ 3L3CA 2BUNA 2HNYB 1IBKJ 2WW4A 3ENWA 2X3DA 4Z7CA 1UA0A 2F1FA 1JK9B 1IBMJ 4OZJA 1CJKA 1U6FA 2J6TA 3KK2B 5IT4A 1J5OA 5ETQA 2W8KA 1FTRA 2V8DA 1U02A 4OLOA 3W9HA 3QGGA 4WIIA 1N32F 3H8YA 2UXBJ 4M5JA 1RWVB 4O3SA 1N0UA 2NZ4A 2ATCB 4J91A 2QG9B 2MYFA 2QN6B 4RKUC 4TYBA 2ZEJA 1F5BA 4NPOA 3Q24A 1X0FA 2QV6A 1ZA2B 4IRDA 4FKYA 3PACA 1H74A 1R7IA 1SV5B 1ULRA 1TKZA 5CZVA 1X9SA 5HMWA 2IA6A 5D3GA 3FCHA 4JI5F 3LQVA 2HFNA 3GB0A 4NA2A 3H2VE 1F2GA 1IJEB 2BVZA 4K4ZA 1VBXA 5LMNJ 3MGJA 2Z58B 3TAMB 1HQEA 3DCAA 3K5MA 1VC5A 4EMDA 2ZOGA 2P9GA 2G13A 3M8WA 3UFCX 1HYSA 3KHLA 2HVIA 2XYGB 5B7WA 4USMA 1D8ZA 3UW1A 4DS4A 1MWQA 4LQ3A 1R31A 1WOOA 3NWRA 3Q23A 1KOOA 4DHVA 4MKAA 3C15A 3M8RA 2HPUA 2YKQA 4KQZA 4BLGA 4RNFA 4QU6A 3B54A 3R5CA 1T9UA 4AXJA 2ATLA 1FRJA 4H4OA 2JC1A 2RS8A 4OV6A 5DS7A 3NL0A 2E66A 2IRXA 4AUKA 4ENOA 4C7QA 3CF5Q 4B17A 4FXWA 2XMVA 2DNOA 2HBRB 3DRRA 2R7XA 2LCWA 5B0AA 1HNZF 3EE3A 2QLXA 2XTJP 2H5IB 1TL3B 2AEJA 4QPTA 3CJSA 2NPFA 2DO4A 2ZOFA 4N41A 2LU2A 3J7YI 2DYAA 5M2PA 3MCMA 1RCXB 2XMWA 1A0OB 2GW8A 3T5HA 4F0HA 4C3LA 3K57A 2R8IA 1U1NA 3VVUA 2D3OR 4TYAA 3QFHA 2AX1A 2NXNA 3T1HJ 4DL0C 5F9NA 1YWXA 2YNGA 5HQLA 1TELA 3UD5A 5KOWA 3MHYA 1Q86T 1IKXB 2HIYA 1BC6A 4JV5J 1H0HB 2E1AA 4CLFA 1UVJA 2MZ1A 4P52A 5J2NB 5L1KA 1S97A 3MECB 3IG1A 2C3UA 4PWUA 1CVJA 4DZDA 2KG1A 1ZS6A 4HACA 2UUBJ 3TX0A 1UKUA 4J9VA 3CD6S 4A8KA 2BANA 2W2OP 3FQLA 1TQLA 2FHJA 1Q5VA 2QMXA 3KG4A 4O3RA 1P8GA 4OZNA 4P7TA 4DSJA 2ZH3A 5ETRA 4ECUA 4WK1A 3KJVA 4A47A 2HLUA 2XEXA 4WFYA 1MW7A 2HFOA 3DLEB 3W1YC 4ATNA 4C48A 2BJEA 4CTAB 4HLBA 2R7TA 3DGPA 4B3TJ 2VQFF 1VYAA 2VPWB 2E29A 4KPCA 4CDIA 4F36A 1FD2A 1UEVA 2YY3A 3BQ0A 3FRYA 1NLKL 5LMUF 4DFKA 1B0PA 1FFGB 3CJRA 5KFHA 1WD6A 4J9UE 1LWEA 1U6ZA 1V3ZA 1EB0A 4USWA 2D3UA 3UNYA 7AT1B 1XNQJ 1A6LA 4ZCLA 4GKJJ 1S1TB 3RU0A 5H9FK 1C0TB 5KFOA 3HX9A 1JIHA 3ISND 3PIOQ 4AL7A 2I8EA 4NX9A 1FKOA 4QW8A 2FVRA 4C8YA 4B3TF 5LXYA 3OL8A 3GZ7A 3JSMA 4HH0A 1RSCA 4GC7A 1WC5A 3JSYA 1NPKA 4M63A 2XG8A 2LDYA 3T5KA 2UUAF 1KHVA 5DO2A 5E33A 3TAQA 1C4CA 1OO0B 4EYHB 5KT4A 5E3AA 2HVDA 2PMZD 1VQMS 3BGFA 2BRKA 3R5DA 4ID8A 3HHLA 1Y11A 4MFBA 2AGQA 1F9FA 3HSDA 2BOPA 2KXNB 2MLXA 3IBWA 5F8JA 2UXDF 3Q8PB 4KGVB 2J5AA 4X4QA 2J9DA 1SPBP 3JXOA 1WHXA 5E0OA 5C2CA 2ZITA 3NKYA 3LOUA 1I6JA 1VIXA 2HHTA 3Q8QB 2MKJA 5DQHA 3D68A 2ZWPA 3G4SS 2NXUA 2C2ZB 4ZVPB 3KUGA 2UVWA 4IR9A 1UFWA 2CNOB 2DNHA 2QA1A 4K5SA 5HATA 3C6UA 4XTTA 5I3QA 4RW7B 5K8NA 3C66A 3PYFA 1V3RA 4IRKA 2NYIA 2HMIB 4J90A 2G9OA 2C3YA 4LRBA 4HI2A 3KHHA 2ZH4A 3M9OB 5F8GA 5K20B 1RI7A 3Q89A 4O23A 4LBHA 4KT0C 3H42A 2QIFA 3AD7C 2XWYA 1XK8A 3H7HB 3HVWA 3K8WA 3PW5A 1VJQA 3DLEA 3RGIA 1KEKA 1JLCA 5JUMA 4YB6A 5DG7A 4YB1P 2QX0A 3W5YA 3OVBA 3UVJA 2CNKB 3QRPA 4ZVOB 3UCZP 2DXFA 2XYPB 3JYTA 4A48A 2M7SA 3UDLA 3DMJB 1NAQA 2ZJPQ 2MQMA 2V4JB 4GMKA 4URSA 5CD4A 3BBCA 2UUCJ 1HNIA 1RWMB 3CJ4A 2BKOA 4NLRA 4ALZA 2DHXA 3HK2A 3H5SA 3ITHB 1OJ4A 4IQMA 4EI2A 3TUJC 5ETTA 5HQ8A 1YGYA 2JJ4D 3ITHA 1FVSA 4USUA 3K59A 2A6OA 1VQOS 3IGVA 1T05B 5J2QA 2ZBIA 1K1QA 4JI6F 4B3OA 1D9AA 2HNZB 2VKZG 3I9ZA 2QZ8A 3VZIA 3QSYB 2XLJA 1KNZA 1RE1B 2WBMA 3D3BJ 2CQBA 5KG1A 3D3CJ 2CPHA 2ZNZA 3T1AA 4X4RA 3CCUS 1WI6A 1QAXA 1S99A 2CKWA 2DY1A 3RB0A 1TKTA 2ZZMA 1FHTA 2H48B 5H9FJ 3UN2A 1T03A 3FDSA 3MAAA 2L48A 3BZQA 2G1DA 5KT2A 2RU3A 1WC1A 3FSYA 1R27B 3CB4A 4Y2MA 3TA1A 5F8IA 1U1MA 3G82A 2KHCA 4PG7A 5D0GA 5K14A 2L41A 5KFDA 3OBIA 5SZTA 1WEYA 5BYRA 3NGDA 3G6VA 2E5GA 4OYXA 2W24A 1NK0A 2O67A 3JQMA 3R5GA 3EJMA 4QZVB 4DV0F 3UD4P 1NJZA 1X9MA 2V68A 2VPYB 2O3DA 2W25A 3SQOP 3I0RA 3ILIA 4DG1A 1U1OA 3DNCA 3O6QA 5D0EA 1KQSR 2VG6B 4LF6J 3L7PA 1BGXT 1XC9A 3VAIA 2A1BA 1V5IB 2OPPB 2W4PA 3SCJE 3CULA 4Q45A 2HW3A 1RWXB 4ID5B 2HZCA 4HH1A 1YQHA 3GU0A 3RJMB 1NUEA 3CO9A 3MR7A 3W62A 3IRWP 2FJDB 2UP1A 2VC1A 4RU9A 3Q2TC 2HVHA 4FKXA 2O5DA 4LF8J 2R9LA 4DQPA 5KFYA 1S12A 4X62F 3D9BA 4TQSA 3JYTB 4NL5A 3EDRB 1U6BA 1ZAWA 1ZH5A 5F41A 2WTFA 3VGTA 1UWBA 2G0IA 2DGTA 4UF4A 1RWWB 3FMBA 3TA0A 4YDXA 3KHRA 2GS8A 1SKSA 1C2PA 3PY8A 1VRTA 3EWGA 1XN9A 4LVNP 1RAJA 5KFKA 3GFHA 5CD4H 1N34F 2FGCA 2J76E 2XO7A 5ETVA 2WAQD 1CJTA 2Y1LB 3AOCA 4NCGA 3ZZYA 2QLFB 3HXMA 3U7JA 2U1AA 1W2BR 1BWVA 2DB1A 4KKOA 5FDLA 1IKYB 2LECA 5KG4A 4QOTA 1X4CA 4MYUA 1IR0A 3IRXB 3PO5A 4OHYA 3EVOA 1TMMA 2RU9A 4JYAJ 4O4GA 4CLUA 2OELA 4Y2AA 1QUPA 4OJGA 3QRQA 4LF7F 1CBKA 3VWSA 4D3HA 1BWEA 1XQIA 2F8HA 2DTJA 2GQCA 3PYEA 3TZXA 2ZDOA 4LF1A 1ZZNA 4WCEQ 1DFDA 2JFKA 2GIRA 2ROGA 4DPXA 2OEJA 1XBWA 2J9DE 2HFSA 3Q2SC 4QR0A 5F8MA 5D78A 3M8SA 2RS2A 1RHJB 1U1QA 2MMYA 1LXNA 4YHHF 4ED7A 3IR5B 3PCOB 1S1XB 4HEA9 1FRMA 1QE1A 4NOHA 1PG5B 3LWMA 2HQCA 3ENAA 3VZHA 1KKHA 1UL3A 4UOHA 1B99A 2RAQA 3OTEA 2DD8S 1LKZA 1JWWA 2DH8A 1D1UA 5HLFA 4PXBA 2NREA 2M8HA 4PAAA 4JUZA 3TVZA 2R2TA 2FGOA 2IVYA 3CUNA 1UVIA 3J7Z5 1DQ8A 3MTKA 5KFSA 4O3PA 4DPYA 3KLEB 2L9WA 2E9TA 1IXKA 4FVMA 1N56A 4DFMA 5EWFA 5E3QA 4OFZA 4CT8A 4MJKA 1RHMB 5HSPA 4S0MA 3DRYA 1RTZA 3L95X 2CA9A 4KYZA 1R0BG 5D77A 4N47A 3ZZ0A 1UA1A 1SCJB 2VG7B 3A8IA 4OX6A 3W8PA 2ZH8A 2VPZB 2QL7B 2W01A 3NAHA 2CPJA 3PRBA 4LRDA 1YZ6A 1KVIA 2Z8QA 3I5AA 3CCSS 3GPAA 2GX8A 5D15A 4TY8A 1KFSA 3G8SA 4IOAQ 3OFHA 3RBDA 1YJUA 3WIVA 3TJ9A 1AW0A 1HI8A 2BDPA 5T14A 1UVMA 4C3KA 2N3LA 2RVJA 4WWSA 1HFEL 3HHEA 5BJRA 3GV7B 3AB2B 2ZZTA 4NYOA 3T41A 5GAGU 1FNOA 3A12A 4L3KA 2ZH5A 5G0RB 3I0SB 4P73A 1IBLJ 4N8OA 2KYZA 1WNEA 1W7WA 5L1LA 2N7YA 2Z4PA 3T3FA 5H1SV 2FJWA 3I0SA 5JVHQ 3B4DA 3OFGA 3GIRA 4MFBB 4WP3A 2HHWA 2CQCA 1KQFB 1FEHA 1ICEB 3ILOA 4OI3A 1GMWD 4PABA 1XMQJ 2Y1RI 4DCPB 2ZVIA 2WSEC 3GJRB 3L7UA 1KFDA 2ZWOA 3QMQA 2IRUA 4NCBA 3KOAA 1CEZA 1YRXA 3KLIA 2CAJA 3N4WA 2UU9F 1FX2A 1R8BA 4IH5A 2P2CB 1WC0A 4QIWD 4HVZA 2ZOMA 1H7XA 2MSTA 4U6PA 4QU7A 2HBQB 4WYLA 4G1QB 1P9QC 3IA0A 4KO0B 3MAHA 4DR6J 2JL9A 1LFPA 2F3JA 2D3O1 2AWZA 1OIAA 3LP1A 3Q83A 3K5OA 4W98A 3IFEA 5K8MA 1AZSA 1ROFA 4MYTA 3MM9A 2JHEA 1QY7A 2MQLA 1Q16B 2QO3A 3LP1B 2VH7A 1YJRA 2JRSA 3LP2A 3KYLA 1WOPA 1M1KT 3R2CJ 4RW8A 3KK1B 4EBCA 3KTQA 4PUOA 3DLGA 1FX4A 2P6TA 5HROA 2MPUA 2AU0A 2NR0A 4MIBA 1EJ7L 4NEZA 4M5NA 3OUYA 4K2XA 2VFVA 4F25A 5BR8F 3CCES 5B0EA 4Q44A 5T7LA 1RT6A 5KT3A 2QRRA 3VCDA 5I3UA 3NXZA 5J2QB 4NWBA 2EG2A 3MMCA 2B4OA 2R2SA 3D6MB 2R7RA 1VQ4S 5HBMA 2KN4A 3D0GE 2UV8G 3VALA 4Y0FA 3RB3A 3NMRA 2Q43A 2B6AA 4ZPDA 1F5AA 1RADB 1RA7A 1TUVA 1Y00A 1NHVA 2PGCA 5ETNA 3J81Y 1S6UA 2ZH6A 1PJ7A 1K0TA 3BDEA 4TNOA 4K4UA 7FD1A 3BKUA 1REVA 1SH2A 4KPYA 1VI7A 1QVFR 4JI0J 4WU3A 4C98A 5KG2A 3GG1A 1TKZB 5EN1A 2F8EX 2IJNA 2LQBA 1L5UA 2WVBA 4DUYJ 4C8KA 1DY3A 4DV7F 2DT9A 3MM7A 4EBDA 3HLUA 2XI2A 3TQEA 2HAFA 2YNIB 9RUBA 1T9XA 4DL3A 2HBYB 2XS5A 3TEHB 4RR5A 3HD2A 2FB0A 2YX7A 3MR3A 1G7CB 1UZDA 2UU9J 4DV1J 3ET6B 5DG9A 3J81j 1CJUA 2H4WB 2ZD1B 5F3TA 1PJ5A 1UFLA 1K44A 3BPDA 3R5AA 1C1BB 3BGRB 3HT0A 3N6NA 3LF0A 2H9ZA 3QSIA 4WJBA 3W7BA 4Z2XA 2Y1JA 2J6SA 4ID5A 2VA2A 2K7JA 3PJXA 4UUXA 3TJ8A 4ILMA 2M3DA 1H3DA 4OJ3A 4K4SA 4KO0A 4DX7A 2C2RA 3QLHA 2F40A 3TUIC 4FNHA 1R6YA 2YKPA 1Y5IB 2X1AA 4K0KJ 2CJXB 4OX7A 2FY1A 1SH3A 1MN9A 3MEDB 2AJ0A 3AQOA 4HI1A 2CQIA 3D1QA 1RAOA 4WXWA 1S49A 1Z2ZA 2CDQA 2EW9A 3PKMA 4RW4A 1Q95G 1WG5A 5IQQA 3KJQB 2O01C 2D1CA 2KTQA 4IO1A 4I56A 1NHKL 4JOUA 4KV8A 2AGOA 1VQNS 3SSQA 2MJNA 1RQ0A 3D1HA 5G0RA 3ELHA 4R5PB 1HARA 2EFOA 1MROB 5CYMB 1OY6A 1RT5B 2DHGA 1S10A 5U47A 3LAKA 4R5PA 1KSPA 1K1SA 1XERA 3SCKE 1H6KX 4OYWA 4U8YA 3UDCA 1HL6A 2RSQA 3M2RB 3M32B 4G1IA 1WOSA 2MXYA 3ONQA 2QLJB 3UO0A 1RAFB 3R6LB 3S1TA 2GO9A 3QPIA 2P6SA 5IS2A 5C2GA 4A8QA 3C8YA 1RKIA 4KGZB 3RRKA 1LNQA 5L1IA 1N48A 1TL4A 3DOKA 5C24B 4K7QA 3W2VA 2IHR1 3AA8A 1QAIA 2DHSA 4ECVA 1FJEB 4DV2F 2ZC3A 1FD8A 4RUCA 4NLPA 2BE7D 3Q22A 1ZPWX 2CVIA 4P2FA 4YDDB 2JX2A 4C11B 3N5FA 1HPZA 2A0FB 2JLEA 1O51A 2JEJA 5IM0B 2Q66A 2ZVSA 4ECWA 4G3IA 1IN0A 3GIMA 5KFEA 4LF5J 4KHPJ 1S9EB 4LRCA 5HQMA 1SUQA 2XMKA 1YI2S 4USVA 4RW6A 3TZZA 1F0XA 3C16B 1A7GE 3GCWP 2OI2A 5EWGA 3V81A 4PG6A 2WONA 4RW6B 5DETA 4R8UA 4IG3B 3E2EA 4KY3A 2HQGA 2DISA 4PR6A 5DLGA 1ZPVA 1HW8A 3CJTA 2BJDA 2Y3YA 3IBCB 1H7WA 1X5PA 4CO4A 1Z2LA 2IM3A 3BS9A 2ASDA 1ZYQA 1NHUA 2AYEA 4K4WA 1WF0A 9ATCB 3ZTQA 3CCZA 3CC7S 3G9CA 1T02A 2YX4A 1TL3A 1TTHB 2HRUA 1WEZA 3MFHA 4AQYJ 1Z4UA 2OJ3A 2VFRA 2EK6A 3N28A 4I0WA 3H98A 3NOGA 1C1CB 2GVZB 1CJVB 1RWOB 3GG0A 4DCOB 2V4QA 1XMOF 4JV5F 3IAM9 2RJZA 2YBVA 4DL5A 1RHRB 4B9MA 1B3TA 2HS0A 4ZIWA 3ICLA 2H5JB 5KAKA 2CG8A 1F3FA 1VHFA 1H2TZ 2AEMA 1HBMB 2GVDA 2Q3PA 4RJVA 4MTPA 1YITS 4KIAA 4M5DB 3CPWR 3MM6B 4ZA1A 2BABA 2XY6A 4N77A 4PYDA 4QR2A 3NBPA 3FKBA 4TXSA 1RB0A 4UOFA 5GVQA 4JI0F 5AXMA 2XO6A 1I1GA 2HAIA 4L75A 3QIPA 1FWLA 4HACB 4DFPA 3HSGA 3N79A 4CLLA 4EBEA 2LQ8A 5KFWA 2GO8A 4LJMA 4ZDNA 3PEJA 2PMWA 2GMLA 2QFJA 2PI4A 3BGUA 1SL1A 3SZ2A 2J0WA 2MZRA 1RCOB 4C11A 4R25A 1NJIT 3C14A 3AOAA 5EWEA 3FGVA 1XR7A 3FQKA 1VFJA 3I56S 3KLIB 4FYXB 2V8VA 4DV6J 5CCMA 1S9EA 2H3EB 1SKUB 3AD8C 3DGPB 3O44A 2AKWB 4B02A 3PR5B 3ZFVA 4HL9A 4OHVA 1OYDA 3E01B 2DPIA 2W2QP 4J9MA 3MM8A 4CLPA 2Y8WA 2GZOA 3D6FB 3W2WB 3X1LB 2E5JA 3CT9A 3LPYA 4LRAA 1D9DA 1R8HA 2PE8A 1BQNA 5KG3A 2VF3A 4CRJA 3HO1A 2CJQA 3FFIB 2H5EA 4OZ0A 2L3MA 2W9BB 1U7LA 2D7SA 4DV2J 2W7PA 1S0NA 4M5MA 1SKRA 3B82A 1FRKA 4Y34A 2EFQA 1UFKA 1PYOB 3R27A 3KUEA 1O5JA 2DCUB 4OX9F 3QGPA 4ECRA 2KM8B 3WQPA 3W9JA 3M8QA 4RBTA 3J7YU 1WF2A 4FYVB 1RAIB 4ZVSB 3G2XA 1FWPA 2HQ3A 4NLXA 1KONA 2CPYA 3HHLC 5F9LA 1N36J 4ZS6A 2QYGA 4DEZA 5D3GB 2PC6A 1S1WA 3NCQA 5B0CA 1ZOTA 3MEEA 3MMCB 4PG4A 4CLKA 2MGZB 1RISA 1T94A 1HQUA 2YPYA 1M1HA 3P45B 4NZ6A 4X64F 1NJXA 4BS2A 4RO0A 1RYRA 3MCSA 2H51B 4C9DA 5ETOA 3W2VB 2NZCA 1HA1A 1S7HA 1SC6A 4P71A 1RAGB 5GMKa 1VIOA 1PBUA 3S6EA 1HBMA 4ED2A 3E8OA 1Q8KA 2RH3A 2DGXA 5ETPA 4EZ6A 2W9CB 2K8GA 4B9LA 3ZTSA 4KAIA 2B5JA 2J7WA 3TX8A 3BSCA 4RWWA 5K14B 1GXUA 1QDUB 1AUSL 4LF8F 3R1LA 1JJ4A 1W25A 4OHWA 4GO5X 3C46A 1GMVA 1CULA 5EGYA 4WK3A 2IRYA 4W92B 4KJIA 1Q81T 2MTLA 1HQ2A 2FVCA 2LDIA 4IG3A 2ZH1A 4OI6A 1B0VA 5ADZA 4XPEA 4B9VA 4DU7A 4I64A 2OAUA 1RT3B 3DM2B 2OEMA 4QYRA 2X51A 1NSKL 1S9GB 3BB5A 5D4OA 2N82B 1QSSA 3GYXB 3LALA 2YQ0A 3OSPA 4ZHRB 5F8HA 3SV3A 3UCUP 4ICLA 2B4VA 2VPXB 3F56A 4DCJB 2CJKA 3H2LA 5K9FA 4ES1A 2BM1A 4X65F 2XCPA 5DQIA 3KLFA 3C3LA 2IY5B 3ZC4A 3SXLA 5BR8J 1U1LA 1N36F 3V4IA 1FA0A 1BUXA 1N52B 3U1MA 3PZPA 3AHPA 3BSOA 3SQGB 3ENQA 8ATCB 4WFNQ 4DWIA 2GA7A 3RRGA 1UPPA 3SIPB 1RTJA 3BM7A 4JBCA 4Y3CA 4JP8A 4CT9A 3M8QB 4DS5A 1BQMB 2WVCA 5FDLB 2VBYA 2DRBA 1SJFA 1HI0P 3AJ1A 5LMNF 2Z30B 3BN4A 3M6XA 2QMWA 5FIIA 4ZLLA 3OTDA 3NBPB 2DNQA 1JQGA 2XY7A 1WTFA 1TL1B 1UVLA 4WE1A 1DQ9A 5MLCV 3FCWA 2OPRB 2V9KA 3GE9A 4KBIA 1Q7YT 2G2ZA 3MD3A 2IVFB 4F3QA 2E1PA 2QA4S 4FBTA 4JV0A 3TUZC 4IFVA 4UTGA 4M8LA 1K73T 2AJ1A 2UV8A 1PILA 2LXFA 4N7TA 2EK1A 1X5OA 4NXMJ 1HPZB 1O0PA 1YG0A 1U1RA 1LWFB 1OQ6A 1GQEA 4OI1A 3A8JA 4WTOB 2EI5A 2BR0A 4RBUA 4PWWA 2LYVA 3HVAA 1SUQB 3G86A 1MMDA 2V34A 3HSJA 3IMQJ 4OI2A 1QSYA 3UE2A 1PCAA 2E5LJ 5B0DA 5IM0A 3D67A 4DX6A 2A2DA 2VL1A 3TEGA 2GIQA 5F3ZA 4K2JA 1IQTA 2OO4A 3DXSX 1DBDA 4A8OA 1PAUB 3BEGB 2YNFA 3SYZA 4P2MA 2P5VA 4DSEA 2XNQA 4ICLB 4FZVA 2J6UA 3HI9A 3OQ2A 5CYQA 4LFCF 1R89A 1Y3JA 3A8KA 3GYGA 1YBUA 4OYBA 4CLSA 4R8UB 2HGNA 2RQCA 1URNA 4PEOA 3KHGA 4DR3J 3MPWA 2VBZA 2A6MA 3ZZPA 1Y10A 4HT7A 4DQRA 4J5OA 1RHUB 1QD1A 2G1HA 4I2QA 4C6AA 5LOQA 2MGZA 3RRHA 4ELVA 1AROP 2KU7A 3C6TB 2QEXS 1S6PA 2DRDA 1SBRA 2MLYA 4EFAC 2M70A 3RB6A 1T9TA 4ZLPA 5CA5A 4CLTA 2IA0A 2VODA 1GXLA 2FYXA 4ANDA 4O0NA 2Y0BB 3PW4A 5G4DA 4QBUA 2EXUA 3D0IE 4RBVA 1RT2B 4RWXA 1Y5NB 5KFQA 2IMWP 3MMJA 3IO1A 4FN5A 1ZM4A 3CJ8A 3K5LA 1NDPA 5B09A 3RR7A 2EBEA 4NZ0A 2V94A 2LQ5A 2OPQB 4PZVA 1DJ0A 3ISNC 2FC9A 2WVDA 5D4LA 1UCNA 2NSCA 2VQEF 5HI7A 2R7OA 5DGBA 3W9IA 2VA3A 1UVNA 2KT5A 5K8OA 4DV7J 2EFGA 4YB7A 3IG1B 1RAAB 2D69A 2EEYA 1KQGB 2QYCA 3HJVA 1PGZA 1PYTA 1S9GA 2ZDPA 4JI4J 1IKVA 2R4FA 5L38A 2VHGA 4NYPA 3ZZOA 1QE1B 2WZ1A 1IKVB 4NLTA 5KFTA 1ZM3A 5A0YB 1ZBTA 3WIUA 3D66A 4ZPCA 4XIUA 4KGMA 4GVLA 4LF4F 2LXUA 2GAGC 1S4EA 4ITSA 5A0YA 1EP4B 1LWEB 3D4JA 5KFPA 4X66F 3SFUA 1T9YA 4X4OA 2WK4A 4LSNA 5CCLA 3OTOF 2JLGA 3LANA 1XJWB 1AB8A 4WFXA 3MPYA 1FKPB 4QIEA 2XYHB 4WBFA 1RA6A 5HROB 2EVZA 1X4FA 3FFIA 3Q8RB 4A8YA 5H9EK 3ILLA 2KT3A 4OL8A 1U25A 3GSIA 2OIHA 3W2WA 1DHMA 2FHOB 2ZBRA 2VG7A 2NPIA 2XSJB 3MOZA 3MDFA 3P5BP 1C0TA 1BLUA 5KFGA 4CYUB 2PD1A 4OYOA 5T7LB 2KDOA 5KOXA 1VBYA 2XSJA 3K7RA 1ITPA 3EVWA 2BEFA 2I9SA 4A8WA 2GCFA 2HHSA 3CMAS 2ALYB 4NMLA 2VC0A 1KVKA 2DITA 4TLRA 2FLLA 3HHLB 1HD1A 3Q86A 4OQJA 5HJYA 5KG5A 3NGSA 1SJ3P 2GHWA 2HHPA 2AP6A 2E44A 2BRLA 1S1UA 2COLA 1RT4A 1KBRA 1IJFB 1S1WB 3M1VA 3CJ2A 4OV1A 3TW0A 4D3GA 4O4RA 1WDDA 4RL1A 2ALZA 1M5VC 2FC8A 1URRA 3M1VB 2HVEA 4H4MA 1NCLA 2HRYA 3NGKA 3TAMA 2CNLB 1G1XA 5D6GA 3OFEA 2PA3A 3PYGA 2QJ3A 3CJKA 3ISZA 3THVA 3J7ZT 5KFCA 3KDNA 1P9YA 1MU2B 3HMJG 2YWWA 2XI3A 3C6UB 4YFUA 3RW6A 4QQBA 1U8WA 2BJ3A 4ED6A 2H54B 1KOHA 2ZKTA 1ZM9A 2XMTA 2UZAA 4CQ1A 4I7FB 3K17A 3PFOA 1QLNA 2ZM6F 1NH8A 1ELOA 1S7IA 1WEXA 1M90T 3VAFA 1XR5A 5F8NA 1X0PA 2DVIA 2BJ9A 3LTOA 3VAMA 3AD9C 2J0XA 1JX4A 4LF4J 1M5KC 3H5XA 3CE8A 1FVQA 4ZPTR 5I4MA 4PXDA 1T8EA 3FUYA 3JTPA 2DR5A 4MKYA 3KMQA 1T9WA 2VZ9A 1X8DA 2L9NA 1N5TA 1GXTA 3PW0A 4MKVA 2IIHA 4J37A 1TK0A 4I6AA 4A46A 4Q8EA 4UY85 1SC1B 2MZSA 1WDTA 2D9PA 3AXMA 4OZ5A 3NS7B 5DLFA 3OL7A 3HFZB 4K59A 1E6VB 1P1LA 2CIMA 2V4JA 2WB1D 2W2PP 3NGTA 4ZP6A 2V2VA 3CJ0A 1DZ5A 1LFWA 4F02A 3IRXA 3VF0B 2IVMA 4LT6A 1B70B 2NXEA 3PX4A 2B9YA 3AA9A 1BQMA 3M2VB 4O44B 4TKTA 3GLJA 1IKYA 1BHNA 2POKA 1UTAA 4OYPA 1RT7B 5L9XA 1HBOA 2IM0A 4CI0B 1NH7A 2J8AA 3T5JA 3CIZA 1S0OA 1WKLA 3O8WA 4QWDA 2F5GA 4IG0B 4MH8A 4QIGA 4ED4A 1NK4A 2ZNYA 4O3OA 2F7VA 2OPRA 3DOMB 1R0AB 3AXKA 3MMBB 1JLAB 5CYJA 3G82B 5L46A 3PYDA 2WBRA 2AYGA 2CQ0A 1OPIA 2YTCA 3CDWA 3M6VA 4EYIB 2AZ1A 4J9RA 2CJ9A 1JLEA 5SUHA 1KVJA 2D3ZA 2AJ2A 2BXJA 2UVUA 4K4YA 1MU2A 2IM1A 3D5MA 5L1JA 1SJRA 3OVAA 1JLEB 4O0IA 1N54B 2KI2A 1EP4A 4WP9A 4C8MA 1HR0J 1TFYA 2IPOB 2M9KA 3THPA 2ZD1A 4JI3J 1TKXB 3EXYA 2HQFA 4HDHA 1S4FA 5T41A 2WONB 3C15B 2HS3A 3SCIE 2B0GA 3N5BA 4CO3A 2N4DA 2RQ4A 3IWLA 4JI7J 1U0HA 3QT7A 2RKIB 1SVDA 1IUJA 4MK9A 4DR6F 4EO6A 3U02A 1RGVA 2J0QD 2ZUAA 1HNZJ 1IR2A 1TU0B 4C0HA 3KMSA 4NXMF 4JI3F 1G2EA 1GFWB 2HZAA 3IP0A 4CIOA 4B9NA 3DRRB 2QSWA 4BC7A 4ZVGA 2M8DB 2R7SA 1M5SA 1N0VC 2QL5B 2XZDB 3DGVA 2XWXA 3W8GA 3OD2A 4H54A 3G71S 2D9OA 2AGPA 3MWBA 3K58A 5GAHU 1DRZA 2YQ3A 2GVZA 2V2KA 3M30B 2OEKA 4LUBA 4Q2LA 3JQKA 4QIFA 4UQTA 4DV3F 3QZ8A 4PRFA 1JKHA 1VRTB 1S1UB 3DYAB 4LSLB 3BSNA 2PFFB 4UOCA 2PSZA 2E5IA 3L09A 2P9CA 3MPDA 4NLDA 1RBLA 1RU1A 3EPIA 3EGZA 4L73A 2QFIA 2OUGA 4KB7A 5CZXA 4CP5A 4Y28C 3GIIA 1GK8A 1QAYA 4J9KA 1OS5A 4IR1A 2R7VA 2YNHB 3CNQP 1AUDA 1HBNA 3EICA 1RHQB 1G4CA 4RUBA 5A8KB 2MKSA 1LW0A 3W64A 5AJ3F 1KN6A 3GTYX 3D7SB 4RW7A 4ECTA 1N6QA 4YR3A 4CWBA 3H2UB 2F63A 2ROPA 3TZWA 4R0JA 3FJ2A 3HD1A 2LXIA 1U2RA 4OZ3A 4DPTA 5A8KA 3I31A 1WACA 5HANA 4DR7J 3UWTA 3HHLD 2GV1A 3QO9B 3THTA 1RK8A 3GONA 4RNOA 1KS2A 2BJ7A 3P96A 5H9EJ 4V19J 3FBBA 1F60B 3R5JB 4GRSA 2CDRB 3NAIA 4RNHA 3QNWB 2G0JA 3NCPA 3ZZRA 4F7VA 3FZ2A 3IXQA 3C19A 1HR0F 4KTQA 3HJFA 3VAHA 1JLCB 1T7PA 2OD4A 3MPVA 3OFFA 1R8CA 3MXHP 2DH7A 1CC8A 4JI4F 1AXQA 4LRFA 1AZSB 1X4DA 4YY3F 3CCMS 2E7XA 3M8YA 4DX8H 3DOLB 3T6BA 4N76A 3OT9A 2GQ2A 1VLYA 1YJWS 1N33F 5AE1A 5KFXA 4BDPA 4DZ6A 3OHBA 4B9TA 4DR7F 2CUYA 4QJVA 4FYDA 1I94J 2RB7A 2DR7A 4RNMA 2C3PA 4X65J 1J2VA 2C2MB 3T5LA 4M1KA 4CYUA 4NCAA 3P5TL 1RT6B 4HYKA 5AXKA 1S59A 3PDNA 2AJ4A 5D4PA 1EETA 3DRPB 4ZCIA 2F9JA 3V2UC 1T3NA 3IWXA 2YKAA 5BXIA 1FFWB 3OXFA 2M52A 5CAAA 2C1EB 4JI8F 4B3OB 1FJ7A 2HHQA 1EETB 3DRPA 2HZVA 4GKKF 1IR1A 5IT9U 1HQUB 2UUTA 3VAGA 1X4GA 2RT3A 4OLPA 2LQ9A 3JTOA 5J1NA 4KHRA 1OY9A 3GYNA 4Y00A 1WHYA 1H38A
chains in the Genus database with same CATH topology
3O2IA 3FSIA 1JNZB 4F3OA 4ZP7A 3I5BA 4HKQA 2CPIA 4CH0S 4CNZA 4DJBA 1N5SA 3CJKB 4AL6A 4P6QA 1FRHA 4R0EA 5E2QA 1ZZFA 2C2DA 3W3SA 3GMGA 2RDIA 3BO4A 4LMZA 1HNVB 2R7UA 4MMOA 2N4CA 2E1MC 2PI5A 2D41A 2CPEA 2GHPA 2DGOA 2K2PA 3JTNA 3UR3C 5MAOA 3CD5A 5DM7Q 3DDKA 1ZM2A 2EG1A 3PW2A 3NRBA 2ZH2A 3UI3A 1X5TA 1RTDB 3MD1A 3A1YG 3H59A 3CCLS 2BW2A 4ZHRA 3EZ5A 1VQLS 1KR4A 3US5A 4ILLA 4BWMA 2HIQA 3EGWB 2KZMA 3VQSA 1IBKF 2XZWA 1IBMF 2RF2B 2E1RA 3BGLA 2J7UA 5J2PA 5HMZA 1SJ1A 1WWHA 1D3WA 3I6PA 1Q4RA 4RW9B 3CC4S 4KV8B 1GAOA 3P6YC 2CPFA 4NLQA 3MEKA 3DLGB 5CH7B 5M2UA 2BV3A 3PXGa 2HNYA 1YVFA 4Y2KA 5CYMA 4IH7A 2XMJA 4DMZA 3U27A 3FEYB 4KKOB 6FDRA 3MR5A 1MMNA 4CO2A 4EEYA 2AYMA 2NUUG 1NK8A 2YNGB 3CDAA 3N0VA 3ULHA 5CD4H 2OSQA 4A8SA 2D3OR 2E1CA 1LK7A 3M6UA 2RDJA 3NNAA 4Y2CA 4H4KA 1FRLA 2XS2A 1HR0F 2KXFA 1DURA 1VRUA 2VV5A 3KLGB 4WE1B 2YH1A 2WW8A 2W7AA 3AAWB 2R8KA 4E0DA 1T3OA 2RQMA 2Y1IA 4B3SF 1CPZA 4OMFG 2PO4A 3D28A 3I32A 4GC6A 3UPFA 4YQWA 2U2FA 1RKJA 1Y3KA 3BR8A 1JLBA 4EU0A 2GHVC 2X1GA 4ED3A 1S1XA 3PX6A 2XMUA 1JLBB 2DNLA 3DI6A 5GAGI 3PO4A 2VG6A 1DTQB 2K1RA 4FF1A 3DI6B 2DNNA 3TNVA 2M5YA 1VBZA 2JLFA 2V5HG 2ERRA 5I42A 2LA4A 4X4VA 3VAJA 1TZ0A 2HG4A 3V81B 2MZTA 5LJ5Y 5DG8A 4KHPF 2I2YA 3DRSB 2DCLA 3E3XA 5IT0A 2O66A 2O1PA 5HO4A 2X1BA 4A8MP 1JJHA 2VFTA 4TY8B 2YKMA 4LF6F 5J2MB 3CCJS 3LH2S 2Q1LA 1FRXA 2LEBA 2HYIB 2OFGX 1FXDA 1FK9B 2ZH9A 4X4SA 1R8PA 1FDNA 1M5HA 4URQU 3E51A 5DM6Q 1F5CA 2I5JB 1S77D 4UW2A 1UVKA 1X4HA 4BWJA 1KTQA 1NKEA 4JV2A 3OJUA 3RBEA 4LVOP 2DBBA 3TP2A 2UXCF 1JKHB 1UETA 1X4BA 5I3PA 5L9NA 2D74B 2DNMA 1V3SA 2DHAA 2HNDA 1U24A 3AB4B 3I5CA 3LP0B 4IOBA 5M2RA 4J9SA 5J2NA 3M8PA 2RQKA 3I9V9 2VKRA 4RX6A 2KH9A 2FJAB 1N5VA 3JSBA 1XWLA 4F4KA 2KJWA 5CQGA 3HHDA 3T19A 3HF5A 1FERA 4K5RA 5E41A 1U26A 4KRWA 4IFVB 3P3DA 3NNCA 2MJUA 1JLFA 4ECXA 1YHQS 1XMQF 3MEGA 1RTDA 3MM5A 1TVRA 4ZMMA 3PV8A 3PVXA 3WC2A 1S6QA 3AQPA 3HDSA 1RYSA 3MMAB 2MKKA 2OFHX 1GTHA 3MM5B 3IN5A 2G0CA 3EUNA 3FZBA 4FVCA 1L3KA 4DBQA 1R3NA 2RF2A 5K5MA 3UR0A 3LP2B 4ZVEA 2ZC4A 3CCTA 3TRGA 2GJIA 2OD6A 3DMJA 5AXNA 3GV7B 3CDBA 3KLEA 1NKBA 1Q78A 2A18A 2KFNA 4DSKA 3PIPQ 2FLNA 3TI0A 4MK8A 3IC1A 2M4MA 1TL5A 1KLNA 2SXLA 4EO8A 4BBYA 2HHXA 3NCRA 2CPZA 3POTA 2NS1B 1YJ9S 4ZVFA 3EX7B 2I0XA 2K7KA 3J7A1 3F73A 3QGHA 3DRXA 5AXLA 3TVYA 2KZZA 3WDOA 1XEZA 1SQEA 3CD0A 5IWAF 5IFMA 4F4YA 2OTJS 4XAKA 4TQRA 2MKHA 1N5YA 1B0TA 1REVB 4PPZA 3OLAA 2KM8C 5KTQA 1T03B 3GFXA 4J9NA 3U1NA 2E7WA 1P1TA 2XMMA 2YWKA 3RAQA 3F44A 2ZHBA 4IKAA 1IKWA 1LK5A 4I6WA 3KLHB 4DR1F 1M5PC 4RNNA 1QVGR 5GAEU 3BJYA 3S7RA 2ZE2B 1QTMA 2DK2A 1KLMA 4WTYA 2CJBA 1C1BA 2ZE2A 4G1PA 4DL7A 2MB0B 2HMIA 3OHAA 1DLOA 3QIPB 3CD7A 1B64A 2CZVC 3RR8A 1VJWA 2C42A 3OSNA 1Y0HA 4I1TA 4FS1A 2IAJA 1RJJA 3PM9A 2JVRA 1HNVA 3TO8A 2PT0A 4F2SA 1S76D 3DLHA 3D1OA 2I38A 1U48A 4LIRA 3QJJA 1V6HA 1NJYA 4ZCKA 5ITHA 3G6ES 3I55S 4C4WA 2IBOA 4C8OA 2OMLA 3TVKA 1N5QA 4NCGB 1SIZA 4QW9A 4F4ZA 3SQGA 4WZQA 3POTB 4FXDA 3LGMA 2BYCA 4O3NA 4XPCA 2ABYA 1H98A 4TLQA 2LMIA 3CJ5A 4B08A 1RT7A 5KG7A 4ECQA 1WTBA 3FVYA 1U45A 5C25B 1T05A 4LIWA 2B4UA 2MQOA 1IBLF 3ETOA 4F3MA 2N3OA 2F9DA 1YRTA 4IG0A 2V4RA 4FS2A 3V6HA 3KK2A 2MY7A 3M8PB 2DH9A 4CH7A 1JLGA 5KFIA 2ZHOA 2YWFA 4DUZF 2R8JA 2E5LF 2WSCC 4OZLA 3UNGC 4OI0A 3NNHA 1K0VA 4NXNF 1JXEA 2JSXA 2DR8A 4ZP8A 1ZAXA 2MSSA 2MQPA 3MEGB 3GR1A 4XK8C 2JH3A 2PA8D 2ILZA 4H4MB 4PQAA 3MUMP 3M4XA 4QWEA 2QLWA 4ED5A 2IYGA 3H25A 3D54A 4PWDA 1IQZA 4E98A 1HQEB 1DTTA 2EFNA 2GMHA 2LQJA 3MUTP 5C5JA 1FDBA 4ZK7M 2BE2B 2RRBA 5A6PA 1JLQB 2QSFA 2FJEB 2B4PA 3CWJA 3G96A 1JLQA 1Q79A 2KHDA 3DU5A 4QYZJ 2VBXA 3ZZZA 4DOZA 2HHHF 1S1TA 5A2QY 2Z2MA 2R8HA 2LEAA 2RD5C 2GGPB 1FO1A 4USJC 2ZZNA 2XLIA 2OH2A 1XNQF 1RWUA 3GSDA 3V4IB 3AH6A 4Q5VA 4IDKA 2J0SD 3H5YA 4C8NA 1Q53A 1HNXF 2VG5A 2WOMB 1X5SA 4TU7A 1NK9A 2CQGA 3IAS9 4MKBA 4ES3A 1RT5A 2ZJRQ 5D8HB 4O44A 2K3IA 3CGIA 3I4PA 4EWTA 1D0EA 3ENVA 1KC8T 5KT6A 4J9QA 5GADI 2Z0GA 3MAQA 2YNHA 3VR1A 1HBUA 2YKNA 4X4TA 1HWIA 5KFMA 5A8RA 2CZ4A 3RAXA 2PMHA 4I2PA 5J1EB 3T9ZA 3MMBA 3Q0AA 1RTIA 1CLFA 2BACA 4YEAA 2UVRA 1LWCB 3CCQS 2DRAA 2WB4A 3T1YF 4CTAA 1VQ6S 3D0HE 3CCVS 3T1HF 2BZ2A 2CG4A 1S6QB 3GIKA 1NEEA 4A8XA 4ECSA 1JLFB 1Y4ZB 3CTRA 3T9NA 4DF4A 3QJLA 2UVVA 1E6YB 1HMVB 4JI2F 5HP1B 3QAEA 4DQQA 4DN9A 1T95A 2JDJA 4TU9A 3IGNA 1SI9A 2EWHA 3HVRA 3HFKA 2CJAA 3TAPA 4RZRA 2CQ3A 3DN9A 3DOLA 3DFEA 3AY0A 2RUGA 1QJHA 4QR1A 2W4CA 2XGPA 3MR6A 1APSA 1DFDA 1YBAA 2XHWA 1Q1KA 1TK5A 3CMES 2YH0A 2W9BA 2JOQA 2DNKA 1C4AA 4IDKB 2FJVA 2I1RA 2DGSA 3N6LA 3NS6A 2Q6BA 4NRTA 4OI4A 5KFBA 2OLWA 3PR4A 2E5HA 1C1CA 4IOCQ 4DQSA 1J5OB 4DQIA 4TN2A 4DR5F 2KT2A 2YWHA 1KTVA 4IFYA 1RT4B 2VONA 1LQ9A 4GKKF 3F41A 3QIDA 1LV5A 3BR9A 3DLJA 2ROEA 4ETZA 5KFFA 1H2VZ 3EXCX 4PWDB 2JEIA 4HHJA 3L7OA 2YWEA 1WHVA 2Q79A 1S0VA 4Y2IA 2CQ1A 1HWUA 3S01A 3HT3A 1RT2A 2KJVA 4ZVHA 1U09A 2EPIA 4CZCA 3JB9k