3TZCA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
224
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 76
structure length 224
sequence length 245
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzcA00
1KVSA 3QP9A 4FFRA 3HSKA 4AJPA 3A1NA 3PXXA 4R68A 4UEKA 4ZQFA 1EBUA 5BSHA 2D4AA 4MVJF 3IJRA 2VRCA 3I9OA 5C5IA 2P68A 3ZNOA 1P0CA 1WPQA 1R0SA 3TDKA 1MLDA 3RFTA 4PG6A 5DULA 2B5WA 1ZH8A 3V2HA 4JN6B 1PQUA 5JNLA 3ROPA 3WR5A 1F8GA 3A4VA 4CUKA 3RBXA 4CV1A 1DJNA 4Z0TA 3EGOA 3QVSA 1C0LA 1BSVA 1ONNA 1X7HA 2FY8A 5L9AA 1T25A 4XQ9A 1HZJA 2WD7B 3OJEA 2YHIB 4II3A 1PJQA 2TMDA 4CM9A 2Y1DA 3GGPA 3VVCA 5T57A 2X8LA 2HK8A 5FYDA 4YAGA 3GAFA 3BHMA 5I7FA 3WYBA 3EK2A 1XSEA 3L07A 2VRCD 4NZ9A 1J49A 4ESOA 5LCXA 1KC1A 1GR0A 1XELA 3D5QA 4UEJA 3GA0A 1YH3A 4JBIA 3GGOA 3P7MA 4ILKA 1N92A 1CWUA 2IYOA 5TGDA 4WLVA 1NAIA 3H3JA 3QWAA 4ND5A 4JIGA 5DP1A 1XHLA 3BZUA 3JQAA 3BMCA 2CZCA 3VH2A 1IL0A 2YUTA 1LRJA 2NU9A 3D4PA 3DBLA 4UVEA 1DDOA 3ZU2A 4O6VA 5BQFA 8LDHA 4CLHA 1VL0A 3DHNA 2X0NA 3ORFA 2SCUA 3ENNA 3P5SA 3FCOA 3PHGA 4K9DA 2O50A 4GMFA 1ADFA 2Q99A 4D3FA 3IAHA 2OP0A 3LLVA 4HBGA 5J23A 4OL9A 4P38A 3GVXA 3G79A 3OHSX 2EF1A 1PSDA 4EGFA 3QVOA 3FHLA 3DBVO 2PD6A 2VT2A 4W6ZA 2V6GA 1VSVA 1EZ4A 2D1YA 3GHYA 4JNKA 5DP2A 4ZRNA 5EL0A 1JVBA 2HMUA 3SLKA 3AI3A 5COBA 3CMMA 3I6QA 3JQ8B 2VHZA 4MO2A 2DKNA 2VHXA 4GKVA 1KC3A 4NPCA 4EJ0A 4OH1A 3O8QB 1WVGA 5BSGA 4Y6SA 3TN7A 1U3WA 2ZTLA 4J43A 2AQ8A 2VTEA 1Y8RB 5A4DA 2YZ7A 2OMEA 1E7RA 5IFLA 5KVVA 1GAEO 4J4HA 1HDRA 4R3NA 4WLOA 1Q0LA 2FRDA 3ONEA 4RO0A 4AJOA 5CPBA 3CKYA 2HRBA 4WASA 4W7HA 4I5GA 4HKTA 1MFPA 4MVJE 3GF4A 4CM1A 1YVEI 2QG4A 3FSRA 4E13A 4E0BA 1DIHA 1W73A 1NFQA 2I66A 2RBEA 4JK3A 5I9LA 1TT5B 1JVSA 3WTCA 3H8VA 5THQA 2RAFA 4O63O 2IODA 1ZK2A 5L4LA 3RUEA 1AHIA 1U3UA 2RHCA 1ZEJA 3DZGA 4J16A 2DVMA 2X9VA 5A9RA 3RJ5A 1SO8A 3DZFA 2GZ1A 3PLRA 4GVLA 3FBGA 4UUMA 1M76A 4Y8VA 1LNQA 4Y6PA 3UCFA 1B3BA 3I23A 3JYLA 3KXDA 2P4HX 1EVJA 4PLGA 1TA4A 2WYUA 3FRJA 3GNSA 1YO6A 3JQGA 3VH1A 4E12A 2VHWA 1O9BA 2AA3A 2Y05A 4CM3A 2V7PA 3WB9A 1LX6A 3RUCA 3ZV5A 1Y5MA 2O3RA 2AE1A 3WLEA 3WNVA 2W90A 4R54A 4BNNA 3VPFA 2DT5A 4LMRA 4ALLA 1GDHA 4FB5A 3MJSA 4LVUA 1HETA 3F3SA 2EHDA 1W4ZA 4YAKA 1GQ2A 4GLOA 2O2YA 3U4CA 2YV3A 2XF8A 4E4YA 4IBOA 3BAZA 3A28A 1M67A 2ZKLA 5JAIA 3GPIA 4CMHA 1LSJA 2GERA 4O0LA 3ZN2A 1IE3A 4KWHA 3ZWMA 2E49A 4Z9XA 4CMGA 2QRLA 5C7IO 3DEYX 1GZ6A 1M66A 1LDMA 5K6AA 2BFOA 2NWQA 3A06A 1U4OA 2I3GA 3BMQB 1NHGA 1NVGA 4L0QA 2EIHA 3GT0A 4XD2A 4PLVA 4D41A 3DDNA 5JO9A 4BUCA 1OOEA 4F46A 2I67A 2NLOA 4ID9A 2ZYGA 4FJ0A 3OFSA 3WNQA 4G5HA 4QECA 5AVOA 3D0OA 1IY8A 4B7CA 1ADBA 4UVIA 3PWZA 1FJHA 3I83A 4OSPA 3TZQA 1D4FA 3TQHA 1DC3A 3UXYA 4WCFB 1O94A 1UDCA 3F1LA 5BNFA 2JKVA 1JAXA 2C59A 1EK6A 1Q0HA 1X7DA 1ZUD1 1XQ6A 3L0DA 3ZW9A 5KIAA 4YB8A 2ZQZA 3DWFA 3R3JA 1DHTA 4FFNA 5L40A 1T2FA 1H2HA 3NT4A 1B3RA 4XR9A 3V2UA 3JQDA 4AJKA 1TLTA 5LC1A 3PZBA 5CDGA 1ZK0A 3JD0A 3OJOA 1X15A 3HDQA 4IDDA 2X1HA 2ZQYA 3E1KA 4KUHA 4OM8A 5CFZA 2D2IA 4ZICA 5KWEA 5TLSA 4B3HA 3H4VA 4FC7A 4E3ZA 4L4RA 1TB4A 4IQ8A 2GLXA 3MCVA 1NXQA 4B8ZA 4PGFA 1HZZA 4CUJA 4IPTA 2GYYA 3ZW8A 4J90A 4WNCA 3Q2IA 2WTBA 4K6CA 1MC5A 1DC6A 1PGQA 3L4SO 4GWGA 1UH5A 3BHJA 3FNHA 1TI7A 4TMFA 4Y9DA 1KVTA 1H2BA 4BMSA 3I9LA 4D3DA 4F6CA 3O38A 3KB6A 1DO8A 2C29D 5DCUA 5ENDA 4BS9A 5JYDA 1U2DA 2PTGA 1M2WA 4XGNA 2VN8A 4QQRA 4A5OA 4YAEA 4BOYA 5JDIA 4Q3NA 3HADA 1NPDA 1SBYA 1VL6A 3H5NA 1I2CA 4OXKA 1TEHA 2FZEA 2V6FA 3E9NA 4IXWA 5AQ1A 5IDWA 1R12A 4KP7A 3VH3A 2CNBA 4I5DA 4XZ3A 3BTVA 4DIOA 1K6JA 3PHIA 1R4NA 4BGEA 2QYSA 1YB4A 3DBHB 3QLJA 4IJVA 3I3OA 1XU7A 4K28A 3PIIA 4XR4A 3U49A 4LK3A 2W98A 4U5QA 1OBFO 4PLYA 3GNTA 1YL5A 3ONDA 5LDGA 3U4HA 3WJ7A 3Q0EA 2J8ZA 1MXFA 4RVGA 2HRZA 2A94A 1ONPA 2OBYA 2OXIA 1S7CA 1GFSA 4NU6A 1LDBA 3BMOA 5JO0A 3TSCA 3SJ7A 4WLFA 4MINA 2PGLA 1C0KA 3MJVA 4PZEA 2EKPA 2DAPA 3ZV3A 3AJRA 1GD1O 2R00C 1LA2A 2Q2VA 4BB6A 4BL5A 3QJ5A 1A5ZA 2I5PO 2JAHA 1BVRA 4AICA 3AOGA 4CV3A 3PDJA 4W7IA 4J49A 4HX5A 5CEEA 4FFOA 3K31A 2RIRA 3WWZA 2YQ4A 3AM4A 3WGZA 1YDWA 3JCZA 1RM5A 1E3EA 3UICA 5FEUA 1B26A 3WLFA 2B5VA 5IG2A 1FDTA 4RPLA 7MDHA 4PG4A 4Y98A 2DTXA 1ZXLA 3MTJA 2GSDA 4EDFA 1K6IA 1MP0A 4R1SA 1PWZA 4BQRA 5G4KB 4MDHA 2F1KA 4RVFA 5HTOA 2Q50A 4WEQA 5EMHA 1FK8A 2NUAA 3BTOA 4Q3BA 4CLEA 1EVZA 3DAGA 4MKZA 1KERA 1TXGA 1SOVA 2NTVA 3MOGA 3GN1A 1CETA 2RH4A 2X6TA 3SC4A 3WGYA 3JQFA 1O0SA 1H93A 1RM0A 1UJMA 2O3SA 3E48A 3EUWA 3BMNB 3KEQA 3W8EA 3HHPA 4J91A 5JCJA 1L7DA 4R5MA 3VOSA 1HYHA 4NK4A 1ZK3A 3U0BA 1F14A 1PGOA 2PKRA 2DBVO 4GBJA 4CM4A 1PQPA 1KY4A 5JY6A 3MZ0A 4LSWA 4YRDA 1AUPA 3ZWXA 3O9ZA 4W9NC 3DHEA 1YBVA 2DBRA 2VWQA 4R69A 1CDOA 3OIGA 4G65A 4U6QA 3NRCA 1LSOA 3ZH2A 3LT1A 2GPTA 1LRKA 4BKUA 3CMCO 1YQDA 3DZJA 4PZCA 1DAPA 1LXCA 1QG6A 1Z6ZA 1WDKA 1B0AA 3LC1O 3PTZA 1K3TA 3CIFA 4YBZA 4XRRA 1GY8A 1NM5A 3X2FA 1KEPA 3MEQA 3N74A 4XJSA 5DN9A 3VZQA 5CHEA 4CLOB 1Y9AA 1NQ5A 3UF0A 1CRWG 5KVQA 1QYCA 4AJ2A 3AOEA 1BXZA 4BMNA 1Z73A 1O6ZA 2UUPA 5AXAA 1N2SA 5F5NA 4EZBA 1WP4A 6ADHA 1ZO8A 3KZVA 2NQ8A 3GMDA 5HS6A 3ZWAA 1LLDA 1ZKMA 2AG8A 3AFMA 4J1NA 2DBZA 2ZB8A 4UEOA 1DBVO 3BXXA 3QHAA 3D4NA 4HV4A 3P2YA 3TFQA 5IXYA 1E5LA 1HE3A 2HU2A 1P3DA 3RCBA 2VT3A 4CM7A 4DLBA 1HSOA 4B4WA 4EUEA 4MOWA 1ZSVA 2JJYA 2P2SA 3VPSA 1H5QA 2FOIA 4BO0A 4BGIA 3MJEA 2HDHA 4GSKA 3KVOA 4PG5A 3KUXA 2PGDA 2HCTA 1P77A 1E6EA 1RPNA 1U5AA 1DAOA 4E6PA 4CODB 1DLJA 1NQTA 1UDAA 4N5MA 4EI2A 1F8FA 3C7AA 2Q1TA 2VUUA 4BNUA 4RLSA 4QFDA 4YAJA 1E0DA 3V5NA 4AJNA 2VYVA 2XXJA 1YB5A 4YJFB 4B4VA 4JQCA 2W4QA 5ICSA 1HRDA 4B8WA 1PJSA 4LRTB 1VI2A 4RJTA 3WS7A 3VH4A 2PZKA 2GN8A 3WIEA 4JJIA 3WBBA 2JFHA 1HSZA 5DCWA 1X7GA 2CUKA 1H9BA 5A9SA 4H3VA 2BFMA 3PHJA 4AJIA 4BNVA 4ZA2A 4RL6A 3H7AA 4IXTA 3B1FA 3GUYA 4U0KA 1P9LA 4FDAA 2NACA 2VQ3A 4KQWA 4ND2A 1P33A 2FSSA 2P5YA 2GRAA 2HO5A 2Y99A 2AEJA 2ZK7A 2IZZA 1EVYA 2XXBA 3E82A 3OIFA 2HMWA 4HP8A 2RCYA 4Z9YA 3AY3A 4H15A 3NAQA 1YKFA 4ROSA 3QVTA 5HBRA 5G0UA 1SOWA 1V0JA 4NQZA 4ALMA 1P31A 2I9PA 2GDZA 2VWHA 4D0SA 1FXSA 1PS9A 1ZMOA 2QQ5A 2AQIA 3WGTA 1UZNA 4O1MA 2GZ3A 1U4SA 3JQ9C 3MOIA 2QX7A 4DXHA 1R0LA 2WD8A 4XQGA 1WMAA 5BT9A 3L6EA 4P8RA 3DZBA 3EY4A 3ZWPA 5EINA 3AY6A 1GV1A 3BMCB 3JQAB 4YDRA 3PGXA 1LC3A 1PGNA 3DBLB 4XYMA 4PLHA 1ZW1A 2C5AA 5F1KA 1WMBA 3C1AA 4Q3EA 3PHHA 2WE8A 1HE5A 3GVCA 4BNLA 3OF2A 3QV1A 1X13A 2OFPA 3E9MA 3ABIA 1U7HA 4FBGA 3WOHA 1PJLA 3RU9A 3KRTA 4DQVA 1O5IA 4XRGA 1NYTA 1GUZA 2YV2A 3Q6IA 4RZIA 1MFZA 5L53A 2VZ0A 5A5FA 3KSDO 2CMDA 1I30A 1Y1PA 2B83A 1UXJA 2O23A 2UDPA 2D5CA 3KO8A 5AXBA 3D3EA 5IXSA 2P9EA 4BKOA 1BMDA 4W99A 3U62A 4AJ1A 1A27A 2PK3A 1X1TA 3GDFA 4NJOA 2HAEA 5CG2A 4M87A 3ZWVA 3PIDA 3PDUA 1H94A 4AVYA 1IZ9A 1MC4A 4KTVE 4OKIA 3SXPA 2P9CA 1R4MA 1UUFA 2EJWA 3B20A 1R16A 1XKQA 1D8AA 4RVHA 1L7EA 1QP8A 4PLCA 3AU9A 3VTZA 3LVFO 1ONOA 3F5SA 1LUAA 2E82A 2H63A 3I9JA 4H7PA 3PJFA 3H9GA 3ON5A 3KBOA 1EQ2A 2JFGA 4MVJM 4WLEA 2ZTMA 5DF1A 4M55A 3HWRA 4ND4A 4WK6A 2B4RO 1A9ZA 4R1TA 4EUHA 4MIOA 4FOOA 2Q2WA 4I8XA 2BI8A 1DSSG 2NU6A 1VE9A 5ITVA 4MPDA 4XGIA 3ETGA 5IN5A 2PD4A 4Q39A 2D3TA 4OMUA 4NU5A 4CLXA 3OQ6A 4CMIA 3K8ZA 1K89A 4PCVA 4DRYA 4J7UA 2O3QA 4MJLA 1E3WA 3NTQA 1CERA 4HUJA 4MVJD 4RDIA 4IMRA 1CQJA 3JQGB 3G49A 3Q3CA 4LMPA 3SLGA 1NNUA 5A03A 3JQFC 1C0IA 3G1TA 3ST7A 3RUFA 1OMOA 4ZD6A 1P1FA 2NSDA 3R3SA 3U4IA 4BO1A 4Z0HO 4EEXA 5IZCA 2Q1WA 1I8TA 4NFHA 1O95A 3ICCA 1KEVA 2Z5LA 1X0VA 3KHUA 2VRBA 4KUEA 3DTYA 2R00A 2VHVA 4Z3DA 4ZQGA 3K92A 4YA6A 4OHUA 1P1JA 1U8FO 2X23A 4R1UA 3NV9A 1HDZA 2IXBA 4BGVA 2C20A 3B1JA 3ICPA 5EESA 1RWBA 1NAHA 1PS0A 2C82A 2J6IA 1IPEA 4RCVA 3ZWBA 1EMDA 3HB5X 3R1IA 2YV1A 3QVWA 4BQPA 5KVSA 2D59A 2J3JA 2CDCA 2RH8A 2Y93A 3O26A 3CPSA 3GVPA 3QE3A 3WIDA 1ZVMA 2A4KA 1QORA 4KOAA 4CMJA 4GSLA 4CM9D 1E7YA 1ISIA 2Q46A 4JJFA 4EBFA 3GFBA 3INGA 3OIDA 3V1YA 4NBVA 4UUPA 4BNMA 1NVMB 3L6DA 1PJ3A 2DFVA 1PJTA 5GZ1A 1K5HA 3AOEC 3LF2A 4IS3A 3T4XA 3PPIA 3QW2A 4PG7A 3ZHZA 3JQAD 2DU8A 1Y8QA 3HZZA 3C1OA 1I3NA 3RC7A 4B3JA 3GMSA 1GCUA 1H6BA 4HFJA 4BO3A 2EERA 2IXAA 4LCJA 3NUGA 4URFA 5L7TA 2O48X 3JQ7A 1FDVA 2CD9A 3LC7O 2XOXA 1MUUA 5ADHA 3BTUA 4D44A 1XDWA 1KVRA 4CQMA 4E2WA 4ZHSA 1EE9A 1AGNA 4I08A 4E32A 4W9NA 4D45A 3DZKA 1HEUA 2JCXA 2Q2QA 2X5JO 1KYQA 2GGSA 3AK4A 3DB2A 4B7UA 1LLQA 4FJ2A 3JYNA 5H81A 4LISA 2O7QA 1GPJA 3W4KA 1GUFA 2TMGA 4BNJA 4DLAA 1VRWA 1UDBA 3ETEA 4LVCA 4JP2A 2EW2A 4NJMA 1K6XA 1V8BA 1YBAA 4GQAA 4J0EA 2O4CA 3IL2A 2DBQA 5GMOA 1C0PA 1BTOA 3PJDA 5G0WA 2AHRA 1B8UA 4CQMD 4JXKA 3ZV6A 2J5QA 1I2BA 3DBRA 5F1OA 4A27A 1HXHA 4BVAA 2X22A 3HJAA 9LDBA 2PH3A 1EFKA 4IGFA 3IDSA 3ITDA 5B4VA 4M1QA 3KV3O 2YYYA 2JCVA 1TT7A 1ZZEA 1MA0A 4TWRA 4DL9A 1HDGO 1SB9A 3GEDA 1R4NB 4FQ8A 3S2IA 4J9UE 2XPCA 3KYDA 3OH8A 1C14A 3PWSA 4RF4A 1JKIA 1YE3A 4H16A 2OO5A 4ZN6A 2GN9A 2GO1A 4RPJA 4UULA 5ICMA 3CUKA 3Q11A 4BGUA 2V6BA 1PQWA 4YACA 4TROA 5ES3A 3VPHA 1P45A 1VSUA 1DFHA 4NBWA 1CF2O 4YPOA 3WJAA 4D0RA 2Y66A 4RV9A 2YHIA 4IGEA 1BW9B 4NH4A 4WPGA 3NJ8A 3UCXA 5GZ6A 3TWOA 1E7WA 4RF2A 4R4JA 1VL8A 3K6JA 1LDNA 4L4XA 1DRVA 5BR7A 3WGIA 3AWDA 3JQBC 2QW8A 4Q3CA 1Q1NA 1V6AA 5A04A 3IOYA 2BGKA 1I3KA 4BNYA 4DBVO 2VYNA 1QV6A 3HE3A 1B7GO 2D8AA 3AM5A 4HADA 1E1NA 1LSUA 4FN4A 4NBTA 3VPXA 5JAZA 4WECA 5TT1A 1HTBA 2JHFA 2OL4A 1V3VA 3Q1LA 4EITA 4I9NA 2ZYAA 1DIAA 4OOEA 3GDOA 5EQFA 3E6AA 4RF5A 1A4IA 1DC4A 3TF5A 3A9WA 3GRPA 4UVDA 3U9LA 5CDUA 1N1EA 3B70A 4BIIA 1JN0A 2Q4EA 1CYDA 3FWNA 2YY7A 4CMBA 3FNEA 4NFYA 3QWBA 4RVDA 1QKIA 2NVBA 5JPIA 1Y6JA 5DDIP 1QYWA 2A92A 4P4NA 2Y1CA 4GAEA 4RPHA 1D3AA 1J6UA 4A2CA 1EQUA 1GV0A 3SVTA 3IKVA 5L51A 2FSVA 4K6FA 2ZCUA 4NBRA 3BIOA 2G0TA 2PH5A 1EK5A 1R15A 2O2SA 1NQOA 3KYCA 3MWEB 4X54A 1W6UA 1M6HA 1NFFA 4FGSA 3RC2A 1DIGA 4E5NA 2NTNA 4GLLA 4DPKA 5A3JA 2JD2A 2V65A 5KJ6A 3FN4A 1YJQA 5CDSA 4Q9NA 3O8QA 3ZWOA 1LQUA 4A73A 4W4TA 3RBVA 3I6IA 3ZV4A 3MJTA 4RDHA 4CM4B 2C2YA 1Y8RA 2OUIA 1U2GA 4HFNA 4HNHA 3RBZA 3U4DA 4KQXA 1T4DA 3JQ9A 1GQYA 3G1UA 3ANNA 5IN4A 1LJ8A 1NFRA 4LW8A 3ZHBA 3IUSA 3QRWA 4IMPA 1XLTA 1R66A 4M8SA 2DLDA 4B7XA 1HL3A 1A72A 2YFQA 3CINA 1B16A 2UV8A 3EVTA 3LLSA 3EHEA 4XYEA 1Z45A 5JS6A 2LDBA 5A9TA 1D7OA 3I1JA 3S1LA 2X0RA 1FF9A 2PKQO 5CEJA 5U4QA 2J3IA 3B6ZA 1JAYA 4WNIA 1HLDA 1K0UA 1O89A 3GZ4A 4MVJG 1EEHA 1H6AA 4DPMA 5L7YA 1NQAO 1PZEA 2QZZA 3S2EA 3FR8A 1SB8A 4IM7A 4LN1A 1FDWA 1NX6A 1L1FA 1LU9A 2EWMA 1NHWA 2O4UX 4XJTA 1ENZA 2C7VA 3PZRA 1U8XX 4MP6A 4JP3A 4BB5A 2WDZA 4DTIA 3DOJA 3Q9NA 4TSKA 1Y5RA 2BFAA 5G0VA 1BHSA 2EGGA 5IZCC 4YAIA 4OQYA 4JBHA 3TFOA 2PZMA 3DAFA 3ZNNA 1PL8A 1YRLA 3W6ZA 3RUHA 1GADO 4YJGA 1DFIA 5JCXA 4PRKA 2Y1EA 4RVSA 3GVHA 5KVCA 4D43A 4NR0A 1MB4A 3NYWA 4DBZA 3HFSA 5BNIA 4UREA 4EW6A 5FI3A 3WX0A 4E5MA 2CDAA 3FPCA 3MJCA 3OJFA 1ENOA 4BNZA 2CF5A 4MP8A 5DOVA 4BNTA 3V8BA 1DLIA 2G76A 3U5TA 1P74A 3GAZA 2O3JA 1EE2A 3OA0A 2BGMA 2C54A 2OORA 1E3LA 4MP3A 3DR3A 3UW3A 4XWYA 3I9KA 3GZNB 2GR9A 3EC7A 5KTKA 1EVIA 3WSVA 1M75A 2EV9A 3LU1A 5U1PA 2GCGA 4FFPA 1JU9A 1QR6A 1YWGO 4YRBA 2FWMX 2NVWA 4ONEA 5JW6A 5EIOA 1IZ0A 4QUKA 5CPFA 3I4FA 4GX5A 2X0JA 3PP8A 3WDSA 5KNLA 3DTTA 1LDEA 3UCEA 3HQ4O 5A9SB 5G2OA 3E18A 3WMXA 1DPGA 3BA1A 3HDYA 4G2NA 4KTTE 3ZDFA 3O03A 4CM8A 3CZRA 1MX3A 4BO4A 1VC2A 4IJWA 2C07A 4WCFA 2J3HA 4F3YA 1BXGA 4QFCA 4AJHA 4CR6A 5CEFA 1KETA 3F4BA 4KMSA 3HG7A 3K9QO 1IHYA 1H6DA 4YTEA 3NT2A 3WWYA 3GVIA 4R1NA 4E33A 5JC1A 2Z1NA 4HFMA 4A0SA 2BRUA 3M1LA 1DIBA 2FZWA 5K9ZA 3RIHA 4DC0A 1DXYA 4XDYA 5KKAA 2I3AA 2BELA 1Q7CA 3QWFA 4R01A 3P19A 4E2ZA 4ZVVA 3NGLA 1VPDA 3F46A 3RVDA 3H65A 4TZTA 3L4BA 2VZ9A 4MIYA 4IDEA 4AJLA 1KY5A 1YB1A 4LGVA 4YJHA 2VWGA 3JYOA 2B35A 5JCJD 4BO9A 1A7KA 3F6YA 1QYVA 2ZJ1A 1GTMA 3DZIA 4PLFA 3DO5A 1GZ3A 1XIVA 2DTEA 2NVUA 4OYRA 4KZPA 2OGUA 1GCOA 4HFRA 3FBTA 3GY0A 4R3WA 3IUPA 3FNGA 3AUAA 4UAGA 2QRKA 3UFXA 3UUWA 4FCCA 3RUIA 3ROKA 1T1RA 1KVQA 1U7TA 4J4TA 4CLRA 3BHIA 3JQEA 8ADHA 1JKJA 4RF3A 2W2KB 3GLQA 4RLHA 5FF9A 3ETDA 2Z1MA 3PVZA 2Y1GA 1LRLA 1HYGA 1ARZA 3NKLA 3D7LA 1Q7GA 4J3FA 5TS3A 2WYWA 4IDFA 3PHLA 1Y7TA 1NASA 3EYWA 3N58A 2Y1OA 3RFVA 3L9XA 5CDTA 3FI9A 2AQHA 3NGXA 4Y67A 1AN9A 1QRRA 4XDZA 3S8MA 1LDYA 3GEMA 4DYVA 5B12A 1FDUA 3AI2A 1B8VA 2JCYA 3FF4A 1T24A 2ZIZA 3LZ6A 2POQX 3JTMA 1B2LA 1HT0A 4XA8A 1XWFA 3ZHYA 2WJPA 3RJ9A 4AG3A 3IJPA 1PEDA 5DBFA 5L3ZA 4FW8A 3HUDA 1R4MB 1AXGA 1ISFA 3MJ4A 1JDJA 2DUUA 2EW8A 3OQBA 4Z0PA 4FJ1A 3V1TC 4YT4A 4A7PA 5C37A 4E2XA 4WEOA 1A7AA 3PEFA 1ID1A 5HS4A 4FD3A 4NNJA 1GPDG 5G4LA 4RPGA 3PQEA 2YFHA 4E2YA 4PVCA 1GEGA 1WW8A 1PZGA 4XIYA 3RWBA 5BSEA 4J7CA 3GN2A 1QYDA 2C2XA 1N5DA 2DPGA 4PLTA 4L8VA 4YYZA 4IQ0A 5KJCA 4BNWA 4LRSB 1MG0A 3WQQA 1U3VA 2FHSA 7ADHA 2Q1SA 3WG9A 4CMIB 1JQBA 2GD1O 4GMGA 1HE4A 4XYBA 4CL8A 1CEQA 1WZEA 1E3WB 1LC0A 5TNXA 1QMGA 4EJMA 3ROQA 4B4UA 2JD0A 4WCDA 1T2EA 1HDXA 3FTNA 5I7EA 1ADGA 1S6YA 3JSAA 4PLPA 2BH9A 3ASUA 2V6MA 1Q2XA 3QIVA 1XYGA 2AMFA 4L9RA 3TOXA 1BRMA 1I10A 3K73O 4XGKA 3F9IA 3OA2A 3TRIA 4QT0A 1UXHA 5BSFA 4XYLA 2VYVD 3RUAA 4OOFA 1ZJYA 4ALNA 1LLCA 2UAGA 3ZU3A 2BMAA 4YT8A 1N7HA 2CY0A 1OC4A 1N9GA 2E4AA 4RPKA 2X4GA 2WSBA 1PL6A 3VHRA 4GGPA 2PNFA 5MGBA 4DPLA 1PR9A 4Q3DA 1Y81A 5HA5A 1J5PA 3N7UA 5IDXA 4U0JA 3JQBA 1GYQA 1ZXBA 4UVGA 5C7OO 1UXIA 4WOKA 4PIVA 5DNAA 2IZ1A 2HK7A 4N7RA 3K96A 5TIIA 3KOUA 3LSYA 4WLNA 4JGBA 5CAEA 1DB3A 4PZDA 1YS4A 5HWSA 4WUVA 2O3TA 2YW9A 3CE6A 4R51A 3NJ4A 5L4SA 3TZKA 3DFUA 3OBBA 3IP3A 3EMKA 2C7GA 3ZI0A 4DVJA 1GEEA 3F47A 3GK3A 1LBEA 2C0CA 3R0IA 2EP5A 3ASVA 3OJ0A 4R9SA 5A3VA 4K1LA 3ZCXA 1ZFNA 2Y1FA 3JD3A 2EP7A 4AJ4A 2EGHA 1E6UA 3EW7A 3LK7A 1VJ1A 3Q2KA 1QYXA 2PV7A 1BWSA 2FPIA 1Y8QB 3QWIA 3F5QA 2WWRA 4IJKA 3LQFA 4J2HA 2BLLA 1OZAA 3JD1A 2E48A 1ISHA 2FPPA 4BO7A 5EERA 4I1IA 4J9VA 3RC9A 5JDCC 4TRNA 3JQ7B 1JWBB 4DMLA 4BV9A 3ADOA 4GPD1 3D64A 1V35A 2G1UA 3T7CA 1N7GA 4CQMB 1PIWA 4BNHA 1HF3A 3PI7A 1U5CA 1AE1A 5GZ3A 4BO5A 4CMCA 2AE2A 2RHRA 2P9GA 3E5MA 1Z7EA 2NTJA 1F06A 3DZHA 3GHHA 4N18A 3DOCA 4NFSA 2A35A 5T8KC 4NMHA 3ENKA 1BDMA 1H0KA 1X14A 4NJMB 3NDIA 3ZHXA 1H6CA 2HSDA 5B4UA 1YOVA 3DC2A 3V2GA 1XA0A 1KEUA 3K5PA 1E92A 1PZHA 3KLMX 3RAJA 5COQA 1ISJA 3JD2A 1CQIA 3DBRB 3NDRA 4OJNA 3W8DA 1GL3A 4P4GA 5T67A 3GDGA 2DFDA 4QTZA 5U9CA 2H6EA 3JQ6A 4CQLA 5HM8A 3KM0A 2C5EA 3SX2A 4EUFA 2IZ0A 3V1UA 4J6FA 2PZLA 4XB2A 3SC6A 3GNQA 3OICA 3ZWYA 2DTDA 3NDJA 2FN7A 4BHTA 3QVXA 1W0CA 2HQ1A 2NU7A 1C1DA 4WCFC 1KBZA 2NQTA 3KYDB 5L4NA 5JMPA 5DBIA 5TQVA 1P1HA 5DZSA 3UKOA 1PU2A 3RKUA 3DMTC 5G0TA 4NHEA 2H9IA 1PJCA 3GG9A 3IS3A 3MTGA 1LI4A 4YR9A 2WEKA 4CR7A 4EYEA 3IMFA 5TT0A 1E7SA 4U6SA 3ANMA 1ZBQA 5L95A 1MGOA 5COAA 4DIFA 2Z95A 3LYLA 4NIMA 3W1VA 5EN4A 1HDCA 3S2GA 3LT2A 1MV8A 1SAYA 2ZATA 3G3EA 4FFLA 3L4BC 3ROMA 4TVOA 3QSGA 5TF4A 4A03A 3GUCA 3VTFA 5TRTA 1E6WA 1LSSA 4ALIA 1RM3A 5FWNA 5T64A 3DL2A 3VAZA 4CJXA 2X5OA 5JFOA 1N8KA 2NV6A 2A9FA 2GNAA 4MVJP 4N5NA 2GF2A 3TPCA 1C1XA 1SC6A 4LSMA 1NWCA 4EJ6A 3GC6A 5DBGA 3QA9A 2VZ8A 2AEMA 3VZRA 2J3KA 3KEOA 4F45A 3VZPA 4QO7A 4BNIA 1NPTO 3KLPX 1UAYA 1LLUA 4S3MA 1F12A 1SEPA 5A06A 3IP1A 5IDYA 1ENPA 4D42A 1JW9B 1B14A 1OI7A 4YRAA 3CEAA 1VKNA 1PTJA 4IDAA 4RQUA 1DC5A 4XQCA 3AU8A 5CP8A 1DIRA 5EJ2A 5JYEA 3H6KA 3I9MA 2VCYA 5MDHA 2FP4A 2DPHA 4CLDA 2HK9A 5DT9A 1EDOA 4E5KA 1ZSNA 4R41A 2FR1A 4U8GA 2CVQA 1X1EA 2PA3A 3D3WA 3IKTA 4WLUA 3KYCB 4IJUA 4BNGA 2FMUA 1UXGA 2EJVA 3GG2A 3VDQA 3F1KA 2H5LA 1I2ZA 2Q45A 2QHXA 4ND1A 2B37A 4QEDA 4ZQEA 3VZSA 4FSHA 4PN3A 1BDBA 1VLLA 5TSDA 4N54A 2G82A 3NX4A 4RZHA 1UZLA 1X0XA 3OECA 1XG5A 3CXRA 4IINA 3AW9A 3NT5A 3FTPA 2BGLA 2QRJA 4R9RA 4ZJUA 1KEWA 4OQZA 2IEDA 3VKUA 2YQ5A 5THKA 4DLLA 1LQTA 5I8ZA 2B4TO 1SCUA 3WBFA 5B4TA 1IULA 1T1SA 5ILGA 1KVUA 3IC5A 3EZYA 6LDHA 2WMDA 4C4OA 3D5TA 3WTBA 2HJSA 1E77A 4YXFA 2Y0CA 1YBMA 4I9HA 3HDHA 4QX6A 5ENVA 3T4EA 4TRRA 4HWKA 2Y68A 5KCZA 3H3FA 3W4IA 2DC1A 4ZU3A 2D5AA 5IDQA 4IZHA 1KS9A 2QYTA 3GOHA 3FNFA 4AL4A 2OBNA 4IDCA 1YL7A 4IY1A 1P0FA 3PWKA 4J1QA 4I5EA 1WZIA 2X5KO 4F6LA 4MKXA 5C3MA 1HE2A 2OZPA 4JCOA 3TOZA 1E3JA 2CVZA 3E9QA 3EAGA 2FPGA 4NI5A 4N5LA 3T7EA 3RKRA 4IUYA 2HMSA 4PLZA 5K0ZA 3C8MA 5JC8A 4FFMA 4FIZA 5KJEA 2PD3A 3BMOB 3DQPA 3TL3A 2W8ZA 1E3SA 2B0JA 3C7DB 1QLHA 2E6UX 3C85A 4YT5A 2WD7A 4XCVA 3RUDA 4YJGB 2VTDA 2X58A 4GWKA 2HMVA 2ZTUA 3Q9UA 2ZB4A 2UUOA 1ISGA 1IUKA 1ZK4A 2ZB7A 3ITKA 2AXQA 4GX0A 1YONA 4BNKA 1NR7A 1WWKA 3DFZA 4FPXA 4YJDA 3G0OA 1XGKA 3VC7A 2ILTA 1DRWA 3WXBA 2W2LA 4OO3A 3MWDB 1ZIDA 4D3SA 1R6DA 5ER6A 5JMWA 4K26A 1JWAB 2YHUA 1DOHA 5KKCA 4ZQBA 3QQPA 4WE3A 5H82A 2E37A 2X9NA 3JQCA 2GZ2A 2Q4BA 4HXYA 2OHXA 4OSOA 1EBFA 4L4SA 4QSMA 5A1TA 1XEAA 5TJHA 4BO6A 4DC1A 3WGOA 3DOOA 2LDXA 4YQYA 3HN7A 1I36A 4NDNE 1AXEA 3GH3A 4PLWA 3PJEA 3DXFA 1WNTA 2VYND 1N1GA 2NNLD 4OXYA 4RORA 5L7WA 3INTA 2EEZA 1HDOA 3D4OA 3W8FA 4CPDA 4GKBA 2O7SA 1YXMA 2GASA 2W2LD 4KUGA 4RGBA 4CM8B 4G81A 4CV2A 4ITUA 4L76A 3IIEA 2Y0DA 5I8WA 1O8CA 4CR8A 1R37A 1ULUA 1BXGB 1QSGA 4S1VA 4CUZA 1AHHA 1I32A 2D0IA 3JQ8A 1XR3A 3GPDG 3OJLA 4DUPA 4L75A 1JA9A 1PWXA 4C7JA 1GU7A 2YDXA 1JTVA 2DUWA 3BYZA 5AXDA 4RQTA 3RQSA 1A71A 5TX7A 1DEHA 2EKLA 4YWJA 4U7WA 4GVXA 1PJ4A 3OSUA 4NG5A 5I9NA 3X2EA 1XQ1A 3GRKA 2AG5A 2CDBA 1IYZA 4J7XA 4ZGWA 1BG6A 4YJHB 1P1IA 1ZNQO 1VM6A 2DQ4A 1J0XO 3FWZA 3KSUA 3UVEA 5LDHA 4WKGA 1T2CA 1I5RA 2X86A 2GUGA 3LF1A 4JBGA 2VOEA 2NVUB 3DHYA 3WSWA 3GFGA 1M6WA 4FGWA 4FR5A 1F17A 3TZHA 1PR3A 1TT5A 4IQGA 1GQQA 3KTDA 5JSFA 1G0OA 1C3VA 3INRA 1IOLA 1YL6A 5JE8A 2R6JA 3WGHA 2QIOA 4CLRB 2CFCA 3PLNA 1PGJA 3I4CA 2HJRA 2G5CA 4FOSA 4D46A 4CMEA 4Y6RA 3CSDA 4BNFA 4C7KA 4J1SA 1DJQA 1G6KA 3C24A 3CH6A 2PY6A 5ILOA 1BVUA 2I6TA 1T4BA 4HNGA 1OFGA 1ZJZA 4BMVA 1Y9EA 1Z82A 3H9QA 5AXCA 1ADCA 1E1MA 1UXKA 4E31A 1QV7A 3OQ1A 5IJZA 1YGYA 4I9UA 4KDEA 5JDCA 4BO8A 1I24A 2Y67A 3WFIA 1Z75A 4HY3A 4OIMA 4Z6KA 1IHXA 5A05A 3RD5A 3FPLA 4DQUA 3WYEA 3B1KA 3M6IA 5F5LA 2B36A 2CSUA 2EG9A 1IPFA 4TZKA 3RSHA 1ZCJA 3ADPA 4P22A 1NPYA 3H5AA 4ZQHA 3VKVA 2YDYA 3AY7A 1U1IA 3H9JA 3AUSA 3TNLA 4CL3A 4XIJA 5JAMA 1E7MA 3UHAA 2H1SA 2PR2A 2Q49A 3KYBA 2CF6A 3VPGA 1NBOA 1I0ZA 4ZRMA 1RM4A 5T8KA 1GZ4A 4MKRA 4W82A 3RI3A 1BW9A 3KSZO 4XX0A 2HUNA 1PJ2A 2PKQP 1ORRA 1EFLA 1VJTA 3PQFA 1EUCA 1HWYA 2BHLA 5KJ1A 2ZJ0A 1UP7A 4RVUA 5AOVA 3NTRA 3ONFA 3QWHA 3BMQA 2J5KA 3ZWCA 3AFNA 4CM6A 1SZJG 4CMAA 3K2BA 3TL2A 4NBUA 4JROA 2QZ9A 1U3TA 4Z9FA 3F4LA 5FI5A 5T5QA 2IRWA 2VUTA 1E1LA 1EUDA 1OAAA 2P5UA 5CG1A 5F3RA 3S2FA 1V9LA 5I7VA 1G0NA 5ER9A 3PJGA 1XCBA 4TQGA 1GYRA 4BNXA 3EZLA 1T2AA 1ZK1A 3HFGA 3E5RA 4B4OA 4JJGA 2PGJA 5IZ4A 1U28A 1HYEA 1E7QA 5B1YA 3DMTA 2I99A 4J4BA 3I9NA 4OAQA 3W4JA 4GGOA 3QY9A 2GN6A 1I33A 3ZNQA 3C1TA 2NU8A 4KWIA 1N9GB 1Q7BA 3S55A 1I01A 3PQDA 1ULSA 5I7SA 4R16A 4II2A 3I5MA 1SMKA 3STHA 4B79A 3H2SA 4OXNA 3WYCA 5JY1A 2R2GA 3ZNPA 5TJ9A 3JYQA 3PFFA 4J2OA 2IDZA 3U3XA 3U09A 4MVJI 4TRMA 3SJUA 3VDRA 4BKPA 1Q0QA 2JFFA 4YQZA 2WYVA 2PLAA 5F21A 4BV8A 1XU9A 4WGGA 5G0SA 5DCYA 2VNAA 1VJ0A 3H5RA 1CIVA 3ANLA 3I52A 4CM5A 3H9EO 3GR6A 3H9UA 3UAGA 1P1RA 4Q3AA 2AW5A 1YQGA 4TKLA 3CZMA 2UYYA 4DWVA 1PS8A 4GI2A 4TRJA 1ZMTA 1PJBA 2J5RA 4TVBA 3WFJA 5C7LO 4D79A 3UOGA 3PK0A 1DFGA 2ZB3A 1QLJA 4QXMA 3H2ZA 4UUNA 3HN2A 3OETA 3OMLA 5JBIA 4NK5A 4E21A 4XYGA 3PYMA 1KIFA 1Z74A 2P4QA 3D1LA 3TZCA 2B69A 3ZGYA 4DMMA 3L9WA 2FR8A 2IEBA 3GEGA 3FD8A 1I3MA 3FR7A 4BO2A 5H83A 3DBHA 1ML3A 1HLPA 1RYDA 1W8DA 4IIVA 3ZU5A 1H9AA 2PWZA 2BKAA 4Z3KA 4JX8A 3IQDB 1MXHA 1G1AA 2HLPA 3OP4A 4BKRA 4WJZA 5KOIA 4XQEA 3JV7A 5F1PA 2OOSA 3UH1A 4INAA 2VOJA 3AUTA 5IAAA 4FC6A 2B4QA 2BF7A 1LEHA 4A26A 2NADA 3COSA 1UP6A 4PVDA 2Y0EA 3JYPA 2JD1A 2BFPA 1LDGA 4AJJA 2FR0A 4A10A 3DAPA 1OC2A 3PYLA 4DYDA 4IDGA 1YQXA 4M49A 1P44A 1NVTA 1DRUA 1T26A 1MG5A 1RJWA 3ULKA 2I76A 4LCEA 1LTHR 3RC1A 2O3UA 1YOVB 4P4LA 1B8PA 3PFWO 2VUSA 4J1TA 4ALJA 4CV0A 1SEVA 5K6AC 5EQDA 1YJ8A 1GUYA 3R6DA 3C7CB 4BKQA 2ZCVA 3CTMA 2BD0A 1J4AA 3TJRA 3RFXA 5G4KA 4AFNA 4L74A 5AYVA 2WM3A 3GZNA 4GX1A 1HDYA 4CQLB 3PYXA 1PGPA 2Q3EA 1IB6A 4UVHA 5B37A 4KDFA 1E1KA 4PG8A 1RYEA 1KOLA 1ENYA 3GGGA 1WXDA 1WDMA 3WMWA 2BI7A 4WOJA 1C1DB 1K2WA 4YT2A 3E03A 1PX0A 1ISMA 2IE0A 3O4RA 3A14A 4YVFA 4B3IA 3OEYA 3BMNA 1PL7A 3AM3A 4MIEA 4DREA 1NWHA 3OEWA 4M89A 4M86A 4IS2A 2GN4A 3KETA 3P2OA 2EXXA 2G17A 3NEPX 5I9MA 3HB4X 5KJFA 1UAGA 1T2DA 4E5PA 1ZEMA 1ZSYA 4O59O 4EEZA 1U9JA 1YDEA 5DOZA 3ZWNA 1CJCA 3C3XA 4ALKA 1WAMA 1DHRA 2CVOA 2JHGA 1NP3A 1QXSA 5EPOA 1WLYA 3HDJA 4AJEA 4GL4A 1V3UA 2UVDA 1FMCA 1P1KA 1PZFA 3LT4A 2I65A 2VHYA 3K2EA 4DA9A 3AUUA 1SNYA 4DIBA 2PFGA 3ZU4A 2JL1A 4E5YA 4FS3A 1I3LA 3UGKA 1SPXA 2PZJA 3G17A 1C1XB 1V3TA 3ZWWA 1GYPA 3L77A 3SBOA 2X9GA 5JAQA 2OP1A 2DM6A 3HNPA 2ET6A 3M2PA 2ZTVA 1RKXA 3WGGA 5FFFA 4OGWA 4CMEC 2JAPA 1NR1A 1F0YA 2VNSA 4GH5A 4JLWA 4PFJA 4O5OA 4YCAA 3RROA 1JKFA 1JLLA 1B15A 3M2TA 3ZZNA 5A02A 1BXKA 1EDZA 4CLOA 5GY7A 3K30A 3WQRA 1NTOA 2P91A 2WE7A 5JDIC 2W2KA 5CDYA 3EVNA 4E30A 4MVJH 3M1AA 3BTSA 2ZYDA 4XEHA 4L73A 4QO8A 3D3WB 1EUZA 1D1TA 2F00A 1A9YA 5TC4A 3NTOA 1WDLA 2IYPA 4IDBA 3DONA 5T6BA 4DQXA 1R0KA 2XAAA 1D1SA 1E3IA 2EKQA 4XKJA 2AEFA 1Z7BA 5ITWA 1TVEA 4J0FA 3AI1A 3GQVA 3SEFA 4YEDA 3LDHA 9LDTA 1HKUA 1E5QA 3PGJA 4GX2A 4ND3A 4PRLA 3WQSB 2YJZA 1FDSA 5A5EA 3JD4A 1VKOA 3WGQA 3VVBA 3RU7A 4I5FA 3LC2O 1UR5A 5L45A 4MVJA 2VWPA 4IZIA 3UN1A 4TKMA 4UUOA 2NM0A 3TZ6A 3W6UA 2HKIA 3EDMA 2HMTA 3E8XA 4D7AA 5JXWA 5IF3A 2AQKA 4XB1A 5JLAA 4CMKA 3WICA 4R5HA 5HRUA 2X7HA 1BGVA 2Q1UA 3OM9A 3PRJA 3RASA 2X0IA 5BNTA 4YJFA 4IIUA 4OKNA 3L6OO 4DGSA 1UP4A 4M54A 3LT0A 3DMYA 1A4UA 1UZMA
chains in the Genus database with same CATH superfamily
4QXQA 1K66A 1FEZA 1S5PA 1VPTA 3HSKA 3RAFC 5C52B 3PXXA 1MDFA 5DHRA 4GBED 4ZQFA 4ZI5A 3A4TA 3BULA 5BSHA 5JUWA 2BMVA 1XP5A 2VRCA 4P80A 4RIIA 4N4AA 4WKPA 4I3GA 4JB8A 3RNLA 1OR8A 2OZVA 2BPOA 2KBFA 2FFQA 1G66A 1Q0ZA 1PQUA 3FJOA 4GE3A 5AESA 2D7DA 1IXKA 3CUUA 3WR5A 4KPYA 1P7CA 3OC6A 3A4VA 2HQSA 3ZJ5A 4CV1A 3SZLA 3MOSA 1LJLA 3MQ2A 4RHXA 3N1UA 5BUSA 2FY8A 1X7HA 4N3GA 1YHYA 1T25A 1QOZA 1HZJA 1N78A 2FK7A 2RHOA 1PJQA 3IPLA 1UDRA 4JJ6A 5CA0A 3BFXA 3GGPA 1STOA 3GEBA 3HUUA 1JKXA 4QHYA 1J8YF 1FP4B 2HK8A 4XD7D 5HFJA 4JDPA 2VPXA 3TMKA 1KI7A 1VCHA 2OAQ1 1KBQA 1QIKA 1WVMA 4RETA 3L07A 2PX0A 4QYXA 1JSXA 3E7WA 2G1AA 4NZ9A 4ESOA 5HGJA 1Y6FA 3LL4A 5LCXA 1PI3A 1ZR2A 3GA0A 4JA2A 1YH3A 3A6DA 3QBEA 1FFEA 4RIHA 3RC8A 3JQRA 4ZAWA 3VAAA 1JI0A 1WETA 3KR2A 3P7MA 3ZDDA 4JLVA 1CWUA 2IYOA 3LH5A 1DQYA 3G9UA 4WLVA 3BE8A 1H4SA 3H3JA 2V9ZA 3EN0A 4ND5A 1C4XA 1RLMA 2Y1LA 4JIGA 4RWEA 5ULLA 5DP1A 1J8FA 3P2JA 5CA0F 3BMCA 1Q83A 5A2QA 3IAFA 4JOBA 2CZCA 4MS1B 1IL0A 1BOOA 1N1MA 2YUTA 1AVTA 2H65A 3VH2A 2FZCA 2PUEA 1UJ6A 2WRZA 4O6VA 2UYHA 2X0NA 1W44A 3ZUGA 4I19A 2C95A 2SCUA 3N76A 2VSFA 3P5SA 4K9DA 4V2UA 2GBPA 3G5TA 1W4BA 3NRJA 4LMBA 4GMFA 2BHSA 1QTNA 3KJQA 2Q99A 3R20A 4BDSA 4D3FA 2V7VA 1GITA 1K7SN 4XE5A 3OPQA 1TCAA 2GWRA 5K2MA 2GEKA 3EVAA 2FWJA 2LUOA 4ZI2A 5DYIA 2VT2A 4P0QB 4W6ZA 1VG1A 4N01A 4B6FA 4JNKA 4ZRNA 3PJRA 3WLKX 5JNTA 2R1TB 5JSZB 3AI3A 5COBA 4C21A 2BBOA 2LE0A 4ZAYA 2VHZA 2XMZA 2DKNA 3C3YA 3MGBA 3QUTA 4N0QA 4UHHA 3NALA 2BMFA 4NPCA 4EJ0A 4OH1A 5M3BA 4C76A 3TN7A 1U3WA 4BMDA 4BNDB 4J43A 2H2FA 2VTEA 3GLRA 4E3WA 2YZ7A 3KXIA 1Z3CA 4W1PA 2QTVA 3MCTA 3ZCSA 5A4IS 2GTPA 3I04M 4R3NA 2J6HA 3OKPA 2RE8A 3ODPA 1T0HB 3ILYA 3OLWA 4JP5A 2G06A 5EIXA 4BLWA 2VEDA 5HQ3A 4NICA 1P8JA 1PVOA 4HDMB 1MFPA 3L2OB 1NZDA 3OHPA 4Z7QB 1OZ0A 1I1QB 2REQB 4PGAA 1P2FA 2VDUE 4MRAA 1DIHA 1HG1A 2W0MA 1W73A 3PRKE 2I66A 5FNZA 3IB3A 1L5ZA 1H2YA 5L4LA 4G0OA 3DZGA 3DMNA 2P1RA 4ENPA 3PNYA 2PKYX 2C2WA 2Z30A 2FEKA 4DLZA 1G20A 2YZ2A 2EDCA 1TL7C 2IYAA 2IBSA 2GZ1A 2BMDA 2V4UA 3A7EA 3G9TA 4KWCA 4PTYA 2O5VA 4YP1A 1DBQA 2ATEA 2O1XA 4GVLA 3W1EA 2SBTA 3HB9A 4TL7A 2Y3IA 4RFLA 2C31A 1AQ6A 3JYLA 4MV8A 1V4BA 3WLSA 2OG1A 2WYUA 3FRJA 2WT4A 1YO6A 2IHZA 3JQGA 4QXPA 2Q8NA 1CB0A 5HE9A 3HBLA 2BV3A 2Y05A 3OZ7A 3L43A 5HW0A 3HNRA 1ZN9A 3B3FA 1RHRA 2M98A 3EUEA 3MBOA 5ALKA 2X7JA 3TR5A 2QQEA 4G9BA 2CFTA 4PRZA 3L0BA 3V1LA 3WLEA 1WEKA 4IMJB 4TKZA 1S01A 2DT5A 4Z53A 1U2ZA 1WSDA 5TQ2A 3ZQ4A 1S8NA 5JFOA 1E2DA 2OFXA 3AH8A 3F3SA 1V96A 5A4JA 1B8NA 4MPPA 2Y1XA 2YY5A 2OD9A 2OHIA 3OP1A 1WMDA 4RSRA 4B6OA 1TJPB 2O2YA 2Y0PA 3O4HA 1X38A 5I5GA 1Q1GA 3U4CA 5BMVA 4GLFA 4HNUA 1XQWA 2GARA 2XA9A 5IUNC 1PEKE 3L3BA 5DTEA 3B52X 3C8DA 5JAIA 3HYCA 5K6RA 3LBYA 4CMHA 4U6NA 2DWUA 4PO1A 3RG8A 1RVV1 3ZN2A 4N7MA 2MR6A 1AF4A 1EUCB 4N0PA 3ER9A 4QATA 3OPVA 4WINA 3R8FA 4CMGA 1QANA 1GZ6A 1ORVA 3I5UA 3KT8A 5K3OA 1C7IA 3A06A 3BMQB 4HX2A 1U4OA 2I3GA 2J31A 5K8JB 2WKRA 4L0QA 4XD2A 4DA6A 4CEJA 3GT0A 2FP3A 3NANA 5IAEA 4LUCA 2B3TA 2KX7A 2QORA 4OF4A 5EKUA 1KF0A 4J29A 5CYPA 3LZDA 2B78A 1EVKA 2CUNA 5BMVF 3WNQA 3H0EA 4QECA 3K70B 4JY7A 1F38A 2Q5QA 3Q8WA 3CVUA 1ADBA 5D01A 3L7NA 2XJ4A 3GZTB 3OBIA 3V4LA 2C99A 3VHXA 1D4FA 1QAQA 2FZLA 3LPMA 2FFJA 3SXJA 2WUWE 4YI5A 2IYRA 3O2NA 5I51A 2I0FA 1BE8A 1JAXA 1QTIA 3RFUA 3P32A 3TNYA 1FFGA 1RJDA 3L0DA 4G5FA 1G5IA 2ZTHA 3BUSA 5JAUA 5KIAA 2HC9A 3AZPA 1ETUA 4OB8A 5FNVA 3THYA 2VXOA 3DBIA 1DHTA 3R3JA 1KAMA 4LTDA 4Z7JA 1N4DA 4JJ4A 1RMQA 3AKZA 1SOUA 2UXDB 2DR0A 2GBLC 2QU8A 1AMNA 3IIJA 2HMAA 5U4XA 1YASA 2JVKA 1AUQA 3DLTA 3V2UA 4HN2A 5FBLB 3DM5A 5YASA 4G8JA 1ILWA 3JD0A 5T41A 1X15A 1XTVA 4OM8A 1U9IA 3PDWA 4C4PA 2R8YA 5A6SA 3A25A 4ZICA 1AZSC 5IK2D 5K45A 4RENA 3WL5A 2W2NA 1CRPA 1BE6A 1QOQB 1T8SA 1TB4A 4X8LA 1NQXA 4IQ8A 4WBNB 2GLXA 3MCVA 2AT1A 3IUQA 4Z9AA 1EIWA 1QPZA 3M5WA 3AP1A 4PU0A 5FNVF 2RIPA 4OHMA 3DXZA 4IKPA 1N25A 4IPTA 5FBHA 2QAGA 3EPPA 4JXJA 1IJBA 3C41J 2N1BA 4IDOA 1M9NA 1GIAA 1QBKC 4G1BA 3CO5A 1MA3A 3OT5A 1Q3KA 2K7FA 1PGQA 2B1GA 5BSWA 3TD6A 4A6EA 3M3HA 3MCWA 2ZBGA 2BGNA 3HJTA 1PT9A 2O2CA 1KVTA 4R31A 3VR6H 1H2BA 1RLTA 4WL0A 4AQ7A 4BMSA 1RKQA 3I9LA 4D3DA 1G20E 3C0KA 3O38A 8ATCA 4L72A 1U7DA 2C29D 5DCUA 4AWAA 2E5FA 2IE8A 4UAUA 1XMQB 4EA6A 2FHPA 1W85B 1M2WA 5IX8A 4A5OA 1YQTA 4B3FX 5JDIA 1L6RA 2J7PD 1VL6A 4ER3A 5AI4A 3IP9A 2FZEA 3E9NA 5AQ1A 5IDWA 3PD0A 5AW9A 1X8XA 1XZJA 2A88A 2R7LA 2ZXEA 3DNMA 1L8LA 4GPZA 1B42A 2BLNA 4MA4A 4UBJA 5LMZA 2GEBA 2CNBA 4XZ3A 4HTFA 1WA5A 4ARIA 3F8TA 4PAWA 1TYBE 3WRYC 4AYTA 2JGMA 2V9CA 1AQYA 4IJVA 2X42A 2G8NA 4W5HA 2D74A 3PIIA 1E8NA 3QPWA 4M22A 5J40A 3I92A 2G9ZA 4Q9IA 2W98A 3O7WA 3EMDA 2QSJA 3PVCA 4A0FA 3JAMA 4HLUC 5LDGA 1OYVA 4QULA 3SJZA 2R6ZA 3L46A 4F5YA 3E70C 3AVVA 1ONPA 1LJUA 3N2LA 3IV9A 4NU6A 3CPJB 3RHZA 5BV0A 1Z2DA 1QVAA 1TAGA 2V45A 2G3YA 5TE9A 4DC9A 4MINA 3E3OA 1X3SA 3QF4B 3D2LA 4ISBA 2QE7D 2DAPA 2VPIA 2O2EA 4PZEA 2OQVA 3ZV3A 2R00C 1Y1RA 3SXUB 1KKLA 1XZIA 3L0YA 4HRXA 4NHOA 4AICA 1RZVA 3TSAA 1C2TA 4CV3A 2OWEA 1P6UA 1BWRA 4TWIA 4UU8A 4I3HA 3L8EA 4LE0A 1R4AA 1P1CA 4FFOA 3K31A 2RIRA 2PBLA 4R2JA 5ICEA 1PD1A 4MVWA 3ENWA 4OGLA 2RCNA 3PA6A 2K7ZA 1RM5A 1V47A 1B1CA 4XEUA 1BZYA 4IRXA 1ATZA 1T5OA 2UUBB 5BW6B 3ZX4A 2B5VA 2BVNA 2QN3A 4RPLA 4WN3A 1V37A 7MDHA 5ELLA 1CZHA 4NEGA 4CUZA 2QUKA 1SRRA 1DCTA 4DHWA 3WKBA 4EDFA 1UMBA 1MP0A 1T2UA 4RHEA 5DSXA 3TK1A 1DKNA 1TM1E 1VMAA 3AETA 4MDHA 2CEAA 5D87A 4OJYA 5SZHB 2P2NA 1BMQA 5HTOA 1USGA 5EMHA 3GU3A 4FHFA 4AY4A 1T8PA 3BTOA 4CLEA 1EVZA 3ZCPA 2QTLA 4D4JA 1KERA 4HDRA 4NJEB 1SOVA 1KYTA 3PUHA 1YJBA 2R11A 3QMWA 1A1SA 1EX9A 2RH4A 2X6TA 1D2CA 2IHTA 3OZXA 1MOSA 4IOLA 2R6DA 4OHFA 3SC4A 3JQFA 1EHCA 3SHOA 4LJKA 4OMFG 4DR3B 1RM0A 1CKEA 1RCTE 3BH6A 3MWLA 1GQRA 1T15A 3I61A 2G5PA 2HA3A 1G5RA 4NARA 5LMNB 1RHJA 4XTCS 3BMNB 1HGXA 1QFSA 3G2IA 1QUFA 3HHPA 4CKYA 1FTYA 1L7DA 3D6AA 1ZGBA 3VOSA 1YNOA 2I2FA 1XVAA 3ZE0B 1HYHA 4ARVA 4PX2A 1RT9A 1GU0A 1PK7A 1ZK3A 4NE9A 1NVUQ 1W36B 1KXJA 4YAUA 2FNAA 2D1RA 1PGOA 1WE2A 2DBVO 3PNBA 2DH6A 3B36A 1SKYE 3LPDA 4ODIA 1U1GA 2OWDA 5T6MA 3MZ0A 3MNFA 1AUPA 3JVIA 4AYWA 3Q40A 1L2TA 5HDQA 3GLFB 3DHEA 2QY6A 1YBVA 2DBRA 4RV4A 1L4UA 3MXTA 4C4YA 4CZ2A 1CDOA 2B3DA 2X0KA 2X76A 1FRQA 3PRHA 4MR8B 1XMJA 4S1OA 3TKYA 1AKNA 4CKEA 5FFMA 1XQXA 2ZR7A 3OIGA 2OK8A 3QNUA 3NRCA 4G65A 4U6QA 3T6KA 3OOWA 3LHDA 1HYBA 2CJFA 3DVAB 1E2PA 3LT1A 5ALUA 5TDHA 4CYMA 2WAYA 2WU3A 2YOFA 1VL2A 5EYPA 2IZ5A 3CMCO 3VNBA 2W6PA 4JUFA 3DZJA 4RBNA 3PFNA 3W3AD 3ZDXB 4PZCA 3WY9A 3PFBA 3BJRA 4TKUB 1CEYA 4G5RA 5CTJA 3PFGA 4EKGA 2DXIA 1WDKA 4XSHA 4L51A 1QM5A 4ZCIA 2IOQA 3CIFA 2QR3A 3G2QA 4AN4A 2R0QC 1Z63A 4LZZA 2FSIA 3DULA 1NM5A 2PANA 2RGUA 1FPMA 1BS2A 3JWHA 4N3BA 4XJSA 4GWLA 2EBUA 5CHEA 1IUNA 5DM0A 2ORVA 4AN0A 4B6QA 1U8CB 5LIPA 2YMMA 5A0TA 2Q5IA 2V7WA 1NV9A 1VP9A 3OD1A 2GHRA 2HEGA 1LPBB 1LK5A 1Z73A 1M74A 1O6ZA 1QQTA 2UUPA 4KBGA 4KPUB 4V0SA 4WZZA 2BYTA 5FOQA 2PXAA 4EZBA 2DQZA 2VT6A 1YZQA 1E1RA 4J76A 4ZVOA 5BVHB 1ZO8A 6ADHA 1XA4A 3KZVA 5T4FA 2VP9A 2XAUA 3GMDA 4P81A 2P30A 5HS6A 4BBJA 4QOSA 1LLDA 1ZKMA 2AG8A 2OO7A 2WNSA 2BR4A 2DBZA 5DYGA 2ZWVA 2IU6A 1OIWA 3D4NA 3P2YA 3RVJA 2VHQA 2WJGA 1E5LA 1SELA 3GLUA 5CXXA 3J81k 1GTSA 1E1DA 1EFVB 1O4WA 2DFKB 1MOPA 2PEYA 2YZGA 5LMUB 1ECCA 1MN6A 1GZSA 4JEUA 4MW9A 1BH6A 2CK3A 2XDQA 3GGSA 2OFOA 1AXRA 1E9SA 4DLBA 1FYXA 4B4WA 3UWSA 3NAMA 2LNDA 1U4NA 4L9SA 1DE0A 4KJXA 1QH1A 1ZSVA 4OYLA 3D7KA 2ZR0A 2P2SA 3LPCA 4OLHA 2QTMA 3SOPA 4D82A 4DJDC 1JFLA 3L93A 2IYEA 1SRQA 3K1TA 4X63A 5HCNA 2AOUA 4FX5A 1CS4C 3MJEA 4JVSB 4TSFD 1RXEA 5EP1A 1WDWB 2JG3A 4PG5A 3KUXA 3NHFA 1W4RA 2PGDA 2Y1KA 3M6WA 1TAQA 1YS2X 3PSAA 2C3PA 1RPNA 3AR4A 3BRSA 2X2PA 2WOJA 4D1YA 2YJGA 2I62A 2OCKA 4KIUA 3ZI4A 2HDOA 3BD7A 2H2GA 1DLJA 3TOVA 2QN6A 2ISQA 3ZKWA 1F8FA 2X4IA 3Q3IA 4EI2A 4B74A 3RTAA 1H9CA 2VUUA 1N2XA 4BNUA 5JLJA 4CN9A 4ME6A 4EUKA 2R65A 1ORHA 3DNPA 3OMXA 4DZTA 2D7JA 2OAGA 3AEQB 5TQ0B 2BHRA 2XT6A 2NZWA 2W4QA 3M9XA 1XFDA 3TFWA 4B8WA 5JQGF 1UT6A 3HRKA 3KTFA 1WKVA 1YJ5A 2NU7B 5IYZB 4QOJA 4JJIA 5D3QA 4LY0A 4QRDA 5KPDA 3EXG1 3F0TA 5EHNA 4H3VA 1IJKA 4MQ6A 4YV1A 4FR0A 4C88A 4UBLA 1EJ2A 5CVEA 2NACA 1DRKA 4GYKA 2VQ3A 5FPHA 2OBXA 821PA 1F4PA 4COKA 1C9JA 2VJMB 1SG6A 2GRAA 3QKIA 1TQ2A 4YRMA 4B1FA 2I6SA 3M1YA 3LLCA 3RAGA 2AEJA 2ZK7A 5CUQA 4AX8A 1XAIA 1M6VB 3E82A 4QWWA 4DB2A 1SKUA 2YIJA 4JNCA 1TIBA 2VJYA 4Z1OA 4YJ3B 2NXWA 4JODA 1VE3A 3PUYA 2RCYA 1FW8A 1Z8HA 2OQRA 4RD4A 5JCOC 3L1KA 3NAQA 4DCTA 2PLWA 1P7YA 1U9CA 2BMEA 2C5HA 1TEVA 5LZ9A 3BGVA 3LY8A 2M1ZA 2H1IA 2ECPA 2I7CA 3VO9A 1DX6A 2VWHA 4E1VA 2P2YA 1Q74A 1WP9A 4WA8A 2JLCA 4D0SA 5J5CA 3UMFA 3QG1A 4GOND 4EHAA 4MA0A 3WGTA 3B9QA 3TX2A 4JQOA 3DOUA 1O58A 5FTJA 2G9UA 2QX7A 3EHDA 5DYWA 1HQYE 1R0LA 3V34A 1XDDA 1KFBB 1RJ9A 4DR7B 2A33A 3KQTA 1II8B 1ZMXA 3RIMA 3VMFA 2CUZA 1AJEA 1L3BA 1D2GA 3ZWPA 3IDAA 2C4KA 4YDRA 5FI1B 2OILA 3RSFA 1LC3A 3A4YA 3BOSA 4QFMA 3RVSA 4PLHA 2DF8A 1SU8A 4DEVA 4DNXA 5F1KA 1R5NA 1ZJWA 2ACEA 5L3SA 5JCPA 4BNLA 3OF2A 3QV1A 1I0IA 4HDSB 4K9RA 1X13A 2UXBB 5DRTA 1U7HA 3RE1A 4ETWA 1BCSA 2GBFA 5LP6B 1O5IA 2KQUA 2VH5R 4BFXA 1ND5A 3W5UA 1NYTA 1KHTA 3I39X 3TLBA 3HU2A 3LM8A 1UC4B 4PYRA 3RHTA 2FRXA 4CRWB 1VJRA 2FYTA 2N75A 3WKEA 5L53A 2HIHA 4PYKA 4G1MB 5A5FA 3KSDO 1W5TA 3LYHA 5JT1A 4WKOA 2A5LA 3RTDA 2AK2A 2ZBRA 5LKAA 1O0BA 3HZRA 2D5CA 4D6XA 3D3EA 2NZJA 4HGRA 3PKZA 5HKKD 1FNMA 2B98A 2WKPA 1DWUA 3OOEA 4LZJA 4MCJA 4AJ1A 2HLHA 4RD2A 2PK3A 1X1TA 4JLMA 4YCDA 4HAZA 4F60A 1RR6A 2YNMD 1I7LA 1QO9A 2Q8PA 4QLOA 2FUG6 2YS6A 3B2EA 4LTNA 1MOZA 4OJMX 4Q3OA 1Y4ZA 3RC3A 2LKCA 2JH9A 4KI7A 4DNOA 3H83A 3O21A 5E9AA 1R16A 1XKQA 5DWDA 2C4MA 5HF9A 4C7VA 2LR0A 2JS7A 1Y6GA 2JHAA 1MAVA 4Q9KA 3FOAA 2QA5A 3F7NA 1M8KA 1O8BA 3KKPA 1MIOB 2PN1A 3AJDA 2KM1A 3VTZA 1FTGA 4EMSA 4JT2A 1R9MA 2BM8A 3USCS 2E82A 2H63A 1T8WA 1DCFA 3PJFA 3ZW7A 3KBOA 1XRQA 3UT5A 2JFGA 3VI4B 4ZO9A 2G8LA 3BQNB 3PXUA 3I2FA 4CCYA 2CNDA 4M55A 4BTVA 1T5SA 2CDRA 3DJYA 5BP7A 4RJLA 1G38A 3EQ7A 3LY9A 4MIOA 4BFZA 2Q2WA 3C14C 2BI8A 3KK0A 4B3TB 2C00A 5E3JA 4R2MA 1XN1A 4P3OA 4BE4A 1GWNA 3A7DA 3ND8A 5IN5A 3OF5A 3Q0IA 2DP4E 4Q39A 3RRJA 2D3TA 1DAMA 2YYZA 4A91A 3K94A 4CMIA 3K8ZA 1K89A 4PCVA 3Q4GA 4DRYA 3PE3A 2O3QA 3IAUA 3RVQA 4X1IA 4NULA 2OHVA 1GRQA 3C4VA 4DSOA 3R4VA 4HUJA 2HCJB 2K87A 3W8NA 4AUNA 1CQJA 2PTHA 4KJZA 3ISTA 3U4QA 1DXQA 5CFQA 3W7AA 3AVTA 3UTDA 1JA0A 1E4OA 2IIQA 2FZGA 4XVQA 1C0IA 1H5NA 3K9NA 4GRDA 1ZP6A 1G4UR 1OMOA 3RUFA 1MF7A 3GBSA 3FCCA 4CI9A 1P1FA 3PUIA 3ZEAA 4BO1A 2BUBA 4E7OA 4WKCA 2Q6KA 1R8QA 1QZUA 1RE0A 4IV8A 1LI7A 5IZCA 4RTMA 2DUNA 1SXPA 1ZR4A 4ZYLA 1Y5NA 2Z5LA 3KHUA 3RRFA 5JISA 1Z83A 3NYQA 4KX3A 4DBLE 2ZWAA 4DV4B 1NMZA 1XZMA 2ZR9A 4IJQA 3ZY6A 4MV5A 4DLUA 5A4MS 4IO1A 4YP5A 4ZMBA 1ISPA 1JZQA 5JS2A 1P2UA 1U8FO 2BRUC 2FF7A 2X23A 3F71A 3IDFA 5TEWA 3VC2A 4CL2A 1V4VA 1OI3A 1CCWA 4QARA 4C0SA 3RVRA 3AZOA 5DHFA 2C82A 4FYWA 1M1UA 1N0IA 1E2HA 1EMDA 1MIHA 2P41A 3PUKA 4IFTA 4MWTA 5KNCH 1GSHA 3QVWA 4RACA 2FSUA 3BH7A 3O26A 1X7ZA 2QDXA 5E3IA 1YUMA 1QHEA 1TUGA 4WAUA 4EENA 1B1AA 4EGCB 1JBKA 4KOAA 4WBSA 1FTQA 2NIPA 3BREA 4EBFA 2H85A 3VU0A 3C7TA 1RLIA 3INGA 1LBHA 4Z54A 2JA1A 5EXSA 4OB7A 3IPRA 3V1YA 4B2LA 3TYXA 3BMXA 3F4KA 4BUZA 4RJJA 1FUKA 2FPOA 3W06A 4ANFA 1Y1QA 3HCNA 4UUPA 1I4TD 1NVMB 5C4IA 4AM8A 4D4IA 1PJ3A 1WHSA 1FUUA 3K9FC 1PJTA 1TPZA 3AHCA 1TMYA 5AJUA 5GZ1A 3EIOA 3IPCA 4QODA 2G63A 3DO6A 5EKSA 3RYFA 1SVNA 4IS3A 3U7EB 1A5SB 5K0GA 2P77A 2VEOA 5JADA 3PPIA 1VRCA 4KWEA 1NRIA 2VH2A 3U49A 3C1OA 2YVLA 1NXWA 3AF5A 1YFZA 4FE3A 3GRRA 4BO3A 2Q2NA 3L92A 1UJ2A 5KOJB 4URFA 1GAWA 3DC7A 1KI3A 1RXSA 1XNGA 2MTBA 1PV4A 1LWOA 1GPKA 1RI3A 3ESBA 4FYPA 4O4LB 1ZN2A 2CD9A 4BPRA 1S96A 3NOXA 1BNCA 3BTUA 1RRMA 3A6ZA 3N9IA 1XDWA 3OKCA 2NW6A 1U7OA 2UZ0A 1CS0A 1AGNA 3M9LA 1P2DA 1JSZA 3C5WP 4E32A 3IEUA 5KSOA 2IH2A 2GBCA 4F72A 1F6BA 2AFRA 3V8EA 5HZKA 2HRQA 2ZP1A 4AMUA 4D45A 3K0CA 4EHDA 1HEUA 2PMCA 3DM9B 2F8SA 1PWHA 1KYQA 3AK4A 1XYVA 3JYNA 1PFQA 2D0PB 4K6MA 4LISA 4PICA 1GUFA 1MJGA 5LKRA 4P82A 4CTOA 4ZVQA 3ETEA 3KELA 4LOAA 3TVTA 2IZ7A 3EXFB 3PNVA 5KDOA 1JQDA 1K6XA 4NU0A 2QV7A 2A7QA 2W58A 3RQIA 3BN3A 1DMRA 4A1OA 4WXRA 1XRRA 4EELA 4JL6A 1BD3A 4DT1B 5DBOA 2GVZC 1BTOA 4AF8A 3H5VA 2PUBA 4A27A 1NF2A 9LDBA 2PH3A 3Q7RA 1SHKA 4UD2A 1EFKA 4X95A 3ITDA 3ZZTA 3UJNA 5B4VA 2IXDA 2Q27A 3NWPA 3KV3O 4M1QA 2YYYA 2O8BB 1OA1A 2ZJ5A 1YB7A 1W75A 3D3NA 1Z2AA 5AM5A 1HDGO 2GB4A 4TTTS 1H2XA 4PZ0A 1CZLA 4L78A 3SHQA 4AMBA 4G0WA 4MJXA 2VSYA 1UKBA 4FQ8A 5E6UB 1I1HA 5IDVA 3HZOA 1CE8B 4J9UE 3QUCA 3FTEA 1WHTA 3KYDA 1C14A 3PWSA 4XLLA 5TLSA 1J25A 1W0KA 3QVJA 1CU1A 1LZKA 3N8DA 4LHSA 4ZN6A 2GN9A 2GO1A 2IY8A 2NSLA 4RPJA 3S8YA 1T2NA 4KR3A 3L8HA 3PD7A 1SIUA 3DDHA 4HXEB 4TROA 4EG5A 2OCGA 3ORRA 3MIIA 1P45A 3OIYA 3QU5A 3WISA 1DFHA 1O97D 4NBWA 3GT7A 4Y6OA 1CF2O 2II6A 1WIWA 5D86A 5DMXA 1UQUA 3WJAA 3T9BA 4BDTA 4D0RA 4M6WA 5B3LA 3LDAA 3JATB 2Y66A 4RV9A 4CU2A 5BRAA 4IGEA 4NH4A 3CN9A 2DERA 1K8YB 4IWNA 2WZDA 1GNLA 3V48A 1JQ5A 1KP3A 1VL8A 2AC4A 2O0KA 3K6JA 3R74A 2RARA 4F04A 3WGIA 4OXQA 3EISA 3P20A 1BX0A 1GN9A 2BGKA 2CV2A 1R0XA 4NBTA 1ZGHA 1LNSA 2D8AA 2MSDB 4LRUA 4FN4A 1KQGA 3TLZA 3AVWA 4DV2B 2JHFA 2YZMA 4LZNA 3T7TA 3Q1LA 2HA5A 2P9TA 2X3UA 5IW8A 4P98A 2DHCA 2ZYAA 1O9GA 3LQRA 2ZR8A 5EQFA 1M2OA 4GMDA 3WLTA 1EH5A 2HF7A 3QU9A 1EP3B 2EKBA 2WIAA 3TF5A 1K7EB 5H3LA 3WLQA 3GRPA 3HUFA 4ZEMA 3B70A 5IH7A 4KN6A 4RLQA 1Z0UA 3DLAA 4CMBA 2DULA 2WHPA 4AMYA 3GJ8A 3BORA 3EVDA 2NVBA 1U1FA 4O4IB 5JPIA 2CXQA 3UT0A 3ZDQA 1OH6A 3ECSA 4L8YA 3KKMA 3NETA 1MR3F 4KVZA 2J3DA 4P4NA 2PYZA 3HNOA 2BM9A 5EUMA 4RPHA 1J6UA 2QTGA 1BJKA 4POAA 1ZRNA 3KQUA 3HBJA 4A2CA 3T3EA 4B84A 1ZA2A 3IVAA 2GO7A 2FXVA 5DHSA 3SYTA 2C8VA 5A7FA 3GLIB 2OBMA 3ND5A 3R5HA 4LE1A 5AP9A 4BN5A 4MUFA 3KYCA 1R15A 3IPAA 3MWEB 1TYEB 4I1VA 4X54A 1GRVA 1RBQA 3OZTA 3QYFA 1VYUA 1V39A 5BT8A 4W5WA 5JNUA 1WB5A 3G2PA 1HQCA 3BIJA 4DPKA 1TZJA 2E4WA 4YRRA 5D6OA 5A3JA 5JZBA 3SX0A 1XRNA 5KJ6A 3FN4A 4YRFA 3H0KA 2P4EA 3EAQA 1S2MA 3V32A 2F4NA 1JE1A 4A73A 3I6IA 2JLUA 1GLNA 3UJCA 1A9PA 1U2GA 4S2EA 1AU9A 2IF0A 2XQVA 3EWNA 3IP8A 4IUDS 1KMNA 3QVUA 1E6KA 3RS5A 1C29B 5IN4A 1CY8A 2I03A 4P31A 1L1EA 2C1ZA 1NFRA 3I6MA 2Q0HA 1M8PA 2JARA 1J0EA 2FVXA 2W83A 2VSOA 3HBNA 4LW8A 1XLTA 2PL9A 4I1RA 3QI2A 2DLDA 3TRHA 1CRZA 2YFQA 4MRMA 1J0CA 3CINA 1YK1A 1LFDB 3WI7A 4L0DA 4XYEA 3EVTA 2FWRA 1JEOA 1VKHA 4I46A 1FDRA 2LDBA 4KR0A 3W79A 4R71A 1S4QA 1XK7A 4XQ0A 4JJEA 3BRWA 3CB4A 5H4HA 1T43A 1XAGA 1SUAA 2X0RA 3J7TA 1A88A 2GFHA 5ETJA 5AT1A 4BVHA 4BVFA 1OX4B 3AL0C 4LRWA 3FUVA 4DZZA 1F4LA 1V9SA 4HCJA 3TLEA 3G0HA 3DP9A 4GZLA 5ALQA 4G07A 2BGRA 1MTOA 2GA9A 4F5DA 4CWAA 4TUYB 4ZT5A 4HS9A 4DJJA 1PZEA 5ENZA 1AO0A 2AJ8A 4LN1A 1E6MA 4UNNA 4DV0B 1NHWA 2V97A 1MDBA 2O4UX 3R3VA 4XJTA 3WK8A 4ACAA 1X80B 2R7NA 4JP3A 3ZKAA 1GKLA 1E2IA 2B2XA 1V5IA 4GOKA 4U3JA 4BB5A 1EX6A 4EPTA 4R1PA 4C6RA 1E2BA 4RQAA 1JHDA 1NW6A 1G1MA 3R3XA 4PPFA 5LXTB 1GA4A 3G6KA 5LBIA 3GIWA 4M9ZA 4N6GA 4YNBA 4D8UA 1BHSA 2EGGA 1J1ZA 4HN4B 4JBHA 2ZJOA 3TFOA 1SVWA 5H9WA 2ERXA 4HAIA 2PZMA 5IF9A 3NPMA 1PL8A 1T3HA 1WMFA 3L8YA 1T36A 2OHGA 3CWCA 4KH0A 4M36A 1KAGA 4QQKA 4YJGA 1DFIA 2BFWA 1R5JA 3GVHA 2B5OA 3QI7A 3BA6A 4QSHA 4M1YA 1CX9B 4BMYA 2OHFA 4DBZA 2JKZA 3HFSA 3TBFA 1YQ9A 4GIBA 3V4RA 1CC1S 3IBTA 2QYHA 1RHQA 1Y1KE 2C4UA 3KKKA 3MJCA 3OJFA 2JLSA 4H1HA 5DLQC 4BNZA 4E6EA 2P1DA 5CLJA 4MP8A 3QE0A 4KHZA 5TEVA 4QQ8A 3PICA 4BNTA 1YS1X 2J6CA 1CSEE 2XOEA 2VP3A 1VIYA 1ZIYA 4MQMA 4GBMA 4RTPA 3OUZA 1E20A 1MO4A 1EE2A 1SC4A 2P3LA 3GAZA 4FE7A 5E7JA 1U2TA 4KSYA 3DF9A 5EAIA 2B7LA 1YVUA 4MP3A 4PZ9A 1ZRHA 1EA7A 5JNRA 1R0RE 1AX9A 5CYFA 4RDCA 1V41E 5NLLA 4CF3A 4DKXA 3I9FA 1EDEA 2GLUA 4E5DA 1T1JA 3KJFA 3O91A 3EC7A 3LJKA 2NYVA 4KZKA 3H05A 1EWTA 5ARCA 5KTKA 1Z18A 2QG9A 1CY1A 2W48A 3CF2A 1NV8A 4D4MA 5KYWB 1SN7A 1G5PA 2FWMX 4H7JA 3W3ZB 4YDQA 3FAZA 5BSRA 2DEUA 3R0XA 4TMWA 2AR7A 4DBVO 1UMDB 1V2GA 2WFLB 3PP8A 4KKXB 4QXRA 1IOZA 4GQIA 5CM8B 5CLQA 3WMEA 1KDRA 4UUBA 3L49A 3HQ4O 1PTJC 2F3PA 3RS3A 5K4GA 1M1ZA 3BRCA 5G2OA 3WMXA 4KTTE 3MCAA 4CM8A 1SIWA 4S05A 5JQGB 1JJAA 1W94A 4EUSA 2DKFA 4BEWA 2VDLB 3EBLA 5EVCA 3MPOA 3AV3A 4CR6A 5HM6A 2BR3A 4H1UA 4ZXPA 5HHTA 4MWSA 3RVPA 5JFGA 1H6DA 1AA6A 4J07A 1TC1A 2ZBPA 3GVIA 3C8ZA 2F6RA 2MHCA 5KAPA 3M1LA 5JJBA 2FZWA 3B38A 5LPNA 2EBFX 2FPMA 3R77A 1VIVA 4DC0A 1DXYA 4XDYA 1R4ZA 1H42A 1CBUA 1QH0A 2HU7A 2I3AA 2BELA 3FFAA 4R01A 8OHMA 5KQSA 5LQNA 1PUXA 3I9V1 4LQDA 3RRNA 4M9XA 4ZVVA 3EA4A 4QJ4A 3MD0A 3F46A 4L95C 3RVDA 3H65A 1M1YB 1W581 4KR6A 2VZ9A 2O0LA 3BEDA 2VPQA 4HN9A 1KY5A 1K92A 4NOLA 3THRA 4PS0A 3I73A 2DT8A 2XTMA 3RWOA 4E11A 2WJZB 4A1FA 1XC7A 2C5GA 4BO9A 3KQWA 1UJBA 3GLHA 2O7NA 1V11A 3N0RA 2C3UA 4OQQA 2RG7A 3LOUA 4M3NA 2PT7A 1RP1A 2NVUA 4C3ZA 5IANA 1PK9A 1RAAA 1XEWX 3QJGA 4G5QA 4G63A 4X61A 2NUTA 4HFRA 1XZLA 3FBTA 3KJXA 4NKRA 5DTIA 3IUPA 3FNGA 3Q7SA 1KPIA 4Q12A 3RTGA 2QRKA 2I6FA 3UUWA 2FMXA 2IZ6A 2XR1A 1T1RA 1GZ5A 1KVQA 2X0EA 3RSCA 4KAXA 4BWYA 1UBKS 3G0IA 3HKCB 3JQEA 4IV0A 2A9RA 2PO5A 3VUFA 3RK4A 3OIUA 4RF3A 3TR0A 3GLQA 4JLUA 3VC1A 3D8SA 5FF9A 3ETDA 4B43A 1F48A 3PVZA 5SYAA 4WMLA 4X64B 4I1PA 4EKEA 2BKXA 1ARZA 2XMPA 3DEFA 4J3FA 5DASA 5JH7B 4IDFA 4EO9A 2IH5A 1Y7TA 1YRHA 2JBWA 3N58A 1AV6A 3RFVA 3FI9A 2C9CA 3OM0A 4NSNA 3S8MA 2I7VA 4AY2A 5CFMA 3AI2A 1M0SA 2OO5C 5CK4A 3UB4A 5B64A 4NECA 2POQX 2VJLA 1HT0A 1JYFA 3CWQA 1OWLA 4L27A 1U04A 3IVCA 3F2VA 2A57A 3TSZA 3NBYC 4B8YA 1UDXA 4G0PA 1AKRA 3RJ9A 4FDVA 4AG3A 2ENUA 1YDMA 2P6MA 3R5SA 3B1VA 3HB1A 3KZ1E 4NCAA 3PNPA 2RGRA 3PNSA 3MBIA 4J0GA 3MJ4A 4KIGA 2JJ2A 2DUUA 1WOMA 4CHTA 4ZJYA 3ER8A 1E1RD 2JAUA 3M6AA 2FMHA 3IERA 1CIJA 3BD9A 5G4LA 5A4FS 6CHYA 2AXPA 2YFHA 1MBZA 3R41A 2GZRA 4PVCA 5ALIA 3EWSA 4XIYA 1SC1A 5IJ0B 1RYYA 2VTBB 1FYEA 4OHOA 3VOAA 4FDMA 4TM8A 2EQ5A 4HG2A 2YWEA 3FZQA 2CK3D 1ZJ4A 2PA0A 1JAZA 4OHRA 4PNHA 4LOJA 1VLQA 2R6FA 4GPIB 1G2PA 3FDJA 3VU8A 2BGJA 4FNGA 4CETA 1A9OA 2RGXA 1PHRA 1AKQA 5J4KA 4LVNA 2ZPAA 2CCGA 3AEZA 1MG0A 1J42A 1U3VA 4LRSB 4MAMA 4PC7A 5IULC 1BX3A 3E7XA 4M8IA 3M6VA 3TRJA 4ENVA 1VGVA 1PLLA 1JQBA 2GD1O 4IH1A 1HE4A 1SBTA 2XE7A 4BYMA 4CL8A 2WM8A 1CEQA 1SVMA 4OBWA 1E3WB 2F43A 4Z0NA 2IUFA 4JUDX 2RI6A 1EP9A 1C9EA 4IEFB 4C2BA 3A1WA 3FTNA 3PKJA 1JH8A 1ADGA 3CS3A 4NOKA 4UBIA 2NVOA 2CNNA 4DARA 1S6YA 5LOVB 1KOGA 5IAKA 1T1IA 2FE4A 4DNQA 3IIIA 4AP6A 1CDDA 1SBZA 1XYGA 2AMFA 3D7SA 4IFIA 1BRMA 1I10A 2MSLA 2Q7OE 3RSOA 4D6YA 5BVGA 4XGKA 1J2RA 4QDXA 2FSVC 3L0ZA 3OA2A 5BSFA 5ISMA 2O54A 1QGYA 1ZJYA 2MU1A 4KQ6A 5DCLA 5JSYA 4ALNA 1LLCA 1LF5A 4BFTA 1Q1QA 1NVXQ 2BMAA 2UAGA 3P9ZA 4P7GA 4LJRA 1N7HA 4G8BA 3DB1A 2W6CX 4FI3C 3BGSA 3BFKA 4XVRA 4IRUB 2VYQA 3LWZA 3HKDB 5EIAA 3TW4A 2ZVJA 9MHTA 1ECPA 4WA7A 2NUPA 1DAEA 2ZT5A 1T9ZA 2XVZA 4MWCA 3DTNA 1Y81A 3LK6A 1BH2A 2OO3A 2XEDA 4O2AA 5CCEA 4B47A 3BE5A 3WNBA 1H1DA 2V7QA 1GYQA 1Z15A 2LCIA 3JQBA 4FGLA 4KWTA 5GJCA 1UXIA 4AK9A 5BRNA 1C7RA 3EEFA 4WOKA 5F7XA 1UAAA 2D00A 2CLSA 3GLHE 3HY6A 4MCHA 1KZ9A 1R18A 3K96A 3Q72A 4GNKA 4BTEA 4EGQA 3SNHA 2HF9A 5TIIA 3S27A 3IH5A 1RWXA 4B6RA 3GEHA 4WD3A 1J2YA 4NL4H 1SXJA 1DB3A 1I5OA 1MU0A 1YS4A 1VSQA 1TCCA 2JBAA 2W2QA 2XQKA 3ZY2A 4C3UA 2O3TA 2WMNB 2YW9A 1OV6A 3M4YA 3NJ4A 1KPGA 3SC2B 4QKQA 3ADCA 5CLLA 3TZKA 3DFUA 5B55A 3EMKA 3HO6A 1ABFA 2C7GA 2VXYA 5CVDA 1KEKA 3DVAA 3S44A 4O2AF 4Q1CA 1W34A 3GK3A 4LBWA 3V3TA 1MZVA 2JGLA 5ICGA 4R9SA 3ASVA 2CNLA 4LYHA 4WWHA 5EIEA 1E5VA 3A1TA 5A3VA 3TTTA 1PQ4A 2ZYWX 1U2SA 3GW8A 2Y1FA 4MQEB 1WJGA 4TKUA 2JGDA 3FUUA 2EP7A 3VU9B 4Y1EA 1E6UA 1WVIA 1RQ7A 3KKOA 4X93A 4ER5A 1GOTA 4JI5B 5DXFA 3U7GA 1QYXA 1SY7A 2ASVA 2O6HA 4GGMX