3TZEA

Crystal structure of a tryptophanyl-trna synthetase from encephalitozoon cuniculi bound to tryptophan
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
367
structure length
360
Chain Sequence
VPVAIDYDKIINQFGCEKFNQALADRLEKLSGKPAHYFFRRGIVFAHRDFNLLLDEIANNRPFYLYTGRGPSSKTMHIGHTIPFLLCKYMQDAFKIRLVIQITDDEKFLWKSMRLEDAMAYGRENIKDIVTLGFDPKLTYIFSNVEASHHFEENILKISKTINLNEAIKVFGFDMSSNIGQVGFPAKEIAPCFSSSFRFIGKGAMCLVPAAVDQDPFFRLARDKAKALGEKKPSSIYVSLLPDLKGVNRKMSASDPNSSIYLDDAQDTIRKKIIAYAYSGGRKTGGDIDVDVPFEYLKYFLDDDQELEKYRSGYIKGEITSKEMKEKCVVVIQEFVSRYQESRKRVTDDDLRAFIDINKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand co-crystallization of aminoacyl-tRNA synthetases from infectious disease organisms.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase
total genus 132
structure length 360
sequence length 367
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 3tzeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3tzeA01
5AHWA 1OBCA 1UFVA 3NBKA 3UC5A 1OWMA 3H9CA 3IVXA 3U1VA 3CLSC 5DASA 2WB2A 2RD2A 1K4KA 3AG6A 3N8HA 3PNYA 5DEOA 4ZT4A 3VRHA 1I2DA 3P0HA 1N2IA 1OD6A 4EG5A 3ND6A 4NATA 3M5WA 1KAMA 4QRDA 1G8HA 4MWCA 4DDMA 3TQIA 1IQRA 1H1TA 1T9GR 5FO0A 4ZT5A 3COYA 2DEUA 2A1TS 4H3SA 2CUZA 4MAFA 2PIDA 4KR7A 1KR2A 1KKUA 2D54A 3CVVA 2AZXA 2A7XA 1PFVA 3G59A 3AG5A 4J75A 4R0NA 4EG1A 4JZYA 2ZP1A 3RFFA 3DLAA 1YUNA 3GMIA 1MB9A 1XNHA 3DPIA 1ZH6A 3HGMA 1JIJA 1J21A 5DK4A 1OWNA 1WQ3A 4ZT7A 4EG4A 3HV0A 2G36A 1J70A 3GLVA 1N2JA 2IJGX 4QREA 4BWVA 3IOCA 1U7DA 2A1TR 3X1JA 1KP2A 1M8KA 4WSOA 3CLSD 5TEWA 1VBKA 1M8FA 1WKBA 3Q4GA 1R6UA 3ZXIA 1O96B 3PNBA 1F7UA 2WQ7A 3DO8A 3FH0A 3LE8A 4NDAA 4E1AA 4MW4A 1WXEA 4F3RA 3DV2A 2CSXA 1M1ZA 1IHOA 4ZCSA 4MW0A 3RHSA 1I6KA 4PBTA 1D2RA 1WXFA 1WXIA 1JMVA 5J58A 3ZGZA 3HFJA 1I6MA 3S3TA 4NZPA 2J5BA 2QJOA 3H99A 2E0IA 2HZ7A 4NAUA 1GZUA 1YIAA 1TFUA 3FG9A 2CV2A 1KQPA 1TYCA 1H3NA 3NBAA 1QRSA 1KQOA 3FDXA 1T6YA 3HZRA 4PBRA 1YIDA 3IUBA 4DLPA 5EKDA 1O6BA 1VLHA 4A91A 2VXOA 1KORA 4MVYA 5IJXA 3AIIA 1G8GA 4K03A 3PNVA 4FZJA 4EG7A 1I6LA 2C5SA 5KWVA 1KAQA 1VL2A 4MUNA 3IMCA 1NZJA 2XRYA 4DDHA 4G5FA 3RBAA 3FOCA 1F7VA 5FNZA 4HK4A 1LI5A 3CLRC 3CVXA 4HJXA 2E89A 3UY4A 4MUEA 1PG2A 1QU3A 4OUDA 3IODA 1PFWA 3AKZA 4AS1A 3CLRD 3K32A 1DNPA 1N2EA 3FIUA 3D6VA 1O97C 2RE8A 3L93A 2EL7A 1VBMA 2PXHA 4MUHA 3F3MA 4MWDA 5LFAA 2PZAA 1YUMA 3NV7A 2GM3A 1ZJWA 1IFXA 2H29A 2QUHA 1JIKA 1J1ZA 5HG0A 1ZH0A 2I1LA 4MW1A 4YMIA 3I05A 3IOEA 2O5RA 1JZQA 4KPUB 2X1LA 1WXGA 1OWPA 3SP1A 1TQ8A 1N78A 1NURA 3IOBA 4ZCPA 4K0RA 4MWBA 1JEDA 3MLAA 4L2IA 4MW7A 2V0CA 2QTNA 5BNZA 1JILA 1N2HA 4U8HA 1GLNA 4G5YA 1IVSA 3ZJVA 2YXNA 1MRZA 1P7PA 3X1KA 1EFPA 1EUQA 2J07A 4NX2A 3ELBA 4S1OA 1O94C 4ARIA 4U7JA 4J76A 4OJMX 1NUSA 1QJCA 3G6KA 1K4MA 2IELA 3CA8A 4MW6A 3IUEA 1NUQA 3SEQA 4EGAA 2AG6A 3CLTC 1XNGA 1MBZA 3A2KA 3FHJA 4R2LA 3MMXA 4EG3A 1N2BA 3LCJA 4DE5A 2X0KA 2CFOA 1TYAE 2Z09A 2AKEA 1F4LA 5H16A 1O95D 1GPMA 2B7LA 3KT8A 1O5TA 2QUJA 1U0BB 2QJFA 3TZEA 2QTRA 4YP7A 4UZEA 2OQ2A 1IQUA 1T6XA 3Q12A 1G8FA 3N2YA 2A1UA 2DERA 4EF6A 4MUJA 1V47A 4MVWA 4MUIA 5LLTA 2DUMA 4OUDB 3QTTA 1EXDA 1LW7A 4WNYA 1V8FA 2CYCA 5KHAA 2YWBA 4KR9A 1JHDA 1X8XA 3OP1A 1EUYA 4Q16A 1VBNA 1TEZA 4ZCQA 3RJZA 1WY5A 1N2OA 4JYZA 3FY4A 1WOYA 4JXXA 2HMAA 2NSYA 4DDKA 2CV0A 3A05A 1XJQA 1SURA 4UZFA 3KT0A 2DR2A 1R6TA 1MOPA 3VGJA 4MUGA 1N77A 2QUKA 4ZT6A 2DXIA 4PBSA 1M8JA 3H05A 4MWEA 3P52A 1G59A 3TQOA 1NUUA 5J5AA 1EE1A 4PY2A 2PFSA 1QRUA 3CLUC 4YBRA 5DB4A 3TNJA 2V0GA 3RK0A 3CVUA 1QRTA 2Z08A 2X1MA 1EFPB 3CR8A 3P0JA 1K92A 1YULA 5HUJA 3E27A 1HYBA 3INNA 4MW9A 2QJTA 4L2IB 2CYAA 3ZUGA 1O0CA 1EFVB 2GKSA 1T6ZA 1H3FA 4KR6A 1PFYA 3AL0C 3COVA 1O96A 1RQGA 2J4DA 5TGTA 4EG6A 3IVGA 3MXTA 3JXEA 2H2AA 2CYBA 3RK1A 1COZA 1EFVA 3ND5A 2WQ6A 3ZIUA 3PRHA 1R6XA 1ULHA 1IRXA 4XFJA 3TS1A 2VTBA 4DJAA 2DPLA 2A86A 4ZT3A 5LM3A 1OWOA 2D13A 1GN8A 1MJHA 4KPUA 4MVCA 1TYBE 3Q10A 5JBNA 2NZ2A 4KKVA 5IHXA 1GTRA 3IH5A 3H9BA 4CT0A 5TS2A 4G6ZA 3N9IA 2A88A 3FI0A 3SZGA 2DLCX 1LI7A 1CT9A 2JANA 1NP7A 2A4MA 1N1DA 2CV1A 2EJCA 5HUHA 3UOWA 1Q77A 4XFDA 3IDFA 4ND6A 1M8GA 3SZ3A 5K0SA 2ZUEA 1N3LA 3D6UA 2Z3VA 4YP6A 1U3DA 1QU2A 2PZ8A 1JIIA 3TZLA 2D5BA 1KH3A 1EJ2A 1H3EA 3ZJTA 2PZBA 2A84A 3L92A 1KH1A 4MW2A 5KCMA 3K9WA 1TYDE 1FYDA 3COZA 4ND7A 2WSIA 4ARCA 5FO1A 4P2BA 4EG8A 2YWCA 5J59A 4ZCTA 3ND7A 3GUZA 5TEVA 4NAHA 1QNFA 3HL4A 1MC1A 3QTBA 1NUTA 3ILVA 4F4HA 1Q15A 2E21A 3PXUA 2VTBB 2XRZA 3CLTD 1O95C 3CLUD 3ZXSA 1YI8A 2HGZA 1NI5A 1M8PA 3AFHA 1JZSA 3P0IA 3A04A 3C8ZA 1NUPA 4ZT2A 3MLBA 1XNJA 2J09A 4HJRA 3OTWA 4U63A 1KP3A 1GTSA 4I6EA 4RUKA 3FETA 3BL5A 4ZCRA 1NSYA 4MUFA 2DETA 3SDBA 3HMQA 4XSVA 1T9GS 4X0EA 1PG0A 3VU8A 1O94D 3ZJUA 2R5WA 3SEZA 1O0BA 1X6VA 4HPWA 3UK2A 2PG3A 3G5AA 1OBHA 4MULA 1F9AA 1MAUA 1QTQA 4R2MA 1WQ4A 1U7XA 4I6JA 2ZUFA 3H97A 1KH2A 4Q93A 4GU5A 2BTEA 1IQ0A 1QQTA 4CQNA 3FNRA 3A4IA 3KT3A 1N2GA 1S4MA 2X3FA 2J08A 4TS1A 1A8HA 3IMGA 2O8VA 4EFKA 1ZUNA 1JGTA 1K97A 1FFYA 2E18A 3CVWA 3QE4A 1NYLA 1WXHA 1ILEA 2GOYA 3IMEA 5K0TA 3N05A 2QTMA 1B6TA 1O97D 5F23A 3SYTA 1J1UA 4MUKA 4I6GA 2A1UB 1MB2A 1WJGA 1IH8A 2IP1A 1JECA 3COWA 3UMVA 1BS2A 4CDMA 1J20A 4YP5A 1Y42X 4RPIA 2QUIA 4JFAA 2JA2A 1JEEA 3IVCA 1U3CA 3ISJA 3MUEA 4CDNA 1KQNA 1PFUA 4MQ6A 1J09A 4AQ7A 3KFLA 4MVXA 4MLPA 5H7XA 3LOQA 2CT8A 4GRIA 2YY5A 2TS1A 1Q19A 1N75A 4DNXA 1OWLA 1WZ2A 3X1MA 4MW5A 4QBTA 1MAWA 2BYTA 3CVYA 1Q11A 3FWKA 1M83A 2JAXA 1GAXA 4JXZA 2OV4A 3KT6A
chains in the Genus database with same CATH superfamily
5AK0A 1GNRA 1U2ZA 3RB8A 3L1VA 1BXGA 3UC5A 5HIAA 1EWTA 2I54A 1IHXA 2QTHA 1SEPA 2IYOA 3ESYA 4OF4A 5DTRA 2ZJ2A 5CDTA 1UDXA 3U1VA 2OUKA 3CLSC 3M3DA 1GARA 4CEJB 2XMZA 3FNQA 3MIZA 4JBNA 4Y9UA 2G5GX 3VU9A 2QLBA 4HXEB 4P33A 5AXBA 3GUHA 1BTOA 2HLDD 2XAUA 3KPUA 3W3AA 3V3TA 4XYLA 4CFSA 4QM7A 3MJHA 4FX2A 3I1YA 4MWCA 1T5SA 4JLSA 1O5IA 2EWMA 4MEJA 4X8HA 1PT9A 2P35A 1W88B 3VO2A 4G0WA 2IPLA 2Y05A 1QO0D 2X13A 2CUZA 1E2MA 3IBCA 3M5DA 4WN9B 4DMUB 1WWKA 4TQ9A 3W3ZB 5EVJA 1XKLA 5LD2C 1T10A 1E4YA 3HACA 1KZ7B 4DLWA 1H2WA 3A6LA 3DBIA 4LGMA 2ZAMA 5AI8A 1N9KA 2FWMX 4LXHA 5BT8A 2BDUA 5IT0A 2GILA 2QYTA 4NYJR 3TMAA 2Q5OA 1DX9A 2WP8J 2ZVDA 5FPHA 1D2AA 5AIBA 3IFSA 1OX4B 4DJDC 2HWWA 1GD1O 2VRCA 3EZ6A 4INAA 1WHSB 3KP1A 3IE1A 2WRZA 4JLAA 3ZK7A 1DIRA 1NC1A 1XQWA 3DDCA 3RS7A 1MENA 1KO8A 1FDUA 1MJGA 1UXOA 2JLCA 2PGNA 3DE3X 3QEMB 4J0HA 4ARSA 4B4WA 3P9KA 4BWVA 2MYTA 5HF9A 1KAGA 4ZOLA 1WPXA 4FR5A 2WB4A 4Q1EA 5DK6A 4ZKEA 1KA9H 3CEMA 4JL5A 4ZDJA 4AW9A 4BRSA 3T1QA 1AUVA 2P77A 5JS7A 3NRJA 2Q3CA 3V5NA 1R88A 1KEEB 3E9ZA 5IAKA 3CLSD 5EE3A 5TEWA 1FMCA 1Z8FA 2ZRMA 1HFKA 4H2DA 4WI1A 2Q7DA 3EEOA 3FROA 3RJMA 1WV0A 4GP6A 3PGXA 1VGRA 4GI1A 4GYKA 5DEIA 3BRWA 4BVBA 1F7UA 2Y0BA 1QHSA 2IEAA 4RZUA 3TD9A 1WX1A 4HNHA 4EHNA 1KZYC 4I19A 3D8SA 3OOJA 3HR4A 3DV2A 3CH4B 4IJWA 5CJ2A 2HLPA 5EHNA 2K5UA 4C3ZA 4PAOA 2JK0A 3ZCRA 2O8EA 1DBVO 1QAOA 4YHBA 3T5CA 2O8CB 3PWKA 3NU1A 3PNMA 4LDAA 1V8BA 4OI4A 2HPZA 3GJ3A 5SYAA 2P41A 3C3EA 3P4XA 1I33A 1M33A 5JARA 1F6DA 2DMRA 1E1RD 1QMPA 4AYXA 3IP9A 1YIAA 1IDN1 4P58A 2ZJ1A 1AO3A 1LBSA 2OORC 1RWBA 2WJPA 1TYCA 1ZPDA 2PXXA 1N6LA 4TL6A 2CCJA 3KL2A 3L0YA 2JFFA 2YQ5A 2QKYA 3E03A 3KAKA 5FQOA 4CR8A 5ARDA 2JGAA 1W2HA 1YF3A 3VYUB 5EKDA 4X1KA 1VP9A 5KBYA 3A1CA 5FYDA 3W1WA 1UPCA 1VHJA 1VXRA 4RVOA 5E38A 5KSZA 5K0GA 3WKEA 1S1CA 2AB0A 4OX9Y 2H1LA 4LEIA 1OTHA 4YEDA 4QO7A 3HZOA 4FZJA 1E3JA 3UJAA 3LPDA 4PNZA 3TRKA 4JN6B 1SOVA 4MA4A 4MNTA 4CT4B 1U4NA 5JUWA 2CF5A 2C7GA 3CEHA 3ZW8A 3ORYA 3UMSA 2HA7A 4IOMA 1AO0A 2HA0A 4AY2A 1DJMA 1BWQA 2VOJA 2I1WA 2V97A 4IVQA 1GGHA 3PTZA 3LBYA 3AM4A 2BM9A 3B1JA 5FNZA 3PXGA 3D2LA 4Q15A 5FL3A 1WDWB 1F20A 2GESA 1GN9A 2I5PO 2PUVA 5LOVF 3FTDA 4PVDA 1P4RA 1CJSA 1L6IA 4RJTA 3FSJX 1I1OA 3GR6A 5DI3A 4HTFA 2BM0A 2JFBA 4H7EA 4NOJA 2GXAA 3LFTA 3NIDB 5HKLA 1VYHA 2DLNA 4HAOA 1SPBS 4XUEA 3UHAA 4Q24A 1Z5PA 4PE5B 3MTJA 1J8VA 4KBFA 1YUMA 5L3VA 5KPDA 2GM3A 3U5TA 3K5IA 1KI7A 5FBRB 1H0HA 4HNVA 5EJ2A 2NYUA 2CLIB 1J1ZA 4ABYA 3OFNA 1ISRA 5K0ZA 4JB8A 2X58A 3M34A 2WTAA 3AMVA 2B36A 3PUVA 4Q3KA 1GUFA 5CCXA 1WUJS 4CKZA 2QNRA 1SC9A 2VP4A 5TVKA 1XB2A 2QTLA 4DLNA 3HG7A 1J8DA 1PZHA 2X1LA 4JLPA 4EDFA 4ZI7A 5IAEA 2JI4A 1D4OA 2JEOA 2NTNA 4RY9A 1OXVA 3PJEA 4B2YA 1KJ9A 3PDJA 1NURA 2FPSA 1KRWA 2HPVA 1VLLA 1YB7A 2JHPA 1A4RA 1S01A 1XJCA 2VYND 3Q3EA 4PX5A 4X41A 3REOA 3VR0A 4ESHA 5I3ZA 1ZNQO 3GVHA 1GZ3A 4L2IA 4MVJP 3I2IA 4NBRA 3SK0A 4OQ4A 3ZGVA 4A2CA 3CUTA 2D1SA 2C1ZA 3CKYA 3QBEA 1R74A 3CGGA 4MVJM 4NV3A 1GEEA 1T34A 5LXTA 1IVSA 1P7PA 3GRVA 3V4FA 1EUQA 1B76A 1XZAA 3PV0A 1J2UA 3H5IA 1EXWA 1C50A 4L5BA 1L7NA 3ZJYA 4YWHA 3H9QA 5F9HA 1HMYA 3P9CA 4DWVA 1J6UA 2NSDA 4LSWA 3SEQA 5HK8A 4GLBA 4EGAA 5B2EA 2O07A 1J56A 1MBZA 3FHLA 3NHKA 3QPUA 1NBIA 3OZUA 4MYTA 1ZBDA 5FRDA 2UKDA 4ZVVA 4L76A 1L5VA 3LW8A 1YONA 4WZBB 1BCSA 2CNLA 2NADA 2ZWIA 1FP2A 3IV7A 4DM7A 1YDFA 5ALIA 4EYKA 4AIRA 3CNEA 4GNRA 4AF6A 4EG3A 3HYSA 4IHAA 5JO9A 3W8EA 2QXUA 2JIMA 3FAKA 5FTNA 3UJPA 2CFOA 4E7PA 2P6MA 5JCOA 2WWFA 1WKCA 4X85A 1OHHD 3RVLA 1THTA 3ITNA 2DHRA 2HJVA 4L9SA 4M9SA 1RPZA 3A2LA 3Q5EA 3LC0A 4JT2A 5HQ3A 1U2EA 3PPXA 1BW9A 1ICIA 2WEKA 3BL8A 3E53A 3H87A 2H3HA 1CJVC 1V8ZA 5KKAA 1KE1A 2DWOA 1VECA 5DNDA 5EZ6B 5B6PA 4LK2A 3RNOA 3WZLA 2YCLA 2R2AA 2W2VA 4YACA 1J0BA 1UM9B 4Q1BA 4AD8A 5F2KA 1T4CB 3ESAA 1DO2A 3BD6A 4DIOA 4H1TA 4JQCA 3L40A 1VBNA 1C2YA 1SN7A 3BGOS 1F2UB 4RM3A 3RJZA 1MA0A 4P34A 3RYIB 3GLSA 4EI7A 4RD0A 5IABA 1WOYA 3F6CA 4JXXA 4XEUA 4JD5A 1UBLS 2CLMB 3B6IA 4OKSA 3VDMA 3M5PA 1WMAA 3IAM1 2CVHA 4YY3B 5ALUA 3GA7A 1M6VB 2CMKA 3VGJA 2JIZA 2RGCA 3RU9A 4CVNA 5I4IA 4GGPA 1JKJA 2O1SA 4PX2A 4YMGA 5H8WA 1ULTA 4G0QA 3HU3A 3U19A 1I94B 4MRVA 2WOJA 1ZMOA 5AVSA 2WE8A 1UP4A 4TSKA 2GRAA 1WL8A 5L3QA 1XYGA 1OREA 1G6KA 2ZIEA 2YNMD 4LZZA 4L8FA 2DWQA 4V02A 2YASA 2PH3A 3O4FA 4ZARA 2WHXA 1GKUB 1YE8A 3QKWA 4UARA 1NT2A 1DEHA 1LEHA 4NBLA 1L7VC 5BUZA 1L5QA 3ZEIA 4JOCA 2PKXA 1BEEA 1PJTA 4RVDA 4MQMA 2O3QA 4B31A 2KWIA 3GU3A 4OSPA 4UULA 5C31A 3UJ9A 4DPLA 1LY1A 2QJTA 1VL0A 2QJWA 4DCSA 3EIXA 5EKXA 1IE3A 1TMOA 4A1FA 4RL4A 1BVUA 1G8MA 3WLHA 3AJ8A 4JENA 4FEYA 1PU2A 3LXUX 2FE4A 1PV1A 4ER5A 2AG0A 3RT9A 2B0CA 2REOA 4ITVA 4Q02A 2Z0MA 3L8FA 1B00A 2GGSA 5KJEA 2HYIC 4MGYR 4GBGA 4ACBA 2C84A 5IDWA 3OKPA 4PAMA 2X1VA 3Q9SA 3C6QA 3JALA 2Z8XA 4QTTB 2J6HA 3RV4A 3DYVA 4BKOA 1ZK3A 5A6SA 3LM8A 4A92A 4QFBA 4AL4A 1R6VA 2DPLA 3UJDA 5LM3A 2XBUA 4MRNA 3ZVRA 4LZNA 2D13A 1POWA 2I4IA 1G21B 4K9PA 2V0NA 4ISCA 1Z7YA 1U28A 4C0WA 3N6RA 4NHEA 2XW6A 1L7AA 2BUBA 3ISVA 4OATA 4TSRA 4K7JA 4BUZA 4DMCA 5EPUA 3WRXA 2FZ5A 1Z0DA 2A94A 1NU8A 3DGEC 4FOPA 5JH7B 1NP7A 3AL3A 4E4RA 4JC0A 2D5LA 3EXIA 4GI2A 5CVVA 5F78A 1CIVA 4YPVA 4KP7A 2L42A 1Q5PA 2WR8A 4KGDA 2FG6C 1RKVA 1SWVA 2BMFA 5K8IA 3SZ3A 2C5FA 3K0BA 2JJ8A 4UHHA 3D6UA 3HO8A 4YMSA 5SZKB 4PG6A 1F4PA 4C7OA 2B92A 5MHTA 2DG2A 3QUSA 4KXQA 1GTZA 4C2TA 2HHJA 3FR8A 2V54A 5HM6A 3VJLA 4KQHA 4CDRA 3PEFA 5BV2P 4AKGA 1QOZA 4BLOA 1T0UA 2VF2A 2N75A 3C5VA 2BBWA 4LTDA 4PCAA 3K9WA 3RJ5A 1KDZA 3U4AA 1FP4B 1TYDE 2KS6A 1X7DA 5K8TA 1SB9A 3R23A 1RS0A 2O2HA 1ZL2A 3KSDO 5DTQA 4Y2VA 2OE2A 3WAGA 5CD1A 4BZZA 3GT0A 4UMEA 3R3HA 3CWZA 1ZBQA 4BQPA 5JEDA 1RKXA 2FEPA 2QRLA 1SXGA 1T8PA 2MMGA 4RPKA 3Q5DA 4KMMA 1C4OA 3CZCA 4WPGA 2MIIA 5FNVB 2EERA 1BCSB 3UK7A 1W85A 1N0HA 1XQVA 2QIOA 1WZEA 3DW1X 3CSSA 3HGTA 2FPKA 4JXJA 1CDDA 2QX7A 4DR4B 2LXNA 1WETA 3G2OA 1O58A 2ZB3A 1XQ1A 3BXFA 5BOSA 1W93A 4IDGA 1AKUA 2H2GA 2OMKA 4GX1A 4KQ1A 1V35A 2HWKA 3DVLA 3NTUA 3WL5A 5LZ2A 3K6SB 2O6LA 1G42A 3N0WA 2AFHB 2H8GA 5KYTA 5DX1A 4I2NA 1RMQA 1FFCA 1XTRA 3W05A 4BDTA 4NS1A 4L4SA 4MV4A 3V7YA 4B43A 3H9JA 2PYDA 1OX5A 2OCIA 3IQIX 5J4KA 1H8EA 2Q4TA 1A8SA 2CXHA 3MB5A 4TMVA 1WW2A 3JQ9A 1Y1QA 4UBOA 1T9GS 3FVVA 1QV7A 1QWSA 4QX6A 2RHWA 3QM1A 1KEZA 3T3IA 3FTNA 1U3UA 1V1MA 2RGWA 2F4NA 4RMNA 3SFVA 2ODNA 1Z6GA 3EVNA 4BQFA 5L7WA 3OE7A 1JALA 5FPSA 3CTMA 5CDYA 3HEBA 2RGDA 1GAQA 1GZ7A 2P2ZA 3P19A 4FB5A 5LIPA 2WU0A 4UVEA 3L79A 1Q7BA 4EEZA 4D3YA 5HKKD 4LWOA 1C4WA 4JLNA 3SHFA 3FTEA 1BHSA 1QQTA 1U5AA 3OVMA 4KGXA 4KB5A 1QIJA 1ZNZA 2NSLA 1EGMB 1XZJA 2ACEA 4KHZA 3WTBA 1RC8A 1N2GA 2Q2QA 2JIZD 4KIFA 4M1MA 1YD7A 4RXMA 3V4PB 1UL1X 2KB0A 4XASA 4K6GA 3WL4A 1AOXA 4HTFB 4FNOA 1G19A 5AVJA 2Q5CA 3E3MA 1X87A 1GLVA 2QRVA 2W6JD 4I9GA 4KDFA 1AN0A 2FEMA 4KN8A 1SRRA 3RYCA 1CY0A 1DIHA 2VYQA 3FPCA 5GIPE 3H5NA 3JWPA 1HFWA 1ADJA 1YR1A 3EGDB 1SOMA 2WFLB 2YYAA 3EOZA 3MINB 4L9WA 1ST3A 4YI3A 5BN3A 5BWLA 4DLUA 5D5PA 2EEPA 3H4VA 1JDNA 4NJOA 4XKJA 3FUCA 5JCJD 1GZ5A 2RDMA 1GL3A 1DC4A 2VDMB 2BWJA 3BFPA 4HQ6A 4TQGA 1MJNA 5CDFA 3N3AC 4HAXA 5JJIA 2FZVA 5AVZA 1FX0A 2VRBA 1N5MA 2EIHA 2OOSA 3JQPA 1JECA 1FIUA 1LPOA 1V1JA 5E3JA 1AK1A 3AF0A 4E6PA 3B3AA 3PC2A 5K8LA 4RJIA 4LZWA 4MQBA 4WGFA 4KREA 4GSLA 4NCXA 1F6BA 4IGIA 2YUIA 2ECPA 5AKLA 1W25A 1TT5B 4YXWA 4BFTA 4GX2A 5JSHA 3B3QA 3C5HA 4F1KA 1EA7A 3G2NA 3U81A 4GMKA 5ALXA 2WINI 5DGCA 1FYFA 2JD1A 1S5PA 5ALFA 4HZUB 1TI7A 1ESCA 2OLJA 2QTVA 3AKDA 4GBED 1P5FA 1EFRD 2D7DA 3PCXA 3TBFA 3DFZA 3CSDA 5F3RA 3WRVA 3OD5A 5C5CA 1PZFA 2UVPB 4D4MA 1OKKD 3C5CA 5JVDA 5EERA 5JMPA 1OILA 4KYUA 5CURA 3PLNA 5BSMA 1FMTA 1V6SA 1FK8A 4JXZA 3C6XA 3IHLA 2C9MA 1ZESA 2SICE 4G63A 1OXUA 3T9DA 2QROA 1K0UA 1UFVA 3NDIA 2O2GA 2Q3DA 4L8YA 4M37A 1F2TA 4RGQA 3ZQ4A 5A3QA 3RANA 5AW7A 4E94A 2F00A 1EE2A 2RH5A 5G3ZA 4D74A 3RTAA 4DLZA 2WF6A 1XROA 3R09A 3O90A 1BIFA 1D6NA 3AG6A 3H83A 2O3JA 4IKEA 5EMNA 3VRHA 3ZDRA 5A62A 2V6FA 3ESBA 5KOJA 2FUKA 2GNOA 3BXEA 3K0KA 3VJRA 4RZ2A 3EXFA 4K8OA 3UWKA 4QRDA 5CDGA 4P6VF 2ENUA 3I6MA 2UZ0A 3EULA 1XTSA 3O38A 1TXGA 2BV3A 1PWHA 2PKRA 3EGWA 4EO4A 5I7SA 2R1TA 1PEKE 1L4BA 3COYA 1NM5C 2AT1A 3KU1A 3OKFA 2YFYA 1CY4A 4OGKA 2VUUA 3PQ2A 4OQPA 4RTOA 3V1NA 1N3YA 4AO7A 1U7WA 2P91A 1PFQA 2A7XA 4WEOA 5C3UA 5DM1A 1GQSA 1VPVA 4KZPA 2WUGA 5E95A 1I4LD 4EPTA 2AOUB 2GYWA 2ZP1A 2C31A 3FKQA 2VF7A 4D8TA 1T1EA 4NCKA 1CS0B 4TVSA 1TYZA 3K6JA 1JIJA 4DJFC 3GT7A 5CA1F 5I9MA 4Q6WA 3EQ8A 2PCJA 2HV9A 4C76A 1AG9A 1Q17A 3W77A 3CNLA 3P96A 3ZU3A 1DINA 2QJRA 3NP7A 4RIIA 5TJ9A 3O03A 3BDAA 4EFNA 5IM4F 1I5RA 2JLAA 4LY3A 1TPZA 2BBSA 2XZTA 4EDHA 2EP5A 4FXOA 2ZXUA 5CFOA 2OO5C 3FCSB 4UAUA 3QFHA 5KMGB 3EGOA 4FDTA 2CHFA 2DT5A 3ABZA 4MX8A 5D3QA 4HATA 4JVOA 1EX6A 4BOYA 4RU1A 4D9JA 5B7PA 4YECA 3SZUA 4DR6B 1EXVA 4CEJA 4YV1A 3TTYA 2XMPA 3B20A 1LBIA 3WLOA 3OKAA 4JOSA 2QUZA 4M36A 1C0EA 4IV8A 2BFDA 1Z4PX 3QBTA 1JQEA 1PJRA 1D6JA 4PLTA 1CTQA 1ONPA 2BKLA 3HVHA 5LLDA 3KQVA 4LX8A 3ZLBA 3WGIA 1ISIA 1NLUA 2P4QA 4JLOA 4PBTA 2YJ6A 1WXFA 3PRJA 4HP8A 2GZ1A 3HSSA 5A5EA 3UMYA 4ZRNA 1Q1ZA 3ZD8A 3H99A 4NCHA 3WFIA 2E0IA 3RGWS 1E4VA 5G0UA 1XCOA 4GMXA 4ID3A 2XWSA 2A0UA 4M46A 2ESRA 3IB6A 2PRKA 3NBFA 3SZOA 3V4ZA 5JXJA 1NP3A 1DKUA 1ENPA 3BBLA 2GKOA 5JFGA 2QZ9A 1CP2A 1BDJA 2E4YA 2P2GA 2J7KA 3AR3A 4DLPA 1LFDB 3OURA 1VLHA 3OY7A 4UDNA 3GP8A 3TL2A 4QL3A 3R6GA 1E8DA 2ATCA 4CKWA 3IIKA 3W8FA 4EENA 5LZ4A 1JPUA 2JHFA 3PUXA 4QT0A 2OA0A 2IYVA 2WVGA 4LY6A 1NG9A 4MWZA 1AU9A 2FSIA 1SUFA 2Y67A 2GVZC 3KPVA 1NSTA 1H5UA 1L3CA 5EJFA 2NV6A 2ODEA 3GT4A 5IMSA 4OXIA 2XTZA 1SBTA 4Z0NA 2HMUA 2QVBA 3IEXA 5A4FS 4LZLA 5EMHA 5KMGA 1T4CA 3MWKA 4HNUA 5B7GA 2EU8A 3RBAA 3S8MA 5KYWA 2ZQYA 4HJXA 3LL4A 3UY4A 3KPWA 3BMQB 1A3CA 4JC8A 4M6WA 1V7PC 3AR6A 4W1SA 3PQ7A 4LZAA 1T1JA 3L01A 5LQNA 3CH7A 1TJYA 1TLFA 1XEWY 2B94A 1GZVA 1YK1A 2WG2A 3ONNA 2H2HA 3KCNA 1PR3A 4A2PA 1NI4A 1P3Y1 2FEXA 4IMRA 2W5UA 2ZLBA 2GHIA 4IXMA 3TLGA 4BFYA 5FPTA 2NUBA 1EBFA 4CHTA 5A5GA 2WV9A 5JZMA 5KYGA 3N2GB 5TMEA 1L8XA 2SCUB 2QUHA 2RFLA 3N2ZB 4OHCA 4UBIA 5HG0A 1XP8A 2AN4A 3WB1A 4B3FX 3Q40A 1OZGA 2FR1A 1LW6E 3QW2A 4Z1OA 4FBGA 1IM2A 2PX2A 4JNKA 5T64A 3T3GA 4KPUB 1W1IA 5ELMA 1GGFA 1XKQA 3EGXA 1GSIA 2PD4A 4G5XA 4WKCA 3H2IA 2XGSA 5CT8A 1FOEB 3JD2A 4WZBA 5JY6A 5IS2A 1KO1A 4Y8VA 2I2AA 3FCEA 1CQPA 3K94A 1XLTC 3JPWA 1U9JA 5E1OA 1PL8A 5I47A 3BHMA 5AOCA 1PNTA 4FFRA 2CNDA 2IHJA 4LSMA 3VAZA 4EX6A 5H02A 3ABQB 1MRNA 3PFGA 4OJQA 2EGGA 1NWHA 4H0FA 4WOCA 2NUTB 1DKRA 1TOAA 5E1DA 5F1KA 3X1KA 3B2NA 4B74A 1IBSA 3PYLA 4HXFB 4KN5A 5FBVB 2EBUA 3ETNA 3LSYA 2GM5A 2H4WA 3A27A 3BULA 2ZTVA 3L7CA 4G2TA 4QASA 4BGIA 4MVJD 4DZTA 5DGXA 4JL8A 1SU8A 3O4RA 5I4BA 5KREA 2Z5LA 1RU3A 3WQHA 5CFNA 4K1LA 1YOBA 2XUHA 1R0LA 1XZPA 3LXMA 4HDOB 4MW6A 4PEVA 4DM3A 1JKIA 3KTAB 5H9WA 1B8NA 2CE7A 5BXYA 2AG6A 1QF6A 1JI0A 1XAIA 3K8YA 1UKCA 1E3EA 1NE7A 3IALA 2HGSA 2W8BB 2XKKA 3N6XA 2A67A 3BSFA 4WLUA 1PHRA 3MCUA 2DLDA 4HZUA 3GLIE 4DC1A 2FU5C 3P20A 1TQHA 3MIIA 1PG5A 1Z33A 2HH9A 4FYYA 4H0NA 3VPDA 3KQHA 3DKRA 4JELA 2A35A 1QHEA 3AVTA 3QZUA 2OBMA 2RH9B 4B3GA 4XE5A 1U4OA 4OM7A 1EX7A 4NU6A 4W7IA 4QTZA 2HDNB 5CCEA 4V39A 5B5SA 3TGLA 1YBHA 1Z2DA 4HWPA 3GCXA 1T3SA 5E9JA 3L1KA 4JJ7A 4N1AA 3A26A 3LZ6A 1AA9A 3BXGA 3DCNA 2G9RA 1PYGA 4MIEA 4X61A 5FEMA 5CFPA 4WUTA 1UODA 4R9UC 3ZQ6A 3EPKA 4C43A 2LIVA 1E3WB 2A9VA 3ANTA 3HWWA 5BN5B 1T4DA 1DZIA 4KL8S 2CXPA 2V7VA 2AFIA 2V7BA 3LQRA 4YO8A 4F2WA 2C00A 2GK6A 4B17A 3FDFA 2WU8A 3GHYA 3A7EA 1HDOA 1M10A 3IAUA 2B4TO 5KHAA 1AV6A 2ZRPA 1K8RA 1DMSA 2YWBA 1AZTA 1DCKA 3WY9A 1CUJA 1LFAA 1DQZA 5J5VA 1M3SA 1NAIA 3ZCPA 1NVAA 3E35A 4J3NA 3TW0A 4QPPA 4C1BA 5L9AA 2NSYA 2CV0A 3H1TA 1TDJA 4REQA 3ECSA 4TKVB 2PX4A 4LN1A 4UDYX 1UPXA 3MJDA 1T36B 1Q91A 1RWOA 3ASUA 4E3ZA 1P1CA 3SICE 3WZMA 4MUGA 1HDCA 1PJBA 4BY9E 1LPPA 1WA5A 1Z6PA 3N7TA 4PCUA 2AEMA 4ANFA 4E5DA 4JOQA 4HZGA 1EP9A 4LXXA 5CLIA 2XB8A 2I6GA 1XG5A 2AUNA 3CUSA 3TJZA 3W5JA 1EP1B 2VRNA 4QPCA 3MT0A 4A4DA 3V9PA 5IARA 2HOQA 2R8YA 2QE6A 4BMXA 2C4WA 3KE8A 2QVYX 1TUGA 3RK0A 4CM6A 4RQUA 5TPZD 1QXSA 3VC1A 3ZH9B 2Q0SA 1E79A 1JEQA 1M1UA 3EDMA 4XPIA 2AXPA 2FSFA 3CR8A 2NM0A 4PSKA 1KL7A 4QWWA 3FJ1A 3PPIA 3QI7A 2JJ2D 4TV9F 3LWBA 5JO0A 4ZU1X 1DAMA 1P2VA 3ZOKA 4ZANA 4FC6A 4W5HA 1I0ZA 5BNFA 3T95A 3DMTA 5IJZA 2NU7A 3G2PA 4J90A 4EPWA 1GFWA 1OGIA 3ZKWB 2GPWA 2HA2A 1RYDA 3H8VA 5TJHA 1KMMA 1RBMA 4DHWA 1C1XB 4DAOA 4IZ6A 1PD0A 1RQGA 3ABIA 5D1HA 4EG6A 2VYCA 1V25A 4IRMA 3S27A 4YUYA 4DSZA 3PDWA 2NO7A 3I9LA 3QEJA 3AHIA 2HPHA 3PNQA 4Y2QA 1R12A 3SS9X 3U7JA 1LDBA 3FWYA 5E2AA 2XCRB 4BUJA 1DO8A 1DCTA 4AXXA 3F5DA 2X8LA 1TM4E 3BKXA 4EA6A 1L4UA 1UZMA 4ENSA 3FWZA 2CVPA 1JLRA 1SQ0A 3M4ZA 5ALJA 5B1EA 3GLFB 2I66A 4HNSA 4B2PA 3PDCA 1B0UA 1JT2A 1HLFA 1MV8A 1GR1A 2KQUA 4AI6A 1X9GA 1VPDA 5JH7F 1EUCB 3R8XA 4RSHA 3SSMA 1B6RA 5K0EA 4EY7A 3PIRA 4F97A 1Z82A 3T12A 4AUNA 4AY3A 2VKQA 4HYYA 4G6ZA 3RFVA 1PRYA 1FP4A 4GUAA 5JSYA 1RRKA 3Q1KA 4CT5A 1T5OA 1K3FA 3LC2O 3OQNA 5E8JA 2VQEB 4L5YA 2ORVA 2CB0A 3W2GA 4DLTA 1NJ6A 5I01A 2GD0A 3B9RA 3PNPA 4NZOA 3I4CA 4EIWA 4YRKA 2HF8A 1YI0A 2EG9A 4MV7A 1STOA 1FYXA 3E9MA 5THKA 1NJFA 1URPA 1X7YA 2J5KA 1ZW1A 3GJ4A 3JASB 3MTDA 4BBPA 4EYEA 2MR5A 2OCXA 5B7QA 5ICGA 1ENYA 2XTNA 2BRUA 5FOSA 2FFQA 3AV0B 1BROA 2PBLA 2JI7A 5KYWB 5JD3A 4M7RA 3IBGA 3ET5A 3RS8A 2C7QA 1S8OA 1WD7A 1Z8DA 2ILVA 2CJWB 4GG1A 2PRJA 4XQCA 4AVYA 4DVJA 1II0A 4ALIA 1OLUA 2HHCA 2ORED 1GR0A 1BWPA 4WMLA 1XMXA 4WUVA 4Z9FA 4D8UA 1ZXXA 4DSNA 1YJBA 3LTEA 3LT2A 5AVXA 2BLLA 3SS8A 1NXSA 1WEKA 5FBQB 3L6EA 1G9TA 4BV2A 2V9ZA 1HNWB 2FH5B 3GOHA 4E31A 3GGOA 1CUAA 4BMYA 5TMDA 3O93A 1UMCB 4GRAA 2Z9DA 1MP0A 1OAAA 4RK5A 2Z6AA 3X2EA 1S2NA 4OP3A 1IN4A 3AJEA 1A9YA 2AMYA 2HRDA 3EPHA 2D62A 2E21A 1AUQA 2HDWA 2TYSB 3QOYA 2FW6A 3KUKA 4BNVA 3I23A 4I50B 4AT1A 4GOLD 3VJMA 4OI2A 3AFHA 1TK3A 1V9LA 1YJCA 3C8ZA 1NUPA 1RQ7A 3K09C 5T41A 3VBEA 3FPHA 1IC6A 4IIJF 3JVEA 4Q9AA 4IDDA 4M0FA 3RSZA 1DC6A 2AQIA 3LUJA 5COAA 3ZDCA 4G07A 1TTPB 4D98A 5EHXA 2V6MA 4QAQA 2JCBA 4GSKA 4CTOA 3A1FA 1OXTA 1OGYA 1VJGA 3MS7A 1HX7A 4A2WA 4DILA 2G9ZA 1S8AA 4KN9S 4LISA 2BSQA 3JQ8B 4ZPXA 2R6JA 4OXQA 3TTWA 1LWNA 4NULA 4AX8A 5K0JA 1J0AA 4Q9LA 1PF7E 1O94D 3ZDBA 4XB2A 4HVTA 1T1IA 1GFZA 2WFMA 3G5AA 3H9GA 1EK2A 4CG0A 4YCAA 3WR5A 2VH5R 4LBZA 4DR3B 1PR6A 4L1KA 5IEBA 4TTVA 2FCRA 2X4GA 1RAAA 2IOFA 3CX4A 1P6QA 2XF8A 2XE7A 5IK2D 2XMGA 3MTIA 1C3EA 3WGMA 2XCUA 2C04A 2FN8A 4LY9A 2O7NA 3MS2A 3PBKA 4JR2A 2J08A 5JEEA 1RCTE 4OQXA 1W4CA 3W8NA 3U61B 3QNMA 5M29A 4AWXA 1YVEI 4G8BA 3WRYA 3PGMA 1XRRA 1GCAA 1K97A 5CFMA 3E1KA 5JHHB 3AJ9A 4RO0A 3KSAC 2C4HA 5AKIA 3BH7A 3RRMA 1XZEA 3CRQA 3TVDA 2OHIA 2WM8A 3S1AA 2EGUA 4Z99A 3NZEA 3VYWA 3ZNQA 2HK7A 4NMHA 3DMPA 5DT2A 5FD8A 1TIBA 4HDNA 4KFRA 3NUQA 3WL3A 3A6PC 5DXAA 1PT8A 1T0HB 5EIFA 3G7NA 4AECA 4RADA 4DCMA 1EWYA 2A5YB 4MTLA 2QYSA 1R0RE 3TI9A 2ZBEA 3GDFA 4RHCA 1DEXA 1Z2OX 3F49S 2O7QA 4HQFA 1WPGA 4IYRA 1LB1B 3HVUA 1FVHA 3M49A 1WS6A 1XTIA 4MWGA 3CY6A 5TR9A 2GXQA 2IUTA 4KUHA 3MYRA 5FTMA 3OZEA 1AX9A 2E4ZA 1EVZA 2YWRA 2ZRNA 3MUEA 2W2PA 3IRUA 1H9BA 1RKBA 1XU9A 3BREA 3R3ZA 5AJXA 5HUQA 5JALA 1UBUS 3B5JA 2RJOA 2AG5A 2Q8PA 3O83A 1NTRA 4TXMA 5JCOC 4KLZA 3D5EA 4RESA 3WLAA 1OFIA 1ZA1A 3PUYA 4DV4B 2ZJAA 4XSHA 4MQLA 1N75A 1SK8A 5EY5B 3QWAA 3RIXA 3QU7A 2JH8A 4MOWA 2AN3A 2VJPA 2Z98A 4PLCA 1XP5A 1CUYA 1AD2A 1MHPA 5CMLA 1Y3DE 4D5GA 1Y48E 1YZGA 5J4HA 4YJDA 4L3WA 3DB1A 4H3KB 4LE0A 4R4JA 2CN1A 3LHSA 1PR0A 2C1EA 2SKEA 3SX4A 1GPYA 5CGQB 3ZVKA 2NLOA 3UAWA 1A4UA 1WCIA 3C14C 4J7XA 2NVUA 3W5HA 1UJ4A 4YI5A 1JZTA 4PYLA 4NTZA 3URMA 1DXYA 2RD2A 1MVLA 3EFOA 3IA7A 3JV7A 1C0IA 3TAUA 2B8NA 2VC2B 1N2IA 2O14A 1UZAA 2Y1CA 1J2YA 1WMSA 3LUPA 1SXJC 3VQTA 4IIJB 1NXQA 4JJ6A 3OFSA 2NTVA 5KTYA 5AYVA 1FX0B 1IQRA 2EV9A 3QLTA 4QXRA 4ZN6A 2BFCA 2HSWA 5BV8A 1Z8HA 1CJTC 1SOWA 5HZGA 4O6VA 4OFBA 4HV4A 3HHPA 1G17A 3KAJA 3BEOA 3D5QA 1CFJA 3D6HA 4NP6A 3RTEA 4WE3A 3A9VA 1OA1A 2XV1A 2Y6UA 4MITA 3G59A 3NUZA 3BB1A 3TXAA 1NRWA 3HBFA 1AM4D 3QXGA 4W63A 4YAIA 3PDUA 2PJDA 1Y3IA 5JAHA 3ZXUB 3WB9A 3BSSA 1G3UA 3MD9A 3SBOA 2IU0A 1RCFA 5ALQA 4Z4GA 4N5IX 1F8YA 5HCIA 2QVGA 4WN3A 1KOLA 2QVZX 2YY6A 3A4VA 2AFVA 2AMFA 4KMOA 4GL2A 2ZETA 4TKVA 3QKIA 4QNMA 3HV0A 1GV0A 2BCGY 4U9UA 3SJCA 4BNJA 2DTDA 3MQFA 3AUXA 4JI5B 3CF4G 5G40A 4NXMB 1XZGA 1U7DA 3P32A 4YC7A 1U5BA 5JADA 4OXYA 3C7CB 3CBQA 3UGJA 2G25A 3OUUA 2FUEA 3HCCA 4YUZA 5ALHA 2JBAA 5KIAA 1GNPA 2PUFA 2JCVA 2VRWA 2ZTUA 4TMXA 5I8ZA 4HLQB 1CYDA 3IX7A 2OFFA 2ZYVX 4DQUA 5KO2A 1WKBA 3N58A 4HGZA 4JJ8A 5IANA 2ZAYA 1KJJA 2KSQA 3FCAA 1U63A 1RWMA 3ZXIA 4GDMA 1WEHA 3I2JA 4LSGA 5DHFA 2WQ7A 2R66A 1SU6A 1QHHB 1K06A 2VT7A 3H18A 3KLMX 3K0EA 3CSUA 3P2JA 2CEKA 4YUWA 1YR8A 2W2LA 3NETA 3WWZA 3NDJA 2WTEA 1EQ2A 4LJ9A 4F4DA 3RHSA 2QN1A 3MJFA 3KR9A 5I7UA 2H48A 1KARA 1E2QA 2FA9A 2JD0A 2R7LA 3FNIA 4FFLA 1R9JA 3CRRA 5FCDA 1U04A 3WGUA 8GPBA 1XRNA 1NX9A 3K6SA 2C8JA 5C0OE 1Z63A 1XZHA 1JTVA 4BBJA 2XNCA 2CWDA 5IASA 1HMPA 2AJBA 3AJDA 2VNSA 2ZUVA 1NQOA 2YFQA 5B4UA 3B3JA 2QN2A 3HZRA 3MF4A 1PGNA 1S8FA 4RJKA 5SV2A 4DRXB 5C1DA 2J3MA 1KJIA 5BO5A 3OZRA 4BWYA 2OM2A 2WU4A 4F6CA 4UXHA 1LF0A 3LLVA 4XVQA 4YDRA 2VHZA 3L05A 2R1UA 4ZDWA 5L40A 2I65A 3KQSA 2BT4A 1RXIA 1Y7IA 3TLBA 4PANA 1U98A 2RGEA 2W58A 1COWD 2CJPA 2XGOA 2PVSA 2V74B 3LHDA 4KVZA 2XHZA 4LBWA 2XCOA 3THSA 4F9EA 1D2MA 1YVRA 3QSGA 3C70A 4BJHB 5DT9A 2FR8C 2C5GA 3AIMA 4UE6A 4BJ1A 2NOAA 3B2EA 4HSGA 2GEDA 2YWDA 4HRYA 3F8SA 1OBFO 4MB0A 8ADHA 3ZD7A 4AQDA 4X1IB 2R6HA 2XQJA 4DLRA 3HJAA 4F7DA 1CJMA 1V11B 1ZOOA 1NN1A 4J1NA 4Q37A 4WEQA 1TZBA 2VEOA 3V7FA 4LRTB 3X1ZA 4N6NA 3SHTA 3I2FA 3ZNOA 3ZV7A 1TEZA 4Y9DA 2YTZA 2FG5A 1HDGO 1SQ5A 1T3GA 1P4HA 2B2XA 3D43A 3EVCA 4D3DA 3V1KA 4EW3A 4DCCA 2LUOA 4LHEA 1L3BA 5INTA 2XH8A 5KQGA 2PXHA 2BBTA 5D00A 4OAPA 4NZNA 3N2GA 4AZWA 3H5LA 2VXCA 4M7PA 4AWBA 2WHQA 2X14A 1PT7A 4X6XA 1W1WA 1XZBA 1D6MA 3KOWA 2FE1A 1E5DA 1DVRA 1G6HA 1K3UB 2OGUA 3D7MA 4F04A 1NVDA 3UAXA 1Y8CA 2NW6A 4LRQA 2EARA 5CLHA 3S5UA 1W88A 1GZ4A 2ZJ8A 5LBUA 5EUBA 2Q4BA 3OPVA 2BFWA 2ISQA 2NXEA 3D8HA 3SC2B 2WJ6A 3DUFA 1KY5A 3R7WA 1ZH2A 5LNK1 3TFQA 3MLAA 3OSZA 5IKOA 5HMLA 3U7QB 2FDRA 2J4CA 1CJBA 4PZLA 4ZVQA 1KK3A 4AS2A 3O82A 2OESA 4XCVA 1N6NA 4JBHA 4BX2A 4QELA 2A57A 2BDTA 1G20E 1RYFA 3HP4A 4G5YA 5AVOA 2JJ1D 5GPBA 3WJ7A 3L4BC 1BXGB 2EL9A 2Y68A 3ELBA 4NIMA 4WK6A 4ZODA 3ZGLA 2OBFA 1OROA 3KZNA 4XGRA 2GT1A 3CF2A 4NZMA 4KO8A 1LV7A 2NZJA 3JQ8A 1Q74A 2UZ3A 2NYVA 1R4AA 2FQXA 2N9UA 4BNGA 1JP7A 2DF8A 2OVFA 2QDXA 4BGUA 1Y7HA 3T54A 1U0HC 1I13A 2P5UA 1FRNA 1MIOA 2ATIA 5DW3A 1AF7A 1UPAA 4FHCA 1NVWQ 1VLVA 1LBQA 3DFUA 4XGIA 1XMPA 2IP2A 1NR1A 4RS3A 5T4HA 4L5IA 4DRYA 2W93A 1SKMA 2X0RA 4BNKA 4UBMA 5AVKA 5IYZB 1NLYA 2CHQA 1P4JA 3HDHA 5DNVA 3LHKA 4EZBA 3VVLA 2HU2A 3TRJA 1Z5OA 1B1AA 1J42A 1F4LA 2B35A 3OX2A 3S40A 4K0KB 3Q7QA 1FUKA 4HT3B 1V1RB 2I4OA 2QD4A 4M99A 5C8VA 1G4AE 1EFUA 3I9V6 2C42A 5KKNB 3DWIA 4TN1A 1UKBA 3CG0A 4F56A 2Z2IA 2FN9A 3E3AA 3GLTA 3K4HA 4OJKA 4ZAZA 4DMKA 3M1IA 3PJRA 2I2BA 2IY9A 3FI9A 1PSZA 3TX2A 3HADA 5BRJA 3H84A 1QDLB 1Y8QA 2HK8A 2P27A 3EA0A 4QBHA 3VC2A 4H6WA 5BXQC 4MCJA 2B4QA 2VF5X 2BFFA 3D8BA 3NKFA 4WKNA 4CM8A 4CQMB 5AUOB 3T41A 2WPDD 4LC9A 4BYGA 2AFRA 3NBXX 3O4IA 4DKXA 1SXHA 3W2EA 2LNDA 3PUKA 3QIAA 1YVPA 2GEKA 3RARA 4PPNA 2HMAA 1M5UA 5JC8A 2X77A 4ZQIA 1A1SA 4GVPA 4YRPA 2O0JA 2NACA 3GRCA 4Q4HA 1NMEA 5HQ3B 3LYLA 3NT5A 5JZOA 3AQIA 4U7WA 5B3JA 2G1JA 2OAQ1 4DCOA 3LBNA 3F7NA 2Y1KA 4ZAWA 2R8OA 3NHRA 1M8JA 1H93A 3EQ7A 1IHUA 4O33A 4JC4A 4RM2A 1R50A 3MGBA 2HF2A 3VR6A 2UXBB 1RP1A 1XEXB 4DQLA 4E08A 1AQ6A 2JJ2A 2WF5A 3K2IA 1WDTA 3RAFC 4PWZA 1QV9A 3BMXA 2Q1TA 5HQTA 1QIHA 1Y8AA 5LL6P 1DAPA 4PPYA 2JC3A 2Z08A 4B4VA 4QO8A 2R1TB 3FYTA 5HIKA 3MAGA 3NC0C 3NV9A 4U02A 1JA1A 2PH7A 3OM0A 3R74A 4O4LA 3VNSA 2F17A 3WO1A 1P0IA 2C5AA 4NYIQ 4PO1A 5CLLA 1BH2A 4BMOB 1TMYA 2JGFA 3QTLA 1ZHOA 1FNCA 2AI2A 2ATEA 5JS6A 4MEBA 2JARA 1KDTA 1OXMA 1ZIDA 3A1DA 1O0CA 3ZK9A 3W9SA 3D2AA 5GVSA 2W2XA 4G4SO 1SO8A 4DT1A 4E12A 4JCCA 1EMDA 5GONB 4G3XA 2QYHA 2CLCX 2B82A 2OC9A 2BMJA 2ZULA 1ZISA 1Z5NA 4ZAVA 2J4DA 1JFTA 3L6OO 5TGTA 3ZZMA 2AI3A 3K0SA 1TQ6A 1FXUA 1VKRA 2X9NA 4TZ6A 4MLCA 4DZZA 4QIHA 1GQQA 3CRVA 3GH3A 1ECFA 3V7NA 2QV7A 4LXTA 5K3FB 2JLVA 2RAFA 2C95A 5AMXA 1J5XA 1DI0A 1ZSYA 1ZY2A 1FDOA 2VQDA 1KVRA 2X6QA 4FWIB 5SYMA 3RV3A 1X1SA 4QT4A 3M83A 1Y7PA 3OCCA 4D46A 2MTBA 4CFYA 2QE7D 1VQ1A 4CLEA 1IN8A 5CCDA 3I9OA 3UWOA 4DJAA 2XNDA 4ESEA 2VTBA 2ACKA 3OT1A 4QYSA 3QFTA 5LZ9A 4E70A 3HJBA 2QQ0A 4UREA 3U62A 3D3NA 1BN6A 3PC8C 1C9KA 3I6BA 3WK4A 4OJTA 3ZYCA 4KBGA 1FMLA 3CZRA 3IH5A 4P4UA 3R1IA 3ZW9A 1UXKA 3USCS 3UATA 4JMLA 5AW2A 3CRZA 3CCCA 5T8KA 1T5LA 4PSVA 5TS2A 1JAHA 3GEIA 4ILEA 3HVIA 3EVGA 3HFGA 4OB6A 4JDPA 2EYQA 2G1PA 2A4MA 2RI1A 2WI8A 3HZHA 3DMGA 3TXXA 1U6IA 3P2YA 2VFAA 5A0FA 2F1KA 2GYUA 3DSRA 1ZRNA 4GRDA 3KBOA 4C0AC 2BE9A 4R40A 3QLJA 3TSOA 2FEAA 3NHJA 3P2EA 1HDIA 3DQZA 1NW9B 4HWRA 1FLDA 1PR9A 2QTFA 3TNDA 3U16A 3HJRA 3S29A 4R6WA 1JFFA 4IUBS 1E7MA 1JKFA 3TZLA 1WHTA 2R8PA 3AXSA 5ALDA 5L95A 2NIPA 2VJAA 4D8XA 1XJ5A 4JQSA 1XXLA 4DV1B 2WJJA 4DRZA 4Y0AA 3SM3A 4FNAA 1QWOA 2VWHA 2VF4X 2AFIB 2HJGA 1INLA 2VSXA 4UUQA 4Y6GB 5IC5A 2Q2NA 2QEQA 1M67A 1TKAA 2FQWA 2K2WA 1X7GA 2XF2A 3DZ8A 3LNTA 4JA0A 1ZITA 4KGVA 4Q48A 4YFVA 4EATA 3VV3A 1SUWA 2AVDA 1BQ4A 5IJAA 4PN7A 1CIPA 1NUTA 3IAXA 4GKVA 2N1MA 3BB4A 4QHTA 3PXUA 4MR9A 4LTMA 2AEEA 1KZGB 4D0LB 1HQYE 2PZGA 4PGAA 1MB4A 2V4ZA 3NEAA 4PS0A 1GZHB 3K1YA 4QTXA 1VJDA 3FVQA 1W36D 3QE0A 3DOIA 4OU4A 3F1LA 1KP3A 2OV3A 3OJFA 4QE3A 1K5PA 1RABA 3E48A 5B12A 3OT1B 4RUKA 4Q7KA 5C7OO 1OIWA 4HH3C 1SB8A 2H1CA 5LQUA 2VJKA 1G1MA 4HEQA 3E0XA 2DBVO 2Q3LA 2WQZA 1E18A 1UDAA 1GKLA 1BMQA 5ILQA 3B85A 3JZFA 3WMFA 1RFLA 3OLYA 4V0LA 3E61A 3N2KB 3STHA 3T0GA 5CK4A 3WLMA 3FSGA 3ILSA 3SEZA 2PCLA 3F96A 1GT91 3BL6A 3KLPX 2N3ZA 1IIBA 4Z9BA 3E23A 3EX7C 1KEEA 4NLLA 1ARZA 1WQ4A 3DOJA 3OETA 4I6JA 3E9YA 2B25A 2DFVA 3LPCA 4HWSA 5C4MA 1QANA 1BNCA 2GWRA 4ZOLB 3FBGA 4HOYA 1JIXA 1NBEA 2ZI9A 2EZ8A 1QO9A 4FCWA 4HTAA 4YJ2F 1LGYA 4J0GA 4BMSA 3GLFE 3QLVC 4PG8A 3AUKA 2JKYA 2XI4A 3KU4A 2ZT7A 3NG1A 4LRYA 3EGXB 2CNWD 4HUTA 4N6GA 3ZHQA 1DTWA 5LCXA 4CMIB 3C1UA 3RE1A 1KJQA 1OX4A 1YZ3A 2XSZD 3O3NB 4NABA 4R05A 3IIMA 4Y2JA 3FNHA 3O3CA 5E7JA 2FW1A 4ZICA 3LH5A 1F06A 4FONA 3TIGA 1YA4A 2XZLA 3MRXA 2QPOA 3ONWA 4NZYA 3UWPA 4P36A 1FPMA 4TMTA 3MT7A 3SF8A 2HCRA 3INGA 1LS6A 1KU0A 5T3YA 4MGHA 3LA6A 1EI9A 1XPJA 2IODA 3W34A 4A0RA 1RW4A 5IFLA 10MHA 5K0TA 2EP7A 2QP4A 1F14A 2XDYA 4PYOA 3HCRA 3UB4A 1BJRE 2A6PA 1O4WA 1J06A 1FSGA 2VUSA 3U4QA 4R2JA 4EQ6B 3N8IA 1SCKA 2FUNB 4OHBA 1B74A 1ZK2A 2BFNA 3IQHX 4D0RA 3CT4A 1SBHA 5CA0B 4Q1DA 1SU7A 4DCGA 2OG2A 2AF4C 1P5ZB 4JI6B 5BURA 4DR5B 1Y4AE 3O9VA 4RTMA 1A9ZA 1FNNA 2RGNA 1EHIA 1A7KA 4KXYA 2A0YA 1DELA 3ISJA 5FWDA 2JVKA 5AHKA 3KOUA 1N1MA 2C88A 2HFJA 3O4GA 4KRFA 3WMWA 4O2AF 3DV0A 5DHAA 3WGNA 1HRDA 2HXYA 4NENB 4AKEA 3DEYX 5KWEA 1NDQA 2HWUA 1H4VB 1EFLA 1JJAA 2P6UA 4FBMA 1VJCA 2YY7A 4OB8A 3OA2A 4B4DA 1CUIA 2A3RA 4UVIA 3BWYA 3BIFA 4ZI7F 3C3YA 2VG8A 1JT9A 1PLLA 1PLKA 1G3MA 3IAEA 4J0CA 4PQFA 5EJEA 1X8KA 4L28A 5CT5A 5JAIA 4TMKA 5MN4A 3DXYA 3IMFA 3MCZA 1T6NA 2PO5A 1CRQA 1O54A 5E0OA 4WBNA 2EF1A 2HQBA 2C29D 2HMWA 3HM2A 5AKZA 5JAOA 3BQMB 3IT1A 1LV8A 4AZ0B 2GVDC 1IOVA 2RHHA 3BORA 5JBIA 3IL2A 2ZSAA 5B55A 4TM8A 1T3LA 3D8NA 1QCCA 5BV7A 4UHBA 2X15A 4IHJA 2H0RA 3ZWPA 3NHSA 4OCZA 1Q3TA 1CUXA 2EX0A 4CL2A 5KNLA 1E3MA 5G3YA 4BMPB 2I1VB 4DXAA 2J32A 1DCMA 2Z4TA 1RKQA 2BFDB 4ZGBA 2PJUA 2VJMA 1JR4A 2I8CA 4ODIA 5KYVA 5F7ZA 1DKOA 4ZT5A 1YJXA 5FO0A 3SNHA 4DV5B 1FU4A 2FB9A 2YUTA 1MJ5A 1W46A 4ZA2A 2QSYA 1ZCAA 1PQ4A 2P4SA 1VMEA 3FVRA 3RHZA 3ZGXA 1PUJA 4F5YA 1PFVA 2DFKB 2OL4A 1XEFA 2CLEB 1LDMA 2DH5A 2P68A 2GAOA 3B3FA 3F6BX 2XE6A 4CF3A 4FN4A 4WV3A 5GY7A 5C1IA 2H17A 3WLTA 3UJ7A 1QP7A 4E14A 3Q0EA 4BO9A 3RFFA 4J3FA 3TH5A 4AJ9A 4BKQA 5ALVA 4EY3A 5CDSA 3T8YA 1JKJB 4NARA 1OCEA 1XCGB 3MG9A 1NDHA 3KK0A 2AQ8A 1R2QA 2FFAA 2R6CA 1KO7A 1RJ9A 1WQ3A 3ZHXA 4HI0E 5C5EA 2JNWA 3JD3A 4ZXPA 3H1EA 3R5FA 1KSHA 3MILA 1LVGA 1GA4A 3O2QB 4P0TA 1YNSA 4YCBA 3UK0A 1ULZA 3UXHA 3ZXXA 4LOHA 4RTJA 1R9GA 1VKJA 1KI9A 2VJLA 3G3EA 3KBBA 2YV4A 1M8KA 2PZKA 1AQIA 2RONA 4IVPA 4IUYA 3BWCA 4LCEA 1RXCA 4WSOA 3YASA 3X0DA 4HWOA 2H7XA 4KNWA 4FM9A 3ASZA 3RS5A 1AK9A 4TMYA 4RYLA 4WD3A 3ZHUA 1PQUA 1JBQA 5JASA 1G4HA 3Q4GA 1IONA 1P44A 1V11A 2H59A 3FNBA 3FN4A 3PB3A 3E6AA 1RXUA 3SQNA 4DG8A 4AKHA 2QE7A 3IERA 3DMYA 3Q7EA 4QLOA 5F76A 3EZGA 4EB6A 2WZQA 2EWVA 1QFXA 1JLSA 2R00A 3RG8A 3SYLA 4HB4A 3JQ6A 4KYTA 3TEJA 2FFHA 5C9ZA 1IVNA 4NOLA 4CPDA 2X4IA 3IQWA 1CR0A 2HL6A 2PS0A 1GUAA 2UZIR 1DDIA 2ZUUA 2XMCA 1HOTA 2CZCA 4U3JB 3R9WA 3O75A 3HA2A 2YVAA 3IE0A 2XY4A 3JW8A 5K20A 1PN3A 1W0KD 5ED4A 1Z4MA 2WFAA 3GGDA 3BGIA 4W7HA 3DTVD 4ZQGA 3ROKA 1BQ3A 4KX5A 4P9NA 1T2DA 3V2HA 3PR3A 4E33A 1SXPA 4REQB 5JVDB 2O5VA 1PS8A 3IIIA 1E1MA 4GH5A 5GQSA 4DRXA 4MA5A 2EAUA 1HG0A 2PQ6A 4G5QA 4RQAA 3WO0A 1DRUA 4CU2A 2NO5A 2PWYA 2YICA 1JNXX 1L7BA 4KK3A 3R9IA 4D57A 1ICEA 3TE7A 4C87A 4US0R 1QB8A 3PC8A 1FDWA 4Z7NB 5A3SA 4TWJA 1GTL1 1XK7A 2OZLA 1QKIA 3CH5A 3I76A 1QG0A 3B6KA 3MWGA 3NH9A 1I6LA 4PFKA 5E9AA 4YROA 5K3OA 4JLUA 4IO1A 3FCXA 3Q3HA 2BF4A 3C39A 4FFVA 2Z2YA 1A8IA 2PDAA 5LP6C 4GBJA 4HLUC 4JT8A 1AKMA 2FN4A 1IIRA 2V5VA 3CNBA 3FKSA 1MEOA 2WUEA 3HRIA 5LZ5A 4DBZA 4BB9A 2EFJA 3FTPA 1BX3A 4CWAA 1J9GA 4HAWA 1PJZA 2FSPA 3UTCA 3HK2A 3EVDA 2N1BA 2H2IA 4DSAA 2BGLA 1YRWA 4B73A 1A9QA 1JQKA 3C16C 2NYAA 3HBNA 2G4VA 4HY3A 2CZQA 4LBYA 3U3ZA 1E64A 3ZX4A 3QMPA 3L6BA 2OK8A 5ESRA 5ADUS 4L4RA 4N5HX 3OJOA 4KQMA 1FTGA 1TLLA 1C0LA 1XYVA 1P74A 3BMNA 3FMOB 3DHEA 1EK1A 4JR0A 4ZK2A 3UB3A 1ZH0A 1M2KA 4RE5A 3ZWWA 3W78A 3SOPA 1TRKA 4U2BA 2HHAA 4EYSA 1JVBA 4IQ4A 4NBTA 4OH7A 1G8KA 3UXYA 3RUDA 5CEJA 4E88A 4UQLA 1XZIA 9GPBA 3UMMA 2QRMA 4MICA 3P9XA 1K86A 4P5PA 4K0RA 3BC1A 5B2FA 1N2ZA 3QOWA 2CVOA 2FWJA 4KGZA 1JEDA 1BMDA 1II8B 3CURA 4MHTA 1XTTA 1IEQA 2N42A 2C8VA 3JU3A 1IBLB 3VAAA 3RSCA 3MJ4A 2PXAA 4BXOA 4OX9B 5G4KB 2E1RA 1X15A 4BNLA 1JSCA 1KBOA 2WKSA 2J07A 4BO2A 1I7LA 4F9TA 2R79A 1H2HA 2C4KA 3DVRX 4N5DA 1B2LA 2IS1A 5CW2A 5A1TA 1VHWA 4YRRA 1MAVA 1FYEA 2A33A 3W8DA 3GZNA 2BH2A 1QS0B 3H75A 3NNSA 1TKBA 4D3XA 4LF5B 2OB1A 3VR4D 1CUDA 3MB8A 4Q4AB 1SBYA 4HN2A 3IQZA 2H5IA 4CODB 3TYXA 5D87A 4MQFA 4GM1A 5EJAA 3S2EA 1YBAA 3TSWA 1EDDA 3OOWA 3A2KA 2WYHA 2Q46A 2JGDB 2XB9A 4FQ5A 3MJVA 5GVRA 3QLEA 4I55A 2J87A 3S81A 1P2GA 2C92A 4MR7B 4V3BA 2YC2C 1A50B 5HGXA 1YCFA 4QEDA 4FMBB 3LY7A 4GLJA 4PQGA 2O59A 3EDCA 4IJKA 1NU6A 4FP9A 3U3DA 4QAJA 1ODKA 3H5TA 4B9EA 6NULA 1HTTA 2C3PA 1RYMA 3BIXA 3I0ZA 5LP1A 3TD2A 2GO1A 3HJUA 3KZ1E 2HU5A 3PFNA 1VI5A 2ZUSA 3INRA 4XEHA 3LYUA 2I8AA 3RIHA 1W85B 3E82A 1XJWA 2ZSUA 3TTXA 2ZDQA 5IWAB 2PZJA 1ZRMA 4JUDX 5AVQA 1G8FA 1I8TA 5KOIA 1SVNA 3T94A 2DERA 3PQ8A 3BHJA 4LNHA 1M2HA 3M3HA 4KXUA 1YRYE 2DUMA 4PYKA 4U39A 5C5IA 3Q8KA 1FSPA 2X0NA 3EASA 2GZHA 4AKTA 1USIA 4JQYA 3ZE9A 1N5OX 1UANA 2D0IA 3TLCA 721PA 4ZAXA 1YQDA 1VLQA 2OK7A 2YV5A 5BMOA 3KKZA 3DMRA 1BYUA 3EWNA 5D8DA 3GJ6A 1N2OA 4YIKA 3LQFA 1JHAA 5DHSA 5JRDS 4ENVA 2IYSA 3ETLA 3C7DB 2VJQA 2V7QA 2OR3A 4UZFA 2ZJOA 1F6WA 1FFSA 1FPQA 1WUIS 3EZFA 3HP1A 4LZJA 1XL1A 3RFUA 5G1OA 3TFOA 2ZBDA 2FP4A 521PA 5EJ5A 5FNVF 3MTBA 3N87A 2VDKB 3F7MA 3GGGA 3IUQA 1PGPA 3H6KA 5FA6A 3UEOA 2FW9A 1KDOA 3TCNA 2VNHA 5F1YA 1ECPA 5ALWA 4AZTA 2VWGA 1NUUA 3C3KA 4QGSA 2RGYA 3CFYA 2GJSA 3PFCA 4ZOQI 4QUDA 1Q7TA 4C0LA 2HCFA 2CJYA 4IIXA 4KVAA 3EWSA 4CLRA 5BQOA 1K3TA 3HUUA 1I0IA 1U2GC 4ETWA 1YULA 1MX5A 1ZIOA 3UHFA 4E15A 1DAKA 1V5WA 2GD1O 4B0PA 5CPBA 4DG9A 1Z25A 3KR2A 1UUFA 4UEKA 1Z07A 4MMZB 3GEMA 1JDTA 2J3JA 1OLOA 5AW3A 3I32A 4PHFA 2PFKA 1RAIA 3A7DA 4KVFA 3RFCA 2DKOA 4G9BA 1G20B 1RNLA 1YR2A 1MAAA 3C3AA 1P9OA 1UJMA 2BH9A 1DAFA 2PRZA 5KAMA 2D4AA 2GM4A 1G21E 3RTCA 3GJTA 2B6NA 3HA5A 3WRWA 4C7JA 2PMCA 1NHGA 2C98A 2K6GA 2ZS8A 3PDIA 4LHZA 4RNDB 1L7OA 3KUXA 3MEQA 3OMXA 4P1ZA 3GA0A 4DV6B 3AEYA 1D4FA 1DBIA 3FLBA 3WIUA 5C3MA 3H9EO 4K8RB 3E1GA 2ADOA 3U17A 4UEJA 1AB5A 1GM5A 2FPPB 2OTCA 2D8MA 1GN8A 1T2AA 2FLVA 2Q6OA 3C43A 3BMOB 1B14A 1KYYA 3KJEA 3NWBA 5A4KA 2VDUE 2A5LA 2P1RA 1UBHS 4HGQA 3H19A 4OL9A 3QU9A 4R1QA 5EQJB 2EXXA 3JQFC 4I50A 1D9ZA 1P31A 4IBOA 1A5BB 2GBLA 3T3MB 4ZV4A 3TSYA 5EAIA 1U0RA 3EEQA 3K6RA 3NUGA 5HRUA 2HSDA 5A05A 2YHIB 4X71A 1OMOA 3G02A 3TTTA 3IP7A 1Q77A 1TGVA 4NV0A 2OXTA 2XTAA 3QFCA 4HGOA 3U26A 4P53A 4Q4JB 2NAPA 1DUSA 3MHPA 3WXMA 1JR3D 1RZVA 1UIMA 4BTLA 1GAWA 3QBJA 5M5BA 3C74A 3VPXA 3G8CA 3CVOA 3VOTA 1TD1A 3SVZA 1YHNA 4MZXA 3CPEA 4E2YA 1ZX1A 3MLEA 2FHSA 4BV3A 1KH3A 3HP7A 4FINA 4OO3A 4BVJA 3SQXA 1XQ6A 4JQOA 3DZBA 2LPMA 1N5LA 4N0MA 4R54A 4CF5A 4Z7JA 1OAOC 3R9KA 1Q0UA 4INPA 3MMNA 1XZNA 1E9RA 2AJDA 3V4LA 3C1OA 1M0SA 1ZHFA 1PBNA 2X8WA 1B15A 3I42A 1N5KA 5J59A 3HB9A 2HCBA 4UOQA 1P4AA 1YTUA 1JE0A 1UT6A 1JA0A 1C7IA 3HL4A 4G97A 1Y7LA 4HHEA 5EWMB 1CR2A 2XT9A 4Y2SA 3EC1A 1M2VB 5AJWA 4MQEA 5FL7A 2DJ5A 3L7IA 3HCWA 4RHFA 1LVHA 5E6UA 1OI2A 3A6GA 3CLTD 2M2IA 4LJ8A 4RFLA 2QORA 3AR9A 3ZXSA 5KX5F 5DLYA 3H0KA 2BFAA 3K2QA 1PJ4A 4IEEA 5FAXA 4FSDA 1B8PA 3EF1A 4B3BA 2C8KA 3K0CA 1SHJA 3P2MA 1TIKA 2XUPA 4BP9A 1RR6A 2P7HA 1DIOB 2ID4A 4P4SA 1CEYA 2Y0EA 4R3WA 3V2GA 1TFRA 4BLSA 1L4GA 3GI1A 2QP9X 4LZPA 4CETA 3ECCA 2WA1A 1IPHA 3LK6A 4G09A 2AHRA 2H3EA 3LUCA 4CLDA 5KSWB 5B6IA 3Q87B 2VSNA 1T26A 5E9QA 4KXNA 4F6RA 4YP1A 1M1YA 4MYDA 4L7VA 3HKDA 3PT9A 3BA1A 2JLQA 1FLNA 1WF3A 2A9RA 3AESA 4FU0A 2WDZA 5DF1A 4QUJA 3KOMA 1TUEA 3I09A 3VMMA 2UUBB 1F9AA 4Y2RA 5AJVB 2F1IA 1HYQA 1NVEA 2E87A 2FR0A 1MX9A 2QD3A 3L8GA 4Y18A 4DR1B 2ZYGA 4KIWA 2XRFA 3O1LA 4MHSA 3V3KA 5EJ6A 5JXGA 2OD7A 4K40A 3OEHA 2JI9A 4HXGA 4FN5A 1JFVA 4WERA 5EZYA 3C45A 5KDLA 5B1IA 3TR0A 1OA0A 1WUHS 4QYWA 5AI4A 5DI9A 1KE2A 3ZHCA 2G28A 4EB3A 4YR9A 3LBFA 2X3FA 4HRAA 4C30A 1Y98A 4QJ5A 5FR2A 3OMWA 2RHJA 3EJWA 4AUEA 5A02A 5DN9A 3MD0A 4M9ZA 5E9WA 3LC1O 2H1OA 5U9CA 4MVJA 5EIWA 3QNWA 5JXWA 1D5CA 1G5FA 3O26A 1RHJA 1NW8A 4QYXA 2PK3A 4UTXA 4V0OA 4PC7A 5WRFA 3IPCA 1WNTA 1KYQA 2PUHA 5FUQA 3WBJA 3G7UA 4E5PA 5C37A 3OCVA 2CMDA 3NBUA 1LH0A 4Z1MD 2P67A 1L7DA 3ZWDA 2W6OA 2O5CA 3ZY3A 3GVXA 1SVSA 4QXQA 2NT4A 2V5UA 4FFPA 2JATA 1LJ8A 5M04A 2XQGA 2B34A 3ELDA 2A1UB 3ZWMA 1WJGA 2OBLA 4ONEA 1UC8A 5KJ6A 3P5SA 2AXQA 2WIDA 1PNRA 4LCBA 2B1JA 1OYYA 5E7QA 3GELA 1TM5E 1VIDA 4FD2A 3W3AD 4I4IA 4JP5A 5LUAA 4CMKA 2WTXA 1J0XO 2ZRJA 5A7GA 4GAEA 2I2XB 3ZJ4A 4COOA 3B13B 2B8EA 1UFKA 2Z30A 3PX2A 2HYDA 4Q3AA 4XR9A 3G7SA 5AP9A 3WFZA 2A58A 4DBLC 1C8LA 2PGLA 2QMOA 1O8CA 3R6LA 4ALMA 3NJ8A 1PW5A 3G6WA 3GVCA 2PUDA 2ZRHA 2UDPA 3DNPA 3KZMA 2W2TA 3MOSA 2FF5A 3E7XA 1VIMA 3ZCXA 4BECA 2D1FA 2GD6A 4RQBA 2WYOA 1SVLA 5A4AA 1F1BA 1SMKA 1OWLA 2A9PA 3GCZA 3RF6A 2WHEA 1JDZA 2RG7A 2W2KB 5ARBA 3ER9A 1QJ4A 3N8DA 1R5OA 1U0JA 1ATIA 3TDMA 1N0IA 3I8XA 1OTXA 3QELA 4MDHA 3ZHOA 4ZFNA 2L17A 4RLSA 4BKPA 3KVRA 1HPLA 2FSUA 4G5SA 1M2OA 1RKUA 3G9UA 3P9PA 1GRQA 1H2XA 2FAXA 3Q6IA 4TL9A 4UCXA 5EIBD 5TY0A 3RVSA 4OHYA 3WDSA 1YASA 4KYIB 5L3SB 4FS3A 2J3QA 1JJ7A 2WWVD 1E9BA 5D7BA 1VSTA 2JAPA 5SY4A 4ENQA 4TROA 5DNCA 2OBXA 4OM8A 1R18A 2QQ5A 3JWHA 3ET4A 4UMFA 3V1YA 4L4UA 3WISA 3ZV5A 4G1MB 5KHOC 4MUYA 5JU6A 1C0KA 4JI0B 4QICA 3S7TA 1C4KA 2FZ4A 2FK7A 1OGJA 2E5WA 5F51A 4YT8A 4FKMA 3CVVA 4DAEA 2OBYA 5IJ0B 1P62B 1OFGA 1XF9A 2YBEA 4OQQA 3NW9A 1ZYUA 3PHCA 2WT9A 3JVIA 1QQ7A 3EZXA 5HE8A 4KE6A 4ICIA 4EL5A 1S0UA 4QQRA 1IEVA 2B7CA 4MB2A 2H5EA 1HC7A 3FPLA 3Q6MA 4ZZ3A 3M1YA 4O2BA 1G9SA 1YWGO 3RRFA 3CZMA 3NC1C 4WCVA 1KNXA 3SKYA 1K63A 2A30A 2PKCA 2QAGB 3OFVA 5LZ8A 1KMIY 4ASUA 5J23A 5J2TB 4MDFA 5DK4A 2IF2A 1PT5A 3HB5X 4M21A 2W6QA 3QRWA 3U3OA 1V16B 4RZQA 5EE1A 2VVTA 4A0FA 4ZDKA 7REQA 3M7IA 3IHWA 4PG7A 4I9HA 1MO2A 1QYRA 2HMVA 3S2ZA 2V55B 1IG3A 5EVCA 1WAMA 2EWWA 1P0CA 1E9AA 2MSWA 2PZLA 1VPLA 2NXNA 3X2FA 1VCNA 3L8DA 5EP3A 3AP3A 4UM9B 1EVIA 1KP2A 3EDOA 3LKBA 4KR0A 3MCVA 3S70A 4DSOA 5HJ5A 2J0UA 3D0RA 5CHYA 4BX8A 5UKDA 1V4NA 1AMNA 4PIPA 4OQDA 3N76A 1H2AS 2VDRB 5F77A 4C1NA 5CLFA 1R6UA 4M6WB 3LVBA 4O2LA 3LUFA 5AO9A 1J5EB 3BMQA 1NNSA 3RK4A 1NQUA 4B1FA 4YJHA 5I9NA 1JFSA 5HKAA 1W4BA 4PAGA 3PGKA 3OQVA 4WBNF 4L9RA 1KPGA 3UYKA 3C24A 4WVFA 3SJ7A 3TLAA 4Z3OA 1I6KA 1MIHA 4UUBA 4IQ0A 4AJLA 5C7YA 3CKMA 1HT0A 2HK6A 5J58A 1XFDA 2IBMA 2FGJA 2VPPA 1IY0A 2R4QA 4BVHA 2ZT8A 1XPOA 1OHHA 5IM4A 5A2QA 1SQGA 3IUJA 4EMTA 5AKKA 3AR8A 1GZUA 1FU8A 2R6R1 3LQYA 4EFDA 1L8AA 3GPIA 2O8FA 1KVUA 1Y3HA 1KI3A 1SHZA 2IV2X 5LP6B 4PBRA 3CX3A 2BGIA 3DEJA 5EWJB 3VDQA 3WGKA 5JFTA 3GDWA 2CUKA 3NTLA 3V46A 4ZJUA 3AUAA 5E2IA 5TIIA 1IMJA 5HRCA 1XN1A 4LX0A 1FZQA 4RENA 4A91A 5BVHB 3FXAA 3C8DA 3JQCA 2Q9BA 4FE3A 4LXQA 4M1SA 3GFGA 1H66A 2IEIA 4ZHQB 2YOHA 5DYIA 4P82A 3K9HA 5BNIA 3OZVA 4B34A 1Y80A 4TWAA 1H2BA 1WP4A 2V45A 2OCPA 3U40A 1YJ5A 5C34B 2PJRA 2C5SA 4R2XA 5EP4A 2Q49A 4E5UA 2ZQ5A 3DMDA 2C83A 2X4LA 1ZD8A 1RJGA 1R6BX 2F64A 2HIGA 2Y2VA 2Y71A 3K8OE 4RH3A 4BE7B 3W5DA 3DULA 4R9VA 1A4IA 4K81B 3GOQA 4QUIA 2FWBA 3L4JA 3PD1A 4G89A 4MYRA 5K6TA 5IJ9B 1YS6A 4W9NC 1X74A 4PLYA 2OGTA 2YOFA 1RJDA 1FFWA 5FLEX 1N57A 3F8WA 1P60A 1B26A 5JPIA 2CHVA 4XTCS 4HFRA 4HADA 2PGXA 3RKRA 1H4TA 1U8YA 2OILA 3GXOA 1O97C 2ID7A 4L3OA 4NU0A 4WXMA 4XQEA 3W1EA 3W4JA 4EHJA 4H7PA 5JDCC 3RG2A 1RI4A 4D43A 1HKHA 1VBMA 1NC3A 1VB5A 1BKYA 1CDOA 1IJKA 2EX1A 1EFCA 1OLXB 3FJYA 4EUSA 4KQGA 2FZWA 4AFNA 3I1JA 1EEHA 2ZBQA 1CS4C 1NXWA 4NBNA 1PZNA 2P6OA 3EIWA 3KEFA 1RTKA 2GD2A 3I61A 1RD4A 3QF4B 2HNBA 2A0KA 2REQA 1NA5A 1G55A 2CFIA 4UKDA 4LJ4A 1FXSA 3KSBC 3H1AA 1M54A 1BYIA 2H52A 2RK6A 1SA0B 4JP8A 4WQMA 4BNMA 2O48X 3CCBA 5F3DA 1JYFA 5T3UA 4BE4A 2ZRFA 3R3YA 1XCBA 1ODSA 2WICA 2CFCA 5FORA 3VZRA 2R1VA 4QPJC 4U2KA 2ZE8A 1Z45A 2G88A 3FBTA 4I4LA 1KYVA 1G41A 1V0JA 2DU8A 4MW7A 4RELA 1EE9A 3TUJC 1ZLYA 4ZDIA 1YT5A 2C78A 4ENUA 4CF7A 4OHUA 2QMYA 4LI3X 1NXVA 4U2DA 5EJGA 5IEJA 1W5EA 2AVNA 3IIJA 1D3AA 3OZFA 2OXIA 1X13A 4X8MA 3R9XB 4EPXA 1MZPA 3T5TA 4R1LA 2ZM5A 4A27A 4J76A 1XVIA 2R47A 1SG0A 4MVJI 4AICA 3CA8A 2QMUA 1M2NA 1CUZA 1WP9A 2WJVA 4X64B 3RTGA 4KODA 2IYFA 1KGDA 2PMWB 5JANA 3BX1A 1KSJA 1K7SN 1CU1A 3KKQA 3W6OA 3IJEB 3MAAC 4EJSA 3VZCA 1RRCA 1GVHA 1W19A 1WKVA 5EGNA 4Z3DA 2FP4B 3ZDQA 1NBMD 3OKCA 3L6CA 3GD5A 1U2DA 2XMBA 4LHVA 1N2BA 1Q1NA 5EPEA 3ZV6A 1ESDA 3LPMA 3QV1A 2R85A 4LZOA 3GIWA 4RHXA 4ZC1A 3W7BA 1F5SA 3FFWA 3REFA 4RD4A 1UZLA 2Z3ZA 1Z5ZA 1W36B 3DE0X 3BRCA 5BWCA 3DBOB 1U2TA 3FRIA 1BRMA 4H4DA 1JWLA 1P1FA 1S8NA 1J39A 1XOIA 2FN7A 4LI0A 2JD2A 1T9ZA 3T5BA 4R8SA 2C7VA 3A4LA 2OEPA 3R7BA 5KTNA 1USKA 1YKFA 4TT8A 2CHUA 1T2VA 2VJCA 1NUHA 1V8DA 1WIWA 1Z4JA 2JZOA 2TRSB 3PE4A 1NXXA 4TUYF 4TTTS 5L3ZA 3N53A 2RSLA 4OUDB 2P2NA 4UE3S 3WQSB 3HLKA 4ECEA 4YTEA 1CB0A 2X1HA 3ZHBA 5A5VA 5H70A 3OPMA 2ZBGA 3EY4A 4C6SA 4PYNA 5IH7A 2GAIA 1TU4A 3BVPA 2QA5A 3TQSA 4KAJA 4NS4A 4IF6A 4ABTA 4WJKB 3U44B 4QHSA 2OCYC 1KXZA 5JWOA 2FUG1 3H3FA 4CM4A 1QP0A 1RC0A 2ZS9A 1YU6A 5BUQA 1NX6A 2ZAOA 2E37A 2ID8A 1H2YA 1VKNA 5JLAA 3TLEA 2YZNA 3U7FB 4M38A 2WFLA 1J0EA 3MINA 4ZJYA 2XUOA 3M81A 3EFHA 1JSLA 2WJWA 3CQ9A 1NPTO 3QIVA 4CHGA 1L5SA 2Y6VA 1E5QA 2IUFA 5FUVA 3JQ7A 1I3KA 3RVBA 2WPNA 1EE1A 2WJAA 4PY2A 3CLUC 4NCNA 5GZ1A 1QH0A 5JNLA 9ABPA 4YIHA 2B98A 3AT1A 4N3CA 4FDVA 1Q7RA 3GLKA 4CG3A 1L3IA 1YCDA 3B8HA 4V38A 5HQJA 1HYBA 5M3BA 3ZE2B 3A28A 5BNTA 5JZSA 5KYYA 3SN6A 5ALRA 2YN4A 2R11A 3FGOA 4WDRA 1PV4A 5IKPA 1WR8A 1AGRA 1WMBA 1SKUA 1ONSA 4N4AA 5DYTA 2QR5A 1RWPA 4BCDA 1E2DA 2C2ZA 2X19A 4Z8XA 5ECDA 1E77A 3T4XA 1U81A 3GGPA 3STVA 2CXOA 4E2WA 2ZB4A 1CJCA 3L7NA 1B73A 2W2MA 3EZ9A 5BN4B 3WLLA 2P0AA 2FSHA 3ZU2A 3IBSA 3RK1A 3O95A 1L7XA 4R1SA 1U0LA 4TVKA 3W9BA 4WJLA 5DM4A 4QNRA 7MDHA 3NLLA 3NTQA 5I7VA 4B8WA 3ND5A 3WSTA 2O2ZA 4LECA 2NQTA 2GERA 3PRHA 2PLAA 1JQ5A 3FHCB 3IILA 4H27A 4QDJA 4UZSA 2ORWA 2MINB 1FNMA 3IP8A 3GW8A 5F33A 4L51A 3WIBA 2G0AA 4IPTA 3QVJA 5M34A 4FFMA 4EG0A 2HF7A 3JVUA 2C2HA 3HCDA 2QRNA 3M3PA 3B6JA 3BRSA 3RUAA 1D0SA 3UH0A 1E1NA 2WW8A 2EKDA 3T7EA 1ZRHA 4A6XA 4ER0A 5BOSB 1PR2A 4O8ZA 1UXIA 2PQ0A 1HL3A 1GTRA 3HO1A 2HSZA 1G63A 5AVVA 3EGVA 2AJ8A 2IPNA 4IQGA 3NTOA 4YYEA 1XRLA 4HNGA 4FGKA 1AZSC 3WMEA 2FPMA 1JJVA 4NCAA 1UOEA 1QFJA 5HM8A 1QCYA 2JFXA 1TTQB 2VAVA 5B53A 3O1JC 1NPDA 1T2NA 1DQYA 4L0DA 4XFDA 3QVMA 3TK1A 2OLKA 4RD2A<