3TZCA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
224
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 76
structure length 224
sequence length 245
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzcA00
3JSAA 5IDQA 1Z74A 3ZU2A 1CIVA 3H5RA 1A5ZA 1VE9A 3L0DA 4IQGA 3W8FA 3MJVA 2FR8A 3AI2A 2Q2WA 5T64A 3OQ1A 1C0IA 2FHSA 4YEDA 3WGQA 4H16A 9LDTA 4KDFA 1IZ0A 1GEEA 4PLYA 2AEMA 4L75A 4ALLA 3X2FA 1M66A 3Q6IA 3LVFO 3KVOA 4DA9A 2WTBA 2Y68A 3AI3A 4Z6KA 1TT5B 3AUTA 2VUSA 3AM5A 3ZN2A 4BO4A 1R15A 2YHIA 3JV7A 2NQ8A 3VPFA 4NBUA 1D7OA 4GI2A 4KMSA 2FZWA 3JQ6A 2VZ9A 3ZHZA 3ZW9A 2X22A 3HB5X 4YBZA 1NQTA 5DOZA 1B14A 1M76A 3KEOA 2Q45A 4O1MA 4CQLA 2D5AA 5U1PA 2VOEA 1PWZA 4PIVA 4XD2A 1HXHA 1GPJA 4E33A 4HP8A 1ISIA 4NFSA 1QP8A 5FF9A 2NQTA 3AK4A 4G5HA 3OQBA 3ZHYA 2DVMA 4J7XA 4ZRMA 3QLJA 3TZQA 4XR4A 3WOHA 2A4KA 1V0JA 4CM7A 1YOVA 4M1QA 4IDEA 1HETA 3HNPA 4BS9A 3MWEB 4IINA 4JP2A 3TSCA 2XF8A 2VHYA 2I65A 1ZSVA 4KWIA 3GNQA 5A5EA 3MWDB 4J4HA 3S2EA 1BXZA 4E2ZA 1PJCA 3H9UA 1DRUA 1VPDA 3FD8A 3GGOA 1LSOA 1C0PA 3STHA 4RZHA 3ZU5A 4XQGA 4HFMA 4BGVA 3HG7A 2ZTMA 2FRDA 2O50A 2Y99A 4RDIA 4DXHA 4TQGA 3JD4A 2CUKA 1B8UA 3M2TA 1MGOA 4OXKA 1KIFA 2R00A 2BMAA 1DB3A 4JBGA 3M1LA 4PG6A 4LRSB 2JKVA 1J6UA 1D3AA 4R4JA 1UAGA 5KVVA 1R0KA 3I9JA 3ZWWA 3GZNA 4P4GA 3DTTA 1LLDA 1FDTA 3RFXA 1TVEA 3GNTA 3KV3O 1CEQA 3E48A 1ADGA 4E2XA 2R6JA 1E3WB 3VH4A 4FQ8A 4ZVVA 3JQ7A 1ZW1A 4WNCA 4NBTA 1XHLA 1ZZEA 3DZIA 2AQKA 2EGHA 1VL0A 3X2EA 3E5RA 1ZMTA 4QFCA 3PHIA 2IRWA 3QWHA 5JCJA 3OJLA 1YQGA 3C8MA 3OF2A 1BW9B 1I30A 1LQTA 2X9NA 4AFNA 4B3IA 3AW9A 4JX8A 1VM6A 1PWXA 4BNTA 5L7YA 4NPCA 5H81A 2ZYGA 4RVHA 1ZK2A 2I99A 3BTOA 2JFFA 2C07A 4FR5A 1U3VA 3P19A 4NU6A 4IGFA 1YB1A 1CDOA 3ZWBA 4M54A 5F21A 4E21A 3DBHA 2VTDA 4XQEA 3PVZA 5J23A 1CF2O 2PZJA 4BNKA 4DTIA 2P4QA 3QWAA 1ZEJA 5ICSA 4ND2A 3QV1A 1O94A 4FOOA 3Q0EA 4BQPA 3BTVA 1YBMA 4JCOA 3MZ0A 4TWRA 3NDJA 4OKNA 3OQ6A 1UZMA 4BNHA 2RHRA 4XR9A 4OH1A 1WDLA 3WSVA 4XZ3A 5KIAA 1V3VA 4RPKA 1RM3A 2CFCA 3E5MA 3Q2IA 4F3YA 4L8VA 4PLWA 1HE2A 3LC2O 2CVQA 4YJFB 3GFBA 2C59A 2FSSA 2NU6A 1EFKA 2ZQZA 4CODB 4DUPA 5BQFA 2Q2QA 2EG9A 1SCUA 3KRTA 4A03A 4UUPA 1P31A 3GY0A 2VRBA 4LMRA 4DYVA 1SBYA 1MC4A 4J0EA 4I1IA 3ETEA 4DPMA 1R0SA 1RWBA 3FHLA 3JYOA 3MJEA 4CL8A 1V35A 2DAPA 3PTZA 2E82A 4GSKA 4D44A 4EBFA 2Y67A 3IP1A 2RHCA 5I9LA 1SO8A 1SOWA 2GN6A 1YL5A 3JYQA 4J6FA 3DOCA 4LMPA 3R0IA 3EAGA 1IOLA 1I3LA 3GK3A 3W4JA 3WQSB 1ENOA 3BXXA 5JNLA 3VVCA 5L95A 4TRJA 5MGBA 3F4LA 1QYDA 4BB6A 1P45A 2X58A 2VHWA 5JMWA 1GAEO 3U5TA 2DBZA 2VUTA 3K8ZA 2OGUA 1LLCA 2D5CA 4A73A 2HMUA 3LF1A 4FDAA 4UAGA 2D0IA 4J3FA 5KOIA 1DFGA 1G6KA 4MINA 3CH6A 1WWKA 2DQ4A 4P22A 5TRTA 3V2HA 1R4MA 2GPTA 3C24A 4JIGA 4NG5A 3TFQA 1E1MA 3RVDA 1MFZA 3TWOA 2JFHA 2H1SA 2ZB4A 2WMDA 3VHRA 4RF5A 4BL5A 5ENDA 4J1NA 1K6JA 4YXFA 3EUWA 1JDJA 2VT2A 4QT0A 2Q50A 3HSKA 4TZTA 3TL3A 1KY5A 3E18A 3L77A 1EQ2A 4K28A 5HWSA 4R01A 5BNTA 5I9NA 3OBBA 4J4BA 1ZK1A 1LNQA 2HJRA 4AJEA 2VRCA 1PS0A 3BA1A 2NTNA 5ITVA 5T8KA 3IUPA 4WCFC 3NDRA 1PEDA 4XB1A 1PJBA 3ROMA 4OOEA 4P38A 5IAAA 2WDZA 3Q9UA 2VHXA 3NRCA 4IQ8A 4MP6A 4RLHA 4WPGA 5TT1A 1PQPA 3TOZA 4DQUA 1E0DA 1U7HA 1WZEA 3KYDB 3UKOA 3O38A 1LRKA 5B4VA 3ANNA 4NK5A 4BO2A 2EP5A 1I01A 3WBFA 1Y8RB 1NHGA 4QUKA 5KVSA 1BVRA 2EP7A 2X23A 1AUPA 4P8RA 2E48A 4Q9NA 1BTOA 1YRLA 3WGIA 4M86A 3FBGA 1GYRA 1D1SA 4MVJP 4IGEA 4WLVA 1YBAA 2ZKLA 3P5SA 3GPDG 4RORA 2BFAA 4Z9YA 2RH8A 1NPDA 3W6ZA 4BNUA 4BGUA 1KEPA 5ADHA 4MVJM 4DVJA 4JK3A 2Q1WA 3GG9A 3KSDO 3QVTA 3NTQA 4WLNA 4N5MA 1OMOA 2O3JA 2TMDA 3PFWO 3RUAA 4JP3A 1LLQA 1UJMA 4IIUA 3H5NA 1O5IA 3AFNA 2B35A 5GZ1A 1JWBB 4Q3CA 1A71A 2CZCA 1Y9AA 3D4OA 2PD6A 2IODA 1UXKA 4IPTA 4BGIA 2P9CA 1QV6A 5JSFA 4UVHA 4WLOA 4IQ0A 2NWQA 4KOAA 4BNNA 1VL6A 3PLRA 2AA3A 3UXYA 4CLOA 1SOVA 2BF7A 3VVBA 4CUKA 2Q99A 1LLUA 1OZAA 3G17A 3IAHA 3OIFA 1RM0A 4TROA 4J1SA 2IEDA 3V5NA 5KTKA 1BRMA 2IXBA 3JQGA 3V1UA 3ZV5A 3ZWCA 1BXGA 5T57A 3U4HA 4LN1A 1QYCA 3GPIA 2PD4A 3JQ9C 4QEDA 4YYZA 1D4FA 1TB4A 3IL2A 1OAAA 1YL6A 4INAA 1P74A 2Z5LA 1RYEA 1OFGA 2R00C 5ENVA 4DPLA 2QYTA 4J90A 2C5AA 1J0XO 3GHHA 3PHLA 1DJNA 2YZ7A 3FNEA 3M6IA 3RKUA 3VC7A 3I4FA 2H9IA 1T1RA 3U4CA 4EW6A 3WMXA 4BNVA 2J3HA 4ALIA 1LU9A 1WZIA 4J9VA 4R3NA 4CLDA 4YACA 3BTUA 2VHZA 4LGVA 2VYNA 3DEYX 3NDIA 1K89A 1D8AA 1P0FA 4J0FA 4OXNA 2P4HX 4CM8A 1XYGA 3GZ4A 5IDWA 4B8ZA 3L6OO 1KVUA 3C7AA 3KBOA 4O6VA 3MCVA 3FR7A 1YJ8A 3GT0A 4WOJA 5HS6A 4D0RA 1U2DA 4R1UA 2YY7A 4JJGA 4YAEA 1KBZA 1SEVA 1EQUA 4JROA 4N18A 1E1LA 3SC6A 3C1TA 3K9QO 2IZ0A 4PG7A 4PLPA 2V65A 5BNFA 5KJ1A 2HO5A 4IDFA 3OHSX 4YJDA 2I3GA 2XAAA 1I8TA 3F1LA 3KHUA 2AQHA 4OXYA 5L4SA 5H82A 1HDZA 3FCOA 3PPIA 5TQVA 4EUHA 1XKQA 1QR6A 7MDHA 5K9ZA 2BKAA 3L9XA 4ZQFA 1G0NA 1JTVA 4PCVA 3R3SA 2G17A 1ZCJA 3K6JA 3PJGA 3PYLA 1I2ZA 1HDGO 4U7WA 5KCZA 1IPEA 4AJJA 4JXKA 3G3EA 3HB4X 5BSHA 5U9CA 1LRJA 4PLCA 1UDAA 1P33A 1LSUA 3U9LA 2HMSA 3U3XA 5IN4A 3I9OA 2A9FA 2NM0A 3WNVA 4RDHA 4RVFA 3QVXA 5DCYA 3WYEA 5KWEA 3QVWA 4K1LA 2NSDA 5DP2A 1DEHA 2IYPA 1JWAB 1N8KA 4MIYA 1LUAA 1JN0A 1PJLA 1SB8A 3TZHA 1ZSYA 4E5YA 2NTVA 1IY8A 5DNAA 2VNAA 3PI7A 3VTZA 1R4MB 3BAZA 1ID1A 1DFHA 4R1TA 4R5HA 5T6BA 3HE3A 3AFMA 2EJVA 1E3JA 3K73O 5TJ9A 2PZMA 4CM9D 1Y9EA 5F5NA 3GEGA 1HTBA 3GAFA 4IJKA 4IZIA 2IEBA 1KY4A 3JQ8A 3ORFA 8LDHA 3V1TC 4QECA 5ICMA 5LDHA 1U7TA 1ZH8A 2AQIA 3ASVA 4KUGA 1K5HA 1BGVA 1DIGA 4DREA 5CEEA 2VCYA 3GEMA 4B3HA 4J1QA 3SJUA 1BDBA 4I8XA 2Y1OA 4TRNA 3PWKA 3EYWA 2Y66A 2PH3A 4YJHB 3BZUA 1NFQA 1T2AA 2J5RA 3WYBA 4D43A 4D46A 4J1TA 3IJPA 4WE3A 3O26A 4OQZA 1ZIDA 2YJZA 3NTRA 1SMKA 2PTGA 4W7IA 2VZ0A 4ZQEA 2H5LA 1DRVA 4ZQGA 5B12A 3SVTA 3WQQA 4NFYA 4ID9A 3DC2A 3NGXA 3AUAA 1U3UA 2X9VA 1CYDA 3WYCA 3DXFA 1I3MA 4CMGA 4PZDA 2VT3A 5JFOA 1UH5A 2OP0A 3QIVA 5TNXA 4ND1A 3SX2A 3O4RA 1MX3A 1ORRA 4JBHA 3G79A 3GHYA 4DWVA 2WE7A 4L4XA 4OSPA 2X0JA 3HN7A 3AOGA 5I8WA 4CUJA 5ER9A 1W4ZA 4FJ1A 3FTNA 3PXXA 4U8GA 1XIVA 4Y98A 2B83A 4YT5A 4XDYA 2QZ9A 4CJXA 2OXIA 1ZBQA 3R6DA 3NTOA 3D5TA 3AM3A 1MP0A 3CIFA 1GZ6A 4IDCA 3SXPA 5BT9A 3HDYA 4XIYA 4BKRA 2WJPA 1PJ2A 4UREA 2EHDA 1V8BA 4YT2A 1PZEA 3PHJA 1B0AA 1LI4A 2OP1A 1YH3A 2W4QA 4O59O 4P4LA 2HK8A 3GA0A 3PEFA 2OO5A 2Y05A 1Q7GA 3GVCA 2G0TA 4K26A 3VPGA 4KTVE 4PLVA 2PKQO 1Y6JA 1V9LA 4XJSA 5I7EA 2DTDA 4NMHA 2QZZA 3RCBA 3JQDA 1ZVMA 3QY9A 5IF3A 4UVDA 1IZ9A 4HY3A 4A2CA 1T2DA 2GN4A 5KJEA 2HK9A 1U9JA 3DZKA 1A72A 4CPDA 4MIOA 3KETA 4JJFA 5BSFA 3WGYA 3K92A 3ZI0A 5C7LO 1EZ4A 2PKQP 2ZCUA 5BSEA 2AG8A 1GZ4A 1E3WA 4XWYA 1Z6ZA 1Z82A 4AJIA 1Z73A 4MVJG 3WJ7A 1XELA 2DTXA 2PA3A 4ZQBA 1JLLA 4CQMD 4LSWA 2GSDA 2C7VA 3QVOA 4AG3A 5EINA 1K6IA 2I76A 1GFSA 2PH5A 3ZW8A 3AU8A 3E9NA 4NBWA 3ST7A 3GRPA 1QLJA 1ML3A 2CVZA 3UVEA 5IXYA 3DWFA 1H6AA 5EIOA 1VJTA 2EF1A 1EUDA 3JQ9A 4NH4A 4M49A 4J7CA 3VPSA 4U6SA 4CMIA 1CJCA 1IYZA 3I52A 2GO1A 2RAFA 1BHSA 3GOHA 1BWSA 2JL1A 5C7OO 2QRJA 2CDBA 3PDJA 1T2EA 2JD1A 1B3BA 3ZZNA 3NEPX 1B26A 1Q0HA 3IDSA 4LISA 3PHHA 4UVGA 1AXEA 5EJ2A 2GD1O 4IJVA 4L9RA 4ND5A 1HE3A 3W4IA 4UEKA 3BMNB 2XXBA 2FSVA 1A27A 4U0JA 1T4BA 1MXHA 1F14A 2G82A 2DT5A 1E3SA 1C1XA 2HQ1A 4XCVA 3WGTA 4IY1A 3GG2A 3I9NA 1ZNQO 1ISFA 1HE5A 2X6TA 3EC7A 5F5LA 5IZCC 3OM9A 4LVUA 3ICCA 3JCZA 2PGJA 3HADA 1GTMA 1KC3A 2HMVA 1J4AA 3OJ0A 2JHFA 4BB5A 2QYSA 3I1JA 3JQ7B 3OJOA 2O2YA 3WTBA 4E5NA 1TT5A 3W4KA 1ZK4A 2YHUA 2J3KA 1HDXA 5C3MA 1BMDA 4ALKA 2Q1SA 4OYRA 3S8MA 5BR7A 4R9SA 2O4UX 1H9AA 5GZ3A 4RF2A 4Z9XA 1EFLA 3ZU4A 1XWFA 4MDHA 4I5FA 3FPCA 4Y9DA 3LT0A 3TPCA 3JD3A 4QO7A 4EGFA 1ZXLA 1DOHA 2NV6A 3BMNA 4I9NA 3DQPA 5DCUA 2GYYA 4CLRA 1LC3A 4YJHA 4BIIA 3UAGA 2DBQA 2ILTA 2VRCD 1DPGA 3GVIA 3K5PA 4Y67A 4W99A 2O2SA 2JCXA 3L07A 1HZJA 2BGLA 1IHYA 3DL2A 4OQYA 4R1SA 3A1NA 4G81A 1DAOA 1PJSA 1UXGA 3TOXA 1WDKA 2HJSA 4PLTA 3RBVA 2FOIA 3ABIA 4W4TA 2CMDA 2Y1EA 4CLRB 1FDVA 1ULUA 4Z0TA 4CQMB 3SJ7A 4RLSA 3TZCA 4CV2A 3W1VA 1E5LA 4R9RA 4Q39A 5TJHA 1NAIA 1V6AA 3P7MA 4IIVA 1PGJA 4GMGA 3RASA 3K31A 3KYBA 4YQZA 4MVJF 2EW8A 3CKYA 4MKRA 5CDUA 1GU7A 3F5QA 4LSMA 4EEZA 1YO6A 4Q3NA 3RAJA 3JQAD 5DOVA 3TN7A 2I6TA 1LTHR 1ZUD1 2Z1MA 4GQAA 4DBZA 4YDRA 5U4QA 1ZSNA 4L4RA 2OORA 4L73A 4IMPA 2J3JA 3GQVA 3KSUA 3NJ4A 1EBUA 1M6WA 4I5GA 2C0CA 4QQRA 5COBA 1JA9A 3OFSA 5TX7A 5ILGA 4MKXA 3PZBA 4NIMA 4YB8A 2LDXA 3L4SO 2DUUA 4QX6A 2XOXA 4Q3EA 1PR3A 3OJFA 1NWHA 4IS2A 3F6YA 3ANLA 5LCXA 3HDQA 1M75A 5T8KC 5ITWA 3WDSA 3D3WA 4QFDA 2GNAA 4CMJA 3K2EA 1B16A 2GCGA 1Z45A 3HWRA 3ASUA 3ETDA 4O63O 3WGGA 1DRWA 3PLNA 4DYDA 3O9ZA 3L6DA 4I9UA 4RPJA 2BGMA 2V6BA 4WEOA 4GPD1 2D1YA 5JW6A 4CMAA 1EMDA 1DC6A 5F1PA 3JYNA 4ZJUA 4CLEA 5F1OA 1MA0A 5DN9A 1GL3A 5JO9A 1X15A 1NYTA 5K6AC 3EW7A 4HADA 3D1LA 3MTJA 4Q3DA 4RVUA 3DBVO 3DOOA 3DZJA 3GMDA 3PGJA 1DO8A 2YW9A 4IS3A 3TJRA 4XYGA 3IS3A 3SLKA 2ZATA 1UZNA 4MVJH 2X8LA 2W2LD 3A06A 4FBGA 3RC2A 1XA0A 2PGLA 4QSMA 1G0OA 3TNLA 2UUOA 1XSEA 5JPIA 4R16A 3V2UA 4XJTA 4OMUA 3I23A 4I08A 4NQZA 3KYCB 5L3ZA 2QIOA 1K6XA 3RU7A 3WICA 3RUFA 1UDBA 2BGKA 4RQTA 1BXGB 2JAHA 2PNFA 2B0JA 1CERA 3RQSA 4BVAA 3WGZA 1KVQA 1NQ5A 1HLPA 3VZSA 4AJHA 1N9GA 4BO9A 5JAMA 2V7PA 1A7KA 4F6CA 1LRLA 2WSBA 4GGPA 2WE8A 2UYYA 2ZTVA 3NJ8A 4KUHA 5G4LA 2B4TO 1UP6A 2AW5A 4I9HA 4RF3A 1UDCA 1DAPA 2Q46A 2ZCVA 1GUYA 3V1YA 1MG0A 1F06A 5EQFA 3ZNOA 5KVQA 4G2NA 3OICA 2V6MA 4OKIA 5A9SB 1CRWG 1YOVB 4J7UA 3W8DA 2F1KA 1J5PA 2YQ5A 4CM1A 1B7GO 1AN9A 3F3SA 4ALJA 4EJ6A 5KJCA 2C20A 2BI7A 4E0BA 1HDRA 1UR5A 4GSLA 2VWHA 1RKXA 4EUFA 4HFJA 4XGNA 1I36A 2QG4A 3WXBA 3SLGA 1Y1PA 5L4NA 1ULSA 1PSDA 3ICPA 4PZEA 4NJMB 3JYPA 4IDGA 2JD0A 5F1KA 2J3IA 1I3NA 1GDHA 5DULA 4U0KA 2DPGA 3O8QB 3GFGA 5EL0A 4NHEA 4UEOA 1XGKA 1E6EA 1IPFA 5AXAA 4YAGA 1HWYA 3ZWYA 5TGDA 3VH3A 5IDXA 3G0OA 1YQDA 5CPFA 4ZN6A 1LSSA 3A9WA 1UP7A 1T24A 4IDBA 3T7EA 4DIOA 3PGXA 2X86A 4GX2A 4LW8A 4BNXA 1I24A 3IP3A 5I9MA 4D3DA 1V3UA 3MJCA 2ZTLA 4FS3A 4CUZA 2F00A 1X1EA 4I5EA 4MOWA 5C7IO 4ZQHA 1ZJYA 5AVOA 2DTEA 3RJ5A 4BO8A 5JO0A 2FN7A 2W2KB 1Z7EA 3VDRA 1ENPA 2GZ2A 3H65A 1TXGA 3JQ8B 4PZCA 4J91A 4JGBA 1EE2A 3EK2A 5TSDA 3C7CB 4FFNA 4BKPA 1I3KA 4IUYA 1NQOA 1YWGO 3ZNNA 2Y1CA 1ENYA 3DZGA 5AOVA 4FN4A 6LDHA 3F4BA 3DBLB 4WCFA 5HBRA 4CLHA 4K6CA 4II3A 4CM8B 2JFGA 5HTOA 3GVPA 3MJTA 1YDEA 1M2WA 4GKVA 1HSZA 3PWZA 1VSVA 3H9JA 4WGGA 1PQWA 3Q9NA 4W82A 5JAIA 3UOGA 1A9ZA 3BHIA 2E49A 1ZFNA 4FJ0A 4JNKA 2OUIA 3OA2A 1PGPA 3HUDA 1EUCA 3LK7A 2NADA 4MJLA 1LC0A 2I5PO 3EHEA 4PG8A 4BNLA 1YBVA 1A4UA 4KQXA 1NQAO 3RFVA 1ZJZA 3ETGA 3PFFA 4A10A 4FGSA 1O95A 3I9LA 3I6IA 3IC5A 5G0TA 2OBNA 3DZFA 1N9GB 2NACA 4GX0A 3IOYA 5DBIA 4CM9A 3U4DA 2PZKA 1R6DA 3D3EA 3M2PA 5EESA 1E1NA 4B4OA 4C7JA 3JQGB 2Y0DA 1HDCA 5CDGA 3KB6A 3OA0A 1GPDG 1YDWA 4ILKA 4CL3A 1PL8A 2JCVA 1P77A 1Y81A 1PL7A 4WUVA 4BNYA 3PIDA 2RIRA 3LZ6A 2GZ1A 3OEYA 3QE3A 1QRRA 3ON5A 1XQ1A 5GZ6A 4BNMA 3DR3A 1R12A 1HDOA 4TZKA 2Q1TA 3AU9A 4D0SA 1HT0A 3UCFA 4YTEA 1XQ6A 2BFOA 1BXKA 4R54A 1HL3A 3JQFA 4XX0A 4Z9FA 5JXWA 3RROA 5A4DA 1P1JA 4B79A 4WEQA 1F8GA 4Y6PA 4OSOA 5TIIA 4IDAA 3T4EA 2P5UA 2I3AA 5JDCA 2W90A 4PLGA 1GUFA 1JW9B 3VPXA 4YRAA 1CETA 2Y1GA 4TKLA 4TVBA 3COSA 4DGSA 4E2WA 4FFLA 4AJPA 4S1VA 4B3JA 2FR0A 4XRRA 3N7UA 3T7CA 3K30A 3F1KA 4J2HA 4DMLA 3UICA 2YV1A 3H5AA 3ZWNA 5A06A 4AJLA 2PR2A 3Q1LA 5COQA 4ZA2A 3AY3A 2ZB7A 1W0CA 1X0XA 4CLXA 2QRKA 1PIWA 1QSGA 2WYVA 5EMHA 3N58A 4RV9A 5CEFA 1B15A 4BO1A 3ZDFA 1MC5A 2E6UX 1QMGA 3Q3CA 4OM8A 5IDYA 1Z7BA 4F45A 3PJEA 1E6UA 1PGOA 1HYGA 1ZXBA 5I7VA 1NVTA 2O3TA 1GQ2A 4AICA 5JDCC 2PWZA 2FP4A 1HZZA 3DBLA 1K2WA 4WCFB 2EEZA 1H94A 4CMEC 3VKUA 5JCXA 3ONEA 3ADPA 4S3MA 4XB2A 1N5DA 3KUXA 3RKRA 2NNLD 1RM4A 3GMSA 2YV2A 1KEUA 3TZ6A 4BV9A 4EJMA 5IFLA 3E9QA 3CZMA 3GC6A 3UHAA 4A7PA 3H4VA 5DF1A 3BMQB 2FY8A 4PLHA 3B6ZA 3IKVA 3F5SA 3VZRA 4MVJD 2ZB3A 2HDHA 4B4VA 4NZ9A 3GDFA 4YAKA 4MP3A 2ZQYA 1AHIA 1E3LA 1SC6A 5HA5A 4BO7A 1XU9A 1PL6A 1E77A 2OMEA 3DHNA 4E5PA 2PKRA 4MPDA 2B5VA 5DBFA 2X1HA 5G0UA 3FF4A 4LRTB 2O23A 5JAZA 4PFJA 2AMFA 5JAQA 4NNJA 2NVWA 3FBTA 3RWBA 3VAZA 2ET6A 3D4PA 1Q7BA 4N5LA 2C5EA 1O6ZA 1PGQA 4OL9A 4ZD6A 1NXQA 5EN4A 3WLEA 4AJKA 5A02A 1U5AA 4HKTA 1R66A 4BMSA 3RIHA 3WR5A 4XGKA 3DB2A 4YJGA 1P44A 2WD7A 2BI8A 1UXHA 4ONEA 3INTA 3LYLA 9LDBA 1JKJA 1H0KA 4AJ2A 1C1XB 2Y93A 3E6AA 4NK4A 3E82A 3CXRA 3OJEA 1GCOA 3RC7A 1DIHA 1RM5A 3WIEA 4WCDA 1KS9A 2DFDA 3OEWA 3WG9A 2ZTUA 4L76A 3HDJA 4MP8A 4MO2A 3S55A 3D7LA 3OETA 4NI5A 3ZV6A 4F46A 3KEQA 1U5CA 3KM0A 3WFJA 1EK5A 1P1IA 3MOGA 2X0RA 1DJQA 2PV7A 4NR0A 2DM6A 3SC4A 2XPCA 2C54A 3RU9A 1JAXA 3H3JA 2CF6A 4NBVA 5KKAA 4ALMA 1I33A 4W6ZA 1E1KA 3I9KA 4A5OA 1R37A 4HFRA 2Q3EA 4K6FA 3O03A 2AE2A 4Y8VA 2GN8A 3WWZA 2JJYA 2JHGA 3NGLA 4LVCA 2WYWA 3QWBA 3ZV4A 3TDKA 2A35A 2X5KO 1Q0QA 3PWSA 5I8ZA 5DBGA 1EDZA 3ADOA 2I66A 3H2SA 4H7PA 4B7CA 1ARZA 3CINA 1WMAA 3AWDA 3RSHA 5A3JA 4K9DA 1QKIA 2ZYDA 1AGNA 3BHJA 4RO0A 4RPHA 5AXDA 3DMTA 1E7SA 5CG1A 3DO5A 3IUSA 2DLDA 5LDGA 2NUAA 4R3WA 1W8DA 4WNIA 5KVCA 2Q49A 3LC1O 4W7HA 1QV7A 3LF2A 3RFTA 1Y8QA 1I0ZA 2FMUA 1O8CA 4ND3A 4OJNA 1NM5A 2ZYAA 1HYHA 3TRIA 2A92A 1PS9A 3DBHB 4O5OA 2BFMA 2FPPA 4BMNA 4CLOB 3BMCA 2X5OA 4GX1A 1TA4A 5ES3A 4D79A 2VYND 4XGIA 1A7AA 2VTEA 4YR9A 3WLFA 2TMGA 2VQ3A 1CQJA 2FR1A 4BO5A 3BMOB 1UAYA 3L4BC 3LT4A 4TRRA 2VWPA 2Y1DA 1PZGA 1Y8QB 3BYZA 4WLEA 2NU8A 1GQQA 2VN8A 1X0VA 3NT5A 4G65A 3UF0A 3CE6A 4FPXA 3ANMA 2YDXA 4WASA 5A9SA 5MDHA 4X54A 5IJZA 4D3FA 4BO6A 4DPKA 3ZWVA 3I6QA 1NR7A 3PYMA 1XEAA 4AJ1A 2NLOA 1R4NB 2FWMX 4CQMA 4BOYA 3CMMA 2ZIZA 4IXWA 4YAJA 5JE8A 4E30A 1H9BA 1U2GA 4YRBA 5H83A 5L4LA 2D8AA 4FFOA 4CV3A 1NBOA 1HKUA 3DMYA 1DIAA 1PJTA 5KJ6A 1VL8A 1O0SA 2X7HA 2DFVA 5A9RA 2AHRA 3DZBA 3UCXA 2V6GA 3JD1A 3RUDA 4E5MA 1P1KA 2P9GA 3H9EO 1PS8A 3ZGYA 3I4CA 2YQ4A 1H2BA 3NV9A 2AQ8A 1HRDA 4GWGA 4HFNA 1YXMA 3ITDA 4FGWA 1NTOA 3VZQA 3OSUA 2HMTA 1T4DA 3ZH2A 4BNWA 1QLHA 4PRLA 1R0LA 3GEDA 3KTDA 3PQFA 4XEHA 1LQUA 4DIBA 1XLTA 4HUJA 1L7EA 3FRJA 3U4IA 2O3SA 2XXJA 3HZZA 3QJ5A 4KDEA 2O3UA 4JQCA 2HAEA 1ISGA 1I2CA 4XIJA 2O3RA 3AM4A 3IIEA 1H6BA 2EWMA 4TRMA 1PGNA 5AXCA 4CR6A 3BIOA 1IUKA 4BHTA 2UAGA 4A26A 1YGYA 1DIBA 1NPYA 3D4NA 4J4TA 2JAPA 5GY7A 1GCUA 2Y0CA 4IXTA 1NFRA 2EERA 2YDYA 4UUNA 2DU8A 4ZICA 5FWNA 3WJAA 4ESOA 5DDIP 5B37A 5JC8A 5JS6A 4FFPA 1BDMA 1PU2A 1H5QA 4CMEA 3QHAA 3ZNQA 3GR6A 1C1DA 4E6PA 4BNIA 3B1FA 3E1KA 2W8ZA 5HRUA 3E03A 4U5QA 3RD5A 5L7TA 4CM6A 5F3RA 4IJWA 3GAZA 1ISMA 4XDZA 4B7UA 4DMMA 4CQLB 4KZPA 4PN3A 3HJAA 3KYCA 5A05A 1YS4A 2AXQA 4Q3AA 5L9AA 4JN6B 5IXSA 1O89A 5FEUA 1KC1A 5TF4A 2OFPA 3GLQA 3GUCA 4BNFA 4H3VA 1ADFA 3EVNA 3QWIA 3TQHA 1A9YA 1GEGA 4LK3A 1BSVA 2BHLA 1KERA 4TVOA 3OH8A 2H6EA 5IN5A 4EYEA 4RL6A 4R1NA 4IDDA 1NWCA 4RZIA 5G0VA 3AUUA 3LLSA 2VZ8A 2EV9A 4E12A 1LDMA 1VLLA 4HWKA 1U1IA 3TZKA 1NASA 4DLAA 4EITA 4J9UE 2O7SA 1LA2A 2WYUA 1WW8A 3DDNA 1VKNA 3PP8A 3JQEA 3D64A 4FSHA 3ONDA 1GR0A 3JQAA 4RVGA 2AEJA 1N1GA 3LLVA 2IXAA 3PQEA 3NKLA 3H7AA 1ZKMA 3WWYA 5L40A 3HFGA 4ALNA 4DIFA 1N7HA 4FCCA 5JDIA 4PRKA 3SEFA 2X4GA 1X7HA 1YB4A 3JQBA 4J49A 4GVXA 5G0SA 1ISJA 1LXCA 2OOSA 4LCJA 1Y7TA 3I3OA 3UW3A 4KTTE 1GV1A 3NUGA 1XG5A 4H15A 1CWUA 4J2OA 1FDSA 2QX7A 4AJNA 4CMHA 5I7FA 4CMIB 3KLPX 2Q2VA 1JQBA 4NFHA 3I5MA 3PYXA 3UFXA 3KLMX 1E7MA 5JLAA 4HBGA 1IULA 4KQWA 3RUCA 2D59A 3NAQA 5JMPA 1FJHA 4FFRA 4OOFA 5FI3A 3WTCA 4FW8A 4OO3A 3QRWA 4UVIA 4N54A 3AY6A 4D42A 4QTZA 1LBEA 3FPLA 3IKTA 2GR9A 4OHUA 3P2OA 3GF4A 4L0QA 3ITKA 5L51A 2DC1A 4UUOA 1EDOA 1RPNA 4A27A 5L7WA 3DONA 1DC3A 1MLDA 3E9MA 2NTJA 1GUZA 4MVJE 4WJZA 4CMCA 1QXSA 3AI1A 1GQYA 3JQBC 1QYWA 4HNHA 5COAA 1F12A 1NVMB 1MXFA 4BNJA 2YV3A 1LDNA 4YWJA 4RPGA 2PFGA 4RVSA 1TEHA 3DMTC 5K6AA 2C29D 4CM4B 3Q11A 4TSKA 1P1HA 3QSGA 2EGGA 4HXYA 5ER6A 2O48X 3DFZA 1M6HA 3EZLA 2GF2A 1S7CA 3WIDA 4R5MA 2HMWA 3EZYA 3VPHA 5AXBA 1DSSG 1NX6A 3OMLA 5EPOA 5THQA 2W98A 4KUEA 2W2LA 2C7GA 2P9EA 3DAPA 5JYDA 3PJDA 1E92A 5DZSA 4PVDA 4BO3A 1ONPA 1NPTO 2J6IA 3KSZO 3RJ9A 3CTMA 5G4KB 3UGKA 2FPGA 3KZVA 4EEXA 5TLSA 4P4NA 3L9WA 4PG4A 4ZU3A 4W9NA 1OI7A 2YFQA 2V6FA 3FI9A 3NYWA 3INGA 4N7RA 5EERA 1KVRA 3UN1A 1ONOA 3LU1A 3E8XA 1P1RA 1LDGA 3FNFA 3DBRA 1IE3A 1NFFA 4Z3DA 1L7DA 2E4AA 5CHEA 2QQ5A 4IM7A 2ZJ1A 4BKOA 1P0CA 3DOJA 4JLWA 1U8XX 1H2HA 2WEKA 3QP9A 4CV1A 3S1LA 3VOSA 4MVJA 3U0BA 4E5KA 3HHPA 3HQ4O 5FYDA 1LDEA 1N1EA 5G2OA 1V3TA 3GUYA 1NNUA 2UV8A 2EKQA 5B4TA 4DLBA 4O0LA 3ZV3A 2OHXA 4YAIA 3RC9A 1E3EA 2GZ3A 1VKOA 1N2SA 2B36A 1WMBA 4RPLA 2YYYA 4YA6A 1LDYA 1M67A 3C7DB 4YPOA 3GVHA 1FDWA 4CR7A 1GYPA 3QQPA 2NVBA 5KNLA 2J8ZA 3IMFA 3ULKA 1ONNA 1P9LA 4BGEA 3A4VA 1ZEMA 1I5RA 2Q1UA 5TT0A 4E31A 2GN9A 3A28A 1U28A 2BRUA 1LEHA 2B4QA 2P91A 1BVUA 2UUPA 4M89A 1I2BA 3DZHA 2CVOA 2AG5A 3PK0A 4EJ0A 1KVSA 1ADCA 1EE9A 5CP8A 2OL4A 1E7WA 4E2YA 4EI2A 3V8BA 4L4SA 3NT4A 5TC4A 4D7AA 2IYOA 1DIRA 1JVBA 5A3VA 4DC1A 1FK8A 4UEJA 1GZ3A 3TL2A 3VH2A 1T1SA 4R69A 1F0YA 3WSWA 3WGOA 2C2YA 4XYMA 4M8SA 3JD2A 1FMCA 2CY0A 4ROSA 4YJGB 3RBZA 1WPQA 5JYEA 3PQDA 3OIDA 4EDFA 1AHHA 1JU9A 3EY4A 1OOEA 1W6UA 2IZZA 5JY1A 3CSDA 1XCBA 3KO8A 3GH3A 3WX0A 3RUHA 1PX0A 4BMVA 3EMKA 4XQ9A 2HU2A 3WQRA 2G1UA 3WS7A 4J16A 1U3TA 4GVLA 2VOJA 1FXSA 1PR9A 4C4OA 4FJ2A 4MVJI 1UP4A 4Z0PA 2Y1FA 3MJ4A 4WK6A 2CDCA 1MG5A 3C1OA 5FFFA 7ADHA 2WD7B 3IQDB 3U49A 2YFHA 1BG6A 1DC4A 3HN2A 4WLUA 3RBXA 1B8PA 4AVYA 1WDMA 1K0UA 2O4CA 3FN4A 5IG2A 3ZHXA 4JBIA 1R4NA 4PLFA 5L53A 1YKFA 4GMFA 5C5IA 1JKIA 3H6KA 1ZMOA 4WLFA 1DHRA 2CSUA 4DBVO 2EIHA 2C2XA 1O9BA 3CZRA 3ZCXA 1N7GA 1GYQA 2HRZA 1YJQA 4D3SA 5A03A 2W2KA 1E7YA 1C14A 4RQUA 1VSUA 4MKZA 4B8WA 3DHYA 1F17A 1LSJA 2QRLA 3MTGA 4HV4A 4FD3A 3GN2A 3LQFA 5IZ4A 3RI3A 3TFOA 1XR3A 2Q4BA 3B1KA 3KXDA 2PD3A 3CUKA 1CQIA 2OBYA 4FFMA 4E13A 2HK7A 1WLYA 3FWZA 4BUCA 1JAYA 1EK6A 3UUWA 4BNGA 1EEHA 4OAQA 1B2LA 4II2A 4GX5A 3H3FA 3LSYA 3EGOA 5KKCA 3GZNB 4XYBA 3S2FA 4HNGA 4N5NA 2O3QA 2WM3A 4URFA 4GWKA 2Q4EA 5I7SA 3FTPA 3ONFA 4IBOA 3WMWA 2JCYA 5DCWA 4W9NC 4IZHA 2HSDA 1K3TA 3R3JA 4JJIA 4YRDA 1PZFA 4BO0A 2CD9A 3TF5A 2EXXA 3C3XA 4KWHA 4FC6A 3K96A 5BSGA 1KYQA 4XKJA 4UVEA 1BW9A 4TKMA 5G4KA 1U3WA 3Q2KA 3ZWMA 3VKVA 1B3RA 1KEVA 1N92A 4B4WA 4ND4A 1SAYA 2P68A 3GGGA 1U8FO 4FOSA 1KVTA 2SCUA 3DAFA 1QG6A 1SZJG 3GRKA 1NAHA 1VC2A 3OECA 3ZNPA 3VH1A 1OC2A 4PG5A 3AUSA 5A1TA 1C1DB 2RH4A 1FF9A 1LDBA 2BELA 3LT2A 3FNHA 3H2ZA 3WNQA 3ZWAA 3EDMA 5AYVA 2CDAA 2HCTA 2ZJ0A 4L74A 5JCJD 5K0ZA 1C3VA 1KOLA 4BNZA 5ILOA 3AOEC 1HYEA 4CMBA 1HEUA 1OC4A 4AJ4A 1QYXA 1VJ0A 1IB6A 2VUUA 5HM8A 1JKFA 5A9TA 2X5JO 1HE4A 2YUTA 1Y5MA 2DPHA 2QW8A 4FC7A 4XYLA 2GERA 2HLPA 4R41A 3KOUA 3ZWPA 4AJOA 3UCEA 4DC0A 2EJWA 3CPSA 4PVCA 2G76A 4YT8A 2PGDA 4FB5A 3KYDA 3HFSA 1ADBA 1X7DA 2POQX 4M87A 3ENNA 2ZB8A 2NVUB 1NHWA 3G1TA 1D1TA 3V2GA 3GNSA 1ZK3A 2EKLA 4B4UA 1W73A 4ITUA 5CDSA 2P2SA 3W6UA 2LDBA 1I10A 2JD2A 3ROQA 1AXGA 2DUWA 1T2CA 4B7XA 3NT2A 2B5WA 1X7GA 2YHIB 3AY7A 4NJMA 1TI7A 5CG2A 4GBJA 2X9GA 1WNTA 4NBRA 3LC7O 2Y0EA 2E37A 1WP4A 2A94A 1LJ8A 1EUZA 2HUNA 3QVSA 3O8QA 1Z75A 3ZU3A 1P1FA 4GH5A 1L1FA 2WWRA 5CDYA 3N74A 1MUUA 4GAEA 2R2GA 3S2GA 3MJSA 2Z1NA 2BFPA 3G1UA 2IE0A 3LDHA 3GVXA 4BQRA 1DLJA 4R51A 1KETA 2BLLA 4HX5A 4FIZA 4CMKA 2WD8A 4RJTA 1Q2XA 4Q3BA 1XDWA 2AEFA 1RJWA 4TMFA 1YL7A 2EKPA 4GKBA 3D5QA 5THKA 4A0SA 3GDOA 2VNSA 3CMCO 4PLZA 1XU7A 4RF4A 1TLTA 3W8EA 4DQVA 2X0IA 1Q1NA 3AJRA 3PHGA 1FDUA 2NVUA 3D3WB 3F47A 3H9GA 2B37A 5B1YA 4YT4A 3WBBA 3DAGA 4RVDA 4EUEA 4UUMA 1H93A 1QYVA 2H63A 5CPBA 2GASA 2PLAA 4OIMA 2CF5A 4AL4A 1YE3A 1H6DA 1UUFA 5AQ1A 1DBVO 3UH1A 1G1AA 3B70A 1E5QA 5G0WA 2GGSA 3P2YA 3QW2A 1S6YA 3VDQA 3F9IA 4KP7A 2J5KA 2UVDA 4CM3A 3GGPA 2BH9A 1Y8RA 2GLXA 1MFPA 1DFIA 1VJ1A 4ZRNA 4C7KA 5CFZA 1HSOA 2UDPA 4IJUA 1PJ3A 2VHVA 3PIIA 4NJOA 3ZWXA 1B8VA 1NR1A 4I5DA 3FSRA 4WKGA 2GRAA 2RCYA 5C37A 5JBIA 3JQCA 1H6CA 5KJFA 3WGHA 3OP4A 4YCAA 4M55A 3ZWOA 1EVJA 3BMCB 2B69A 3OIGA 4BKQA 4E3ZA 2VYVA 1SEPA 2P5YA 3R1IA 4Y6RA 4XQCA 1Q7CA 3BTSA 1MB4A 1E3IA 1EVYA 4E32A 4XA8A 2DBRA 3B1JA 4YVFA 1DHTA 1GADO 3ROPA 4XRGA 5IZCA 1C0KA 4BKUA 5T67A 3H8VA 3EVTA 2IDZA 1C0LA 3DHEA 3ZHBA 5T5QA 4Z0HO 1EBFA 2G5CA 3A14A 1T25A 4CR8A 1PQUA 2O7QA 3JQAB 2VWQA 3L6EA 1UXIA 2HKIA 1P3DA 4D45A 1U4OA 2NU9A 3QWFA 3INRA 3RUEA 1OBFO 3PRJA 4F6LA 4EZBA 1WXDA 3L4BA 3B20A 5FI5A 5DT9A 3F46A 1ENZA 4WOKA 1X13A 1UZLA 1AE1A 1E7RA 1IL0A 3WFIA 2AE1A 1DC5A 3PJFA 4GLOA 1NP3A 1WVGA 1QORA 1DXYA 1DLIA 1X1TA 5JDIC 3ENKA 4QO8A 4LCEA 3FNGA 3JQFC 3NX4A 2I67A 3AOEA 1U4SA 4CV0A 3T4XA 4DL9A 4GGOA 2HRBA 2Z95A 1VI2A 1SPXA 3FR8A 1EVZA 2D3TA 5JY6A 3MOIA 4PGFA 2I9PA 4R68A 5TS3A 4CM5A 2GDZA 3D0OA 2D2IA 4YQYA 4UULA 1SB9A 1J49A 2OZPA 3QA9A 3U09A 3LT1A 4DLLA 3FWNA 1PZHA 4GL4A 1E7QA 5B4UA 1R16A 4BV8A 4NDNE 3VTFA 2EW2A 5LC1A 3PDUA 1ZK0A 2B4RO 1F8FA 3JTMA 2GUGA 2BD0A 5CDTA 4ZHSA 2ZK7A 1ZO8A 3RUIA 1NVGA 4RCVA 4DRYA 1SNYA 2C82A 1T2FA 3IJRA 1WAMA 5GMOA 3HDHA 1RYDA 1PJQA 1PTJA 2J5QA 3DTYA 3C1AA 5JC1A 2X0NA 3G49A 3C85A 1HF3A 1YONA 1GY8A 4J43A 1Q0LA 1I32A 3BMQA 1A4IA 3GDGA 1UXJA 3PZRA 5BNIA 3JD0A 1E6WA 3WB9A 6ADHA 5L45A 2PZLA 1YVEI 3I9MA 1GD1O 3S2IA 1Y5RA 1HDYA 3RC1A 5A5FA 4WECA 1HLDA 2PY6A 1X14A 3ROKA 3DBRB 1YB5A 4OGWA 8ADHA 2PK3A 2QHXA 5CEJA 2D4AA 1KEWA 1YQXA 3BHMA 5HS4A 4GLLA 1EVIA 1TT7A 4XYEA 2NU7A 2RBEA 2DKNA 4YJFA 4QXMA 4RGBA 4D41A 2DBVO 2CNBA 2VYVD 4E4YA 4ZGWA 3SBOA 1IHXA 1GV0A 1VRWA 5CAEA 1MV8A 3JYLA 3MEQA 3H9QA 1DDOA 5DP1A 5A04A 4DQXA 4U6QA 3M1AA 4Z3KA 3GN1A 2FZEA 1JVSA 3VZPA 5EQDA 3CEAA 4NU5A 4Y6SA 3K2BA 1T26A 1LX6A 3I83A 2FPIA 3BMOA 3U62A 2VWGA 4CM4A 1PJ4A 4MIEA 2IZ1A 3DFUA 1ISHA 4IMRA
chains in the Genus database with same CATH superfamily
5BV1A 4IWNA 3SZRA 1N6KA 5M29A 3HI6A 1D07A 1R0ZA 3TIFA 1ODSA 4GQIA 4G0PA 4H0FA 4OLAA 1NVVR 3MJVA 2FR8A 4YP5A 2Q2WA 4V0ME 5I7OA 1O87A 1NY6A 4K3UA 4G5RA 1PAUA 1UMDA 1K75A 1N2ZA 4FD2A 2OGSA 4PU0A 1WKCA 2KW5A 4H16A 4M9RA 1UFQA 1GEEA 1L5GB 4L75A 5E0OA 2VAWA 1M66A 1U31A 1CFJA 1Z5PA 1JFFA 1IONA 2JGFA 2WTBA 2Y68A 3AI3A 3LPDA 2QD2A 4IKEA 3RVPA 1TT5B 3TDMA 3WAJA 1BE6A 2XOKA 4WWHA 4BO4A 1U2DC 4OKSA 1KJJA 3OIWA 4NICA 3ZPXA 4NBUA 1D7OA 2FZWA 3JQ6A 3FHCB 2VTVA 5LIPA 3JS5A 1WUTA 2RGXA 3HB5X 2LV8A 3IR6A 4YBZA 5EJIA 1NOJA 2Q45A 3QKRA 3CR7A 2VOEA 2O59A 1X2EA 2Z2ZA 1T5HX 1HXHA 2WM8A 3B9QA 1GPJA 3BWBA 3PXAA 5EHQA 4E33A 4EK9A 5FWYB 5FOQA 4QAQA 4DAOA 3L6UA 2HLDD 4JOQA 5HFJA 2CNKA 4BQOA 1NATA 3WGUA 2A4KA 4Y1FA 5DT2A 1O4WA 2ZT6A 1T5LA 2FX5A 3N8IA 3AUXA 4IDEA 4W9RA 1JDUA 1SK8A 2D5IA 3MERA 3BVPA 3WRYA 2GAJA 4JJ8A 1AZTA 3BCUA 4IINA 3GWZA 4MV1A 3TSCA 2OAP1 4KWIA 1J2TA 1P4HA 1P5ZB 2I65A 2MT9A 1P0IA 2P1RA 3T3MB 4E2ZA 1BXZA 4PGAA 1PJCA 1IBKB 4KXWA 3LHSA 4MS3B 2H0RA 1LSOA 3TTWA 4EA7A 5KVAA 4RZHA 4HFMA 2WY2D 3V4ZA 3O8CA 4MR9B 1H2EA 1OXTA 1ITZA 1U6JA 2O50A 2Y99A 4LWPA 4TQGA 2NUTB 1Y48E 2WIJA 1MGOA 2GEKA 3REGA 2EBUA 1QOZA 1HC7A 2IPNA 3RS0A 3KCQA 1Y8ZA 1OXBB 4ZV7A 4KWTA 3A25A 2WWWA 1IVSA 5BSRA 2PL3A 1N5LA 1D3AA 1RJGA 1WU8A 2QXUA 1V25A 1UAGA 2W2QA 5KVVA 3ZWWA 2WWTA 4IHAA 4KNVA 4KVZA 1LLDA 1FDTA 4P4GA 4WTOA 4AC9A 1SU8A 1CEQA 1QWSA 3E48A 1F3OA 1ADGA 4E2XA 3ILYA 4I19A 3VH4A 4B80A 4OPMA 2XE7A 1SRQA 2RGNC 2PGXA 2HRRA 4ZEXA 2QZJA 3LBIA 4WNCA 1GVHA 4NBTA 1XHLA 4BEBA 3L7OA 4EY7A 2YZGA 3E5RA 1JJAA 3NEJA 2CNOA 4PRZA 3S1AB 4C4RA 2P8SA 4ADSG 4ZI7A 2JFVA 5EE3A 3P8ZA 3UMYA 4O4HB 2PUDA 1L5FA 3OF2A 2NZUG 2R62A 4U7DA 1I30A 1LQTA 2X9NA 3HBJA 1XE3A 1UK6A 1VB3A 1E6LA 1GQSA 2TMKA 4H7EA 1KP2A 5KZMB 5FHRA 1PWXA 3A1SA 2JC3A 2P4EA 3C1UA 4MMYB 6REQA 2R6DA 2Z56A 1YZFA 5L7YA 4MQMA 2IS1A 1Y0BA 3V4SA 2I99A 3BTOA 4FR5A 3I2JA 2C8LA 4XTCS 4QTYA 1QP0A 4IFBA 5C8ZA 2W11A 1R0XA 4IVQA 1ZD5A 1JAHA 3K4QA 4NU6A 2GK3A 2PJDA 1BWPA 5F21A 5DGTA 2VTDA 2XMPA 1AQLA 4WADA 3MPUA 4BP9A 3CB2A 4PAWA 5IHXA 3G0IA 3MHPA 1CF2O 3OQVA 1UDXA 2PZJA 5HQ3B 4G4SO 4DTIA 2P4QA 2VPWA 3I9V1 3FNIA 2BZGA 2PQ0A 1E2IA 1G4UR 2Q9CA 3OZEA 4WNAA 2FK7A 3HO6A 5I7AA 1QC5B 4K3VA 3UHFA 2O2CA 4FOOA 2P9BA 3LUFA 4UHBA 4QVIA 4FR0A 1Q7EA 4RZUA 1RW4A 3WK5A 4AQ7A 2IBMA 1IATA 2ZUSA 3B5EA 3G8CA 4MDYA 5DNCA 5GGYA 1U99A 3ZV7A 4TWZA 2HMAA 3IJ5A 4GMDA 1LF5A 4RNDB 4EHFA 3FFAA 2OCLA 3B5IA 4ND6A 1UZMA 1PP4A 1SXIA 4TTTS 2VQDA 5CCBA 4NYJQ 1LW7A 3VC2A 2P6PA 1KI6B 3QKSA 4CTMA 3SZOA 3ED5A 4Z49A 3WSVA 1R0RE 1XZCA 2HYIC 4V1CI 5JQGA 5KIAA 1V3VA 4M99A 4D92A 1YZQA 1RM3A 3VVMA 4AKHA 1CY2A 1PYOA 3E5MA 3QPBA 3SNHA 4XWKA 5JSZB 3ZJ5A 4PLWA 1QIKA 3V46A 1LF0A 2A86A 1OKKD 3GFBA 2FSSA 5FWYA 1EFKA 4CODB 3QEMA 5BQFA 4A03A 1T9BA 4F3NA 3JVEA 3NM5A 4M0LA 2GBPA 4MKHA 2AGVA 2VRBA 5BSKA 1C41A 3BXFA 3DD5A 1W94A 5B2ZA 4POOA 5ICCA 3P0IA 5JBQA 1XHFA 2BGTA 2E4VA 2ZT7A 2CHVA 3G8YA 3L1UA 4OLHA 3X1ZA 2ZSKA 2ZFUA 4L6IA 1QVWA 2X5XA 3B7GA 3OZBA 4LRXA 1EAYA 1RWBA 3FHLA 1MKYA 1F5NA 3MJEA 4UHFA 2XUHA 5JAUA 3COJA 1IXRC 3E3AA 1V6CA 4ZOLF 1QF6A 4A2PA 3T1VA 5AVRA 3IP1A 1ONBA 1QCCA 5I9LA 3AEKB 4MYDA 1SOWA 4J6FA 2PXXA 3F67A 3N05A 4BE4A 1VYUA 3EAGA 1IOLA 3K1JA 4BFYA 2VYFA 1QUEA 4I9GA 4J0JA 3BXXA 4QOIA 1NONA 3VVCA 3E7XA 3HR4A 3F7MA 4S0ZA 4LFAB 4YK7A 4H08A 4LZLA 4LOAA 1KY2A 1P45A 3E5HA 1WR8A 2N1BA 2ZT5A 1GAEO 1AGPA 1BQ4A 3LSTA 3K8ZA 2OGUA 1LLCA 2D5CA 1E9CA 2HMUA 2XQJA 3CGGA 4FDAA 1V5EA 1CS0B 4J1TC 4Q12A 5AQEA 1JAIA 2GLTA 2D0IA 3B3GA 3SEAA 1XCGB 1REQA 3K9WA 3O2NA 4R2MA 1UC8A 1PHRA 1G6KA 3MTEA 5AI8A 2PT9A 2VJBA 3GJQA 1UBLS 4P22A 4OQQA 4D82A 1MF7A 4Y0VA 2EHJA 2GPTA 2I3ZA 3VNSA 3E9EA 2J08A 4P2GA 1EK0A 1U7ZA 1JIIA 1E1MA 3QHQA 3TFQA 2V54A 1MFZA 5DWQA 4Y2QA 1NUUA 2H1SA 1U04A 2IUFA 2ZB4A 4HB2A 3ZZTA 1RQLA 2AOTB 4PO9A 5ENDA 3WJ1A 5SZHB 3ZHTA 4BL5A 1K6JA 2AIRA 3OZDA 2E9SA 2QLLA 4RKFA 3TNFA 4YXFA 1JKMA 1KFBB 3VKHA 3DL4A 1Z22A 3QY0A 3BKWA 3E18A 4IUCS 3W05A 4JELA 3ACDA 4R01A 5BNTA 1CUZA 2I29A 2H2WA 4HGZA 4YQEA 1LNQA 4GRIA 5F4ZA 4OLJA 1OLUA 3BA1A 2NTNA 4M8IA 2AN9A 4HD8A 4NCNA 5ITVA 5H4HA 4WCFC 3R0VA 1PEDA 1CR1A 1NYLA 1O7JA 2GBGA 2YS7A 2ZULA 4PSCA 1PJBA 4UXIA 2BGJA 2RG7A 4YASA 4CEHB 1E9DA 2WJ3A 4MP6A 4RLHA 1GXSB 2ARKA 3BEDA 3PQ5A 3R8CA 2WBLC 4RK4A 4HJXA 3O38A 1LRKA 5B4VA 4DABA 1SQ0A 1TPZA 1U8AA 3WBFA 1J1ZA 4LHWA 4BBZA 4QUKA 2MHCA 1CV2A 1UKVY 1G9XA 4IZHA 3RHSA 2PGAA 4P8RA 3ER9A 1BTOA 3TIGA 4TMTA 4M86A 4EB3A 5EXEA 3Q1KA 2JLBA 1YBAA 3TQFA 1MAHA 1N2EA 1C3OB 1YMQA 2YHSA 1XF1A 3IAM6 4OHXA 5DHFA 2RH8A 1BYIA 1N2CA 5ADHA 1Z4MA 1T15A 2GXQA 3D6FA 5TXGA 3QVTA 3X1KA 5HKBA 1OMOA 4QREA 3AF3A 4R83A 1O5IA 1AO0A 1O6FA 5FPHA 2B35A 5A4JA 4I4CA 3WLMA 4IDPA 5GZ1A 1A71A 4OXRA 4WIAA 3MJRA 2XH8A 4FI3F 3D4OA 3QITA 2O8BA 1N5JA 3HM9A 3RJTA 1DOZA 1DBSA 1PJAA 1L4KA 1GJRA 3P27A 5FULA 2F3TA 5AR1A 5EOVA 2OAGA 4R0NA 4AZTA 3KTFA 4UM8B 3MMZA 3ONWA 2R25B 3IAHA 3MJFA 4TUYA 2Z4SA 4AUNA 4J1SA 5KTKA 3V5NA 4KXNA 3YASA 4BVHA 4CCYA 4X64B 4DA7A 3FNRA 1R3DA 2YWEA 1OASA 3RWMB 3EH1A 1BXGA 3WE7A 1QYCA 3IPXA 1E2MA 4Y2VA 1UBKS 3LRXA 1VHTA 4EO4A 1OAAA 5JI2E 4B84A 2F43A 2QD5A 3JAWB 1XVLA 1QH1B 2QV0A 2HPAA 1K3FA 4OXXA 4TWAA 3GHHA 3PHLA 2QRZA 4KR3A 3E8SA 1OYYA 3FNEA 2O07A 1GQFA 3U56A 4KI0A 2BL4A 2I6GA 2PU5A 3R4VA 5DBEX 4MUYA 1YAHA 2PFKA 1H0HA 4FZVA 4AIIA 1W5TA 1LU9A 2N46A 2PMBA 5CB4F 4MCJA 4ZOLB 2R84A 4R3NA 1DXQA 2XGSA 5KYXB 4LGVA 4HNSA 9ATCA 3DEYX 3NDIA 4ENVA 1D8AA 1Y63A 1EX6A 1XRJA 2QTCA 1IAVA 5CCDA 1P6UA 4CM8A 2C4HA 5KQLA 2V45A 3HBAA 4B8ZA 2JI8A 1E9RA 2VJAA 2ZZKA 3KBOA 3QOFA 4H6PA 4K86A 3UC5A 1FXUA 1RTTA 3MCVA 1JNXX 1GN8A 1XFDA 5AKKA 4V0KA 3GT0A 4PIPA 2D2VA 5I45A 5BW4A 4MWOA 1P9OA 4EA8A 1R6BX 3RS5A 1EQUA 3C3EA 2IDJA 1DZ3A 1E1LA 1US8A 2WFLB 4JJKA 4L27A 3SC6A 4GKJB 3QG5A 2ZRJA 3D8RA 3K9QO 4PG7A 4PLPA 3KCNA 1WXGA 2Z4TA 2D1RA 3PKIA 4IDFA 4J29A 4R6WA 4YJDA 2I3GA 4F9TA 1B6TA 1KYIA 2C2ZA 1CFZA 3THWA 4LF9B 3MCUA 1OI3A 1UJBA 5DTRA 3LIIA 1HDZA 2PO7A 3KJEA 2DWUA 2IOFA 2QS9A 2AJCA 2OY0A 3PPIA 4NYMQ 5CLGA 4YUZA 1HNWB 1YQWA 5EMMA 3BB1A 1UWCA 2BKAA 2WR8A 5AW9A 5ALLA 5CK4A 1ESDA 2JIZD 1U2ZA 1FS6A 2X77A 1BKDR 3R3SA 4H6VA 2PRYA 5CFNA 3PJGA 2OCPA 1OZHA 1AA9A 4LXHA 4X90A 3GEPA 1JZQA 1I2ZA 1HDGO 1ZWKA 2ZYWX 4U7WA 4YCNA 2B30A 1CRPA 4BWVA 1A5SB 3C2QA 3H2KA 3QVVA 3I42A 3X0DA 2NYVA 2PS1A 2FPOA 1D9XA 1K8YB 2XGGA 4WBXC 4DKJA 3W3AD 3ENQA 3WKCA 3X1DA 5KWJA 1JXAA 4JKOA 4CT0A 2NM0A 4XWAA 3WNVA 4BU1A 2IYWA 1F8YA 3P2KA 1B0UA 3B36A 4GLBA 3C43A 1LGYA 3UJPA 4CN8A 1WQ1R 1AB6A 2WIAA 3QVWA 1Z0DA 1E79A 5CH8A 5DX8A 3SFVA 3SY8A 3A1TA 2O57A 3P52A 2Q5FA 4HLNA 1FJXA 2RJNA 3KEFA 4EMTA 5K5EA 4MIYA 1PJLA 4E5YA 3TZHA 2WV7A 3UPTA 2NTVA 2OZLB 1KQ3A 4RADA 3VTZA 1PW5A 2QJTA 1BHO1 3BAZA 2QN9A 1M2GA 3T35A 4OU5A 4HZUA 2PXHA 1CUUA 1C7IA 1P18A 1TZJA 3EE6A 3NHJA 4B6OA 2OGWA 2ZT8A 3WGMA 1E3JA 5TJ9A 3BERA 4K9NA 3SSAA 4CG0A 2JG3A 1PN3A 2Z6UA 1KH1A 5JXJA 5F5NA 1I1HA 3GEGA 3DWGA 3D81A 1JBKA 2VDOB 4IJKA 2IEBA 3U7EB 2C58A 1RKVA 3BULA 4MW1A 2N42A 3JQ8A 3PKZA 4XB6B 4DSTA 3USZA 1UQRA 8LDHA 4X6XA 3LYHA 3SK0A 4QECA 2XE6A 4DREA 5C1DA 4QU8A 1Z4QA 5LPNA 4G4SP 3CC8A 3GEMA 3RW9A 4ZZ3A 5CFLA 5LP6B 3PGKA 4KN6A 1UL1X 2BFCA 4INJA 2VKTA 1G8KA 1USVA 4F60A 5EC8A 4Z4IA 4PE5B 2LD4A 2WG2A 2A5YB 3SC3A 3WLLA 3K71B 1X3SA 3EDRA 5KAMA 1JT2A 2A78A 4HGYA 5EJAA 5B7PA 2HHHB 1U1CA 1TADA 1NFQA 2MINA 4EJSB 2J5RA 5KNBD 2WA1A 1MOZA 3L7MA 3W0LB 4BWGA 3B12A 5FL7D 2F6RA 4Q00A 1CB7A 4J1TA 4WFJA 4O3MA 1ECFA 1JQ5A 3SQMA 4F7WA 1XMQB 1VLVA 3CH7A 3ESCA 3QTTA 4WE3A 1NW7A 3TLGA 4BMCA 3NTRA 4ZOQI 4UAVA 3RBAA 1SMKA 1N2OA 1FTQA 2PTGA 2PQ6A 1RWVA 3SVTA 4ZQGA 2Q07A 2WU8A 3WQQA 1O94C 3S68A 3HU2A 1R5NA 1XRNA 2BEVB 4X1YB 3ZGOA 5C35A 3TEJA 2GCOA 3B8EA 5IEJA 3NBQA 5T4BA 4Q21A 5DSXA 5ECWA 3OM0A 3IURA 1A88A 3D2LA 4PZDA 1Z37A 3AVWA 3CA8A 5LMCA 3GP8A 4L0DA 3GROA 3IMGA 4NEHB 3ICQB 4DWVA 5LN1A 4RDXA 1YZGA 2G0AA 1G19A 1GGFA 3VFDA 1Y3IA 4R2JA 2H5JA 2ZJFA 3V34A 1RZUA 2QX4A 4MV4A 4P3OA 2ZWVA 2NZWA 3RS2A 1R3UA 3LUKA 3VSCA 4U8GA 2BGWA 1NMYA 2B83A 4XDYA 4KGVA 2H7CA 3GOQA 1ZI6A 2HGSA 2IUTA 3NTOA 1E2JA 3DDOA 5GV8A 3AM3A 3G85A 2GCNA 5JNRA 1YULA 3COYA 4KVAA 1Q0ZA 3T3EA 1DCMA 5BT9A 5TPWB 2IOYA 2IY9A 2QI9C 2DQSA 3BPSA 1PJ2A 4L50A 4HDKB 2VAPA 3HFRA 4H4DA 1MH9A 4HRVA 1S3SA 3GA7A 3Q3HA 4QPJC 3KVVA 2A3RA 2IVZA 2VPQA 3GWGA 4X94A 5SY4A 1IXYA 1XXHB 1G41A 1TM4E 1XCMA 2EGUA 3CQ9A 3VPBA 3L3BA 2Y05A 3ISTA 4N0QA 3AO0B 4NSNA 1F0PA 2K7FA 1ZC4A 1YCGA 1P5FA 4IIYA 1VLQA 1JB1A 3HSYA 2QTAA 5I7EA 4G41A 4NMHA 3RCBA 2A0UA 2JGNA 1UK9A 2R1VA 1G64A 3BJEA 3IIKA 3JQDA 3V33A 3L7LA 3HCBA 1IZ9A 4HY3A 3DPUA 5JS2A 2GA8A 2NOAA 3A9TA 5KJEA 4JZKA 4YJ3A 4EY8A 2CYBA 3M6LA 3OZTA 5BSFA 1CP2A 3B48A 3GEBA 1P8JA 1RXSA 2B9VA 3ZY4A 4F0JA 2E0IA 1YFZA 3HXTA 2L42A 2AG8A 1G3MA 1GZ4A 1V8OA 4KO3S 3ZHVA 4LS3A 1Z6ZA 3BAFA 1W48A 4ZRDA 1Z73A 2H57A 1YFLA 1QGUA 1JLLA 4LSWA 2WFZA 4P08A 1W88B 2GSDA 4K87A 3CRNA 4JYMA 1W44A 4K8OA 3KQMA 4FCVA 3EPLA 2H2FA 5EINA 2I76A 3R20A 4FMDF 5EFOA 1WUIS 3RLIA 3VSBA 4ZCMA 1T8UA 4YRRA 4ARSA 2BSQA 3E9NA 3ZXYA 3ST7A 3GRPA 1QS0B 3MMPA 2H59A 2P9QA 1L4YA 3COVA 5GAJA 5IXYA 3UVEA 1CVRA 3KAQA 2MSKA 2PN1A 1O9HA 2EF1A 1EUDA 3JQ9A 3KB1A 4NC9A 4J7CA 4OQXA 1W36D 2JGKA 4BQEA 3A10A 4NOMA 3UMFA 1ECLA 2G40A 4M7OA 1FSPA 4JSRA 1BWSA 2N9UA 5D00A 1TD9A 5CT8A 1A4RA 2NG1A 3EXHC 3PDJA 5F3DA 3B85A 4US1R 5K1ZA 2O05A 2JD1A 3R0XA 5JTUA 3MF4A 3OTQA 1KK3A 1KI3A 3IVXA 3MWEA 3NEPX 2BKUA 1GZ7A 1XEXA 1AKTA 2G9QA 2C5HA 1ZCAA 4O33A 3STTA 1JHAA 1PR5A 2ZRMA 2O0LA 3I0NA 3RVLA 4YCCA 3VQTA 1Y1SA 4MWZA 3GGCA 4QOSA 3MNFA 4HN9A 1I5OA 1MH1A 5FBLB 2ODWA 3BMNB 1RVV1 5JJKA 3KHSA 3ZCRA 4NFLA 2QF7A 2FSVA 3W5VA 2X8JB 3ESBA 5DK4A 3IVCA 4G37A 1MXHA 3B3JA 3QUCA 4U0JA 1MO4A 4V02A 4E22A 1F14A 5BO5A 4N7BA 5IASA 5J4LA 1LTQA 1V1RB 1Y5NA 3F7OA 1C1XA 2A5GA 4Q4JB 1NMQA 2IX3A 4IY1A 5KYNA 4M6WA 4WESA 1HE5A 2GN1A 2HBYA 1XQ9A 2D7CA 3D8TA 4IQFA 2A0YA 3SHTA 2A57A 1IY2A 4QL3A 1DDIA 2C2HA 4LYJA 3AR5A 1GTMA 1IQPA 4K9OA 3JWJA 1J4AA 5BQ5A 1FFBA 1DWUA 1G8JA 1C50A 3JQ7B 5KMGB 4CXMA 3ZBUA 3W4KA 3TQIA 1ZK4A 3Q7EA 1HDXA 4M6WB 5JZVA 1Z8HA 1BMDA 3WWOA 3VR3A 2J9YB 4FXPA 1WHSA 3MPOA 4Y6GB 2UVPA 3LNCA 2CLCX 4R9SA 2O4UX 4YXWD 1ATIA 5GZ3A 3SJAA 3NALA 4K40A 4X3CA 1Z5NA 3UGQA 1KK2A 3NOXA 2H4XA 3DDSA 1CHNA 1UBUS 3KJIA 4Q1AA 3ZU4A 3JPYA 4I5FA 2HCRA 3IAXA 5AW2A 1QLWA 1NBWB 2QU8A 4KFCA 3E8MA 2QW0X 4EGFA 1MAWA 3VNRA 3P9SA 3OT1B 3EISA 2WHXA 1WCV1 3P96A 3V32A 5TS2A 1TEVA 4PAOA 2CLMB 2DBQA 3B6JA 2ATEA 2ILTA 4COKA 1JG2A 3QOWA 1H8HA 2V7XA 3ODGA 7YASA 1IHYA 3MYYA 4MJ3A 2WUVA 2R6FA 4G81A 2GZDA 4X91A 1GA4A 1KP9A 1Y8AA 4ASUA 1VBKA 1YT5A 1QC5A 2APJA 5EFZA 3A32A 3I8OA 3RBVA 3F74A 1VG1A 2ID7A 2RJOA 5AI5A 2GI4A 2UYOA 3T3HA 4YMLA 1VYTA 4K6MA 1GQOA 1X1RA 3PC6A 1U5BB 2GCOB 2FZCA 4H3SA 4R9RA 4Q39A 1V6AA 1OF1A 1PR2A 3EAFA 1PGJA 3RASA 3K31A 4R84A 2IYEA 4UMDA 4FHGA 2H11A 3MTIA 4IH1A 1GU7A 3PE4A 2OV2A 4F56A 5CDUA 3FPJA 1YO6A 4Q3NA 4RA6B 5K0BA 2FEOA 2FFJA 4LKRA 5DOVA 4DIDA 1LTHR 5D7NA 4GQAA 2Z1MA 2J6HA 2ZG6A 5AI4A 5U4QA 3UQZA 3SD7A 5JSZA 2OCGA 2OORA 3NJ4A 2EBHX 5I8PA 2Q28A 5CM2Z 1AT1A 2IU0A 3D6TB 3MTAA 1ZL0A 3OFSA 4KO4S 4JQSA 5CLLA 1TM3E 5TX7A 3U61B 2WAAA 1JDVA 1XJCA 2D4HA 1TNDA 3PZBA 4GSYA 5I5GA 1E1CA 3L4SO 4TZ0A 2DUUA 2IHVA 3RRFA 4QDUA 3TX6A 4DUZB 4Z7NB 4QX6A 1XQXA 4LOJA 2A9PA 4DZTA 2FPPB 4YDQA 4JVMA 3WHIA 1PR3A 4MW9A 2GD6A 2FSFA 1NWHA 3M83A 4KCGA 4QPZA 4IHKA 3SM9A 1BDJA 5AUQA 3I45A 4TWBA 5KOYA 1A2BA 4QC2A 3DF9A 5BMOA 4JI3B 1UBGA 2GNAA 3GFSA 3THOA 3MTBA 4BRUA 1J0CA 3PLNA 4JLPA 3BE4A 3O9ZA 5FR1A 2VP0A 4RPJA 1X19A 2BGMA 2V6BA 3OZVA 3U0VA 2QPOA 1QUFA 4WEOA 1VKJA 4BFUA 2NMVA 2A0XA 3PFNA 1DC6A 2EDAA 5F1PA 2OYSA 1RAIA 1CTQA 1EVLA 4YP1A 2ZWOA 2G4CA 4QVGA 3R7WA 1OT5A 2F4VB 3EGIA 1X15A 1NYTA 4L3VA 3UUFA 4HR7A 3CRRA 2HOQA 5DGDA 1M6VB 1QRTA 3DE3X 4HADA 2M32A 1WXFA 4GYJA 4Q3DA 4RVUA 4YAWA 2ZRBA 1FEZA 1ODLA 2L17A 1EGQA 4NENB 2YZ2A 3TTXA 1RKBA 5A0TA 3ADKA 1Y7LA 2PUWA 3M70A 2GNOA 2ZAOA 4CKYA 5LYJB 1L7QA 4YRJA 3PHBE 3C87A 2VF2A 3QJYA 4UNNA 5J9FA 3SLKA 2YJ6A 2GESA 1B42A 2FQXA 4KXVA 1KBOA 3RUPA 4MVJH 4HDOB 2OHVA 2X8LA 1M8JA 3SN6A 4FBGA 5FTMA 1XA0A 3HBFA 2PGLA 1HG0A 2XZTA 4IV0A 2EWVA 2IIVA 5JPIA 1EZZA 4AF6A 5C9ZA 1T29A 5LQDA 3I23A 2ZEJA 3ADCA 2PJRA 1O1YA 2XVZA 4HB3A 4W8GA 1UEIA 4H18A 1Y6FA 2I0FA 3RUFA 2QMQA 2XCQA 2BGKA 4IR7A 1K92A 4K9LA 2J0UB 2XJ9A 4BVAA 3E58A 3R3WA 3LGXA 4CCAA 4W5RA 2NSLA 4C21A 3DE1X 4FKBA 1AM4D 2XBMA 1HLPA 2IOQA 1TJ3A 3T94A 1N9GA 4AJHA 1JKJB 4N3CA 1F48A 2QG6A 1Y9JA 4UMVA 4WRRA 1LRLA 4GGPA 3KQLA 4UBOA 1DTEA 3LRTA 4I9HA 1N6NA 2C0QA 2PZAA 3CX8A 5SZJA 2XQGA 4WZZA 3GPCA 1U11A 5BRAA 5I47A 3DEFA 2UKDA 5EQFA 2CFTA 4G2NA 1BCSB 1K9SA 1N8TA 1QHXA 4OKIA 3V7NA 3WGNA 1F6BA 3TJZA 1O6CA 2DE0X 3QU2A 1WD7A 4HGOA 1RXVA 5AJHA 2C4KA 3JAMA 1QHEA 1ZD3A 3CCCA 2F1KA 4KW7A 3RSOA 1PK8A 4CM1A 4EJ6A 3ND7A 3W6NA 5DISB 4JT9A 4WJKB 2C20A 5KJCA 1N0VC 5CW2A 4ZVQA 2V5VA 3ZKAA 3BFJA 4DYDA 3L7JA 3HCAA 4XVHA 1ST2A 1X77A 3DV0A 3HXLA 2WDPA 3KT3A 5EUMA 1I36A 5JMOA 3AUYA 1U90A 3PNQA 2AMVA 3TLJA 4KFSA 1U28C 2IU3A 2HGZA 2QUAA 4G36A 4C2BA 4F5WA 2V0NA 1I3NA 2B8EA 4ZQCB 1LPNA 1ZM4A 4AO7A 2BTOA 4Q24A 3I0MA 1KZYC 2E4WA 4UEOA 3CX7A 4TM8A 3F6BX 2JLRA 1Z34A 2B8NA 5CFQA 4R8KA 1HWYA 1IPHA 1W5BA 2YNMA 5TGDA 3VH3A 5ESWA 4LQDA 4B3TB 1H3NA 1NURA 2H1RA 4ZN6A 5B6PA 1JH9A 4NVRA 3ERCA 4KITB 4NV0A 2DZDA 1XZGA 1D1PA 1KEEB 2HSZA 2VRNA 4IDBA 3T7EA 4DIOA 2YV5A 1VJ5A 4CNBA 1LPPA 4JAVC 3MJCA 3OLYA 3WLNA 2ZUBA 4CUZA 2JDID 3FKSA 4FP9A 3DLIA 1X1EA 4MOWA 4MKFA 3R77A 4C06A 1S2DA 2DTEA 4Y9SA 1GNVA 1J7JA 3BRWA 3WGLA 1E4EA 1PSZA 3R3HA 2MSEB 4QULA 4WY5A 4YFVA 1FPQA 4K5QA 3T0GA 1G291 3DEKA 3DVAA 1DARA 1Y3FE 4XUDA 2EL7A 1E98A 3EK2A 4FFNA 4RH1A 5CT5A 2G06A 5TSDA 1KH3A 3ICWA 5FTJA 4LGMA 3VXKA 2GJKA 2Y1CA 4P3YA 4KACA 4JGIA 1UPXA 4IIEA 4NATA 2GRJA 3WYFA 1VA5A 3I0ZA 1FFYA 1T43A 3EQZA 2JFGA 3A6GA 3GVPA 1JHMA 3MJTA 3NNDA 3OY2A 3QYPA 1VGQA 5HQJA 2C5BA 1SUDA 3ZCTA 4BRSA 1T5DX 1LBIA 3FJYA 1GPH1 2Q27A 4WGGA 1KU0A 5A4MS 3KKKA 2YXPX 3Q9NA 4W82A 2H4HA 1XNRB 3C5HA 1A9ZA 3BHIA 2V7VA 1ZFNA 2OG1A 3ZDXB 3HMKA 3I61A 2B7LA 2OTCA 3DLBA 5CNMA 2FMIA 1FVXA 4FYHA 5JAHA 3NBAA 4MJLA 1NJ1A 2WKSA 3UT6A 3OPYI 4UHCA 4EJFA 1YBVA 1NVAA 4QTUB 3SVZA 3UM9A 4HDRB 3ZJYA 3CEPB 4EYSA 4MS4A 3RFVA 4IQ4A 1CD5A 4BN5A 1ODJA 1SWWA 3I6IA 4L6AA 4D25A 3IC5A 3JR3A 2OBNA 3T7RA 3DZFA 1N9GB 5F2EA 3DULA 3ZS9A 3I64A 1LB1B 2L82A 3IOYA 1E5TA 1P7WA 4GS5A 5DBIA 1LD3A 2PZKA 1OPRA 4X6UA 3UHPA 3D3EA 1NI3A 3IE2A 1S9HA 3M2PA 1GUBA 4KV7A 4B4OA 2C4VA 2DHQA 1RIFA 2Y0DA 1KHHA 3LQYA 1SHTX 1ZY2A 4HH4A 3KB6A 1OWLA 4LYDA 5D84A 4MIKA 4AXBA 3TZLA 3OQIB 4L5IA 1Z25A 4K03A 1OBVA 4QU5A 2G1AA 4BLWA 3W6PA 1WB9A 1E2GA 3MQ2A 3LOQA 1UWVA 4RW0A 2D5LA 4FBLA 1ORHA 5K8TA 1OI4A 1XEWX 3RKSA 4EHKA 3LZ6A 1K86A 3OEYA 3B1XA 3QE3A 4TKUB 3TRFA 3ZZMA 5DNUA 1J8FA 1TQ8A 2HHJA 2HF9A 5GZ6A 3DR3A 2FFRA 1WCXA 2ADMA 4K8RB 1M54A 1FS5A 1HT0A 2NO1A 1EDEA 2B1RA 2VF4X 1MO3A 1XQ6A 3GRUA 1BXKA 3QFSA 4IKPA 4JLUA 5CYPA 3HMQA 4XX0A 1GSAA 1ZIPA 1X92A 2YBEA 4LXIA 2B61A 1T5TA 3DTVA 2XMDA 3BT7A 1P1JA 4RZ2A 3OX3A 4CWAA 4EW1A 1PVDA 1SG6A 4OSOA 3W5IA 1M1YE 4EWLA 4ZODA 5TIIA 2RI0A 3GP5A 4HZUB 1GZVA 4YUXA 2W90A 2X42A 3HDTA 5BOSA 4PLGA 3A7EA 2Y1GA 2PPLA 2RSLA 3COSA 4TVBA 4F7DA 3NHPA 4UTXA 1KFKB 1OAOC 3K0EA 1DAEA 3ZXSA 1X1DA 2WT8A 3DM5A 3T7CA 4F2WA 1R0CA 4J2HA 4YQFA 1O8BA 1M2HA 1ZN9A 3Q3GE 4HAXA 2D1SA 3CCBA 2O8FA 4DT1A 4ZA2A 2ZIGA 2PMEA 4X65B 2BGRA 4JLAA 1W0CA 5AP9A 5DRTA 5IKEA 1TX4B 5JHHB 2BRUC 5EMHA 4JBLA 2JAOA 3N58A 5ETJA 4DN6A 4RV9A 4DR4B 4BO1A 3UB3A 2F3UA 3B3FA 3EVDA 3PVCA 3HGQA 3JRWA 3Q3CA 4OM8A 3ZDFA 4NV3A 2RB5A 4B33A 5IX8A 3ZX5A 4KSBA 4F45A 4Q93A 4WGFA 1XZLA 4X00A 4PR3A 1PGOA 1KI8A 2PS0A 1OTYA 1XPRA 3T3IA 1OH6A 1NVTA 2ZWMA 4AICA 1EM6A 2O8FB 2ADFA 2PWZA 2C2MA 2OK8A 1Z3IX 1DBRA 2E4XA 3DBIA 1U7DA 2C88A 4WCFB 3SP1A 1H94A 3AWIA 1G21B 3R6LA 3S2YA 2WSSA 3TUIC 1QHIA 2QN8A 5EXTA 4A0FA 4XB2A 1WDWB 1N5DA 3JAKB 1ADJA 1DKOA 1GRQA 2NNLD 4B83A 2HT1A 1NJ8A 1UZUA 3PDHA 4RK6A 3K6KA 4MGIR 2CB9A 2I6XA 5B6JA 3OZAA 5JD6A 1QFXA 2VRWA 5C18A 5CXUA 1SBZA 2YVUA 3H4VA 1ZJJA 3AUJB 4O4JA 4PANA 3K5IA 3IRUA 3GIDA 2ZB3A 5AHOA 3WL4A 4PYOA 2HDHA 1JR3D 3CX3A 1SXPA 1I7DA 5AK4A 5K3SA 2OCIA 1M5TA 1P2VA 3L49A 4ZZ1A 4BMPB 4D6XA 2ORYA 3CPHA 1VKRA 5E4YA 4B9EA 3LPMA 1E77A 3DHNA 4OHOA 3VR5A 3CVWA 4MPDA 4MUAA 5LQAA 2I2XB 1Z7WA 2B5VA 4LJLA 4CNQA 1Y6RA 3AF5A 3FF4A 4N03A 4D02A 2ZVJA 4Z8XA 2GK4A 4NNJA 5AM5A 2ICAA 3RVMA 4GMKA 4N9WA 2ET6A 4OFWA 2RGGA 3KLOA 2GBFA 2IXTA 4DG5A 2O2ZA 3H1FA 1QHNA 3WL6A 1O6ZA 1P6QA 3AEUB 3CZQA 4WK2B 5A02A 2PUEA 3K9LA 3F71A 4OI0A 1SCIA 1TECE 4G86A 3WR5A 4E5VA 3NBMA 4XGKA 2VTBB 2XZLA 1VJCA 2QXTA 4ER6A 2BFEA 3FDXA 5FBZA 2BI8A 3TZEA 2UVPB 1EA7A 2JBAA 2W6ID 4ONEA 3IH5A 2Q5OA 3TI9A 1VDZA 1PI3A 2GPAA 2JCBA 3GJSA 1GCIA 3Q0TA 3S7ZA 2V3VA 4YPFA 1QQAA 4DMGA 1FUEA 3DT6A 3E82A 3VPDA 3OIYA 2ZSHA 3AR9A 1GCOA 4FGJA 4QYXA 5E2AA 1A97A 1IZ7A 3PF8A 3PRHA 1BA2A 3R6GA 5FQNA 1EUYA 3F78A 2NAPA 2WK1A 1GITA 2XAUA 4WCDA 2ZVPX 4UU7A 3WIEA 5DM70 2DX7A 3KQHA 1T3TA 3H75A 1N0IA 2X41A 2J0VA 2XCUA 4P1ZA 4BIMA 4NXMB 1ZCBA 2FOLA 4R98A 3ZUGA 4JXJA 3E0XA 2GARA 2XUPA 2ZTHA 3KUCA 4MO2A 4RKWA 3ZLTA 4LZWA 3ZV6A 3KEQA 2Z2XA 1WF6A 4U4AA 1T9HA 2BI4A 4N40A 1FQWA 1J9GA 3THXB 1KO4A 3EUFA 4KE8A 1LPAB 4IZOA 1Y3HA 1EAMA 2PV7A 3R7WB 1GKKA 5CCXA 2GTIA 1M34B 2COUA 1JAXA 3KSAC 3D8BA 4PF1A 1VPTA 1U0SY 2VO1A 1SA0B 1GN9A 4W6ZA 5TQJA 1OBOA 2WYHA 3H0CA 3I72A 2GLUA 5FFNA 5AUPB 2Q3EA 3EGCA 4CKCA 5HCNA 4ZZIA 2O2EA 2W37A 3ANSA 3O0DA 5TQ2B 4CL2A 3L4JA 4M38A 3DFIA 1Z2NX 3GARA 4LNUB 4TMZA 1U2QA 4ID3A 1ZONA 1EDZA 1QOPB 1SK9A 1SGWA 2I66A 2XDWA 4H7PA 5L3RA 3WRYC 4RTRA 3QKRB 1FY2A 4OQNA 3BC1A 5AKZA 3RR2A 4H0CA 5A3JA 2ZYDA 5CM8B 4ZI2A 5CG1A 1E7SA 1NF3A 2BCEA 3IUSA 4DG8A 4DQDA 4G9GA 1YRWA 3CW2A 3PFIA 4DLSA 2WKQA 4NABA 1M1NB 3F2IA 4R2LA 4WNIA 4ZXPA 5LUBA 3ZTWA 5KVCA 1YFJA 1UAAA 3LC1O 3TTVA 4KMMA 4C05A 4M21A 3KJFA 1Y8QA 2FMUA 4ND3A 3TEFA 2P1DA 3UFXB 3W3ZB 1VCOA 3D31A 1E1YA 3ESAA 1PS9A 1SXJD 1U2GC 4ZOEA 3WISA 5KX5A 1X74A 4CLOB 5GWXA 1QP4A 3MVEA 5HZKA 4Y2HA 3A6ZA 1SCAA 3TCNA 5EHXA 2K2WA 3MWYW 4H35A 4MI9A 1CHDA 1CQJA 2VQ3A 3I39X 5BR8B 4J03A 3HCCA 1UAYA 4EYQA 2Y4NA 1YRBA 3IBTA 5EPUA 4PZ0A 1KDRA 4YCDA 1QBGA 2VN8A 1X0VA 1LWNA 2Z04A 4G65A 4YS6A 3CE6A 3NONA 5SZKB 5BOSB 3MTQA 2AFVA 2YDXA 1E2HA 2PJUA 3H1BA 4QPPA 1PT9A 4RETA 4D3FA 8AT1A 1I2AA 1NN3A 1WXEA 3PQ4A 4HNAA 4KV9A 4L85A 4QIHA 5JD5A 1P39A 4BX9A 4AUMA 1RWXA 2J1LA 3BSSA 1MW8X 4QGBA 3K1TA 3ZJ4A 4Y2GA 2VJCA 1BQEA 3KQSA 1EFCA 4KXMA 4C14A 2NO6A 3OQMA 1WUHS 2B3DA 2ORED 3U3RA 4Z3OA 4I3GA 2VPIA 1HDIA 2J85A 2D8AA 4IJ6A 4HDNB 4EKYA 4GMHA 4X7RA 1U1DA 4CV3A 3PDCA 4NMMA 1HKUA 3N76A 5IH3A 2I6FA 4ZZ2A 4IP0A 2PSSA 5KJ6A 1O0SA 2X7HA 1J07A 2DFVA 5A9RA 3K20A 3UCXA 1P2DA 3FKJA 1Y5IA 2PKCA 1QE5A 3FMOB 4I55A 1YS2X 3U40A 3K3PA 4E5MA 4GIBA 4Q6WA 2PRSA 4WD3A 3WKAA 2DFPA 4GWGA 4WZAA 1YXMA 1GSIA 4KQCA 2JGEA 5LP6C 2BMVA 4CFSA 5CJ2A 4PRLA 5CNKA 4XVRA 1E5VA 1R0LA 3BE5A 3HLKA 5B3KA 4OV6B 5DYNA 2IEIA 3PQFA 4C7OB 1NDQA 2ZJOA 3VNVA 2OILA 1GAXA 1XLTA 5K4AA 4HUJA 5H3LA 4BC1A 1P91A 1EIZA 1RMTA 4WXHA 4KDEA 4MYCA 4F5YA 3ZOZA 1KZ1A 1H1LB 2FLKA 4P53A 2GK6A 4HTAA 2FFQA 1RRVA 1I2CA 1J90A 4U63A 2ZXUA 1T8SA 2HD4A 2X3FA 4LZZA 3NTVA 4KVGA 4XM1A 4E03A 5HOEA 3JAWA 4NY1A 3QMPA 3C4VA 1A9TA 4XVQA 2XCSB 4QBIA 1M2VB 2VP5A 4ZJPA 2KM1A 1T6XA 2GN0A 1PGNA 3H2GA 1SELA 1G8MA 4A2WA 1IUKA 3LXUX 2FX3A 3UK2A 2ZJYA 2JK1A 1YGYA 1T2VA 2C42A 2R97A 3DGFC 3I1YA 5F9MA 3JVUA 5H1YA 1Z68A 5LXTF 1I7LA 4K6HA 4BFXA 4J4TA 2JAPA 1RCTE 4HPWA