3TZCA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
224
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 76
structure length 224
sequence length 245
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzcA00
4WCFB 4WNCA 3U49A 3U3XA 4MIOA 1H9AA 5DP1A 1U8FO 5JCXA 2X4GA 1YJQA 1V9LA 1KEVA 1R37A 4D3SA 3EDMA 3PYLA 1E5QA 1BDMA 3FBTA 3C1TA 4CM9A 3C1OA 4UEKA 1YJ8A 2CF5A 2HK8A 4XX0A 4YQZA 3VH4A 4FIZA 3R0IA 1UDBA 1NXQA 3RKRA 1AXEA 4HFRA 3C7CB 4HNGA 2P9CA 3LT1A 4WJZA 1MX3A 1W4ZA 1YH3A 4ZA2A 3L6OO 4DC0A 1HL3A 3CINA 3KB6A 2HLPA 1T2FA 4NU6A 4OKIA 2WM3A 3H5RA 3UVEA 3TZQA 3ANLA 4HADA 4UAGA 1BHSA 4M86A 3FPLA 4CLRA 4YAGA 4U8GA 3M2TA 4DBZA 1SOWA 1PGOA 3DBHA 1LJ8A 1G0OA 3WQRA 2O48X 1K6XA 1P1RA 3B70A 3HADA 2A9FA 4ESOA 5U4QA 1TT7A 2B37A 5DT9A 1P3DA 1ONPA 4M49A 3GAFA 1ZK2A 3OEYA 3KTDA 2PA3A 2WD7A 2ZJ0A 4RJTA 2D8AA 5JC8A 3I3OA 3HDHA 5CG1A 5L7YA 5IXSA 4HNHA 1JU9A 2X86A 5AXCA 3RFXA 1HE4A 3PYXA 1E1MA 1HE2A 3BTVA 1LQTA 3KLMX 2CDBA 2E48A 5EPOA 3QJ5A 1ARZA 4IDDA 4MVJP 4A27A 2HJSA 5IDQA 5F5LA 4RPKA 2HCTA 2NLOA 4AG3A 5B4UA 2GUGA 1C1XB 3VH2A 2FOIA 4HWKA 2HRBA 4URFA 4FW8A 3OIGA 4FGSA 1U5CA 1YDEA 2RIRA 5JDCC 1B26A 4IMRA 4CQLB 4AICA 1YBAA 3OJFA 4CV3A 3BA1A 4D44A 4MVJI 4GLOA 5IFLA 3RASA 1DAOA 3V2HA 2DPGA 2W98A 3E9NA 2VNAA 3G1UA 3KZVA 4RF3A 4I9UA 4D46A 3JQAA 4DGSA 3OICA 2I9PA 1FDWA 1JKFA 4S1VA 2I99A 3AOGA 1M66A 1Q7GA 3ORFA 2Q3EA 5HWSA 4BKRA 3AFMA 5FI3A 2C0CA 5DCYA 1NQTA 1HRDA 5CDYA 2Q45A 3JQ8A 4J0FA 3EW7A 4OSOA 4IDBA 2R2GA 4U7WA 2AHRA 2QRLA 1LSUA 2IYOA 3DHEA 1KEUA 4MO2A 4CLXA 1ADGA 1DDOA 4J91A 4CL3A 1RM0A 2AG5A 4ZQEA 5A06A 3ZHZA 3NV9A 2QYTA 1OMOA 4FN4A 1ADCA 1X0VA 4GWKA 3QVOA 1HE5A 3NTOA 5DBGA 1TT5B 4D3FA 1FDUA 3SBOA 3PPIA 2VWHA 1ZUD1 2VOJA 2BGKA 2G82A 3OH8A 4NPCA 1AHHA 3TL3A 3OQ1A 3UFXA 3ZHYA 4Q3CA 1WW8A 1XLTA 2OP1A 1PEDA 2GO1A 3K6JA 3B1FA 1LEHA 1JWAB 3M2PA 3QHAA 4BO9A 3NKLA 4EJMA 4E12A 1GUFA 1LDYA 3K8ZA 1UZLA 1YQGA 3WJAA 4K6CA 5A04A 2VWPA 3H2SA 5G0UA 4HBGA 5JS6A 5DCUA 1F0YA 3FWNA 2HJRA 2NUAA 4XCVA 4NBWA 5L7WA 2P9GA 2I66A 3FNEA 3JCZA 5HBRA 4PG8A 1CETA 1QYXA 2I67A 1PJQA 1CJCA 3K5PA 2GF2A 1Q1NA 3QLJA 5JAZA 7MDHA 1N9GB 2E6UX 4Z0HO 3BYZA 4JJGA 2C2XA 2GN9A 1TI7A 3WFJA 3PP8A 1PQWA 3JYNA 4PN3A 1ZK1A 3BXXA 4QECA 1YBMA 4BO2A 1M6WA 2NQ8A 4WPGA 1V3TA 3RUIA 5IG2A 4PVCA 4ZJUA 2IEDA 3H4VA 4JJIA 1GU7A 3DZFA 1HLDA 1Y5MA 3INGA 4IMPA 1E3EA 4YJHB 1NFRA 1KC3A 1P1FA 1VSVA 4BUCA 4IY1A 4U6SA 2POQX 4R4JA 4BNNA 3G3EA 5LDGA 5F1PA 4W7HA 1UUFA 2FHSA 1DIRA 5EERA 3IKVA 2X58A 3D5QA 4M55A 1PS0A 4I08A 4RPLA 4D7AA 4YYZA 3CTMA 2X23A 4DQUA 3RD5A 3JD3A 4MVJD 3INRA 2B36A 3FPCA 4PLPA 4Q3DA 4Y6RA 5EESA 3S2EA 4D45A 2NVUB 5ENDA 3W4KA 1WDMA 3RC1A 2NU9A 4OH1A 3LYLA 5EQFA 5C7OO 1S6YA 1NR7A 2X0IA 2XXBA 5GY7A 1CF2O 1LNQA 1GY8A 2VHZA 3O4RA 5DCWA 4BNYA 4E5NA 1VL0A 1PU2A 4DQVA 5TIIA 3IP3A 4DTIA 4E3ZA 4E21A 1T4DA 1HZJA 4XGNA 2VUUA 5KVCA 4BNXA 4GGOA 4CUJA 4DL9A 3GMSA 3ABIA 3VPHA 1V35A 3HDQA 2OL4A 3AY6A 1HDZA 4QFCA 3W6ZA 1RYDA 4M54A 2BF7A 4DLLA 3L4BA 1GCOA 3W4JA 5AOVA 1O6ZA 1GPDG 1QKIA 2VYVD 1FDSA 3QWHA 4INAA 5HM8A 1ONOA 2P4QA 2P2SA 3OM9A 3HQ4O 4E6PA 1BXKA 4BO6A 4CMAA 3PRJA 4YAKA 4BNKA 1J0XO 2PK3A 2GSDA 1B2LA 2JL1A 3GC6A 4WLVA 2P9EA 3C3XA 3F4LA 1WLYA 3PZBA 1UDAA 2VYNA 1A9ZA 3H5AA 4Y8VA 1GZ6A 2DFVA 2FMUA 5ICMA 2Q4BA 1E7RA 2A4KA 3D3WA 2AW5A 4J7CA 3R6DA 1U3VA 1E7MA 3MWEB 5CP8A 3TRIA 4Z3DA 2C20A 4TVOA 2D5AA 8ADHA 2FY8A 1HYGA 1WMAA 4TMFA 2Y1CA 2C82A 4PZDA 2AMFA 3DBLA 4L73A 3E18A 2O2YA 1GPJA 4MIYA 3W8FA 3SXPA 2PD4A 4F6LA 1Y8RB 3LVFO 1NNUA 1VL8A 3CMCO 2BFMA 1GV1A 2FR1A 2GD1O 2W2LA 4KQXA 4NI5A 1PZGA 2PZLA 2B69A 4OL9A 4O1MA 3ZV5A 3KETA 2EW2A 3BMNB 2QIOA 5EQDA 5T6BA 1QMGA 2UAGA 3S55A 4IBOA 2O3JA 2AE2A 2JHGA 3CIFA 2J3JA 1EVZA 4JGBA 4ALNA 1PJBA 4ND5A 3L4SO 4LCEA 5H82A 4CMKA 4J43A 1LI4A 3IUPA 2B4QA 1U3WA 2O4CA 5JLAA 3CH6A 4B7UA 1N5DA 3O8QA 3WGIA 3H3FA 1Y1PA 3KV3O 4B7CA 2CD9A 2OP0A 2Y1DA 4WCDA 1XYGA 4E30A 2I65A 1EFLA 1QYVA 1T2DA 2BI8A 2FRDA 4YJGA 1F8GA 5KJCA 1IYZA 2V6BA 3AFNA 3ANNA 3ROPA 3V8BA 1LTHR 3E9MA 2FZEA 1HZZA 3AU8A 2UDPA 2GERA 3EVNA 1NPYA 1EBFA 4PLCA 3AY7A 4KWHA 3PFFA 3CKYA 2Q2VA 3PLRA 4ITUA 2IXAA 3G79A 1ZJYA 3OBBA 2O3QA 1RM5A 1CWUA 3OP4A 1U7HA 4QFDA 1R66A 5B1YA 2PKQP 4BKUA 1VPDA 4HXYA 2IDZA 5ES3A 2B83A 1JAXA 2BH9A 3EC7A 4ZHSA 2JAPA 1B8VA 1T26A 4CODB 4ROSA 4ZQBA 2VT3A 3T4EA 3TFOA 1P1KA 3NT2A 4PRKA 4DYDA 2Q50A 4WECA 4RCVA 4CV1A 4FC6A 4DLBA 3AOEC 1AUPA 1UP7A 2X22A 4NJMB 3WQQA 5BNTA 4FFPA 2PY6A 1UP4A 2DPHA 3GGOA 4YBZA 2GCGA 4CQMD 1GZ3A 4I9NA 2GDZA 3SEFA 1IPEA 1SC6A 2VZ8A 1KVTA 1ISGA 4RL6A 2C7VA 3S2FA 4D41A 3DMTA 5F21A 5JSFA 3CMMA 4JBIA 2OHXA 2CZCA 1OI7A 4WK6A 2WWRA 1IHXA 3QVXA 1N1EA 4PLZA 4L9RA 1VL6A 3FCOA 4KOAA 4W6ZA 1WDKA 3MJEA 2WD8A 3Q9NA 1KVQA 4XB2A 2OOSA 1PX0A 3ZWAA 4CUZA 1HT0A 3AUAA 4YAJA 5HRUA 2YZ7A 3L77A 2Q1WA 4D79A 2JD1A 3JD0A 2Y1OA 1I3MA 2OGUA 1ZKMA 1RM4A 5TT1A 4YT4A 3GFGA 2ZKLA 4BHTA 2BFPA 2AEJA 2XAAA 1U3UA 3BZUA 4MPDA 4WCFC 3C8MA 3JQ7A 2VHVA 3OQBA 4EITA 1PGPA 1K3TA 5EN4A 3PVZA 3LC7O 2YHIB 3NUGA 1NP3A 4CLOA 3BTSA 3WYCA 1EFKA 2JCXA 5JO9A 2X7HA 5TQVA 4LMPA 4UUNA 3C85A 3DZJA 4ZQGA 2H63A 1LA2A 4MKXA 4LISA 3ZNQA 4W7IA 5CEJA 1LSSA 4UVDA 1WNTA 4ND1A 3WIEA 4FOSA 4TWRA 3UN1A 3L6DA 1R12A 3GH3A 4IJVA 4U0KA 4E5MA 2DBVO 3U4IA 4H15A 1YO6A 1BXGB 1T2EA 3GOHA 5L4LA 3DR3A 4MVJG 1VSUA 1CQIA 2D5CA 3H8VA 3G0OA 3UCXA 4HFNA 5A9SA 4NR0A 4F3YA 4FFLA 2GN8A 1VE9A 4I5FA 2G17A 3NJ4A 4OJNA 1I0ZA 5A05A 1NAHA 4ZN6A 2NU6A 1C14A 4JBHA 1KEWA 2O3UA 4CLRB 1U1IA 1EZ4A 2YQ4A 1A9YA 3DBHB 3PHIA 4TSKA 4IXTA 3NYWA 3PTZA 3PIDA 3VDRA 4Z9XA 4PLWA 3DAPA 3WYBA 2IXBA 4BOYA 4XIYA 4NQZA 1WZEA 4RF5A 3LF2A 4U5QA 2JCVA 2PZKA 3D4PA 1KYQA 3ENKA 2WD7B 3VZQA 2P68A 4OMUA 4LRTB 4Q3BA 1V3VA 2DTXA 2E82A 1KVSA 4GBJA 3QE3A 3WSVA 2EG9A 4QQRA 3P19A 3V1TC 4OO3A 1N7GA 3WIDA 1DFGA 5BSHA 5MDHA 4RVUA 2HQ1A 3LC2O 2AQIA 2I3AA 1EUCA 3PGXA 3RUFA 5JDIC 3ZZNA 1ZCJA 4IXWA 1NVGA 1J49A 3P2OA 4KWIA 4LW8A 4N7RA 2FP4A 3JV7A 1GADO 3E5RA 2EW8A 1IHYA 2PH3A 2ZCVA 4OYRA 5DBFA 1H6CA 2NVBA 2VYND 2BMAA 1E5LA 2YYYA 2ZTLA 3PI7A 3QWIA 4HP8A 3ZNPA 1R4MA 4DREA 3G1TA 3JYPA 3V1YA 2B4TO 3GGGA 3KVOA 1Y8QA 3A28A 4WLFA 4JROA 5JNLA 1GYQA 1RKXA 1ZW1A 2CY0A 3TZHA 1U2GA 3R1IA 1ZBQA 1Z6ZA 3WFIA 2V65A 1FJHA 4NJOA 5JAQA 2EKQA 2PZMA 1P1JA 3JQ8B 3HZZA 4RV9A 4W4TA 4GX2A 1QLJA 5G4LA 3UUWA 1PJ2A 1C0LA 2ZB7A 5H81A 2BFAA 3WNVA 2JD2A 2W2KA 3DC2A 4DXHA 5JMWA 4GAEA 2WJPA 4CV2A 5L4SA 1JAYA 2QQ5A 2UYYA 3EHEA 4J4TA 3VZSA 1YS4A 4E5YA 1EUZA 4JCOA 1ORRA 3OECA 2W8ZA 4GMFA 3HE3A 4EUEA 3WXBA 1A27A 3MEQA 4BNMA 3IL2A 3NT5A 1NVMB 4BNWA 3RJ5A 1LUAA 2H9IA 2HSDA 3FD8A 1B16A 4QTZA 3Q6IA 4RF4A 1KEPA 4II2A 3MWDB 4KDEA 3LDHA 4JXKA 2B4RO 3KUXA 4N5NA 1EK6A 4FR5A 4B79A 5IZCC 1MV8A 5F1KA 1PWXA 3ZH2A 2VRBA 2NTNA 2NQTA 4B7XA 4EEXA 1NFFA 3RC9A 2Q1SA 2HMVA 4BMNA 2IYPA 4IIVA 4AJ1A 2R6JA 3C7DB 4MVJA 2ZJ1A 1YONA 4M89A 4A0SA 4WLEA 1A71A 3ZWNA 1BG6A 2EP7A 3TNLA 1KOLA 4HV4A 4MOWA 4P22A 4DA9A 3RU7A 4MVJM 1DRWA 4TROA 2WYWA 3DZBA 5COAA 4B3JA 5JY6A 4AJJA 4R9SA 1TLTA 4RGBA 1XKQA 4RPHA 1GEGA 4AVYA 4CM4A 3MJTA 3RUCA 3FTPA 1ZK3A 1PR9A 3DOJA 4FFNA 3COSA 1L7DA 1XG5A 2GN6A 4IM7A 3UHAA 3ADPA 4CR7A 2XOXA 4NFYA 2Y0DA 4J4HA 2VYVA 5I9MA 4OXNA 4A03A 2RHCA 4Z0TA 4BVAA 1IUKA 3FNGA 1LDGA 4R01A 1NYTA 4BKOA 4PCVA 2GYYA 1DLIA 4ZQHA 3ZWPA 3S1LA 3QP9A 3P5SA 2VUTA 3KOUA 3PYMA 1Q0LA 3NGLA 2NWQA 2BRUA 3TZCA 2FPGA 1MC5A 3IIEA 2PTGA 1ZZEA 3KHUA 3B6ZA 4CMHA 5A3VA 3TZKA 3SX2A 4R51A 3LT0A 3VKUA 1OZAA 4BGUA 5C37A 1VKNA 1R4NA 1Y5RA 3ZHBA 4RDIA 4XQGA 3NTQA 3U9LA 3P2YA 4Q3AA 3I1JA 2O23A 3MTJA 1MG0A 2X8LA 1A7KA 4P4LA 2I3GA 4S3MA 1XHLA 1VKOA 2HDHA 1ZMTA 4F45A 1YWGO 3FN4A 3GNSA 1UXKA 2VTEA 3EY4A 5AXBA 1DIBA 2PH5A 5C7LO 3ANMA 4K9DA 4JN6B 3B1JA 4PFJA 4IIUA 3KRTA 4MJLA 4QEDA 4BL5A 3E03A 2Y1FA 4K1LA 3O26A 2Q1TA 1GCUA 2YDYA 5B12A 1YL6A 4J9UE 5IXYA 3TN7A 2PD3A 3NDRA 1ZSVA 4BO0A 4YPOA 1VJ1A 2VHWA 2QZZA 1IZ9A 3D0OA 3QW2A 1P1IA 3MJSA 1GV0A 3UAGA 2Q46A 4WEQA 2C07A 4NH4A 2PKQO 2TMGA 1B8PA 2VWQA 3BHIA 3D3WB 5TT0A 4J2HA 3TPCA 3JQGA 4L76A 1QLHA 1GTMA 3KYDA 4W9NA 3OF2A 2Y93A 3K30A 3PFWO 2YHUA 5ER6A 3GVCA 2QW8A 2Y68A 3DBLB 3PJDA 4N5MA 1GYRA 4DYVA 5B4TA 5L51A 3WMWA 1BW9A 1ZNQO 4IQ8A 1LSOA 1N7HA 3EVTA 5JO0A 3JQCA 3BTUA 3RC2A 1NAIA 3HN7A 5I9LA 3EYWA 1ADBA 1XA0A 1O95A 4K6FA 3E8XA 1L1FA 4KP7A 3VTFA 1ULUA 1N8KA 4P38A 2LDXA 5BSEA 2GRAA 4WOJA 2Q2WA 3ZWXA 3ROQA 4IS2A 1R15A 4LN1A 4BKPA 1HYEA 2HU2A 3WWYA 3DONA 5CFZA 1BVRA 1MB4A 1IULA 3O8QB 3WSWA 4PIVA 1BXZA 4L4RA 1ZFNA 1HDRA 4W99A 2C7GA 3RFTA 1P0FA 4CQMA 1OFGA 1YOVA 1PGNA 3F9IA 1TEHA 4RPGA 3HNPA 3PHLA 3GVPA 4YJGB 1F06A 1ZMOA 2R00C 3FRJA 1HWYA 1F17A 5A9TA 2HO5A 4GX1A 3GG2A 3VTZA 3WGOA 1PZEA 1I32A 3IOYA 4JP2A 1I01A 3GZ4A 4ID9A 2PZJA 1ENOA 3DFUA 3TFQA 2BI7A 5T57A 4HFJA 4QXMA 1QR6A 1PJTA 3GQVA 1HLPA 3JYQA 4P8RA 4R1NA 4X54A 4ZRMA 2NU8A 1U3TA 1FF9A 3GZNA 2C2YA 1C1DA 1WDLA 3IKTA 3AOEA 3TZ6A 3VOSA 5ILGA 4HUJA 4UVIA 3PEFA 5KJFA 1JDJA 3FNFA 2OZPA 2JFGA 1ISJA 1VM6A 3BAZA 3OA2A 4MKRA 1IL0A 4IZIA 3VPGA 5IF3A 3ETEA 4YA6A 1I2BA 1DEHA 1LXCA 4XRGA 2ZATA 3GRKA 4PLVA 1U8XX 5LC1A 2WYVA 3L6EA 4F46A 1B15A 3WGYA 5TNXA 4FGWA 1CDOA 1QRRA 4Q39A 1DXYA 1VI2A 3OA0A 2AXQA 5IN4A 3GEGA 3WTBA 1I24A 3L9WA 5I7VA 4RQUA 1DC4A 2JKVA 1GD1O 4GX0A 3GA0A 5L3ZA 3IJPA 3DHYA 1ZXBA 2CDAA 4MVJH 4ONEA 4QSMA 4UUMA 1M2WA 1MFZA 3CE6A 3FR8A 5KKAA 1H0KA 1OC4A 2GR9A 2Y0EA 1D8AA 5KTKA 1EVIA 1I2ZA 2DBQA 4IJWA 4DBVO 2UV8A 3JQBA 5KOIA 3DBRA 3PWSA 3IC5A 3KBOA 4BNFA 2QYSA 4AJNA 3V5NA 3GVHA 2DC1A 5I7SA 1NX6A 4BNZA 2ET6A 5TJHA 3LF1A 3ROMA 4OSPA 1HTBA 4UVHA 5FYDA 2VN8A 1QYCA 3MJCA 2VRCD 1TXGA 5KNLA 1E6WA 1XDWA 3ZHXA 4EBFA 5BSGA 1ZH8A 2AQKA 3RUDA 1EVYA 1XCBA 4TKLA 3ST7A 3G17A 2GGSA 2DT5A 4RLHA 5A4DA 3FHLA 2YV2A 2YV1A 3DEYX 4DWVA 5L53A 4CLOB 3KLPX 4E2WA 1DIHA 1LQUA 2RHRA 2DVMA 3OJOA 1DPGA 1DRVA 1Z73A 5FFFA 2DM6A 2JJYA 1B7GO 1HXHA 5EINA 2V6FA 1S7CA 3DXFA 1E3LA 4OOEA 1K6JA 3JQDA 3QA9A 4R54A 5TGDA 4Q3EA 4R69A 3UCEA 1PJSA 4FJ0A 4Y6PA 5KVQA 1RWBA 5FEUA 2YDXA 3OETA 4CM8B 2X9NA 4YB8A 4CJXA 4AJ4A 2X5OA 1Z7EA 2B5VA 2IZZA 3WQSB 1M67A 1SB9A 1JA9A 1MA0A 1ZXLA 3F4BA 3VAZA 4FFMA 2BLLA 3JSAA 4PLYA 3TL2A 2YJZA 1XQ1A 1UR5A 2DUUA 4WE3A 2DTEA 2O3SA 3U09A 2ZCUA 5A9SB 3EZLA 3PQEA 3S2IA 3GUYA 3SLKA 3F5QA 1LSJA 3OEWA 3X2EA 4GQAA 5F3RA 4B8ZA 3K2EA 2QHXA 4NDNE 1QG6A 4ALKA 6ADHA 5TJ9A 3GPIA 2Z5LA 1PJ3A 1FDVA 3FNHA 1PJCA 3MZ0A 1XGKA 4PLTA 4U0JA 4N5LA 3ZDFA 5L40A 3H65A 2WE8A 4FBGA 3WGQA 4A5OA 1UAYA 5COBA 1IB6A 3DAFA 1HE3A 1PL8A 2UUOA 1WP4A 2PR2A 3GY0A 1GAEO 1SB8A 3U4CA 4UREA 3HUDA 1UJMA 4ILKA 5TF4A 5J23A 1UXJA 2LDBA 4KQWA 1ZEMA 4XIJA 3LK7A 5JDIA 5T8KC 1HDCA 4XEHA 2XPCA 5AVOA 2H1SA 3WDSA 1DFIA 4YT2A 4WASA 1ZVMA 3KEQA 3GN1A 4PG5A 4O5OA 1BSVA 1GR0A 1NHGA 4MIEA 4Q3NA 4J2OA 3DZKA 5KKCA 5DZSA 1E92A 3WGTA 1BGVA 2DQ4A 3KYCB 4CMEA 2C5EA 1MXHA 5A03A 1DLJA 3KSZO 3UOGA 1H9BA 3ONDA 4Y98A 1H5QA 4NBUA 1GL3A 4CMCA 3MJVA 4Y9DA 3QWBA 1T24A 4CM7A 1ONNA 5DDIP 1T1RA 5IDYA 1AXGA 3ZWVA 4E33A 1N2SA 1YL5A 5HS6A 1YDWA 5AYVA 5JYEA 2X1HA 3G49A 4EGFA 4R68A 4LCJA 5L9AA 4J3FA 1E3WA 3RROA 5IDWA 4KZPA 4BNTA 4K28A 3LSYA 2FSSA 4PRLA 3DWFA 4OM8A 2NTJA 5CDTA 2ZIZA 1P33A 2NADA 1HDXA 3MCVA 3OHSX 3R3JA 2Y67A 5TX7A 5L4NA 3GNTA 3C24A 2PWZA 2AE1A 5CEEA 3D4NA 1HDGO 1E7YA 2OORA 5IZ4A 1SEPA 1GUZA 2PD6A 3H5NA 2I76A 3RAJA 1AE1A 2OO5A 2VNSA 3Q1LA 2X6TA 1NQAO 4L4XA 2NU7A 2JCYA 1P0CA 1FDTA 3QRWA 5B37A 3W8EA 4E5KA 1DC6A 4R41A 2ZQYA 5DF1A 4GGPA 3LT4A 4PG6A 1XWFA 3OJEA 4ALIA 3ZV3A 4UEOA 1J5PA 1MXFA 1E3IA 4YWJA 1ML3A 1LLUA 3BHJA 4R5HA 3INTA 2A92A 1GYPA 4D3DA 5ENVA 3DZGA 1RPNA 1WWKA 3B1KA 5I8WA 3GEMA 3CEAA 3VDQA 2VUSA 1XEAA 3L07A 4L74A 4TKMA 3DZIA 3WX0A 4C4OA 4RPJA 5KIAA 5EMHA 3AM4A 1Q7CA 4XA8A 1N9GA 3F47A 1MC4A 4E31A 3AW9A 1X7GA 4YJFA 3Q11A 2ZYAA 1U4SA 1K6IA 4UULA 5DNAA 2C54A 3GHYA 3NEPX 1SNYA 1CQJA 4CL8A 5CEFA 3UGKA 1SPXA 2ZYGA 4PZCA 5KVSA 2ZTUA 4J7XA 1PZHA 4IS3A 4CM1A 1E7QA 1ZIDA 1G6KA 1Q2XA 3MOIA 2NM0A 5G0TA 2HRZA 4YJDA 1EQUA 4YJHA 5HS4A 1F12A 3VC7A 4RZIA 5C5IA 1XSEA 5U9CA 1YB1A 4PLFA 1PQUA 1DFHA 1F8FA 3H7AA 1C0IA 3V2GA 3AUTA 3EZYA 5KJ1A 1KERA 4J90A 3RBVA 3LLSA 3DAGA 2EXXA 1WAMA 4E32A 3W1VA 1HDYA 5KJEA 3A9WA 1PJ4A 1JVBA 2V6MA 2FWMX 4YVFA 1I2CA 4ND4A 4YR9A 1R6DA 4R1UA 4HX5A 2DU8A 1DJQA 1EDOA 3NTRA 4NHEA 3ZNNA 4XB1A 4RVDA 1Q0QA 3RBZA 3RVDA 4J49A 2D1YA 3PHGA 3I9LA 1U9JA 4IGEA 4KUEA 3H3JA 4QT0A 2FSVA 3AUUA 1LLQA 4XGIA 3O03A 3IP1A 2EP5A 1PSDA 4NBTA 3RBXA 2VZ0A 4H3VA 4CMIA 3U4HA 2BD0A 1O89A 1UDCA 2BHLA 4A26A 2H5LA 4AFNA 4DRYA 4CR6A 4AJPA 3FF4A 4A10A 1T2CA 3ICCA 3NAQA 5A9RA 1HYHA 1X1TA 2PV7A 2WYUA 2P4HX 4NBRA 2I6TA 4GLLA 4J1TA 2BELA 4GPD1 3AM3A 2WE7A 3DDNA 3NJ8A 4ZU3A 1W8DA 1EK5A 3WR5A 1CERA 4ALMA 5FI5A 5DOZA 1ISMA 4BO7A 3I4CA 2B0JA 3RFVA 2Q4EA 4LVCA 2Y1EA 3I9NA 3NGXA 4M87A 2IZ0A 4WOKA 5T67A 4G81A 4B4UA 4I9HA 1M75A 5TLSA 4EDFA 3I52A 3OIFA 4YT8A 3BMQA 3WBBA 1J4AA 1D1TA 2BFOA 1UZNA 5C3MA 3PZRA 4XYMA 1U7TA 4IDFA 4E2ZA 1NBOA 5KWEA 4IDGA 2YUTA 3VZPA 3W8DA 2AG8A 4AJOA 1ULSA 3ONEA 1Q7BA 4DPLA 5JDCA 3HN2A 3A1NA 1A72A 1WVGA 1E1NA 1SBYA 1B3RA 1Z45A 2GPTA 2RCYA 3WGGA 2ZK7A 4NFSA 9LDBA 1PGQA 1KBZA 4KDFA 3JQEA 4G5HA 3GRPA 3ASUA 3JYLA 2CDCA 4GWGA 1GDHA 3RWBA 4DLAA 2CFCA 1NHWA 1NWHA 3JQGB 1NVTA 4Q9NA 3QY9A 4IDEA 4UEJA 3KYDB 1GEEA 3ASVA 3GUCA 2GLXA 3JQAB 4JNKA 2Y66A 4YEDA 1TA4A 1SO8A 1ID1A 2OMEA 3BHMA 4EUHA 1H2BA 1XIVA 4YAIA 1BW9B 1I30A 1UXIA 2X5JO 1BDBA 5G0VA 3CUKA 3I4FA 1SCUA 1PTJA 3K96A 1UZMA 5KCZA 5T5QA 1P44A 2PGLA 3GDFA 4MVJF 5K6AC 2FPPA 1O94A 1NWCA 3ADOA 1Y81A 3RSHA 3X2FA 4XYGA 2O50A 4GSLA 4QO7A 1ENPA 1JN0A 2R00A 4AJIA 3WWZA 3E9QA 2UUPA 2JAHA 4RVGA 2VQ3A 3RU9A 2QZ9A 2YW9A 2HKIA 3JYOA 4AJKA 1GQYA 4B3IA 2O3RA 3GK3A 4I5DA 1QV7A 4CQMB 2XXJA 1PWZA 5MGBA 5COQA 3OJLA 4OXKA 3U62A 1YOVB 1NR1A 3DTYA 2G1UA 1LLDA 1X15A 1AN9A 4WKGA 2E4AA 2EGHA 4E4YA 5CDGA 1NM5A 3C1AA 2EGGA 1LDEA 1JW9B 2J6IA 3HJAA 4IQGA 4DPMA 5FWNA 2HMUA 3FR7A 1LRJA 1LRKA 5EJ2A 2ILTA 1BRMA 3TOZA 3CSDA 2WEKA 3V1UA 1ISFA 1HETA 1GQQA 1EEHA 3GZNB 2JD0A 1BTOA 3HSKA 4BNHA 1C1DB 1BWSA 4EI2A 4JX8A 3GVXA 4R9RA 3WYEA 3JQ9C 1YL7A 2CVQA 4QUKA 4DIFA 2VRCA 1MP0A 5TRTA 4R5MA 3AY3A 1V0JA 2C59A 1Z74A 3IMFA 1Z75A 1ZEJA 2AEFA 2CF6A 4ND2A 5ITWA 4L75A 4GH5A 4YQYA 3E48A 1PS8A 3FTNA 3DMTC 3EGOA 4CMJA 4IUYA 1ZSNA 5AXDA 1SOVA 4BIIA 1RYEA 4R3NA 1HDOA 5DP2A 3VPSA 3UXYA 4KUHA 5BR7A 1L7EA 2Y1GA 5G4KA 1JLLA 2EHDA 4OAQA 2F1KA 4J16A 5DULA 3ZWCA 1E3JA 1E7WA 3AK4A 5IDXA 3MOGA 4NFHA 3QV1A 4PZEA 4MDHA 3F1KA 1B3BA 1M6HA 5BT9A 4EEZA 5EIOA 3VPXA 4ZRNA 1KVRA 1P45A 3PDUA 1PL7A 3DBRB 2WTBA 2A94A 1VRWA 4UUOA 3EAGA 1H93A 4ZICA 3GAZA 3GVIA 1EE2A 2OBNA 3D64A 4DUPA 2AQHA 1NASA 4TRMA 1V8BA 5FF9A 4G2NA 1XELA 3CZMA 4TQGA 4YRDA 3W4IA 5I8ZA 1K2WA 2F00A 1QYWA 4KMSA 4W82A 3K2BA 3DO5A 3JQFC 4NZ9A 4DVJA 2IRWA 3ENNA 2Z95A 1O8CA 4XYEA 4Y67A 3PHHA 3D4OA 5TC4A 3ETDA 1E77A 3GR6A 3ZU4A 2W90A 4R1TA 4XKJA 1E7SA 1BXGA 1SZJG 1IY8A 4FB5A 4PVDA 2Z1MA 3WTCA 5JCJD 5K9ZA 3ZU5A 3PLNA 3LLVA 4IDAA 5BSFA 3Q0EA 1ZK4A 1F14A 4BV8A 1I3NA 3D7LA 5IJZA 2GNAA 1IZ0A 4PG7A 3WICA 3T7CA 4CPDA 2O7SA 5DN9A 4E5PA 4FCCA 4J4BA 4J9VA 4O59O 2OFPA 1CRWG 3CPSA 1YBVA 1MUUA 4RQTA 5ITVA 1PL6A 1MGOA 3S2GA 1YGYA 4MVJE 5I7EA 3E82A 5HA5A 1KY4A 3TJRA 1C0KA 2EERA 4E2YA 4DIOA 5C7IO 3DZHA 3WGZA 2O7QA 5A3JA 1K89A 9LDTA 3NT4A 3IS3A 1DHTA 1X1EA 4HY3A 1IOLA 5JYDA 3SC6A 2DLDA 1KS9A 2P91A 2H6EA 3H9EO 3PJFA 1T1SA 4L8VA 2ZB8A 2Q1UA 3AUSA 2QRKA 3AI3A 1I8TA 4UVGA 5T8KA 1ENYA 4L0QA 2DUWA 1C3VA 1GQ2A 1H94A 1KVUA 2FR0A 3I9JA 4CMBA 4BMVA 3I9OA 4XQCA 5JPIA 2X9GA 3OFSA 5I9NA 4ZGWA 1G1AA 2Y05A 1G0NA 3FSRA 3KSUA 1U5AA 1I33A 3WOHA 3GDOA 3A06A 4LSMA 3ZWYA 2ZB3A 3BMOA 1HSOA 1QP8A 4YCAA 4RORA 5GZ3A 3UKOA 1GFSA 1PIWA 4BKQA 2C29D 2EF1A 2FZWA 3Q3CA 1JKJA 4BB5A 4CR8A 1J6UA 3K73O 1PS9A 2IODA 2Z1NA 3K31A 3GT0A 2PGJA 3PHJA 4L4SA 4LMRA 4UUPA 2GZ2A 3ZV6A 1B14A 1U2DA 3K9QO 3TQHA 3PXXA 2VTDA 4XJSA 4CLEA 1D7OA 4WGGA 4B4WA 1P77A 1CIVA 1E3SA 3E5MA 1O9BA 3Q9UA 5JXWA 2Y0CA 4BO8A 2V6GA 1DHRA 5CG2A 1RJWA 2IEBA 2IZ1A 4HKTA 3DFZA 2Q2QA 4FFOA 1VJ0A 2PKRA 5JY1A 1E3WB 2NNLD 8LDHA 4XYLA 5JMPA 2WSBA 2AQ8A 3V2UA 4B3HA 1SAYA 3CXRA 4WLUA 4II3A 1ADFA 3LU1A 4ALJA 5LDHA 1X14A 5DBIA 3QQPA 4AJ2A 4BGEA 3VH3A 1E0DA 3I6IA 3PQDA 4AJHA 3FBGA 1EMDA 4BV9A 1PQPA 4M1QA 4IJKA 2JFFA 3F5SA 4ZVVA 5JW6A 1Y6JA 3A4VA 3GDGA 1OOEA 1XQ6A 1B0AA 4JK3A 1SEVA 3CZRA 3ZV4A 4DPKA 3AWDA 4FSHA 1I10A 1ZJZA 2I5PO 1N1GA 2J8ZA 3JQ6A 4IDCA 4TRNA 1PJLA 2EJWA 3GNQA 4H16A 1LBEA 5CAEA 3U5TA 3DBVO 1I5RA 4XR4A 2YQ5A 3DOOA 2RH4A 3ZWMA 3ZWWA 3DB2A 4CLDA 3BMCA 1NQ5A 1P9LA 2HAEA 5BNIA 4N54A 1LX6A 1JVSA 3EK2A 5AXAA 3VKVA 4MP8A 1D1SA 1KY5A 3ULKA 3F46A 4GVLA 1NPTO 2TMDA 5K0ZA 2ZTMA 1AHIA 2HK9A 1D4FA 4GSKA 3LZ6A 4YJFB 1R0SA 1DSSG 4PLHA 2D0IA 2ZTVA 1W6UA 3K92A 7ADHA 4XQ9A 3UF0A 2NTVA 3H6KA 1EUDA 2G76A 4Y6SA 4WCFA 4XJTA 5JC1A 2UVDA 1MFPA 4YXFA 1XU9A 1O5IA 3Q2KA 4D42A 1UXGA 1B8UA 1W73A 4AL4A 3R3SA 1R16A 1YXMA 2J3HA 1SMKA 4XGKA 4XD2A 3H9UA 3JQ7B 3WNQA 1D3AA 4R3WA 2OXIA 1CYDA 1EVJA 5G0SA 2YV3A 3TF5A 2JHFA 1A5ZA 1PZFA 4CLHA 5CDUA 3EUWA 5BNFA 2X5KO 2O3TA 1PR3A 1R0LA 4YAEA 3SJ7A 4N18A 2D4AA 2QG4A 1DC5A 1NTOA 5AQ1A 1MG5A 4YRAA 2YFQA 1YQDA 3GG9A 4CM5A 3VZRA 3ZCXA 4BQPA 3MJ4A 3OQ6A 5G2OA 1KETA 1VC2A 4CMGA 2DBZA 3GFBA 4Z6KA 4CUKA 1NPDA 2CUKA 3DOCA 3ETGA 1H6AA 3I6QA 4NK5A 2PGDA 5JFOA 4OQZA 4NNJA 3RJ9A 2CVZA 4D43A 1KIFA 5THQA 2AA3A 1K0UA 2CVOA 4CMIB 3QVSA 2BGLA 4XR9A 1JWBB 4UVEA 3PDJA 4YACA 2O4UX 4NBVA 1WXDA 5HTOA 4B8WA 4BO4A 4J1NA 2E49A 4TZKA 2D2IA 5F1OA 4E0BA 3ICPA 3WG9A 4G65A 4OOFA 3JD4A 3ITKA 2P5UA 3DTTA 4BNJA 1FXSA 1H6BA 3IUSA 1YB5A 4CM9D 1DAPA 3ZU2A 3EMKA 4I1IA 2DTDA 1KC1A 2W4QA 4TVBA 4J1QA 2NV6A 1C1XA 4XDZA 2RH8A 3BMQB 3SC4A 1V6AA 4FJ1A 4GKVA 1T4BA 2Y99A 4NG5A 5KVVA 4CQLA 2X0RA 3KSDO 3GEDA 4FD3A 4C7KA 1PGJA 5GMOA 1CEQA 2YY7A 5IAAA 2Q99A 3QSGA 3HFSA 4IGFA 4TRRA 3O9ZA 2QRJA 5IN5A 5JAMA 4EZBA 4EW6A 3E6AA 4YT5A 3UCFA 4JLWA 4IZHA 4WUVA 4NU5A 1BMDA 5H83A 4OXYA 3IDSA 4YTEA 2OUIA 3HB5X 2CMDA 4W9NC 3JTMA 1YVEI 2YFHA 1OC2A 2DFDA 2HK7A 1HSZA 1WMBA 5DOVA 5GZ6A 4FC7A 4ALLA 2GZ3A 1M76A 3RC7A 1UXHA 1XU7A 5CHEA 1LC0A 5GZ1A 3JD1A 4R1SA 1R4MB 4RO0A 4BO1A 4LK3A 3H9GA 1IPFA 4WNIA 4BGIA 3F1LA 4BNGA 1EE9A 1RM3A 4NIMA 3WMXA 2VHYA 5ILOA 1NFQA 4C7JA 1Y8QB 2X0NA 5K6AA 1E6UA 2EEZA 4WLOA 4E2XA 1AGNA 3OJ0A 5T64A 5A1TA 1I36A 3GMDA 4RLSA 3VPFA 2FR8A 3AI2A 5JAIA 2VOEA 3E1KA 3H9QA 2HMTA 4JP3A 1TB4A 3TWOA 5CDSA 1TT5A 3QIVA 3M6IA 2O2SA 3S8MA 4Z9FA 1TVEA 1QORA 2W2KB 3HHPA 2VHXA 4P4NA 3PQFA 1Z82A 4ND3A 1ISIA 1BVUA 1DIGA 1U4OA 1WZIA 2ZB4A 3JQAD 4JJFA 4AJEA 2PNFA 1IE3A 3AI1A 3C7AA 5IZCA 4DC1A 2C5AA 1LDMA 3AJRA 1A4UA 4RVFA 2A35A 3QVTA 4A2CA 5L7TA 3I9MA 2HMSA 4A73A 4BS9A 4CV0A 3HWRA 3JD2A 3B20A 3RUHA 3ZW9A 3N58A 3I83A 5TS3A 3BTOA 2J5RA 3IAHA 4D0SA 3JQ9A 4P4GA 4WEOA 1X7DA 4IQ0A 1I3LA 1DJNA 3DHNA 3ZNOA 3U0BA 2X9VA 5BQFA 3OIDA 2RAFA 2Q49A 1X0XA 3KO8A 2J3KA 3TSCA 4FOOA 3HDYA 3MTGA 4DMLA 4MP6A 4FDAA 3ZGYA 4ZD6A 1FK8A 4NK4A 1LDBA 4EJ6A 3OSUA 3GN2A 2EWMA 2FPIA 2JFHA 3P7MA 2AEMA 4IPTA 4EUFA 4R16A 3SJUA 3F6YA 3RI3A 2EKLA 3PK0A 3N74A 4QO8A 3FI9A 4GVXA 1YB4A 5A02A 4CM4B 5TSDA 4OIMA 1JKIA 2D3TA 4FS3A 3KXDA 4PLGA 5JCJA 4I5GA 4CM6A 5G4KB 3LT2A 4FPXA 1A7AA 3WLEA 3ZWBA 1YKFA 1LC3A 3BIOA 3JQBC 2NVUA 3ZN2A 2DKNA 3PJGA 5LCXA 4AJLA 1EBUA 2WMDA 4J0EA 4BQRA 3ONFA 3QWAA 1LRLA 2GN4A 3SVTA 4OHUA 4F6CA 5ADHA 4GI2A 1DOHA 3WBFA 1ENZA 3WB9A 3JQFA 4RVHA 4K26A 1T25A 3KYBA 1UAGA 1W0CA 2EKPA 4TRJA 2X0JA 2P5YA 5ICSA 3I5MA 3RCBA 3GGPA 2DBRA 1E6EA 3T4XA 2B35A 3O38A 1C0PA 3NDIA 2B5WA 4BB6A 4BGVA 2EV9A 4XRRA 1Y9EA 4MP3A 4O0LA 4DQXA 4IINA 4DMMA 1DRUA 3IJRA 3PGJA 2BKAA 1R4NB 4CM8A 3PJEA 3ZI0A 3LC1O 1WPQA 4O6VA 3VVCA 3L9XA 1H6DA 4PGFA 3AM5A 1O0SA 3L4BC 4BNUA 3D3EA 3ZW8A 4B4OA 3HDJA 3PWKA 4NMHA 1U28A 2EJVA 1EDZA 4HFMA 1MLDA 1NQOA 4GL4A 3TDKA 2PLAA 1HEUA 4E13A 1GUYA 3U4DA 4Z0PA 3HB4X 3SLGA 2VZ9A 5A5FA 3N7UA 2CSUA 2E37A 3D5TA 3QWFA 3I9KA 3WGHA 3NDJA 1YRLA 1P31A 4KTTE 2J5QA 1ZSYA 4H7PA 1P74A 4M8SA 1Y8RA 4YRBA 4I8XA 4ZQFA 5F5NA 1OAAA 5L45A 2XF8A 3VHRA 3L0DA 3UH1A 1XR3A 3BMNA 2RBEA 4XQEA 2D59A 3GF4A 4J6FA 2ZYDA 5EL0A 4RVSA 1QYDA 3AU9A 4BNIA 1ISHA 4RF2A 4O63O 1OBFO 4BMSA 2GASA 4XWYA 3KYCA 2GZ1A 3M1LA 4OGWA 1UH5A 3TOXA 5JBIA 2J5KA 4FFRA 3RQSA 2NVWA 4QX6A 2FN7A 5U1PA 3W6UA 4XDYA 1Z7BA 4XYBA 1LU9A 5ER9A 2BGMA 4JQCA 3DQPA 4CM3A 3BMOB 4GKBA 4CMEC 4MKZA 4LRSB 1VLLA 2VT2A 1DC3A 2VCYA 4EYEA 2NSDA 1HKUA 1ZK0A 2WDZA 2G0TA 4RDHA 1JTVA 5G0WA 3RUAA 3LQFA 5THKA 4U6QA 3A14A 3D1LA 4BNVA 2PFGA 1LLCA 5A5EA 1E1KA 2OBYA 2CNBA 3RUEA 4LVUA 6LDHA 3IQDB 5CPBA 2W2LD 1ZO8A 2HMWA 3ON5A 4JIGA 4KUGA 3GPDG 3I23A 3ITDA 3KM0A 2DAPA 4TZTA 3RIHA 4BO5A 3F3SA 1DBVO 4FJ2A 1HF3A 1JQBA 4A7PA 2V7PA 3RKUA 1Y9AA 1E1LA 2VWGA 4JBGA 4NJMA 1DO8A 1VJTA 5CPFA 2G5CA 1A4IA 2J3IA 1GZ4A 1LDNA 3T7EA 3DMYA 4BO3A 4Z3KA 4WLNA 5JE8A 1P1HA 3OMLA 2EIHA 2SCUA 1X13A 3HG7A 2QX7A 4B4VA 4EJ0A 1QSGA 1EQ2A 4PG4A 4RZHA 3PIIA 3WJ7A 1DIAA 1Y7TA 3ZU3A 2HUNA 4FQ8A 4GMGA 3STHA 1FMCA 4OKNA 1R0KA 5B4VA 1Q0HA 4J7UA 4J1SA 3ZWOA 3VH1A 1DB3A 3NRCA 1YE3A 2NACA 1T2AA 3BMCB 1N92A 3H9JA 3UW3A 2ZQZA 4GX5A 5I7FA 5KJ6A 1X7HA 3GHHA 4LGVA 3KEOA 3QVWA 1I3KA 1QV6A 4Z9YA 4IJUA 3NX4A 3WS7A 3H2ZA 4BNLA 4I5EA 1V3UA 4XZ3A 4YDRA 4OQYA 1UP6A 3M1AA 1YQXA 3GLQA 3HFGA 3Q2IA 1QXSA 5L95A 4KTVE 4D0RA 2IE0A 3UICA 2YHIA 3FWZA 4MINA 3VVBA 1K5HA 3ROKA 3PWZA 3DL2A 4DIBA 4LSWA 3WLFA 1H2HA
chains in the Genus database with same CATH superfamily
4YP7A 2HQBA 3WYDA 1I4TD 3A11A 3LFUA 3U3XA 3A6FA 4G37A 4C2AA 2INGX 3DM5A 3O3MB 3GLFA 1W47A 2A9JA 2QAIA 2YHSA 3H75A 4PGGA 4M38A 4FDVA 4EB0A 1YVPA 4FDTA 1JKMA 2G5PA 4NEHB 5HCUA 3BJRA 2X4GA 1Z7YA 2YINC 3GRUA 3PDWA 2JIDA 1UJ4A 4D3SA 5LOVA 1WOMA 1E5QA 5HM6A 1IJFA 5CH8A 2WHEA 1N6KA 3FPSA 1Z12A 3C1TA 3DMRA 4GMKA 4MICA 2ZUBA 1FTNA 1JQ5A 1YJ8A 2WV7A 3FPFA 4UEKA 3A70A 5GM2A 3HB1A 4B2YA 4XX0A 1GL6A 3NBXX 1AXEA 3HSSA 5AJZA 2IU6A 2W2QA 2HJWA 5FJJA 4HNGA 2P9CA 4CCWA 2YC4C 1L5MA 1MEOA 1MX3A 5AHWA 1WMEA 2I8CA 4RL4A 3L6OO 3TPFA 2RH9B 4DC0A 1SXHA 2OFWA 4IFTA 2EKZA 1SXJE 2QJTA 2Z8ZA 3CINA 3NC0C 3JVUA 3NHBA 4RKRA 4V0NA 1FVFA 4D9EA 2WM3A 3U44B 2DFLA 4EB3A 2P78A 3TZQA 4Q7JB 4OH7A 1QFXA 5KYYB 1UAAA 1M3SA 3FB4A 3THRA 4M86A 4N8SA 3AHDA 3FPLA 3M2TA 2VJMB 3R3YA 1AKUA 1PGOA 3B1YA 2IKQA 1LJ8A 4LWQA 2IWHA 3S2YA 3WQRA 3WFZA 1IXZA 3MD9A 5JVDF 3HADA 3KSBC 2A9FA 1EAMA 3V8VA 4P7JA 3N5KA 4MV3A 5EHNA 3M8KA 5BUCA 1QPBA 1K4YA 1ZK2A 5K01A 3UWPA 3N2NA 2COUA 2ZYHA 1IPHA 5KC9A 2PA3A 3IX7A 2D8AA 3SSOA 3LPNA 3I3OA 1XLVA 2CUZA 3BFJA 4NRDA 4UD6A 4UU7A 1IZ7A 4W99A 3BCSA 3H7IA 4BFXA 5IXSA 4HNHA 3WRWA 2WWWA 2X86A 3RFXA 4R1OA 3W5JA 1N2CE 3N8HA 3TLGA 1E32A 2JZOA 3PYXA 1E1MA 1DJOA 1FX0B 4JC0A 3UUEA 3NOQA 4OLBA 4IWNA 1XJ5A 3QJ5A 1ARZA 2RGRA 1D6MA 1UEXC 2JFPA 2WAMA 4IDDA 4Y2SA 4Y2XA 5ADWA 4QVIA 4RPKA 3IPXA 5FA6A 1X3SA 2DCMA 1QHIA 1RBYA 2NZJA 2HWWA 3H11A 3AR5A 2FWRA 3K20A 3LFHA 4KW7A 1KZGB 3U9TA 5B4UA 2DWCA 2QJWA 2HHAA 4Z86A 2FOIA 5H4HA 3NHYA 1JI0A 3HUEA 1P9NA 2HRBA 1RLIA 2NPIA 1GO2A 4WZAE 4K9LA 1WP9A 3ADCA 2WJHA 4PANA 4TS9A 4O3FA 4D26A 2Z4RA 1YDEA 3KQQA 2RIRA 5ALSA 2I6UA 1B26A 4IMRA 3WXMA 4CQLB 3PENA 1JLKA 4AYWA 1M2EA 3TM5A 5JSUA 1V16A 2W98A 2FZ4A 4I9UA 4D46A 2QX8A 3JARB 3EXHA 3RS0A 3UHOA 3W5IA 2ZUWA 1Z25A 3OUTA 4LS3A 4KNWA 4S2UA 3BWEA 1JKFA 3CW9A 4R1PA 3K9FC 2K6GA 3HJFA 2I99A 1M66A 1SIUA 2Q3EA 1I6KA 3WYGA 4WY2A 5HWSA 2O8FA 3SM9A 4IFEA 1NQTA 3AQIA 4TTTS 4PINA 2Q45A 2IYUA 4BMPB 1ZAKA 1NW9B 1ZKDA 4G5OA 2I80A 3EW7A 1X8KA 1EG2A 4ZJPA 2QZSA 2AKYA 2H2DA 2QRLA 3PX2A 4OHKA 3OPYA 4BEVA 1XRNA 1HTWA 4Z8XA 5BN4A 5IAKA 1C2YA 2H65A 2DQSA 3WLKX 4CF6A 5JIBA 2KYRA 4P31A 3F97A 5C2JB 3V4SA 1H3EA 3OEHD 4QQNA 2VUHB 3RG8A 5ALOA 1O94C 2AG5A 3P2IA 4ZAXA 4BVBA 4HNTA 4ZQEA 4KCGA 5A06A 4EJ2A 1S8FA 4KVFA 2NXNA 5EHIA 2QYTA 4C89A 1OMOA 1GPUA 3B9PA 1ADCA 1O6BA 4FCTA 1QHXA 1FS5A 3AIIA 2HZBA 4P3KA 4YJ3F 3ZIUA 3LC0A 2PE5A 3TIIA 4DMUB 1HG1A 4G1BA 4IRXA 3NH9A 1FDUA 4YMWA 3ORSA 1RYFA 2JG3A 2CVPA 1QANA 1N3YA 3RYIA 1L8OA 4IVQA 2CBXA 4IWYA 3K94A 3V97A 5HXAA 1X1SA 3OQ1A 4OFZA 2XV1A 1NNSA 3IR5A 2NUPB 2PRKA 1PEDA 3B1FA 1JWAB 3M2PA 4MWZA 2P1RA 3OQNA 3PT5A 4UKDA 3CEPB 4EJMA 3L0CA 3OWHA 1GUFA 3G2IA 4RZ2A 8AT1A 2Y2VA 3U0VA 4OA8A 1BD3A 1XD2A 2A57A 3H2SA 4E51A 1RHRA 4A2PA 4GYJA 2I2DA 2HJRA 3DZCA 1LB1B 5J4VA 1W36D 1T0PA 5T3UA 4C6TA 4JNCA 1X38A 1CFJA 1KSJA 2Q9BA 3IA7A 1A50B 1A88A 2V74B 2I67A 2WM8A 2X5NA 1CJCA 2BCGY 2JHCA 3K5PA 4XDGA 1R18A 2CLLB 4OHYA 4JC4A 2VK8A 2MDTA 3M9XA 1KK0A 2E6UX 2IIBA 2AX4A 2JASA 1D4ZA 3SYTA 5ALWA 5IASA 3QK7A 2YFYA 1DO2A 4JJGA 2G7ZA 3JX9A 5ADVA 2GN9A 1TI7A 4RY8A 3WFJA 1W87A 2YMLA 3GJ6A 3TKYA 3OQJA 1ZK1A 3RTBA 3O3NB 2ZT5A 4BO2A 4EWLA 1M6WA 1C30A 1XCJA 2H08A 3NNNA 1QGDA 1SHUX 2BV3A 3HVIA 1TEVA 1GU7A 3DZFA 1PJAA 3DWGA 2ZM6B 4BIMA 3R9KA 3IB6A 3QY0A 4IMPA 1WPGA 1KC3A 2MT9A 4F71A 1VSVA 3QUBA 4IY1A 4QRDA 2Y1WA 5IULC 3GPLA 4FYIA 2JK1A 1WV0A 3MK31 1E1CB 2FQYA 4W7HA 2FHSA 4DQ0A 2R66A 3HCBA 2FUG6 4L1KA 3D5QA 4RPLA 3EIUA 2I33A 2GEKA 4B82A 5JTTA 2VRNA 4NS1A 1QWOA 4DQUA 1NY6A 4MVJD 4ARCA 3CXUA 2EOAA 2O6HA 4GZ6A 5E6UB 5EESA 2I4NA 4PTYA 1ILWA 4B6FA 3W4KA 2NU9A 4FDUA 1EX6A 3LYLA 2WJWA 5C7OO 1S6YA 3OQOA 3SJAA 1NR7A 1U3DA 1L1RA 2GZSA 4ND8A 5EHZA 1GY8A 1I2MA 1UF9A 5ENZA 2R3SA 5F2EA 3O4RA 4YK7A 4LDJA 4RXMA 5DM0A 4E5NA 4ZV9A 2OCKA 4GI7A 3UWKA 1H22A 2QN2A 1H0RA 1M33A 3A9TA 3I1IA 3IP3A 2WP8J 4QYMA 2OY0A 3DPSA 3QUQA 3IIIA 1RD4A 2VUUA 2L69A 5H0IA 4BRWA 4BNXA 4R05A 4KAAA 4X63A 2UUBB 2OL4A 4LRUA 3AY6A 1PG5A 4ZWNA 3W6ZA 5E1DA 1RYDA 4M54A 2FVYA 4L07A 2BF7A 3HJUA 1HT3A 4PSKA 4FWTA 5AOVA 1QKIA 4Q93A 4D96A 4INAA 2AN9A 2UXDB 1GL9B 3A6KA 2C2BA 1OWOA 1SIWA 4F11A 1TQ6A 2XWPA 3HQ4O 4E6PA 1IBCA 1MF7A 1DBQA 1E1YA 4PR0A 1IWPB 5ANRB 1O03A 4JC5A 4WXHA 1SVNA 3G7UA 4C5CA 2C5GA 4ZOCA 4BNKA 3URMA 1NXXA 4C3UA 2P9EA 2Q3BA 2R1UA 1L5OA 1UKYA 2WG1A 3F4LA 3UMCA 1TK2A 1G9XA 2PZEA 4HX2A 2OT3B 4TUYF 5HMLA 3VBCA 2VYNA 3TRDA 5CCEA 4KC0A 2HF7A 3AB8A 3HCAA 2OECA 2NT3A 3JR3A 2XKJE 2IP4A 1KJZA 1UEIA 2RGNC 1J8FA 3D3WA 3N9IA 1SCKA 2AW5A 3NATA 3VSCA 1AS2A 4KPUB 5FWAA 1EH5A 2C20A 4TVOA 3TRIA 1CVIA 3KFXA 5CDHA 4M9SA 4G4SO 8ADHA 2FY8A 2CLOB 5BWOA 2JI6A 5JCOA 4F56A 4NYJQ 3SIRA 3E18A 5F23A 4PX3A 5LDDC 3DC7A 4BN5A 1DKMA 1OFIA 1RNLA 1XXLA 1X9IA 2H31A 2X9LA 3W8FA 4E94A 2Q4OA 1U1GA 1OBOA 2BFMA 2FR1A 3CMCO 1Q0SA 4NI5A 3NOVA 4KQXA 4TRMA 1INLA 5KNBH 2A14A 3ELWA 2J33A 2ODEA 3JRNA 4MO9A 4O1MA 3KETA 3PR1A 2C4VA 2DY1A 3F5FA 1JU4A 2QU7A 3EUEA 4TYNA 5A0VA 5T6BA 3KXIA 1PZXA 3S55A 1G20A 4ZOEA 3E3LA 1AZTA 3S8EA 4KRXA 2Z6QA 1UKZA 2HF9A 1OI4A 2JLCA 1DADA 3UBTA 3LX5A 2WWTA 4NATA 1WB5A 1U3WA 4FZJA 4HWTA 2QVBA 3ER9A 5JATA 3LD9A 4FNGA 3WGIA 3KV3O 2K87A 2OGTA 2HPHA 2JFUA 2Y1DA 1JR6A 2HEGA 3D4LA 4YMSA 4E30A 2I65A 1Z4QA 3IDOA 3NCHA 5B5SA 1QP4A 2FRDA 3PC3A 3QNWA 5DBHX 3TCXB 4BB9A 3S28A 4C3VA 5KJCA 5FUMA 3UANA 1RWKA 3AFNA 4CQJA 4EA9A 4GR4A 4ED9A 5LZ2A 4K6OA 5ELMA 1KY2A 4R81A 3VO1A 4EKNB 1LZLA 3V8BA 1KEEA 4V0LA 2FZEA 3GLUA 5BV2P 4OMCA 1HZZA 4LG1A 3AU8A 2PX0A 5KPDA 5K99A 2NZVG 4YC7A 2AXEA 5LP6A 3JATA 5HDBB 4FUTA 2LVBA 3GUVA 2BZ0A 4MVXA 1Z08A 2IXAA 3C14C 3G7NA 2O3QA 2XD9A 3HBAA 3IP5A 1AIPA 4IZ6A 2ZXFA 1SUWA 3DE1X 4QFDA 4TX1A 2IV2X 2RJOA 2ZBPA 2HGZA 3OTWA 4A0QA 1QGZA 1W75A 4QPDA 4UDXX 5FA8A 3G0HA 5KYGA 4OB7A 2GPWA 3JAMA 5CIWA 4PONA 1BWPA 4TL9A 1E3DA 2GBLA 3UH0A 1RCFA 4DB4A 4QUAA 2VPIA 2B98A 3AZQA 4PRKA 4QA9A 1E2PA 4BLUA 1NMQA 1F7VA 1ZOPA 1L5NA 1U9YA 2CK3A 1KL7A 1C8VB 4RCVA 4I3FA 3E7DA 1E1RD 4QICA 3LCJA 3F3MA 2GPJA 3WQQA 2CKMA 2WFLA 1SJ9A 2H11A 1BGXT 2ZI6A 3FTQA 3LVRE 4YBZA 2R2AA 1GZ3A 2YIDA 2GDZA 3L8EA 1WSBA 4G8CA 4WESB 5EJ6A 5K0CA 3U4QA 3UJHA 3HCCA 4OQDA 4PC7A 4WK0B 5SV2A 3OKAA 3S2FA 4BVJA 4D41A 5BMVB 2JLZA 1EFPA 2QQGA 1EFVB 3FYCA 3IEIA 5DXJA 6CHYA 3WGUA 1JEAA 4M53A 4UZEA 1MDBA 1OI7A 2CZCA 2FFJA 2WWRA 4B09A 4C0QC 1IHXA 1NUSA 4MROA 3FM9A 1UKCA 3LQKA 4M0KA 2A0WA 2YXNA 3FCOA 2XGSA 4RIGA 4W6ZA 3CNNA 1WDKA 3UAZA 3Q9NA 2WD8A 3R0ZA 4CGYA 5MHTA 4HNUA 4AUNA 4RSMA 4ZYVA 2FCAA 3I5UA 1SHJA 5HRUA 1D2EA 2ZIUB 1U0HC 4EA7A 3OLZA 3L77A 4F84A 4ZZ3A 3SNHA 3B51X 1NJ2A 1I3MA 2Y1OA 1MA3A 2QM7A 2QYOA 4XIGS 1XYYA 1HNXB 1RM4A 5FHRA 2C8LA 4Y2TA 2BJHA 4FT2A 5H7XA 2QD5A 4QVKA 1C9MA 2AEJA 2XCQA 3G2NA 3BZUA 4L0CA 5K0JA 3VNRA 3AL0C 3GPBA 3JQ7A 3R0JA 3OQBA 3IAUA 1L4HA 1QGUA 2WAAA 3KQTA 4ISBA 2YHIB 2PZFA 1NP3A 1W59A 1O9HA 4G8DA 5FDFA 2JCXA 4MR8A 5JO9A 2WF8A 1LBTA 2IIPA 3N07A 1JR3D 3T7JA 1NVWQ 3THSA 3V7FA 2I8AA 1P9RA 2IOFK 1K4MA 5HCIA 2JI4A 1XWIA 4R8LA 5EEGA 4W9MC 4OXXA 3BORA 2XB9A 4YASA 1KO8A 4TZ0A 2QN3A 2HPAA 4ZKEA 2C99A 1A2OA 4QJ3A 3WIEA 4DF3A 3UN1A 2O54A 2CJYA 2FXVA 4MAAA 3KXLA 1TU3A 4MQFB 3ZJ5A 3PE4A 3HBLA 3EXEA 3N70A 3OU7A 2R7LA 2VF5X 3U4IA 4H15A 3CUWA 4LKRA 3CZ4A 3SJBA 1DKNA 3GOHA 4Q4AA 5EWJB 3WSTA 4D0GA 4M0FA 4EYOA 3M1YA 5ALUA 1NZJA 4AS1A 4YCBA 3TI9A 3THXA 1C9EA 4CN8A 1CUDA 3AHGA 4LE2A 1Y42X 3AR3A 3CNBA 4QG3A 4M6WA 2XQGA 1A5AB 5HUHA 3S68A 4RJIA 1JPUA 1T9HA 2PGIA 4I5FA 4OM7A 4OJNA 1XZHA 1RJGA 2E1RA 4R9UC 2AC7A 1L1QA 3LNCA 4J0CA 5NULA 5DPMA 3RRFA 1EZ4A 1IK6A 1II9A 3Q3VA 3DEZA 4TSKA 3RHSA 3Q0IA 4IXTA 1OXKB 4Y3UA 4R2JA 2WAXA 3V34A 3PTZA 2Q3LA 4NV0A 4DLTA 4KR0A 2XQFA 4K86A 3AR2A 3EVEA 3IV6A 2J4DA 4BOYA 1QNLA 4XIYA 4NQZA 3SKVA 2HA0A 2H1WA 4F2GA 4LXQA 1YZGA 2EQ5A 3BWCA 3I2KA 4L8FA 2C57A 2PZKA 3FCCA 2FHPA 2WC1A 4HOYA 5JMOA 4I1PA 2XY4A 3V7NA 2WD7B 5AW7A 3B8HA 3Q9LA 4J6EA 1PR0A 1U65A 1YI1A 1QONA 4LRTB 1GT91 3CRZA 1G4UR 1U7UA 4GBJA 1M6NA 4QL3A 1Z8NA 1US8A 1E8NA 1SQSA 3GELA 3I9V6 3C45A 1QNFA 1JALA 4OO3A 5MDHA 1DFGA 5CGQB 4JT8A 3K9NA 1MNQA 3VNQA 3JR7A 4DBLC 2WHPB 1ORHA 1X77A 3C3KA 3CUTA 3MQFA 3PS9A 4QODA 3REOA 3RUFA 5B7QA 5JDIC 2GM4A 4EHNA 2CLEB 1TTPB 3CNEA 3JASB 3M0EA 2WIKA 3OCXA 3SXJA 4R2WA 3EZ9A 1GPAA 3JV7A 5F9MA 3V4LA 2QMYA 1IHYA 3DVSX 4TL7A 3PI7A 2YYYA 2ZTLA 4L51A 1UBKS 3QWIA 2QTHA 4GQBA 5AKGA 5DTIA 3ZTYA 3RT7A 5L6MB 2JLYA 1W5TA 1OSNA 1WCXA 4LF4B 3ND9A 3UG6A 4Q9JA 4ZI7F 1Y8QA 4YCCA 1YBFA 1XDSA 4D9CA 3W05A 4ZK2A 1XCGB 1RKXA 1V1RA 3NEJA 1MEEA 2XCTB 3TZHA 4RHTA 2BBSA 5I4CA 1FFSA 5D01A 2IF2A 2VTBA 4YONB 1FYWA 5HF6A 3GQBB 1Z6ZA 2ZSUA 3STTA 3LX4A 1FJHA 3CF6R 4NYIQ 1IY9A 2EKDA 2PZMA 1WF3A 3R76A 3OJCA 1LH0A 4RV9A 3R41A 4DV3B 2Z9BA 2NV2B 5G4LA 2WVJA 3PNMA 1X39A 3UV7A 3HU1A 5YASA 2ZB7A 1P3JA 2HWXA 1S2LA 1QH9A 3R6GA 2W2KA 1VL5A 3FWKA 1PL0A 1DU4A 1KF0A 2WJPA 3HXKA 4ZAGA 3UB4A 5L4SA 2FMTA 3ABSB 4J4TA 4O5AA 5HF8A 4JVNA 1QRAA 3II6X 5CD9A 2QAGA 4MAMA 5JS2A 2R84A 3FMVA 4QSHA 1NVMB 3F3KA 5BR1A 4KHZA 3K4QA 1LUAA 2HSDA 3ID6C 3GWGA 3FUUA 3QTTA 1H2RS 4GEGA 4II2A 2C4NA 4HTFB 1N3LA 3I2GA 3MWDB 3LDHA 5AR1A 1YS7A 3KUXA 3FUWA 3Q3JB 1EM6A 2ZWOA 4I9FA 4FM9A 3PC4A 1MB3A 1WCIB 4YRKA 2GM3A 3EISA 4DMHA 5BMOA 1KH3A 3O8OB 1VKHA 5LOVF 5F1KA 1PWXA 2N42A 5JBQA 3L7CA 1MENA 1WTAA 1TM1E 2H5EA 3ELUA 3ELYA 4IF4A 4NAHA 4PHGA 3T3OA 3RC9A 4OYHA 4S2EA 1MB2A 3OTOB 3I2YX 2W22A 3EIEA 2PWBA 2JVIA 3W5SA 3HI4A 3Q9SA 4LJ7A 4C4AA 3L7DA 2XAUA 5IBQA 5CFMA 2EFDB 3WKEA 1RFGE 1YONA 1A71A 2OV1A 5IJ0A 1HYBA 1NVEA 2XDYA 1UL1X 4B76A 5HIJA 3GLHA 4UM9B 2BZ1A 1CZHA 2PBLA 2X76A 1XYVA 4Q1AA 4D9BA 1T8RA 3ZZUA 3C3WA 5IFKA 1VKRA 2OXRA 3EFEA 2YJGA 4MB0A 4WDRA 5COAA 2VT6A 3S99A 4FYJA 2HMAA 2O2EA 3KTFA 4R9SA 4RE6A 1YR3A 5C8YB 1MO6A 4Y2HA 1U31A 5K4HA 2BEWB 4YY3B 4GR9A 1GEGA 4WBNB 1TADA 4CM4A 2XUDA 3VJKA 3VOTA 4QM7A 4KYIB 5DCLA 3RUCA 5KOJB 1SBHA 2AI1A 4K9OA 3RHZA 3PXEA 2BKLA 4MEBA 2QLLA 5WRFA 3K0FB 3DOJA 5EIBC 3ITEA 4X6UA 4BCBA 3LPDA 3M3HA 2ZSIA 4CR7A 5CX1A 2Y0DA 4OKSA 4Q21A 3T5MA 1W88B 3W90A 3DTVD 4MA4A 1D4AA 3ZLBA 3ZHRA 2C4WA 4DJJA 4Z0TA 5HIMA 3RYCA 3FOFC 2UYGA 5IWCA 3I37X 3QOFA 4IHJA 1PT6A 4FHDA 4IHAA 4JBNA 4BKOA 1H0HA 2HWYA 4JEIA 4ZO6A 4CDMA 1NDQA 3ZWPA 3FDIA 3LNTA 1AKYA 4DLUA 3QP9A 4C01A 4QYTA 1Q0LA 3HMQA 3CF4G 2AR7A 3TZCA 1E9FA 4ZIRA 1DXOA 5LPNA 1TPYA 1MC5A 2FPGA 4KE9A 4BE9A 1W0KA 1QIEA 1U02A 2IHZA 3E9EA 1Q16A 3HZOA 3STYA 5HK9A 1JFSA 1FIUA 4UE2A 2PUCA 2RHGB 4YRLA 3HGQA 5A3VA 2Q5LA 4MS3B 2EX1A 3ZE6A 4R51A 1LBSA 4RDXA 2HLNA 2B94A 2IXFA 3SR0A 4ZXPA 4OF4A 3QX3A 3TW8B 4A0HA 4RDIA 3TI7A 1TK3A 4HQLA 3L6CA 5CFLA 1X8XA 4UU1A 3RK1A 4L78A 3DLPX 4JELA 4BN0A 2QL9A 3OY7A 2I3GA 4B81A 1VKOA 2HA2A 1ZMTA 4MUEA 3V8MA 4F45A 3CW8X 4UTRA 5AW1A 1VFPA 1UFKA 3FN4A 4MH0R 9ATCA 2OMKA 1JWLA 3ICQB 4IR7A 5SY6A 1DIBA 2YJ3A 5C7LO 1TOAA 1P5HA 4PR3A 1K1EA 3L8CA 3AM1A 3PL5A 3QJGA 4XVRA 1DQZA 4HK4A 4PFJA 4IIUA 3GJQA 2UYHA 4MJLA 3CLHA 4BL5A 3ZGLA 1JSCA 3EIXA 1RAHA 4ZCRA 2AI2A 3GLIE 3O26A 3BCUA 3IBCA 2VDQB 1F6DA 1Q5PA 2Q1TA 3I64A 3QE0A 2WSIA 3TJMA 2VXBA 2XMDA 4AQYB 3U2QA 3ZXYA 5JJBA 3JQRA 3DCIA 4HDKA 3R4VA 3TN7A 2PD3A 3NDRA 2XE7A 4X71A 4QUDA 2FI1A 3KD3A 1VJ1A 3OZCA 1ANKA 3IUNA 2QTBA 2PGOA 2QZZA 3V4PB 4UDOA 4B3XA 1IZ9A 3D0OA 1LJLA 4OY3A 1JFRA 1XAHA 3ORYA 1P1IA 2WKQA 1U7OA 2XUKA 3BULA 3UO8B 4ES6A 3DEKA 1HBJA 3M82A 3UAGA 1EWTA 4QOHA 5IUNC 2C07A 4NH4A 3UIEA 2AMVA 4BTLA 1B8PA 5TT0A 4A3SA 3TB6A 1P5RA 3N5CA 3P52A 3JQGA 4J2HA 5EZ5A 2Q2OA 1FPMA 1IQ0A 1O5TA 1NRWA 4L76A 3OF2A 2Y93A 3PKZA 1MVLA 3GFPA 5B2ZA 4CF4A 3IULA 1V11A 1XBTA 2JIBA 1SK8A 1JJAA 2W7TA 3KKEA 3Q98A 2QLBA 2P30A 4MW6A 4XUDA 121PA 2Y68A 2ZIVB 3PJDA 4N5MA 1YASA 3WL7A 3A0UA 1AXRA 1ZRSA 5AHOA 5B4TA 5L51A 2Q29A 4F38A 4Z4HA 3LOPA 4NH0A 3TLMA 4F72A 5JO0A 4GNKA 1HT1E 4YH1A 3PA6A 2YJNA 5EMLA 4DJDC 3ROEA 4LQDA 1ADBA 1YTLA 2AN4A 1PR6A 1XA0A 2EYUA 4K6FA 4C76A 3UXHA 5B57C 3O2NA 4KP7A 1V7QA 5AW2A 5JQGB 1N8KA 1PBNA 3GZTB 3P9PA 4JLAA 4TV9A 3WGVA 3H05A 4ERNA 5CD1A 3LHIA 4UASA 1CHNA 1L5FA 1PK9A 3C2QA 3ROQA 4GT1A 1YVRA 4LN1A 4IJMA 1BCSA 4ZV7A 1PTJC 3DONA 4YGYA 2JIZA 2P8JA 4MGZR 3V46A 4C4ZA 4F9GA 1X9HA 2PX4A 2HU8A 3D8TA 3GARA 3O8QB 2XUGA 1QKJA 1BXZA 4K9KA 1TMGE 4V3BA 3WSWA 3DDWA 5J4KA 1EUYA 1K98A 4CQMA 4QHTA 1SU6A 1OFGA 3KUKA 1YOVA 2OCDA 3F9IA 3PB3A 4LK2A 4DNQA 3AT1A 2C3PA 3PHLA 1R4ZA 5DYIA 1VZ3A 1ZMOA 2BFEB 2HB6A 2M32A 4GMXA 5AKYA 4ESEA 1POWA 1RKVA 3EF0A 4XWWA 3D6HA 1U1FA 2B2XA 3FRJA 1R27A 1WUJS 1POXA 3W5DA 3PDCA 3GG2A 4HJXA 1M34A 3HA2A 3SIWA 1I32A 2BGUA 3WL4A 5A5GA 4DR2B 4OBXA 4JP2A 3TG8A 1V2HE 3DFUA 2VXCA 1VPEA 4JZKA 4QXMA 5T57A 3TFQA 4EPXA 4KPGA 3NBUA 2FSGA 4ZYYA 5HUQA 4CKZA 3A26A 4I0WB 1NM5C 1R9NA 3LLMA 4L2IA 1EP2B 3IEVA 1ZC3A 4JJAA 1U3TA 3VC2A 4CKXA 5EHXA 3FSJX 4C0WA 2A5JA 3NWPA 3GZNA 5DSTA 2XW6A 4MEJA 2H2AA 1SXJC 3GJ3A 1AUXA 1UBJS 2VJNA 3ABOB 1XPOA 1RQXA 3INYA 2TRSB 4FYWA 4HUJA 4UVIA 1SBQA 2J9GA 1C29B 2A58A 4F93B 1KOGA 1H3NA 4KQCA 4UEWA 2VAXA 1ISJA 4Y2JA 3MN1A 3SY8A 3ETEA 1RQNA 2IPOA 3E7PA 3NUQA 4YA6A 1DKLA 3W7BA 4D80A 4XRGA 1XNHA 3JALA 1Z17A 3C6MA 5LC1A 3J80A 3MAJA 2R8PA 3L6EA 5B1HA 4F46A 3LYHA 4YRMA 2QUIA 3DQQA 2H4XA 5A0FA 2D4HA 3LUAA 1CDOA 2F64A 1QWSA 3FMPB 2PPLA 2AXQA 5D86A 1FSFA 1V8OA 4JLMA 5BYAA 2UUAB 3L9WA 5SY9A 5D87A 4RQUA 4M1OA 1II0A 3W6PA 3SC3A 5J4LA 3ZDXB 3JU3A 5L3ZA 3AEZA 1W4BA 5DXAA 3HKBA 3UV6A 2V7QA 3K16A 4UUMA 2R8ZA 1EGVB 1W9HA 1M0SA 3CE6A 3MBKA 3ZY5A 1H0KA 1WSWA 2GR9A 1MQ9A 4X7BA 4UFPA 3EIFA 2QBYA 1M6VB 5LQAA 4YV0A 1I2ZA 3K2QA 4N03A 5CXQA 4YUXA 1MW9X 4YGXB 1PUJA 5H3CA 3L8DA 4LC1A 2AFHE 4FTWA 4FI3F 1FU4A 1W93A 4BNFA 4M1ZA 1L8AA 1I1HA 2DC1A 4JZYA 3D4IA 4OQEA 3EWSA 1L6IA 1QJ4A 4KAFA 4MRNA 4D97A 2E4ZA 2OCBA 2YVLA 1KZ4A 3CX7A 2VZLA 3RFFA 3D7RA 4OSPA 2O8BB 3OPXA 3HXMA 1XZDA 3A1FA 2J5BA 4S1PA 4UVHA 5FYDA 3FYUB 3MJCA 4HQ0A 4MS4B 2DMRA 1D1QA 2QX9A 5CURA 2DZDA 2HWUA 3H1FA 4LYDA 1ZH8A 2AQKA 2YCBA 4OV6B 5AK3A 2RGCA 3HBFA 3O1LA 1XE3A 4TKLA 1NBEA 1F6BA 1G3MA 2GGSA 4B5LA 4FB4A 4ZHQB 5A4DA 2YV2A 1UBGA 2YV1A 1JPJA 1PNOA 4E2WA 4X8LA 2PM8A 1LQUA 4MI6A 5TVGA 4C03A 1PR4A 2V03A 1YIDA 4LXIA 5E1MA 1EXWA 1YDGA 2HIHA 3OJOA 4KQKA 2YN4A 3P9XA 1Z73A 5K8TA 1B7GO 1P0PA 2DFPA 1YZTA 1QH1A 2H8GA 2PT7A 2H06A 1TUEA 3DXFA 3K5IA 4HS4A 4PNZA 2FQWA 4QFBA 1I1QB 3QA9A 5EGSA 5M3BA 1Q0TA 3HO1A 5FOQA 2GARA 1QF7A 4L57A 4Y6PA 5FEUA 1Y4UA 1T35A 2JKZA 2IX3A 1UDRA 2ECOA 2VJMA 2ZG6A 3ZGNA 1KAHA 1B8NA 2W83A 2B1QA 3WHPA 1Y4DE 2D6FA 2O2XA 3FPBA 1MA0A 1ZXLA 1X1AA 4GOND 5AM2A 5A7FA 4C22A 3VJRA 1PLKA 3DLIA 4FFMA 5C1DA 2BLLA 1UBFA 4PLYA 2R8BA 3ZHSA 1H66A 3V4VB 2O3SA 3EBLA 3U09A 1IOZA 5F9FA 4L6CA 4GC5A 4LAFA 5F98A 3S2IA 2ERXA 1OBVA 4I2NA 4R8RA 3CX6A 1USGA 1VSTA 2HO4A 3GUYA 1W36B 4PYIA 4QBIA 5A3RA 4MCJA 2WU0A 4GQAA 1Z2OX 5T4BA 2Y6UA 2HEIA 2QHXA 3MERA 6ADHA 2IEYA 3DKRA 4ALKA 3ZDRA 1IXRC 1S1MA 2QN9A 5LP6F 1RTKA 5HJEA 3GPIA 4B9EA 2F62A 4FE7A 1E9SA 1SOAA 2VTBB 3DMFA 4EO7A 1R64A 2DH6A 1IB6A 4AI6A 5DEOA 1JDTA 3PA8A 2D2EA 2G6TA 3OU2A 2QPOA 2OR3A 4FN5A 3ZI7A 2JVJA 3SLRA 1P5JA 2GTHA 2HDOA 1RJDA 5CT6A 3R0VA 3GY0A 4F8EA 2X4DA 2BGJA 1KK1A 3PNBA 4QATA 3U4CA 2Z2IA 5J23A 3B2NA 4BY9E 1S1CA 3E15A 1I7SB 4ITVA 5AK4A 3K70D 1VHLA 4N7BA 2WHQA 3WHIA 1RJEA 4C0HA 4MGHA 4OFWA 4ZAYA 5AVOA 1CXZA 3BQNB 3ZDBA 1VHDA 3U19A 4V0MA 1U6IA 4WASA 4NZNA 2UZ3A 3HDVA 3I0ZA 2OWDA 4ODIA 4DCSA 1BSVA 3CSSA 4WV3A 3SZLA 3KU1A 4EMSA 1XNQB 4MUKA 3D7MA 3OD5A 821PA 1HQYE 1UK7A 3DE4X 3RRYA 2DWOA 5KKCA 2VHJA 5DZSA 1E92A 5ALRA 4KSYA 4EFMA 1O96A 2DQ4A 3KYCB 1P4JA 2Q9UA 2VA8A 3CA8A 2BKVA 3GP3A 1A9TA 1MXHA 3ZD6A 1C7EA 1B6SA 1H9BA 3NV7A 3GB9A 3ONDA 1HOTA 4OHXA 1GL3A 1BIFA 1YRAA 2R8RA 4Y9DA 4CIBA 1T24A 5DDIP 2BY4A 3SOZA 1M8JA 1BYIA 5CYGA 1OKKA 4UBNA 2WB2A 3KXPA 5DW0A 2X1MA 1DEXA 2FMFA 3EUFA 5CLLA 2CL6X 3CEJA 1RSZA 4ON9A 5CCDA 2F1JA 3CE9A 3UAOA 1R9JA 1FW6A 1U2DC 4B47A 5CBPA 5FXMA 4QBTA 3TO5A 4R68A 4EGFA 2DETA 3O31A 4Y6QA 1ZM3A 4OUDA 1A98A 2OLEA 2FSSA 2ICAA 1ITZA 3C48A 4PYRA 3DWFA 1DEAA 4QTUB 3GIDA 4UFNA 2NTJA 4FBLA 3FTEA 2E5WA 4IOJA 5TPZA 2A9RA 2QR3A 1P33A 4I1UA 4EMTA 2NADA 1HDXA 3MTIA 5HBGA 1E98A 2FK7A 2H2WA 1RI4A 1W1IA 2Y67A 1DZ3A 2ZAGA 3C24A 1IN8A 4PFKA 1AJEA 1TTHA 2Z09A 3OLXA 1SU4A 5CEEA 1LPPA 3D4NA 2OORA 1E7YA 1ACJA 1OXXK 4XWAA 2PZAA 2I76A 3H5NA 3RAJA 2HJVA 2WIDA 4FSXA 1WXXA 2WU3A 3UTCA 1LTKA 2QYHA 4X91A 2NMVA 2GCEA 3G2KA 2JCYA 4U7DA 4FNMA 2ZE5A 5B37A 1E62A 4KQ6A 3BM5A 5SYAA 3I28A 3T1HB 1PF7E 3ESRA 3UMVA 4ZXFA 1BROA 4RV4A 1FSSA 4P7GA 4TYWA 1ATIA 5KOYA 1S9DA 4UEOA 3WIBA 4LRXA 1CPYA 1BNCA 4G84A 3KU4A 4FMCB 1DX9A 4YMHA 4F6RB 1LLUA 1U1EA 3BHJA 4R5HA 2FU5C 2XA2A 3TTWA 1OH6A 2EARA 5ENVA 2BAGA 1RPNA 2GT1A 1WWKA 1Y6ZA 3DZGA 1UM9A 2CHEA 4M60A 3GEMA 3CEAA 4KODA 5BN5B 5I8WA 1T1GA 2AZMA 4UXJA 1DBWA 2P6OA 4CN9A 5BNZA 5HQ3B 3A6HA 5KIAA 3ETCA 3JZDA 4RPJA 5EMHA 4R31A 3WOVA 1EPUA 2WFZA 1PDVA 3QE4A 4M1YA 3F47A 4E31A 2O1SA 5CTJA 3NIWA 5F9HA 4CCSA 4M1MA 1C7FA 3WO1A 4PS0A 3RAEC 4IIXA 5BN3B 2OM2A 2XEXA 3VQTA 4DDTA 4ZMBA 4PZCA 5KSYA 1QIMA 3O9VA 1E2IA 5JOQA 4REMA 4QX6A 2IYTA 4MYRA 4JEMA 1OLUB 1E7QA 4LF6B 1QZXA 1IEXA 4YS6A 3VSAA 1W76A 2H92A 3TSWA 5A4IS 3MOIA 5I3ZA 3SQNA 4F0JA 5AVVA 4YECA 1EQUA 2P5SA 3ODPA 1TRKA 1L5VA 4BFZA 1HUQA 1O6CA 4X7PA 1EHYA 3RV4A 2QMEA 5C5IA 2M9MA 5AH0A 4ADSG 2XH8A 3H7AA 1RJ9B 2B20A 4OHMA 3ZCRA 4RTLA 2PJZA 3RIMA 4J90A 2OFOA 4JWKA 1QP7A 2I4RA 4P93A 3PNYA 2VT7A 1PJ4A 1Q84A 1JVBA 4EVIA 4JI6B 2FWMX 5D3ZA 1K2VN 4R6WA 1I2CA 3QI7A 2EWWA 3H4TA 1ABFA 1R6DA 2Y6VA 5BVGB 4MNTA 1EDOA 1Y4AE 1E59A 1RR6A 4RVDA 5H80A 3PHGA 4RGQA 3PEYA 5JCPA 5JEEA 1P62B 4JSYA 4RKFA 3KB2A 1QAMA 3H84A 5LZ5A 1HNWB 4DJ5X 1GNQA 4HDCA 1ZNXA 2JBHA 1V39A 1G8GA 2FA9A 3LUCA 4H1WA 2IYAA 1NMEA 1ZD4A 3S1AB 2F55A 3NHAA 3D6VA 1T3TA 1DXHA 4A26A 1HO3A 1L7OA 3IE2A 3OWXA 1SUEA 2AMJA 3FKQA 5DE3A 3WRXA 4AJPA 3FF4A 3ZDYB 4CR6A 1T2CA 1TUIA 3Q2OA 4EL0A 3RIGA 1A5SB 4JI1B 4G0OA 4HWOA 1HYHA 4LJ4A 3TAHA 3L3BA 2PV7A 3KOWA 3UHFA 3MILA 1W29A 2BL4A 5KHLB 1NJ5A 4JJZA 3NTUA 1ND5A 1FRFS 2G9UA 2QTVB 4S24A 3WISA 3WR5A 4D8VA 3RYTC 1C2TA 4BO7A 1N2HA 2DWPA 2B0JA 3RFVA 4DIEA 5E0KB 5DI3B 5JFTA 3I9NA 1GAXA 2Z3WA 3KXKA 1CB7A 4WOKA 2P75A 1EK0A 3L7BA 1L3BA 3U40A 4AP5A 4I9HA 4B4UA 4DRXB 5F3WB 1T6BY 2RKBA 3IQIX 1XZBA 3I52A 1N7JA 1OLSB 4W5WA 3TXXA 3EPRA 2B3DA 1Q74A 4W5OA 1XZNA 1HY3A 2OD7A 2ZBUA 3ESBA 3PZRA 4UTOA 5BQOA 3VISA 1U7TA 1WVIA 4E2ZA 1Y5IA 1YS1X 4PYQA 2UU9B 4XSGA 2YUTA 3KR2A 3W8DA 5EQJB 1ZOSA 3K53A 1GZDA 3M6VA 5LMNB 2BW0A 4AJOA 3BH7A 3RNOA 1U0NA 1DC8A 1E0SA 1AOXA 3DV0B 3F8TA 1Q7BA 1TYCA 3ONEA 5FAKA 2Q0QA 1U9CA 2J48A 3DXZA 3MUNA 1A72A 1WVGA 1L4LA 2WI8A 4INZA 4UE3S 2RCYA 3DA8A 1RCUA 3A2LA 1W5SA 1XMXA 1MZVA 2OK8A 1WXGA 1PGQA 4RTKA 4KDFA 3GJ8A 3H1BA 4G5HA 3GJTA 3GRPA 1JS1X 2D2VA 3VHQA 1MQAA 4BNDB 5BW5A 1NI5A 1PW7A 2JIQA 3FRHA 3H2IA 4FBMA 3T41A 2BMFA 1CRQA 3L01A 4DLAA 1V7PC 2CFCA 3R6WA 4WIAA 5AVSA 2FCRA 2GILA 4NYMQ 4Q9NA 3WQBA 1H4SA 3IAS6 1GPMA 1O9GA 3E7FA 4CEIB 3IEMA 4KNYA 1QS0B 1QZZA 3QHPA 4ZT3A 3H99A 4XWOA 2FJPA 5DLPA 3PDHA 1SO8A 1ID1A 4D9HA 5TPWB 1DJPA 3DLTA 3FJYA 4BVFA 2OC4A 1I30A 5F5XA 2X5JO 2XZTA 1BDBA 3RLIA 4F85A 4EG1A 5K09A 4RHEA 1SCUA 2YMQA 3EZNA 3K96A 4HDNB 1WZ2A 5KCZA 3HCNA 2H54A 3LM8A 4JUIA 3GDFA 3H86A 2ZP1A 3RSHA 1O94A 1NWCA 2F59A 3BAFA 5EXSA 3V7UA 3X2FA 4F5DA 2FLKA 2C4KA 5EMNA 3BRWD 2H4ZA 3R09A 3FUCA 2O50A 3DE3X 1YSCA 4ARZA 4BVKA 5IVPA 3N0TA 2FR8C 2M6RA 2PQ0A 5FD8A 4AZWA 2QPLA 4AJIA 3BKWA 3WWZA 2IY9A 4DSZA 3FPGA 2YW9A 5EWLA 4B3IA 4N0EA 3MLEA 4NBKA 5AI6A 5IH3A 4FMBB 4LC9A 2FE1A 1UODA 1MJNA 3GLTA 4R9VA 5COQA 4MK4A 3TD9A 3DTYA 3ZHQA 2V59A 4KR9A