3TZHA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(f187a) from vibrio cholerae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGAIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 88
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzhA00
1LXCA 3PHIA 4OO3A 3ASUA 2Q3EA 2X4GA 4XEHA 4B7XA 8ADHA 1QYXA 4DBZA 1KEWA 4GWGA 4XCVA 5DBFA 2B37A 4GPD1 3GRPA 2Q1SA 2BFPA 4WLVA 4TZKA 3SC4A 4JNKA 1DIAA 4NR0A 2GPTA 1GV1A 5I9MA 3DBVO 1C0KA 1ZCJA 3E9MA 1ZEMA 2AQ8A 3L07A 4I1IA 1GPJA 4EGFA 1GEEA 4UAGA 2JD1A 1M6WA 3DQPA 4CUJA 5EINA 1ARZA 2G76A 4CM4B 1YB4A 5G4KA 4RF2A 2BFMA 3AJRA 3T7EA 3ZNPA 4FOSA 5JNLA 3M1AA 1YJQA 3D7LA 3RASA 4GWKA 2BLLA 3F47A 4FGSA 1LUAA 3LF1A 5KKAA 3RKRA 4WGGA 4PLCA 3KETA 4NK5A 3KXDA 4GGPA 4G65A 3U0BA 2Y0CA 1ENYA 3MJ4A 4IIVA 2YZ7A 3E18A 1LDYA 4DA9A 4INAA 4E5YA 2CFCA 3EVTA 4KTVE 3PXXA 3GN1A 5FEUA 4RPKA 1FDWA 4J90A 5JMPA 2FPIA 5TT1A 1W0CA 1FDTA 4WE3A 4WCFB 1OOEA 1PJLA 3GZNB 2WMDA 3SEFA 4DIBA 3L9WA 3LF2A 4PG4A 3NUGA 1UJMA 1AGNA 2POQX 4WCFA 1F8GA 1JWBB 4BMSA 4BNXA 4IJKA 3W8EA 2QRKA 2B5VA 1DBVO 4L4RA 3ZGYA 4E5MA 4OOFA 1PEDA 5U9CA 5G2OA 2VWPA 3KVOA 2R00C 2P9GA 4JP3A 5IZCA 4GVXA 4ALKA 3NGXA 5HBRA 4W7IA 5I9NA 2IZ1A 1C1DB 3TZQA 4ITUA 4G81A 4RQTA 2YQ5A 3JD4A 1XLTA 3E82A 4BKQA 4CV0A 4XX0A 3HB5X 4ND4A 1WMAA 2YQ4A 3W4JA 4ZICA 1OFGA 3LSYA 5IXSA 4IS2A 3CH6A 4R54A 2C5AA 1BSVA 1QYDA 3FCOA 4IINA 3UH1A 4LRTB 1KYQA 4PVDA 3G17A 2DQ4A 3PWZA 1QRRA 1XQ6A 4E5PA 3KRTA 5I7VA 3I6QA 4II3A 2BI8A 1JVSA 4L73A 3RJ5A 3EC7A 2CDAA 2CNBA 3I23A 4Q3BA 1V3VA 1RM5A 5JPIA 3NGLA 3QLJA 2DT5A 1M76A 2O4CA 4FGWA 1P33A 2AE1A 2Q49A 3EVNA 4U5QA 1SB8A 5CG2A 5DOZA 4YJFB 4GMGA 4KUGA 4RV9A 3FI9A 3WNVA 2CF6A 3F6YA 3CE6A 3GMDA 4D42A 2H1SA 1M67A 2J5RA 3KYDB 2ZCVA 1X1EA 3CSDA 2YV2A 3O38A 3WSVA 2D3TA 3T4XA 4NFHA 2HK7A 3RJ9A 1GAEO 3QVOA 2G82A 3CKYA 1E6EA 3I9NA 3BXXA 3GNQA 3L6OO 1NQAO 2XXJA 4CLDA 2VUUA 1KC3A 1TB4A 1WVGA 2DVMA 1JKJA 4QT0A 1ZBQA 4Q3NA 4L8VA 4HBGA 4E6PA 1G0OA 4KQXA 4DC1A 3V1UA 1C3VA 3QA9A 3CMMA 2EGHA 2VHXA 3L6DA 2AQHA 2Y1GA 3RIHA 2AQIA 3WGQA 1IZ9A 1U5AA 3WGIA 3PQEA 2HUNA 3JQAD 5LCXA 4QX6A 3K96A 4CM9A 3KBOA 1X1TA 5G4LA 5JC1A 1GU7A 1VRWA 1HSOA 1LBEA 3ULKA 4NBVA 4D44A 1PTJA 1LLUA 1T1SA 4JCOA 3KM0A 4Q9NA 5ER9A 1J4AA 1I36A 3GRKA 4FC7A 3RC1A 5JCJD 2YHUA 1NASA 3RBXA 3IUSA 4BUCA 1Z7EA 1A4IA 4YCAA 3T4EA 1ZK1A 5L9AA 2DKNA 1EEHA 4FFPA 5L4LA 3RUEA 1P45A 4IDAA 4NDNE 2X1HA 4UVHA 1LTHR 3ZWOA 1GL3A 4GMFA 1HE4A 4QUKA 4Q3AA 3RQSA 3JQ9A 4KQWA 4BNTA 4A7PA 5ICMA 2Q45A 4TRMA 2J3HA 2Q2QA 4DUPA 4ND3A 3VZQA 1E77A 4DIOA 4CQMD 2NVUB 3VZPA 1PJTA 3OQ1A 1TA4A 3EYWA 1XKQA 2X0JA 3HFSA 1M75A 1EK6A 4J0EA 4BVAA 4TQGA 1BTOA 3ZV4A 2PTGA 3AY3A 4L75A 3SXPA 3U5TA 4DMMA 3Q1LA 4PZCA 4BO1A 4R9SA 3ZH2A 5TJ9A 3W6ZA 2PKQP 4UUOA 3WLEA 1PJCA 2I67A 3O03A 3OJOA 3VTZA 1X15A 5CFZA 3W8FA 3GVXA 3PDJA 4AJ4A 6ADHA 1N7GA 2OGUA 1XCBA 3H9UA 1NBOA 2CF5A 3AUSA 3BZUA 2GSDA 1Q0LA 4UUMA 1N92A 1P9LA 4CMEC 2AG8A 3QY9A 5MDHA 3OECA 4MVJP 4IDFA 5DBIA 1IB6A 4ND5A 4RVHA 4W99A 1XIVA 3JV7A 4MPDA 1FMCA 4DWVA 4TVOA 2YYYA 1NQ5A 2BFOA 2UDPA 1Y81A 4MVJG 4YYZA 2I3AA 3MJVA 3RUIA 3DOCA 4NFYA 1WMBA 1Y8RB 1EDZA 1LLQA 3AUUA 3NEPX 4GVLA 4YR9A 2GERA 2Y66A 1VL6A 1I24A 1QG6A 4GLLA 4ZQHA 1AHHA 4EDFA 3VZRA 3GPIA 4AJKA 3VH2A 5ILGA 1PR9A 1PGJA 3TZCA 4RL6A 3WJAA 3GA0A 1A5ZA 4MIOA 5BNFA 4B4WA 4LSMA 3JD0A 4NK4A 2G5CA 2W8ZA 1MA0A 4FOOA 2LDXA 4WJZA 3PVZA 3ITDA 2E6UX 4J2OA 2HLPA 3GVCA 5JC8A 3OA0A 1NVTA 2C82A 4R16A 3TF5A 1HDCA 3FNHA 1KVRA 4KP7A 4CR7A 2WE8A 2Z1NA 3FSRA 3JCZA 2OBYA 4B8WA 1PGPA 1UP4A 3OETA 5T8KA 1LLCA 3K9QO 1UP6A 2QZZA 1R4NA 4CMJA 3BMNB 3PHGA 4Z0TA 2AA3A 2WSBA 3ETEA 1ZVMA 4BO7A 1YJ8A 4RDIA 3DHNA 2Q2WA 3ICCA 3KSDO 4NJMB 1HDGO 1O0SA 4E3ZA 4GX1A 4XIJA 1LDEA 2BD0A 5L7WA 4NPCA 3GDGA 4E2ZA 1I3NA 1LDBA 3G1UA 4TMFA 3E1KA 1DC3A 3RC7A 3KYDA 2PZKA 3FPLA 1W4ZA 4BNMA 1QV6A 3GGPA 1MXHA 3F9IA 1K5HA 3DXFA 4M55A 4NH4A 5F3RA 4NBUA 3DZIA 4BNWA 1G6KA 5C7IO 2HJSA 4D43A 4FFMA 3FD8A 2PNFA 5I7EA 1RM0A 2P4HX 4AJPA 2YW9A 1WP4A 5EERA 1SPXA 1DIRA 3AI3A 5T67A 2QX7A 4WEOA 3JYPA 3DZHA 2B4RO 2ZQZA 3TDKA 5B4VA 3KUXA 4BNYA 2PD3A 2GZ2A 3HFGA 4OH1A 4DMLA 3ENKA 3ZWNA 2PGJA 2RIRA 3F46A 1M66A 1NWHA 3IUPA 1PZEA 4M87A 2DFDA 2DTXA 3GFBA 3PP8A 4WEQA 2WM3A 2GN9A 1TXGA 3ETGA 1GYRA 2VOJA 4I5FA 1U2DA 1MFZA 3INTA 1K6XA 3CXRA 3PGJA 3TFQA 5TLSA 5KNLA 1MFPA 2FPPA 3OM9A 4EJ0A 3UFXA 4OSPA 3EMKA 4JIGA 2VYND 4JQCA 2VUTA 5JYEA 1IPEA 4OOEA 4XJTA 1E92A 2O3QA 5DCWA 1Z75A 4BNNA 4NHEA 5L7TA 3IP3A 4DPLA 3H9QA 5ES3A 4YACA 4FFOA 4TRJA 1MC5A 2VQ3A 4IGFA 1BXGB 1UDBA 1NFFA 3HZZA 5MGBA 2EP7A 2EF1A 1E1NA 1NYTA 4MOWA 4RO0A 3MTGA 3QWFA 4J49A 1J0XO 3C7DB 2V6GA 1P1KA 3F1LA 3PYXA 1H6BA 1I2BA 3ZZNA 4E0BA 3D3EA 3SX2A 2C5EA 5AVOA 4BGIA 1ZK4A 1ISHA 1E7WA 1SEPA 3C8MA 3PEFA 3BMOB 4PG6A 3DZGA 3HQ4O 3GG9A 3TSCA 3TQHA 3RD5A 2ZTUA 3HJAA 3C1OA 4N54A 2OHXA 1C1DA 5DP2A 5KWEA 1KIFA 3JYNA 4PLZA 5I7SA 1EVJA 1K6JA 4A27A 3UVEA 5LDGA 3CIFA 1EUDA 4WASA 4KDFA 3E6AA 2XPCA 3QWIA 1JVBA 2O7SA 3LC7O 3WXBA 3A28A 1ZEJA 3ICPA 4ND2A 4J91A 3DDNA 4LVUA 1DRVA 5CHEA 1BRMA 5GY7A 1JDJA 4UUNA 1ZIDA 2IDZA 1UXKA 5G0VA 3Q6IA 3DBLA 1RWBA 2VNAA 3GT0A 3ROQA 3ONEA 2EJWA 1YL5A 3RUCA 1DJNA 4ZQGA 4HY3A 4IBOA 4D3SA 3H5NA 4M86A 1HDZA 2DBZA 4Z9FA 3RFXA 4K6CA 4RF4A 2AEFA 3NT2A 1SBYA 1JKIA 2CY0A 4YXFA 1BW9A 2VYVA 5KIAA 3U3XA 4UVEA 3G3EA 1E7SA 4MVJH 4BO3A 2OP1A 1DAOA 1LQTA 1V3UA 1Y9AA 3A06A 4O59O 4W9NA 3TL3A 5BR7A 1A71A 3PZBA 4AL4A 2PKRA 2NM0A 3GAZA 4YDRA 2NLOA 3JQ7A 4PLYA 3GUYA 3PWKA 5DDIP 3DMTC 3OH8A 3IQDB 2EKLA 2EW8A 4S3MA 2O3UA 2HK8A 1HYGA 2NSDA 4RZIA 4NIMA 4JROA 5FFFA 4HX5A 2A35A 3S2IA 4B4VA 2X0IA 3KLMX 3Q9UA 4IPTA 1KY5A 3HHPA 3KZVA 4AJOA 4J7XA 2R00A 1CIVA 3F1KA 2PD4A 3WB9A 1B3RA 4CM9D 4ILKA 2FOIA 4MKXA 1E1KA 1WPQA 1IL0A 5IDYA 3GDOA 3ZU4A 2X0RA 5G0UA 5CEFA 4GX5A 2NACA 4E12A 2I9PA 3VKUA 3B1FA 5DP1A 4R41A 5A9TA 1Q0HA 2DPGA 4PRKA 1DIBA 3D5TA 3E03A 1T4DA 3FR8A 1I33A 4BGEA 1YOVA 2HQ1A 3H7AA 4B8ZA 2NVWA 4RVGA 4J6FA 2O3JA 4WNCA 4QXMA 1YS4A 2RH4A 2X0NA 2A92A 3GEMA 4HFMA 1PS8A 4FFNA 4JX8A 2QRLA 4L4XA 1X0VA 2UUPA 3DWFA 3UOGA 4NZ9A 2FSSA 1UZMA 4CM3A 4JLWA 2JD2A 2GNAA 4BKOA 3WQSB 4DQVA 1E5QA 3AOEC 1VL8A 1E3LA 1X0XA 5JAQA 4HWKA 1FXSA 2W98A 1QR6A 2Y1OA 3JQFA 1I2CA 4FFLA 4CMGA 4MVJD 1LI4A 3VPXA 5LDHA 1U3WA 1UXGA 4LGVA 5JDIA 4YT8A 3RUDA 2FPGA 4I5DA 4EEZA 4J43A 1BVUA 1P1HA 4I08A 3GDFA 2Y0DA 2C2XA 1R16A 1C0IA 4RLSA 4BNZA 5A5EA 4LSWA 5DCUA 1WZIA 3JQ9C 1FJHA 2PFGA 4F45A 8LDHA 2EV9A 3INGA 1VL0A 4FQ8A 3WYBA 1B3BA 2GN4A 3LC1O 1NPYA 4FB5A 1ADGA 2HO5A 1T2EA 4PVCA 1NPDA 1NAIA 3VDRA 2BGLA 3WYCA 4HADA 1IHXA 1QYCA 4NG5A 5CPBA 5ITVA 3LT4A 4GKBA 4JBGA 2EKQA 1I3LA 2Y0EA 3ETDA 2B69A 3HN2A 3QVWA 4YT2A 3EZYA 4IGEA 2OOSA 3RVDA 2FZEA 4N5LA 2RAFA 3PQDA 3P7MA 1PQWA 3WX0A 2O3TA 4NJOA 2DC1A 2PK3A 5GZ1A 4M54A 1UZNA 4Y9DA 1MV8A 2F00A 3WYEA 4E2XA 2JL1A 3SJ7A 5KVQA 4L76A 3TN7A 3WTCA 3WWZA 1R12A 2NU7A 2Q99A 3FR7A 5U4QA 5GZ6A 1R15A 1T24A 3AUTA 3C1TA 4DVJA 2WD8A 5IZ4A 4MO2A 4LN1A 1XSEA 4J3FA 2NQ8A 5K0ZA 1BG6A 1A4UA 4ALMA 4AJNA 5JAIA 4HV4A 3DC2A 3P19A 5CEEA 1E5LA 1U2GA 3V2GA 4ZHSA 1DSSG 1E3WA 3DZBA 4TZTA 4M1QA 2PY6A 3GNTA 3ZU2A 5KJCA 1BMDA 5JS6A 2LDBA 1GPDG 1ONPA 1ORRA 1S7CA 2P2SA 3NX4A 4JXKA 5AXAA 3S2FA 4Q3DA 1N5DA 1R4MB 4K28A 1ULSA 2FP4A 1GYPA 3JD2A 3QIVA 2BF7A 4MVJE 2Q4BA 4XYLA 1H2BA 4P22A 5F5LA 1NHWA 2B4QA 2PKQO 3UCEA 5CAEA 1ID1A 3S1LA 1LQUA 4NFSA 1F12A 2IXAA 3EHEA 3U49A 3ZWPA 4QO7A 1VSUA 3H9GA 5ITWA 1FK8A 1OI7A 2WWRA 4FFRA 4L4SA 4UUPA 1B15A 2EG9A 5B4TA 5IZCC 4JJFA 1VJ0A 3VVCA 2HRZA 5T6BA 1U4OA 3B20A 3ZCXA 1MG0A 3FNFA 3A9WA 4AJJA 3KYBA 1MXFA 3PJFA 1QORA 3COSA 4U6SA 5A02A 4HNHA 4BL5A 2PV7A 4D3DA 5DT9A 2RHCA 5ENVA 3RUFA 3KSZO 4C4OA 1AE1A 2AG5A 3W1VA 3ZWWA 1LA2A 4E21A 3UGKA 1ISGA 4K6FA 3SJUA 4IIUA 2DBQA 4Y6RA 2JKVA 2ZATA 3AFNA 5KJEA 4DLAA 1P74A 4DQXA 3IOYA 4IUYA 2I76A 2JAPA 3PFFA 1LSJA 5KVSA 3JQ8B 3IL2A 1CQJA 5JDIC 4QECA 1TEHA 2JD0A 1A7AA 1GADO 1I5RA 2HDHA 2O23A 1Y8QA 1PJBA 4CM5A 1NTOA 3KSUA 4OKNA 1UR5A 4KZPA 4H7PA 1I10A 5I8WA 2NVBA 1DPGA 4K26A 1ENOA 4Y98A 5B1YA 1KS9A 3OIDA 5JCXA 3QRWA 3K2BA 1ML3A 4YB8A 3WMWA 3ZHZA 4ZJUA 3CZRA 4QO8A 3JQ6A 3DTYA 4J4TA 4IDGA 4JJGA 1LSSA 1LDGA 2O48X 4OMUA 4PLWA 3ZW9A 2OUIA 4Z3KA 4GH5A 2IZZA 1DFHA 3I83A 1O9BA 2X23A 2FZWA 1V3TA 1Y5RA 1P1FA 1KBZA 1PQUA 4IDCA 4HFRA 3SLGA 4R68A 2R2GA 3OMLA 3BMCA 1U1IA 2OZPA 2OO5A 3QHAA 4BO6A 4WCFC 3E8XA 4WPGA 4IMRA 1SEVA 5KJ1A 4XYGA 1DHRA 3M1LA 4IQ8A 5JBIA 1Q7BA 1TLTA 5B4UA 3UAGA 4UVDA 1EE9A 3I9JA 4GI2A 2GYYA 3HG7A 3JYOA 1H2HA 4BO4A 4OSOA 3D64A 1P1JA 5EMHA 1EQUA 4E2YA 4C7KA 2DUUA 1XELA 1ZW1A 3D3WB 4URFA 2Q50A 4BKRA 3UHAA 4IZIA 4MP8A 3GG2A 2PH5A 3EW7A 4PCVA 4R1TA 2XXBA 2TMGA 2ZB4A 3NJ4A 4YJFA 1B8VA 1T4BA 1VE9A 2CSUA 3ZWXA 4CUZA 3AOGA 1RM4A 2P68A 4BNVA 1XEAA 5A9SB 2AEJA 3KEOA 4P4LA 4XYMA 3PPIA 4CM8A 2V7PA 4HP8A 1ENPA 2EWMA 2Q1UA 3ZNQA 1UAGA 4GAEA 5F1KA 2W2LA 1EQ2A 2CDCA 1IUKA 3DMTA 3NT5A 4IMPA 3STHA 4AICA 3CINA 1EVYA 4BV8A 5CDTA 2EKPA 2Y99A 5JSFA 2X9GA 5A9RA 4J1NA 3L6EA 1VPDA 3ZWAA 2NTVA 3KTDA 2DU8A 5THKA 4I5EA 4DLLA 3WGHA 2Y1FA 3I4CA 1NFRA 1DOHA 1ZMOA 2V6FA 3V2HA 3I9MA 4ZU3A 3RFVA 3IJPA 3O26A 4MVJI 2D8AA 3B1KA 3UCXA 5GZ3A 1MX3A 4R3NA 4BQRA 3VPFA 1Y9EA 3JQ7B 1B16A 2O4UX 3S2EA 4XB2A 1M6HA 3H65A 3FPCA 1NP3A 3TPCA 4WLOA 2UYYA 2BGMA 3R1IA 2BKAA 5BSGA 2O2SA 5KVCA 2QW8A 1YBMA 4XQCA 3Q2KA 5ER6A 5GMOA 3VH3A 4OXKA 3BHJA 3B6ZA 4J1SA 1DJQA 2VTEA 4L9RA 3GVHA 4O63O 3P5SA 3MJSA 2NU8A 3A1NA 5A3VA 5HA5A 1K2WA 4BNGA 3WOHA 3QP9A 4EUHA 4FSHA 5G0TA 3DHEA 2BRUA 2QRJA 4W82A 1UXJA 3VH4A 2VWHA 4BNUA 3TFOA 3LT0A 1CDOA 4OYRA 2OXIA 1NWCA 1U28A 3C7AA 2O2YA 3I9LA 3LT1A 4FCCA 3PJEA 4RPJA 4B4OA 3LLVA 2I66A 4IS3A 1YXMA 4W6ZA 5ICSA 2W2KB 4UEJA 5FWNA 2H5LA 1MG5A 3GPDG 4QFCA 3H4VA 1CERA 2CDBA 2C59A 3V1TC 4DPKA 3G0OA 1D7OA 4WLEA 5K6AA 2WD7A 4UEKA 4KUHA 1EDOA 2P4QA 4TRRA 4MP6A 1E7YA 1RPNA 4PLHA 4G5HA 4I9HA 4R4JA 1NFQA 1ZK2A 4CLEA 1P31A 3GN2A 3ZN2A 3TZHA 2D4AA 2QG4A 1QXSA 2WYUA 3WICA 1JA9A 5LC1A 5DBGA 4P8RA 4AJ2A 1BW9B 4NI5A 4WCDA 3HADA 3DONA 4ALJA 1V8BA 1T2AA 3NKLA 4NBRA 4CR8A 1LRLA 3D3WA 1MLDA 1GD1O 3T7CA 4DIFA 4IJUA 3WLFA 3OEWA 1PQPA 3MTJA 1DC5A 2DTEA 1W73A 2EHDA 3DBRB 3H5RA 1Y8RA 2DBVO 4YAIA 4R01A 1BHSA 2PGLA 5A05A 3DO5A 3AI2A 1LC0A 5AXBA 2WD7B 2VZ9A 1U3VA 4BNKA 5CDYA 2JCVA 3BMOA 4FN4A 4RORA 2X8LA 3AY6A 5CDUA 5DULA 4TRNA 5JFOA 2E37A 1YDWA 3PZRA 1DHTA 3PHJA 1D3AA 2O7QA 1DFIA 1K6IA 3PQFA 1PWXA 1ISMA 5L40A 4XGNA 1N1GA 3MEQA 4ZRNA 2C7VA 1SOVA 4C7JA 4UULA 3F4BA 3D4NA 4Z6KA 4U8GA 4DXHA 1XYGA 3CPSA 5EPOA 5AXCA 5A06A 3ZNNA 3HDJA 1E7MA 4EI2A 2ZTVA 3EAGA 1PZFA 1XU7A 5T57A 3ZV6A 2AHRA 3DBHB 4LISA 1HLPA 4J2HA 3JQCA 3QVXA 5TF4A 1MB4A 2Y1CA 2HRBA 1YB1A 4W9NC 4BNJA 5THQA 1PX0A 1U7HA 1GY8A 1ZK3A 1PU2A 1EFLA 5BSFA 4QEDA 1ISFA 1TVEA 1YBVA 1YKFA 3KEQA 1EE2A 3GZNA 3LLSA 3JQAA 3L0DA 1U5CA 2WYVA 3WGTA 1S6YA 2HK9A 2IEBA 4JN6B 4Y6PA 3KO8A 2NQTA 1H93A 2WJPA 4F3YA 4PLPA 4NBWA 3SBOA 3O8QA 1EUCA 1PJ2A 2HJRA 2EW2A 4ZA2A 1ZSVA 4IJVA 4CV3A 4EUFA 3O8QB 4EW6A 4PN3A 1DFGA 4NQZA 3DBRA 3I9OA 4NU5A 5CP8A 4D41A 2IYPA 1Q7CA 3MWEB 2VYNA 5TX7A 3RFTA 4FDAA 5KCZA 3IIEA 4FJ0A 3D4PA 1YH3A 5IDQA 1PGQA 5AQ1A 2EP5A 3U9LA 2EIHA 3ZW8A 1YQDA 3HDYA 1R66A 4WNIA 4ZQBA 3BMCB 2X5OA 3QV1A 1R4NB 2DUWA 3L77A 1ZNQO 1GZ4A 3L4SO 1NXQA 1HRDA 3QQPA 1DO8A 2B0JA 2WTBA 3PJGA 2ZB8A 4RVFA 4DBVO 4N5NA 2QZ9A 7MDHA 1U8XX 2FWMX 4CLHA 4B3HA 3H9JA 5COQA 1T2CA 4AJEA 5JMWA 3TZKA 2GR9A 1EK5A 1GCUA 3ZWBA 4CLOA 2GLXA 2J6IA 4YJGB 4YAJA 3CZMA 4XQ9A 2SCUA 1VJ1A 4ZQFA 1GZ6A 4D3FA 1HT0A 4ZGWA 1N1EA 3GFGA 7ADHA 3QWBA 1LDNA 5G4KB 4E32A 4JP2A 4CMHA 5IDWA 2ZIZA 5IF3A 1EVZA 5EIOA 4E33A 2HMUA 2TMDA 4ONEA 4Z0PA 4TROA 4GX0A 1LX6A 2FN7A 3L9XA 4MVJM 3E9NA 2ZKLA 1FDSA 5AYVA 3GLQA 1DB3A 3TRIA 3R6DA 2GUGA 4PRLA 2B5WA 2FRDA 1W8DA 3INRA 5A1TA 3UCFA 3HUDA 1QLHA 1UUFA 4OQZA 3RROA 3FTPA 4LVCA 4J1TA 4BIIA 3JD1A 2Q46A 4XDZA 3K31A 3BTSA 5G0WA 5I9LA 2QIOA 4G2NA 5IFLA 2CMDA 2D2IA 5AOVA 1H5QA 3JQAB 3DBLB 3FWNA 3ZV3A 4KWHA 1Z45A 3NDIA 4LCEA 2O50A 3OBBA 2YFQA 4U0KA 3PYLA 2DPHA 2UV8A 4GQAA 1QP8A 2ZYAA 4XZ3A 4BO2A 4J9UE 4CMEA 2HMTA 3VH1A 1IZ0A 5TIIA 1K0UA 4BO0A 1PWZA 3OIFA 4TSKA 4F6CA 1H6CA 1HWYA 2C2YA 1RYEA 3BTOA 4LCJA 5L3ZA 1WAMA 1XHLA 3L4BC 3QVTA 2VTDA 4E31A 2VWGA 2AXQA 3TL2A 3WJ7A 1C0PA 4BOYA 4W4TA 1GUZA 1SB9A 1Y1PA 5L95A 1N9GB 5JY1A 3NYWA 4FW8A 1ZH8A 2EGGA 4YRAA 1JTVA 3KYCA 3I5MA 3PIIA 3PLRA 4O5OA 1LSUA 1SC6A 2CD9A 1QLJA 4AVYA 1QKIA 1J5PA 3OFSA 2JCYA 1HE5A 4EUEA 3DEYX 1KEVA 1XDWA 1CWUA 4BQPA 2HCTA 1ZXBA 1GTMA 3RU7A 3GC6A 3ZHYA 4EJMA 1WW8A 5B12A 2PZLA 2JCXA 4R5MA 3H9EO 1GR0A 1Y8QB 4HKTA 2UUOA 4BNHA 3V5NA 4J1QA 2YV3A 2JFGA 2OFPA 4CM1A 3M2PA 4FIZA 4WLUA 1K3TA 4IZHA 3D5QA 2VOEA 3ADOA 2BMAA 4XR9A 1W6UA 4O1MA 3DAFA 4FC6A 4BO5A 1QSGA 3N74A 2D5AA 3ROMA 2DBRA 2ZJ1A 3EGOA 1ADFA 4K1LA 4B79A 2OBNA 1EBFA 4P38A 2ZCUA 5A03A 1PR3A 2GZ1A 3GEGA 4BO8A 3FBGA 3ONFA 3WR5A 1GFSA 1ONNA 2HAEA 5BNTA 3AM4A 3AM3A 2NUAA 4CODB 4YT4A 4YA6A 3B70A 1KVTA 2V65A 3AOEA 1P1IA 1F06A 1U3UA 4XWYA 2C7GA 3OJLA 4HFNA 1C14A 4DYDA 4PIVA 3Q2IA 3VTFA 4LMRA 5KJ6A 2VZ8A 1Y7TA 4OGWA 3OICA 2CVZA 4Y6SA 3ON5A 2YY7A 3WFJA 4Q3EA 1NR1A 3R0IA 4BB6A 4JBHA 1PL7A 1OZAA 2O3SA 2IRWA 3NTQA 1YQGA 3S8MA 4F46A 3MCVA 4CQLA 1HEUA 5DF1A 1PS0A 1XWFA 5CEJA 2B83A 4RF3A 3QJ5A 1KC1A 2D1YA 2D59A 2QQ5A 3UICA 3F3SA 4ZRMA 1LRKA 3GGOA 5EL0A 4UVIA 5COBA 3U4CA 1Z82A 2H9IA 3ROKA 5KTKA 3D0OA 5F1PA 4YJGA 1PJ4A 4J0FA 1VSVA 4YAGA 2AE2A 4XB1A 1HL3A 4EYEA 3JSAA 1GQQA 3IKVA 4AFNA 1VI2A 1NHGA 3GK3A 4DLBA 4XDYA 2VT3A 4B7CA 1KVUA 4DGSA 1KEUA 1B2LA 3WTBA 5I7FA 3H3JA 1JLLA 3WWYA 1OC2A 1NQTA 1JAXA 5KVVA 1C1XB 4E4YA 1B8UA 1LNQA 2DTDA 2P9EA 2Z1MA 4OQYA 1KVQA 1L1FA 4EJ6A 3WBBA 1YO6A 2J5QA 4OHUA 4DL9A 1XG5A 4QTZA 1NQOA 1A27A 4DTIA 1C1XA 4BGUA 2RH8A 4AJIA 3ANNA 2ZB7A 3ZWVA 1KETA 4CJXA 2VRBA 1CQIA 5TC4A 3BMQA 1BDBA 1ADBA 1AUPA 3PI7A 2C54A 3RBZA 2GGSA 3HB4X 4MIYA 3U09A 3NRCA 1IHYA 2HMWA 4M8SA 3TWOA 3MJCA 1JN0A 4A73A 4B3IA 3QW2A 1YOVB 4XD2A 3K92A 3V2UA 1VKNA 5K6AC 4R5HA 4FBGA 3MJTA 3TNLA 2NNLD 1DAPA 2VYVD 5CPFA 3IJRA 1HE2A 3I1JA 4RPLA 1BDMA 1YRLA 4YRDA 4RPHA 3C7CB 3K8ZA 4CPDA 1MP0A 4CR6A 5JW6A 4D46A 4MKZA 1ONOA 4OKIA 1O89A 2V6BA 2VHZA 5C7OO 4WOKA 2FY8A 4JJIA 1I3KA 3EDMA 2E4AA 3JYLA 2F1KA 4Z0HO 4D79A 5KKCA 4PLTA 1KVSA 3Q3CA 2GN8A 1B26A 3LT2A 1I2ZA 4GSLA 3AW9A 2VCYA 4A03A 4U6QA 4NNJA 2FR8A 3LK7A 1DLIA 5H83A 2NTNA 1PJSA 4KTTE 2C07A 4N18A 1V0JA 2XF8A 4BO9A 2RBEA 2JFHA 1XA0A 3VPSA 3WGZA 2XOXA 1Q2XA 3K2EA 4ROSA 2R6JA 4FS3A 5K9ZA 2B4TO 2AQKA 3BAZA 5DCYA 3RSHA 1R0KA 1H9AA 2ZYDA 4OL9A 3A14A 1IPFA 4RLHA 2IODA 4WECA 5A3JA 2JHFA 3BTVA 1H6AA 1YWGO 1FDVA 5ENDA 3PFWO 4WLNA 1J6UA 2GO1A 2PH3A 3C85A 1Z73A 2JAHA 2O3RA 3AU8A 4RVUA 1HZZA 1TI7A 3JYQA 4XR4A 3BHIA 3VAZA 4J4BA 1PS9A 3DTTA 3CTMA 3GQVA 4IDBA 4BMNA 3PGXA 3RCBA 3CEAA 4QSMA 4DQUA 4WLFA 1WDKA 4OJNA 3ZU5A 1R4MA 1SNYA 1YL6A 1ZFNA 2VRCD 3H5AA 5CDSA 1T2DA 2GCGA 1PJQA 3WG9A 1K89A 3UF0A 2PWZA 5EESA 3IMFA 4HUJA 4CQMB 2DLDA 4H15A 3PLNA 1UAYA 4ZVVA 1HTBA 4CM4A 3H3FA 1V35A 1KEPA 2GRAA 1V9LA 1CRWG 1ZO8A 2GZ3A 4CQMA 2ZQYA 3I3OA 4YJHA 4Y67A 2FR0A 3SLKA 4XJSA 1ADCA 3VC7A 3VPGA 2J3IA 2BI7A 1VM6A 2P5YA 3UUWA 2P9CA 3AWDA 1XR3A 5BT9A 3TZ6A 4MJLA 5DNAA 3ZWCA 2WEKA 4W7HA 3UW3A 3D1LA 1JW9B 4JK3A 4AG3A 3SVTA 2W2KA 2A94A 4GX2A 3WGGA 1P1RA 2RHRA 4AJHA 4XRGA 3GR6A 4HFJA 3DR3A 4IXTA 1P77A 3HDQA 2B35A 3ST7A 3V1YA 3ANLA 2BELA 1GV0A 3GEDA 4CMCA 5BQFA 2Y05A 5A5FA 1GUYA 2E48A 4Q3CA 1YDEA 2CVQA 5FYDA 4EEXA 1PGNA 4DC0A 4IM7A 3RKUA 4BB5A 4RJTA 1XQ1A 1UZLA 2PA3A 3OQBA 4IQ0A 4PLGA 2YV1A 1AN9A 4YJHB 1I0ZA 3WQQA 1J49A 2IEDA 1LDMA 5G0SA 3HWRA 4RF5A 1KY4A 2PR2A 3FWZA 3U4HA 5F5NA 5L51A 1SMKA 1ZSNA 4PG5A 4Z9YA 4P4NA 1UXIA 1CJCA 1ZKMA 1F8FA 4XYBA 3PRJA 1BVRA 3QSGA 3NDRA 9LDTA 1D1SA 1RKXA 2BFAA 2J3KA 3WDSA 1ZXLA 3NDJA 3PWSA 1SOWA 2AW5A 3EUWA 3OP4A 1N9GA 3VDQA 2NTJA 4L0QA 4GL4A 4U7WA 1XGKA 4CUKA 3S2GA 4OAQA 1U7TA 2AMFA 2Q4EA 1MUUA 1PL6A 4CMIA 2QYSA 2W90A 5IN5A 2X5JO 1ZJYA 3ENNA 3LZ6A 5IXYA 1X7GA 4ND1A 3QVSA 4CL8A 2GASA 4XGIA 1E3IA 4MKRA 5JDCA 1I3MA 1P44A 4YRBA 2ZB3A 4WOJA 4CM7A 1HLDA 2EXXA 2IZ0A 1PL8A 5JXWA 1HETA 1VJTA 4FD3A 3NTRA 4CV2A 1DRUA 3EK2A 2X9VA 4OXNA 3DZJA 4O6VA 3H8VA 2OP0A 2J5KA 3DFZA 5TGDA 2WYWA 4YT5A 1T25A 3TOXA 2Y1DA 2OMEA 3QWAA 5FI3A 2P91A 3AUAA 2YUTA 4TKMA 4RPGA 2HKIA 1JKFA 3E48A 1WLYA 5JE8A 4PG7A 4E5KA 2GF2A 3GF4A 1I32A 3ZI0A 2BGKA 3FHLA 3BMQB 3GMSA 4LMPA 5HS4A 1E3WB 3AM5A 1H9BA 1ZMTA 1EZ4A 3L4BA 1DIHA 4CLXA 3RU9A 3JQBC 3TOZA 2X9NA 4RZHA 2QHXA 3BTUA 1DIGA 4R1SA 4PZEA 4DRYA 4OIMA 3MWDB 1FF9A 3NJ8A 4CLRB 1DLJA 3SC6A 4XQEA 4DYVA 5A04A 3ZHBA 5A9SA 4D0RA 3GNSA 1YL7A 2VUSA 2YDYA 1CYDA 2VZ0A 3QWHA 5I8ZA 4GKVA 1EBUA 4MIEA 3RC2A 3NV9A 1PSDA 3PYMA 1CETA 5KOIA 1D4FA 1ZK0A 3BHMA 2I3GA 3H2SA 1A72A 2VHVA 3PHHA 1D1TA 3ADPA 4IQGA 1U9JA 2Y93A 5DOVA 3DAGA 4MP3A 3BMNA 1ZZEA 4BHTA 4A5OA 3GHHA 1X7DA 3LYLA 3P2OA 1BXGA 4YQZA 3KB6A 5TSDA 3OHSX 2YJZA 3OEYA 1HSZA 6LDHA 2XAAA 3H6KA 4I5GA 3GOHA 4A10A 1GQ2A 4CMAA 4CMBA 3R3SA 4FJ2A 4LRSB 1PZGA 1FDUA 3C3XA 3X2FA 3RAJA 1HDRA 3WGYA 5C3MA 2DAPA 1RYDA 4CLRA 5H81A 1YQXA 3OJ0A 3LU1A 5J23A 4CMIB 5C5IA 3BYZA 2J3JA 3JQ8A 4RQUA 1N7HA 4BMVA 2E49A 3KOUA 3UKOA 3IS3A 3B1JA 4HXYA 1DC4A 3HN7A 4JBIA 4BV9A 1YONA 4RCVA 1Z74A 3K5PA 3WS7A 4P4GA 1ENZA 1P0CA 4PG8A 4PGFA 2Z95A 1SCUA 4XIYA 1I8TA 5CG1A 1D8AA 3W6UA 5TT0A 3AU9A 3IDSA 1T2FA 4A26A 2PZJA 4TKLA 1E6UA 5A4DA 1WNTA 4A0SA 4FJ1A 1A9YA 2Q1TA 1P3DA 4GBJA 4KMSA 4AJLA 3EZLA 1BXKA 5TS3A 4AJ1A 4X54A 1U8FO 1R0SA 2ZTLA 3JQDA 4EITA 3E5RA 5JLAA 2OORA 2B36A 3S55A 3ZDFA 1WDMA 5EN4A 5TQVA 5L4NA 2X86A 3DAPA 5EJ2A 3AY7A 2BH9A 5HS6A 4O0LA 1B8PA 3O9ZA 2Q1WA 1PGOA 4TWRA 2I99A 3IC5A 3G49A 3DZKA 1KOLA 5TJHA 4II2A 3VZSA 4N7RA 2W2LD 4PLFA 5HM8A 3I9KA 1R6DA 3U4DA 2DM6A 4RGBA 1DC6A 2NU6A 3K30A 3NT4A 3IP1A 3GHYA 4R1NA 3X2EA 3MOGA 1ULUA 2PD6A 4FPXA 2VWQA 3RI3A 2C0CA 3KYCB 3Q11A 2UVDA 3O4RA 2YFHA 1NVGA 3FNEA 1HDOA 2NWQA 4Z9XA 4NU6A 4E2WA 4F6LA 1EVIA 4ZD6A 3U4IA 3ZWMA 4I9UA 3OIGA 3W4IA 4J9VA 1E7RA 3CUKA 3G1TA 1GZ3A 1OC4A 5DN9A 1YBAA 1N2SA 4YAEA 3BA1A 5F1OA 1T26A 4EZBA 3DL2A 4I9NA 4R69A 4WKGA 5IDXA 1QMGA 3JQGB 3U62A 1TT7A 3FNGA 3MJEA 4H3VA 2NADA 2QYTA 2A9FA 4A2CA 1NM5A 5KJFA 4UEOA 4NMHA 2Y68A 4KWIA 1O6ZA 3WMXA 1MGOA 4N5MA 4Z3DA 4KDEA 1UXHA 2AEMA 1HYHA 1IY8A 4RDHA 2VN8A 4CMKA 1RM3A 1WDLA 4BNFA 1LC3A 5EQDA 1N8KA 4B7UA 1VLLA 1HYEA 4CM6A 2V6MA 5HTOA 1AXGA 3C24A 4CQLB 1C0LA 1HDXA 2JJYA 1Y6JA 4JGBA 1LRJA 2VT2A 3Q0EA 1B7GO 2RCYA 3AI1A 3WIEA 1E6WA 1NR7A 2P5UA 4PZDA 4BS9A 5TNXA 2FHSA 1E1MA 3JQFC 3K6JA 4BNLA 2YDXA 1O94A 4ID9A 5FI5A 3PIDA 4OM8A 4CM8B 1T1RA 4YEDA 1VKOA 1E1LA 3OQ6A 4PFJA 5ILOA 4RVSA 2Y1EA 5TRTA 5JO0A 3GZ4A 2EERA 2A4KA 3JD3A 1A7KA 1EUZA 1DXYA 2GDZA 3WBFA 3WGOA 2ET6A 3ZNOA 3M6IA 1R0LA 1WXDA 3NAQA 3GVIA 3LC2O 5IG2A 4R1UA 2PLAA 3AFMA 2FR1A 4IDDA 2VNSA 4TVBA 2EJVA 3JTMA 3VPHA 1NPTO 3R3JA 2CVOA 2G1UA 1IYZA 1HKUA 2EEZA 4EBFA 1SAYA 1IE3A 2NU9A 2BHLA 4J7CA 4L74A 4Y8VA 5HWSA 2C20A 3ZWYA 4ZN6A 2X58A 3PTZA 3VOSA 3GVPA 5F21A 3M2TA 4M89A 4DREA 4U0JA 3OA2A 3OF2A 1NNUA 3RBVA 2ILTA 1Q7GA 3PHLA 4MDHA 4YWJA 3JQEA 2PZMA 3WSWA 1H6DA 1NX6A 5JDCC 4I8XA 2D5CA 1U3TA 5IAAA 1KERA 1OMOA 5C7LO 4YVFA 3W8DA 1YB5A 3D4OA 3I52A 4ALIA 4M49A 1TT5B 2HMSA 3FF4A 1R37A 3DB2A 1JU9A 1L7DA 1I30A 3QE3A 3ONDA 3ASVA 3ANMA 2NV6A 2H63A 4Q39A 1BXZA 1E3JA 1HXHA 2HMVA 4R51A 2NVUA 3I4FA 3HDHA 3G79A 3VKVA 5AXDA 4UVGA 4XRRA 5H82A 2ZYGA 3LVFO 1GQYA 4K9DA 4BGVA 3DBHA 1Z6ZA 1AXEA 5U1PA 3HNPA 4XYEA 3UXYA 5IJZA 2C29D 5JAMA 1B0AA 3FRJA 3WNQA 5BNIA 1Z7BA 3HSKA 2E82A 1AHIA 4QFDA 4ALLA 3LQFA 1H94A 3ROPA 3GY0A 2GN6A 4E5NA 1H0KA 3RWBA 1UDAA 1DRWA 1CEQA 5JY6A 1WZEA 3F5SA 4LK3A 9LDBA 1E3SA 4LW8A 1L7EA 1GEGA 3OSUA 3ORFA 1ISJA 1YVEI 3GAFA 2JHGA 1P0FA 3MZ0A 1B14A 2H6EA 5T5QA 3VHRA 4ESOA 2D0IA 3FTNA 3Q9NA 5BSEA 3GH3A 2YHIA 3EY4A 3HE3A 4YAKA 1MC4A 1EMDA 3DFUA 2VHWA 4H16A 5BSHA 1LEHA 1V6AA 3IAHA 4D0SA 2I6TA 4J16A 1JAYA 1JWAB 2CZCA 3DZFA 4CLOB 1NAHA 3JQGA 3WFIA 2ZTMA 5COAA 1E7QA 4YTEA 2Z5LA 4IY1A 3E9QA 4S1VA 3WQRA 1E0DA 2HU2A 2GD1O 2X6TA 3DOJA 3LDHA 4UREA 4XA8A 5L4SA 1SZJG 5B37A 2G17A 4PLVA 4DPMA 3RUHA 5FF9A 4YBZA 2I5PO 5L7YA 2Q2VA 4GGOA 1E3EA 4CV1A 1I01A 2J8ZA 3WIDA 1HDYA 1GYQA 3PK0A 2X22A 1GUFA 1BGVA 1CF2O 5JO9A 4WK6A 1UH5A 3ABIA 5EQFA 3RC9A 5CDGA 1PIWA 5T64A 1F17A 3DMYA 1VC2A 4BKUA 4MINA 4HNGA 2HSDA 5JAZA 5L45A 2CUKA 4NJMA 2Y67A 2IYOA 1X7HA 4D7AA 1F14A 1HF3A 1UP7A 1HE3A 1UDCA 4FR5A 4R9RA 4B3JA 1DEHA 5HRUA 3KV3O 4IDEA 2OL4A 1HZJA 3VVBA 1ZJZA 1IOLA 3JQBA 3AK4A 1DDOA 3I6IA 3N7UA 3ZU3A 3TJRA 2WDZA 3ZHXA 1M2WA 4E13A 1QYVA 3KLPX 4MVJF 2FSVA 3ITKA 3GGGA 3C1AA 3UN1A 2X7HA 4XGKA 2UAGA 1RJWA 1O8CA 2ZK7A 4YQYA 1Q0QA 1GCOA 1Q1NA 4GSKA 2JFFA 4QQRA 2DFVA 1QYWA 4B4UA 3PDUA 3NTOA 1LJ8A 1WWKA 1TT5A 1NVMB 2X5KO 4E30A 3OJEA 3P2YA 2W4QA 1G0NA 1JQBA 4YJDA 1X13A 4ALNA 3BIOA 2VHYA 3GUCA 1XU9A 3DOOA 3OJFA 2PGDA 1X14A 3V8BA 3FBTA 2ZJ0A 1A9ZA 1OAAA 3A4VA 1SO8A 5T8KC 2I65A 4KUEA 1PJ3A 1BWSA 4J4HA 1OBFO 3E5MA 4IXWA 1O95A 3F4LA 3K73O 3N58A 2YHIB 5ADHA 3MOIA 3FN4A 4ZQEA 4YPOA 3F5QA 1ISIA 4KOAA 3PJDA 1O5IA 1GDHA 1QV7A 2G0TA 4GLOA 2WE7A 3H2ZA 4IJWA 1LU9A 1LLDA 1U4SA 1ZUD1 1IULA 1ZSYA 3RUAA 2VRCA 3DHYA 4R3WA 4WUVA 5IN4A 5L53A 4BKPA 2FMUA 5JCJA 4RVDA 1F0YA 4NBTA 3IKTA 5DZSA 1Y5MA 4J7UA 5JYDA 5C37A 4BNIA 2IE0A 3W4KA 4D45A 4XKJA 4XQGA 4OXYA 1EFKA 4CL3A 3ZV5A 1PZHA 1LSOA 1YGYA 2IXBA 3CMCO 3KHUA 4MVJA 1G1AA 1YE3A
chains in the Genus database with same CATH superfamily
2DHQA 2JH8A 1DCMA 2YIDA 1N25A 3HGQA 3ASUA 2I7XA 2VEOA 4XEHA 8ADHA 4TWAA 3ZCTA 4DBZA 1MAVA 4YROA 5CT6A 2RIPA 3VDNB 4HWTA 4TMZA 2HDOA 5M3BA 2AOXA 2B37A 3CLUC 3GRPA 5ICGA 4B82A 1H1TA 2ZUEA 621PA 4GOND 4HNQA 4RIEA 4TZKA 4X97A 5LUAA 4GWLA 1N8TA 2FPUA 2RHWA 5JV5A 2VF4X 4OHVA 1UAAA 4Z8XA 2P7IA 1GV1A 4HYYA 4OYYA 1ZA2A 5I9MA 3U7FB 2ATCA 3COJA 1NX9A 1F0PA 5E8JA 2AQ8A 3QPCA 3L07A 2CVFA 1GPJA 4QJ5A 3R7LA 4GU5A 1GEEA 4D96A 2A0YA 4R05A 3HKBA 2Q7OE 2JD1A 3AVQA 2HMYB 1M2VA 3QXHA 2LE0A 4FSXA 1P2FA 4LHXA 5G4KA 1IVYA 2FVXA 3R5XA 5JNLA 3QVGB 4ADSG 4JXZA 1KBQA 1Z8NA 3D7LA 3Q3EA 4DMUB 1NLUA 4MI3A 5KX5F 1V1JA 4FGSA 1J2UA 5C31A 4EPXA 4HGOA 1F4VA 4NK5A 1P81A 4Z5XA 1PLJA 5HJEA 1JFSA 2NZ8A 1JQAA 2Y0CA 4IIVA 4BE4A 4BMZA 2D62A 2YZ7A 2ODTX 2ZGVA 3E18A 1G59A 3EMDA 3UANA 4RZQA 2CFCA 2D1QA 3A27A 4KXXA 4QC2A 5JH7F 4ZOQI 3PXXA 5CFLA 2CMGA 1SC4A 1BKSB 2FPIA 2HJVA 2IFTA 3A1TA 3K09C 5TT1A 2YZMA 1A4XA 1TJ4A 2A0WA 3T7AA 3W7AA 1OOEA 2G5TA 1PJLA 3GLIA 1RHJA 2WMDA 2Z5FA 3SEFA 1Z7YA 4DIBA 4Q7EA 3TMKA 4YCMA 4ZAWA 5AVYA 1UFVA 1X7WB 3S2ZA 3DP9A 1AGNA 3W05A 2HF2A 3C3MA 2NUBA 3MB5A 4WCFA 2UZ4A 1ZGBA 4LQ4A 1Q3HA 5EPUA 4UBMA 821PA 4WW0A 4WQMA 2B5VA 2B78A 5IUNC 5SZKB 2WNHA 1ATIA 1TCVA 5IDVA 1JFRA 2NU6B 3QE4A 5G2OA 1NXPA 3BGOS 3KVOA 2P9GA 4D02A 5IZCA 3FPKA 3QEBZ 5HBRA 4OGFA 2XCQA 4W7IA 1LX7A 1TYCA 2UVQA 3AR3A 1Z7WA 2F8MA 2IZ1A 2QXUA 2WICA 4HQ0A 2CLIB 1ILWA 4LHYA 3C7TA 4TWBA 5ED4A 5FPTA 3FVVA 1H42A 1XWIA 3E3LA 4F4CA 1GSIA 5EIAA 2DR2A 4ZICA 4RS3A 4L51A 5LMCA 5IXSA 4I4LA 2Z04A 4B6EA 4XH9B 2QXTA 4G0QA 1P5FA 5CLGA 3WL7A 2WMNB 3ABZA 4L5JA 4PXSA 1QHGA 2C5AA 1QYDA 2RHGB 3FCOA 4IINA 3UH1A 4LRTB 4BTLA 1KYQA 1N2GA 2O8CB 3A31A 1XQ6A 4E5PA 1SBTA 4CKYA 1JTEA 2IK8A 2VTBB 1GNVA 3EC1A 1JVSA 4WY8A 2CDAA 4QUIA 4HK4A 1NLYA 4NY1A 4Q3BA 1V3VA 1MOSA 3IVMA 5IW8A 3NGLA 3G5AA 3R0QA 2IPMA 2XODA 1QFZA 2ODAA 3M4NA 1ORDA 2DT5A 4Y7DA 3VUFA 1M76A 2P0AA 1P33A 2AE1A 1GA4A 3G0BA 1YJBA 1KJ9A 2VVTA 1IHDA 1SB8A 1RDFA 2IYRA 4UTOA 3OQIA 1MJGM 4KUGA 4RV9A 2XSZD 4YJFB 5K3SA 5ALOA 5SZIA 2O8BB 2ZSKA 3FI9A 3ZK7A 3PQ7A 2XVAA 3QKWA 2NO5A 1L7VC 2VA8A 3C6KA 1XD8A 1VRCA 2EX0A 3F6YA 2FB9A 4OD0A 3U7QB 4BMXA 4URXR 4EWLA 2FWRA 2C5GA 2M6SA 3AFIA 4GNKA 4RKRA 2C7BA 3O38A 3N0RA 1J0AA 1JBEA 1NLZA 4WOCA 5HX7A 4NXNB 3MCTA 1GAEO 4RSGA 2QJWA 5P8WA 3IB6A 5E9AA 3BEDA 3K0FA 2J0VA 1DMSA 4JBXA 2Y1KA 3BXXA 4A6PA 3FCAA 1RKBA 1Z63A 3GA5A 3OZDA 3FOFC 3RH0A 2CE7A 1JJIA 1ZZGA 4B6JA 1X8KA 3FRIA 3PC7A 2IL1A 1WUIS 9GPBA 1JKJA 1JNXX 1VPLA 2Z8ZA 4EKEA 5ESDA 2E4ZA 4KQXA 4P3NA 3PUWA 5J2UB 2V4UA 3VR6H 3U1BA 3CMMA 4FZVA 1J9EA 2AQHA 4PIMA 4EG1A 3RIHA 3UA3A 1IZ9A 3BE8A 3OBIA 2V3CC 4Q19A 2IS4A 2WVJA 3AWIA 3MFYA 3WGIA 4ITVA 5F9FA 2HUNA 3JQAD 3KUDA 4RFLA 5FAXA 4IIFA 2QRZA 3SDBA 2BSXA 4KN8A 5JC1A 3T3NA 4H6VA 3ICWA 1HSOA 2XD9A 4HGYA 3L0OA 5AKHA 5BVGB 4MV7A 4D44A 1N2CB 4C6TA 1LLUA 3TOVA 1J9GA 4JR1A 4Q9NA 1RHMA 1Y98A 4R1QA 2XA1A 1I36A 4X64B 1XYVA 4HNUA 3RM3A 1WZ2A 3IHLA 2Y9PB 4ZVSA 2YHUA 1ZQ1A 2H11A 1QOZA 4XM2A 3SC2A 1HLGA 1R1DA 3IT2A 1XT6A 4DNXA 2H5JA 2DKNA 1XRLA 4NOJA 1YB2A 2ACKA 4FFSA 1DC7A 4LSGA 3QEKA 4KEAA 4F8JA 4IDAA 4HNVA 3PFKA 4NDNE 3V00A 1RMYA 3H1TA 2BCJQ 3PRKE 2GN2A 2X1HA 4UJ5A 3H84A 4H1WA 3OOEA 2AOVA 2PS9A 3OF5A 4Q16A 4QUKA 3FUVA 3EYAA 3M81A 5AI5A 5FWYA 5ICMA 2II6A 3E7FA 4JFRA 1M8GA 3AUJB 1YBFA 4MHSA 5IF9A 1QP7A 1EK2A 8ABPA 1IQUA 2A0XA 5SZHB 3FDJA 3L7YA 1CQXA 5HBGA 2Z8XA 3OG9A 1JSCA 3IKMB 4M8KA 2A1UB 4DIOA 3OQ1A 3ZTWA 2X0JA 1XTTA 3L8MA 3L7MA 4KXQA 4P54A 4KLAA 4NWIA 3U5TA 2ERYA 3AY3A 4YCSA 2JNWA 1CUWA 3KVYA 4XX1A 2GFIA 2X1MA 3NHLA 3H2KA 3BB1A 5TJ9A 3ZH2A 2PKQP 3STUA 3VRHA 2HU5A 3VNQA 3WWOA 2P2NA 3WLEA 2H1OA 1T9AA 4RE5A 5F2OA 5HCIA 3SI7A 5EUQB 1EXVA 2CLKB 3G9XA 1U99A 2XUGA 4HVAA 5DIZA 3PNKA 1U0BB 1JR2A 1XQVA 3HL0A 5E2AA 4C7BA 5KDDA 1QFXA 4LYDA 3H9UA 3VR2A 1M0EA 1NBOA 3BORA 1BGXT 3K1TA 1GQFA 2BEWB 3BZUA 4D9FA 3VAAA 3NOXA 5KU1A 1N92A 5J2TA 4PX2A 3L4KA 3QY9A 1N1DA 3A3YA 2BZGA 4INOA 4YUWA 4OI4A 4JLNA 4WRRA 5DBIA 5AK0A 3OCJA 4W99A 4YJ2B 1KOGA 1IAQA 2HW8A 1YZQA 1WMFA 4L1KA 4KMMA 2BRUC 1ZOSA 3NFRA 4TVOA 3QEOA 2HIGA 1AKNA 4X3OA 5EJ5A 3BK1A 3WKBA 3FOCA 4IAOA 1KYVA 4UHBA 3HTXA 1VYUA 3BRSA 1HQKA 1OYOA 3MJVA 4DMCA 2QBYA 3RUIA 3DOCA 3V8EA 1NJ8A 1EDZA 1LLQA 1UANA 3QE9Y 4YR9A 1WSWA 2GZAA 4TTSA 1I24A 4H7HA 4LBZA 1TO6A 1VYTA 2R68A 3CN7A 4GLLA 3ACBA 4WKCA 1JKMA 4ZQHA 3R24A 2YH2A 4WK2B 5L3VA 2ZIFA 5CVTA 1PGJA 5GM1A 2VQDA 5ICCA 4NCNA 1FFYA 1S3GA 2QY9A 3Q8XB 3GA0A 4LJLA 3UY4A 5B3LA 2ECPA 2H0AA 1H8ED 1R18A 1TJPB 3IQGX 4MLZA 1KARA 2SNIE 3N7TA 4KAAA 1MA0A 1OX4A 2ADFA 2ZPAA 1ZVKA 4O4JA 4RNDB 1G17A 3V3KA 5F2KA 2AOTA 3PVZA 2E6UX 2HLPA 1SOAA 2XQJA 3GVCA 3DFKA 3VSBA 2DUMA 4R16A 4GP7A 3QNWA 3TF5A 3RC8A 1QGUB 1ECJA 1Z17A 3GRRA 4L78A 1P9OA 1FBTA 1S2DA 2L69A 3BN3A 4B8WA 1PGPA 3AZPA 2R8YA 1KJQA 4H6PA 2X4LA 4OJYA 2J87A 3K53A 1IY2A 2NQ2C 3USES 4NLLA 1F1JA 3BWCA 2I91A 1MQAA 1E61A 2OGTA 5K6TA 1F7VA 3DHNA 1P7YA 5P21A 4BZWA 1U2ZA 1XDSA 3ICCA 3MTAA 1HDGO 4QXOA 1C4WA 4PCAA 2HIMA 1U0LA 1LDEA 1Z4KA 3JW8A 4WZBB 1E0SA 3GDGA 4E3ZA 3EPRA 3MT8A 4G8JA 4MHTA 3ESCA 3DKRA 4NVRA 2R8XA 1DC3A 3T15A 3AGQA 4RWZA 1Q6YA 1NQXA 1QDUA 1H69A 2B7BA 4L5IA 4F2DA 2JGJA 4ZCSA 1V7ZA 4M8IA 1CYEA 3RVKA 1PT6A 3DXFA 3ZPXA 3RTGA 1IATA 1F9AA 2O5VA 3O2SB 4S1OA 3VU8A 3AV0B 2A9RA 2IU3A 4DG8A 1XF1A 2HJSA 4O29A 4JLVA 3ROTA 5HHTA 3VZDA 1P18A 1UL1X 3IEUA 2PJZA 2Q21A 3FLEA 2HSZA 1AKWA 2YW9A 2GJ4A 1C9NA 4N0EA 4CNQA 5BMVA 3AI3A 1KWKA 4M1TA 1X8LA 5T67A 1JBQA 1NN3A 4MV3A 2B4RO 5EIWA 3O21A 2EZTA 3B7WA 4F38A 2CMFA 2OAGA 2N1MA 3HFGA 4O4IF 4OH1A 3ENKA 4B0OA 1VIVA 8MHTA 1KH2A 1NJFA 3F46A 2GM9A 1JR6A 1G6Q1 5E4JA 3WL3A 1U9YA 2CB0A 3U26A 3KPUA 3IUPA 1T8PA 1X9GA 4PHTA 3T3EA 1PZEA 3I05A 3GFBA 3P9RA 4EB0A 4U3JB 1PZXA 3JAWA 4X6XA 4O2BA 3BQMB 1SKBA 4PYNA 1NATA 3UJ9A 5K7SA 3V8MA 5B64A 1AV7A 1DUIA 2A2ZA 2VOJA 4LI0A 4TKUB 3TCKA 2QM8A 3PGJA 2Z5GA 3FVRA 3JATB 5AKKA 1YJ5A 2DHDA 2IV3A 1L7AA 3TFQA 3PEEA 3NMUF 5LQMA 1WTCA 1I7LA 1MFPA 2RHJA 4LTNA 4YJ3F 4EUKA 1XZQA 3QVUA 1M34E 2PRZA 5KWJA 4JIGA 4ASUD 3ZDDA 4OHMA 2VUTA 3KR0A 5B1SA 3DTVB 5DK6A 1IPEA 1Z8DA 1JDNA 4X63A 1F4LA 3H99A 3DKVA 3QH4A 4Y7CA 4QBGB 4NMLA 2ZULA 1GG8A 2AX4A 2V7VA 1MC5A 2VQ3A 2K2WA 1NFFA 1Z0KA 3HZZA 4AQDA 4CKXA 2EP7A 2FMFA 1ZM4A 4KBYA 4BVEA 2XVMA 4YUAA 1P4JA 5DHFA 4JT4A 4KIWA 2H59A 3W2FA 4HATA 4KMOA 3C7DB 3AQ4A 3F1LA 1BE8A 3CUVA 2IYVA 2PS1A 3SX2A 4W6QA 2C5EA 5AVOA 1P1BA 2CWDA 2XECA 2ZXEA 3OUZA 4QTTB 1DX9A 4DCVA 3H2YA 3E8SA 4ER0A 5CM2Z 4WAUA 3MTEA 4GIBA 2WY2D 2PGAA 1AA6A 3PGA1 1LZLA 1C81A 5L3RA 4LF8B 5L6LB 1A97A 4S24A 4BLVA 2ZTUA 3LGSA 4EHNA 1M2VB 4GZ6A 5GINE 2QTTA 5F23A 4HDKB 2B25A 4D9NA 1EVJA 3SS9X 1TUGA 4A27A 3B2QA 2ZBDA 2A84A 2PZFA 1CS4C 2QSJA 4UU7A 4DJDC 4B84A 4DCJA 3BK2A 3JASA 4HPWA 5IC4A 2XPCA 3QWIA 1JVBA 3DE2X 1AUVA 1L5FA 1GTJ1 1QFJA 3VDXA 3BERA 3A28A 4PC3A 5AUQA 2XRZA 2KBEA 3V2IA 4J91A 2WT8A 3DDNA 4LVUA 4ECEA 2B8WA 4OQPA 5IJXA 3QELA 1JDJA 1XCPA 1J5EB 1NW7A 1IXRC 1TO1E 1G7CA 1UXKA 4UTXA 1W76A 1Z16A 1G20B 4I1RA 1BD3A 1RWBA 3AERA 5ALXA 3RK4A 4LBYA 2IP2A 1FY2A 5KREA 3G2PA 3KDSE 3HM9A 4MNTA 1DJNA 1NVDA 4RCZA 3KPVA 3IYLW 2PUDA 5CJJA 1WW2A 5ILQA 1N2JA 3V7UA 2OO7A 3PUXA 4IDOA 3I8SA 4CG1A 2DBZA 3Q41A 4Z9FA 3VHXA 4M2LA 1Z2DA 2CXOA 1CS0A 1KDTA 4G23A 4K6CA 3RFXA 4EO9A 3JS5A 4H1HA 2HTFA 4URHA 2DUNA 2XNKA 3A36A 4JR2A 5B2EA 3UC9A 4PO1A 3DEIA 1JJFA 1VPEA 2VYVA 1YR2A 1MRSA 3B1VA 1TLFA 4DAEA 2RE8A 3TM5A 3HWX1 2QENA 4A8PA 3TH5A 1DOAA 3NBAA 3EZXA 3UK1A 3TX2A 3FTCA 3LBAA 3RNLA 1HKHA 3K6KA 1A71A 2YHBA 1JLHA 2IELA 2NM0A 3SIPA 3GAZA 4BX3A 3NQ41 4NF2A 3IIIA 4YDRA 2YNMC 2ZSUA 2NZXA 5HCUA 3GUYA 4DJTA 3IQFA 1ZCAA 3N2IA 1Q21A 1R3DA 3ZGOA 3DMTC 2FZVA 1KWGA 4GO1A 2FH5B 1AKUA 1J2EA 3GV0A 2O3UA 2NSDA 4PRYA 2QTHA 4RZIA 1NVVR 1QPBA 4I4TF 4IEFB 4YDHB 4AUNA 4RH0A 3PGMA 1CUJA 1VIDA 1XB2A 3ZX4A 2HJWA 3QBJA 4B4VA 2J4CA 1FXUA 1G9TA 3KLMX 5K0EA 3QI7A 3KZVA 4EA6A 5FA8A 1CIVA 4V3BA 2PD4A 3N8GA 3WB9A 4ILKA 1MVNA 1BNCA 2GCOB 2RAVA 4B71A 4CEJA 4PQEA 1JMKC 1U3FA 4MKXA 3U80A 3GT7A 3AO0B 1WPQA 4M9UA 1IL0A 1EWTA 1GGFA 1N6RA 3EOAI 3R3ZA 3T99A 1LJLA 1T2NA 2BTQA 5LNK6 4J07A 4D0NA 2EBUA 2X0RA 4URVR 2NACA 4UMVA 4IYRA 3V42A 1MOQA 2OCYC 3LQ1A 4IKPA 1JEYB 2R6CA 1X38A 5DP1A 3D54D 3QYJA 2DPGA 4I55B 1ULAA 5FOUA 5A9TA 3RSOA 2WHYA 4HGRA 2CKDA 3SE7A 4REOA 1CULC 1JILA 2CLCX 3FR8A 1NOIA 4OGLA 3GRZA 2UZAA 5ICFA 4FT2A 4OBXA 2C4TA 4UPDA 5HF8A 1HEIA 3AUKA 3RU3A 1P80A 5AVUA 4CCSA 3WLJA 3LWBA 1RZRA 2YN0A 2BFBB 4YI5A 3KQHA 5CURA 3GLTA 4B81A 4QPZA 2LNDA 4L4XA 2UUPA 4JJKA 2H17A 4QDTA 4AG6A 1YZVA 4C21A 1VKJA 4NZ9A 1X3LA 2GNAA 4BKOA 4DQVA 2JHCA 1E5QA 1LB1B 1Z25A 2GK6A 3DOEA 3E3MA 5L8VA 2EFJA 1FPMA 1ODTC 5JAQA 1FXSA 3CEPB 3JQFA 5JZBA 3VA7A 4BZZA 3WL8A 4AQ7A 4Z1MD 1GL6A 2ZTHA 4AUMA 1LI4A 5AHWA 3R5KA 3WWPA 3WLTA 2PMCA 2ZJ3A 3W6NA 1FU4A 1BX3A 4C6HA 3KHTA 1FYEA 5LDHA 4I5DA 4J43A 3SYRA 1WABA 4XPIA 2DETA 4QUDA 3UBMA 2ONYA 2Y0DA 1OASA 5BNWA 3AHCA 3NEYA 1OZ0A 3V4PB 2OKCA 1Q91A 1WZIA 1GGVA 1K9VF 2NSLA 3BSSA 1FNSA 4NV0A 4QTYA 2EV9A 1Y6GA 1R2QA 1VL0A 3C3YA 3INGA 2ZJAA 4FQ8A 2XBLA 4LZOA 1BEEA 2GN4A 3DA8A 2H4WA 5E1OA 2YMMA 4FB5A 1ADGA 2HO5A 1GRQA 3H13A 1NAIA 2HNAA 2FETA 1CQPA 2ATVA 4NG5A 2OHJA 2IY9A 1I3LA 3HN2A 1BFUA 1I4OA 2LCIA 3D4IA 4RKEA 3CGGA 4IGEA 3RVDA 4YT2A 2Z6UA 3M5PA 2B20A 1JHOA 1SN7A 3C5EA 3PNSA 5HJ7A 3CQ9A 1UK7A 4N5LA 4KFCA 3FCEA 3VNSA 1PQWA 4Y0NA 2D13A 2O3TA 2YZ2A 2ECQA 2PK3A 2CL0X 5EP4A 3T35A 2JVJA 1UZNA 3OLVA 2J67A 5D5HA 4RC9A 2IUEA 1K7CA 1MV8A 1TVKA 1YZLA 1UZAA 2F00A 5K8TA 4E2XA 1KPGA 1TU3A 4U1RA 3WTCA 5I3ZA 4CN9A 4ZAZA 4DR5B 4ZRDA 2OK7A 3FR7A 3F2IA 3K9GA 3LHKA 4YMSA 3C16C 4DVJA 3G5UA 1STOA 5FYQA 2WG1A 1PHPA 5GOZA 4CIDA 5IZ4A 3EF1A 3IP9A 1XSEA 2HF9A 4PZ9A 4ZKEA 1H4SA 3PQ5A 1Z07A 4K8RB 2B30A 1G6OA 5K0ZA 1A4UA 4N3NA 5IUKC 1TQ8A 4OB6A 5CEEA 1U2GA 3BDAA 4UU1A 1V5EA 2QF7A 3RS4A 4EFKA 4OQXA 4TZTA 4OUDB 1N0VC 2XAUA 3GNTA 3ZU2A 3F74A 5LN1A 4ZVLA 5JS6A 1FIUA 1ORRA 1S7CA 4YFYA 1CR4A 1E4EA 3PEUA 5AXAA 3S2FA 4EA9A 5FL3A 4Q3DA 1N5DA 4PFSA 3NIFB 1NRXA 1PR2A 3ECSA 1GYPA 1EGVB 2P8JA 3V4SA 4QYIA 4ZJYA 4B3XA 4EPWA 4HG2A 2HR1A 2Q4BA 5KNCA 4TT8A 3EDYA 1NHWA 2B4QA 1Y4ZA 3FCUB 3G2KA 5CLHA 3H5TA 3S28A 4V02A 4M9RA 3CUUA 3FCCA 5ETJA 4R0MA 3PNPA 4NFSA 1XNQB 2RGXA 4RY0A 4MI1A 3EHEA 3U49A 3JY6A 1LW7A 1W6RA 4QO7A 5ITWA 3T5TA 4MW0A 3Q12A 3ZVKA 4JI0B 4RTRA 5F12A 1FP1D 1KU6A 1DXHA 2FX2A 2HRZA 1U4OA 1VL1A 3B20A 2PKYX 1JEDA 3H6HA 5K0LA 1VIAA 1MG0A 5JH7A 2PO5A 1RWMA 5KMGA 5JJKA 4AJJA 3KYBA 2EJBA 3H1FA 1VHLA 1Z36A 4U6SA 4QWMA 3S4YA 4HDOB 3IQEA 3I2KA 2YIJA 5CVDA 3IPXA 5DHAA 5DT9A 4GS5A 3SPXA 3WNDA 4G5OA 6CHYA 1P8JA 5E6RB 3LXRA 4WINA 1AE1A 1M2NA 3LXXA 3PC8C 4JJ7A 5FPYA 5CNMA 5B58C 4E21A 2VAMA 5MN5A 2DFNA 2GBGA 2VHQA 2GOYA 2YL2A 4PICA 2NU9B 3N87A 1KDZA 1P74A 3GEPA 2NPOA 2G8NA 1Y63A 4IP0A 2V6JA 2FP3A 2JAPA 4BE7B 1LSJA 3LX8A 4QDZA 3MQFA 3DUFB 4AZ3A 1CQJA 9MHTA 3MERA 2HXGA 1XZLA 2HHAA 5JDIC 1TEHA 4EKYA 1UOQA 4LDRA 4GRDA 1FPQA 1E2MA 3OTQA 4XEUA 1VSBA 3TW8A 1GADO 1MB9A 1P9NA 3KPWA 3NTLA 4D8VA 1Y8QA 1PJBA 3KVRA 1CY1A 3GFRA 2LRHA 2E1PA 4OB7A 1SXJD 2AG1A 3B5EA 4DCSA 2AUNA 4AS1A 4ZU6X 3UGTA 3O91A 1RD4A 4M1ZA 2Q41A 3A4LA 1O7JA 2NAFA 3GFTA 3PC6A 4KIUA 1Q95A 2OB2A 3HABA 4EF4A 3UWOA 3KR9A 1XBTA 1KS9A 5DHQA 3W7VA 6YASA 4ZI5A 3S8YA 3ZHZA 4YB8A 3I28A 3MSXA 4J0KA 4BYMA 4DG5A 3G8BA 1I2DA 4IDGA 4JJGA 1VTKA 1ZGHA 2O48X 3EBLA 5T4BA 4TVKA 2OUIA 2XSZA 5LL6P 1FRQA 3QPAA 3U7IA 3DHVA 3SXUA 4KO2S 5BN3B 1J8MF 3ZCUA 1R6VA 2IKSA 1Z3IX 1V3TA 3DGFC 4HDCA 4IDCA 5HE8A 1P4AA 4R68A 2C78A 2R2GA 3E9YA 1NJSA 3TQQA 1JMYA 5K0FA 3OMLA 3VR3A 3U7EB 3BMCA 2Q7XA 1N6IA 5EIBD 1TD1A 1QUFA 2WT9A 3E8XA 4IMRA 2VCHA 2WJZB 1DKMA 1U04A 2O7RA 5FFMA 4YMUA 5JBIA 2G0NA 5FADA 4DQKA 3I9JA 1XJWA 3AR4A 5BMVB 2AWNA 1UJ6A 3MRXA 3IOBA 2ZXFA 1KYYA 1PYOA 1GAWA 1VE1A 3LV8A 5EMHA 4PW0A 2HCFA 4E2YA 2VLIA 4GLFA 5DWQA 2MINB 2Q50A 3W3ZB 3RB8A 4H0FA 2QUHA 2HDWA 2MOKA 1JE1A 1LBIA 1YU6A 1E2KA 3I39X 3K1YA 2TMGA 2ZB4A 5AW4A 1M0TA 1QDEA 3ITNA 4MGZR 3LUCA 3FMGA 1T4BA 2X8WA 4JR0A 3TTSA 3TI7A 2FF7A 3KEOA 3WLNA 4P4LA 4XYMA 1U65A 2VL7A 1E3MA 5AVQA 1VI5A 4HP8A 3EGDB 5I6DA 2EWMA 1T9DA 4Q7JB 3RG8A 1TADA 3MXTA 2V58A 1R3UA 3QPVA 3E53A 1XQWA 3CRNA 4B7AA 4NXMB 3R2JA 3DMTA 1E96A 2JGMA 3IEPA 3NT5A 5IHPA 2G7ZA 3FOZA 3NVKI 4TQ9A 5J1TB 4BV8A 5CDTA 2Y99A 1F3OA 2E4WA 3D1VA 3IEXA 4M60A 4D1YA 4DUGD 4WFKA 1UPCA 4NENB 3EB9A 2J33A 4D8XA 1BA3A 4WJLA 1VPDA 2DU8A 3PNBA 2JBAB 4C22A 4RHFA 1KORA 2B8JA 3R3HA 1P60A 4DT1B 2R87A 3HXMA 3TD6A 3UXMA 1NFRA 1BA2A 4M9QA 1ZMOA 2Q6IA 2QDKA 3I9MA 4ZU3A 1OE0A 2XMZA 3UO8B 2FUEA 2UZIR 4BPBA 3RFVA 1H1LB 4I99A 3O26A 4I5IA 1P0PA 4D4IA 1VGVA 2D8AA 4KFTA 3UCXA 3KT8A 4R3NA 2X0KA 1W29A 4DHWA 4C01A 5GZ3A 5K0GA 4H7DA 2X5NA 2GUWA 4YRFA 4F5WA 1F2TB 2F1RA 1ND5A 3JQ7B 4KFSA 2XNCA 3R7WA 3BZBA 1KJ8A 2OESA 3Q72A 4TLCA 2P2GA 3S2EA 3G0DA 1X7XA 1O96B 3REQB 1G66A 1QJ4A 3NUQA 3RANA 1I13A 2AEEA 4XB2A 3ZQUA 4F0JA 5EGSA 1HRKA 2O2ZA 3FPCA 4QYTA 3ZY5A 1E2GA 2YXNA 4NNOA 2H4ZA 2O14A 4TV9B 2VK1A 2QRUA 2O2SA 4ZHQF 3LPAA 2QW8A 1LPNA 3ZG6A 4B32A 1H3FA 3LQQA 1F1BA 1CUDA 2GBIA 4FGKA 5CUQA 5GMOA 4E1VA 1X1CA 1VSTA 3L05A 5JPDA 1HFEL 3QXCA 3GVHA 4O63O 2IYYA 3MJSA 4R7ZA 3A1NA 3O1LA 4ZAFA 4DKJA 4PAOA 5J1SB 3REFA 5HA5A 1K2WA 4EMSA 1KZ1A 2H0RA 3FVWA 4MRSA 3QP9A 5AKXA 1L7NA 3AVPA 3O4FA 3SE0A 3T6KA 2XRFA 2EJTA 1P6UA 1R00A 1NT2A 1ST2A 3D6MA 3GRYA 3TLGB 1AQIA 2VWHA 2RGCA 4OYRA 2OXIA 5ALEA 1LK7A 1A9QA 2FRVA 3C7AA 2ASVA 2C2KA 2V8BA 3RSFA 4F86A 3VR4H 1XPUA 3LT1A 4M9ZA 1RRFA 4N0QA 1FMFA 1JUDA 5K45A 5J2UA 2RK4A 1VLVA 2W2KB 3UQZA 1QVWA 1MG5A 1SD5A 2ZE6A 1U3GA 2ZU6A 1E8DA 3H4VA 1NE2A 4QFCA 1O54A 1J20A 5AK5A 2C59A 2IW3A 4DPKA 4WLEA 1D7OA 4EJSA 5BY2A 4DV7B 1ZESA 2WD7A 1TTTA 5A4MS 2P4QA 3M7IA 4ZMSA 1D6NA 4LJKA 1WDTA 2M1ZA 2MSCB 4BVHA 3ZIAD 5HSGA 4N41A 2ZZNA 1CEEA 1ZBDA 2JFPA 4JL5A 3ZOKA 2WHPA 1RBMA 4HZUA 3K0KA 4IRUB 2XUZA 1BGWA 2QX8A 4R71A 1C30A 1Q0SA 2D4AA 5MN4A 1QNLA 3WICA 1CRLA 2E87A 1E2FA 1NI4B 1TU0A 1BW9B 2F3RA 4MMZB 3HADA 3N0TA 3DONA 1KEEA 1V8BA 1E5VA 3WLHA 2AD5A 4ZXFA 4F5DA 1PT5A 1GD1O 4LY6A 3U5ZB 2NXCA 3N05A 3I1IA 4IJUA 3JASB 4RKQA 2F62A 1PDWA 2R86A 3RYFB 3MTJA 5KNCH 1DC5A 2H7CA 3NBQA 5DM0A 2DTEA 2EHDA 2C83A 4Z1MA 4QJ3A 3RS2A 4RHYA 1T1JA 3AF2A 2DBVO 2VZEA 2KPOA 2R96A 4YCBA 3NALA 5JTTA 1ULBA 3O73A 2ECOA 1JTFA 3EA4A 4YRMA 2BYTA 1EVEA 1SXJA 2AZMA 3KU4A 1PVDA 3CV3A 4FN4A 4HN9A 2Z3WA 4RORA 1W1WA 5EJIA 1VFPA 3AY6A 3N9IA 5JFOA 2QAJA 2ZS9A 4K9SA 3R7SA 1DHTA 1XD2A 2A59A 3MYRA 3OSZA 1UEJA 2BEWA 2A9VA 2V3VA 4EMBA 4YV7A 2QYOA 1JLKA 1E2IA 1KOJA 2CEAA 2OO3A 4TGLA 4D57A 2BEUB 1SCQA 4R84A 3C3DA 2FQXA 2VPYA 1KI3A 5B7PA 2P8SA 1NULA 1SOVA 4Y6GB 1SXHA 5KYTA 3WA7A 4QGHA 1XMOB 3F4BA 3N2GA 4RFVA 4S2UA 3FHJA 3CPSA 3GGJA 5EPOA 4CGZA 4PBSA 3HDJA 2YJ4A 3W5UA 2OLKA 2XMQA 2V59A 3EAGA 1XU7A 5B1EA 4YP0A 3T5DA 2F3SA 3F7NA 5AOAA 3UOWA 4UAJA 4Y0AA 1DDGA 2FGKA 4J2HA 4TTVA 3L6UA 5TF4A 4DLTA 1H05A 4Y3UA 1MB4A 3OPYA 3OTOB 4W9NC 1GITA 2YWRA 3C8ZA 3C45A 3NEJA 5CT4A 5EP2A 3RADC 1QHHA 1QG2A 1R8JA 2XRYA 3B6KA 2HIAA 1C3XA 1P7CA 3R3UA 3KEQA 4LE0A 1GZ5A 1OV6A 3PIRA 4Q3LA 3C6BA 3JWEA 4HQNA 1PCXA 2WYVA 5J59A 3NI2A 1SUCA 3RJTA 3ZZTA 4CNBA 1KZ7B 3ND9A 1X7ZA 1S6YA 2Z83A 2HK9A 3BH0A 3AONB 1QIIA 3KO8A 4B5LA 4L02A 2NQTA 4LCBA 4XUGB 4I2NA 4F3YA 1WY7A 4X1OA 1U2QA 3OM8A 4UU0A 3SBOA 3QU4A 4BFZA 1QG4A 1NXSA 1W0JD 3EODA 5GJCA 1TQHA 2EW2A 4ZA2A 4J0HA 1ZSVA 4O5AA 1FRVA 3Q10A 1SKMA 1IHPA 4CV3A 2WQZA 2Q4OA 2REQB 5CR9A 1C5KA 1AS2A 4HC4A 4S2EA 3EFOA 3EN0A 3F49S 1BQ4A 4IH9A 4ROTA 4EW6A 4YGXB 2C2HA 3UT5A 5CYOA 1FS4A 2WFLB 4D8TA 3D31A 4OMCA 4C30A 1RLUA 3OE7D 3MWEB 3LTNC 3F73A 4HTAA 3RFTA 4FDAA 1F6DA 4NBNA 3IIEA 4TV9F 1JI3A 2JIZD 1JR3E 3D4PA 1YH3A 3HI6A 4LJAA 1ZLYA 1Z6XA 2RK3A 3ZW8A 1OFUA 1YQDA 2V9ZA 4V0NA 1GPH1 3C74A 3BMCB 2W48A 3QV1A 2AJCA 4GMDA 1J06A 1RRGA 1A8SA 4MQ5A 1TW3A 4MQEA 1GZ4A 1FFAA 1EJ0A 5CD1A 3L4SO 3OU7A 5JS2A 4TT3D 1QVAA 5CU7A 4CE6A 1EZZA 3PJGA 2ZB8A 1RYYA 4CKZA 4CLHA 4EA7A 4XWAA 3D02A 5I9IA 4JZYA 4MRMA 2PUBA 1HNXB 3T7SA 2GLXA 2PMDA 1BH6A 3B3GA 3WLRA 4P7KA 4D3FA 3SGLA 5EIHA 5BUCA 2EZ8A 4PX5A 3FPEA 4GF5A 4RMHA 1HT0A 4YRGA 2BAGA 2E55A 4ZGWA 5JSZA 4PYRA 4DNOA 4JT9A 1EVKA 2P4SA 2ATEA 5LWQA 1Z5PA 2GWHA 3LHSA 4CXMA 1V26A 1UJCA 4UD2A 1BJKA 1EVZA 1CEXA 3TS1A 3WZMA 3IPCA 4AIIA 4F4DA 4HDNB 2EAUA 3AF5A 2XIJA 5IH7A 3ILXA 1ID8A 1GQSA 1JLLB 5KC9A 4MVJM 3L9XA 3AHEA 4A1OA 1XZDA 2IP1A 3GIDA 2RFLA 1KSJA 3A05A 3R6DA 1Y80A 1OH5A 1JHZA 2H2DA 3X3HA 4TXMA 1U7PA 1WEHA 1DCFA 1QK3A 3CEJA 3CJTA 3HBMA 4RW0A 3UCFA 4OQZA 4Q4JA 3W9UA 4FZJA 3F7TA 3FTPA 4BIIA 4X62B 3JD1A 1UEXC 2CNLA 5FV4A 3WB2A 3O1IC 2AR7A 2GPAA 4WBSA 3L7LA 2XUJA 1JLMA 2QIOA 3QYFA 3RSSA 1JKXA 5IFLA 4PN7A 4WESA 3URMA 3Q9LA 4MJ7A 4OK3A 5HCNA 2R85A 5AOVA 5DMXA 1W5FA 4MQUA 4YUYA 2ZI6A 3UBTA 3DBLB 4HH4A 1CLEA 3ZV3A 3K35A 1KFJB 1P0MA 3AHDA 2I4MA 4G1BA 1C4KA 1CU1A 2B3DA 1AQLA 1UJNA 2JZCA 2WKWA 3C3JA 3PYLA 2GESA 2UV8A 3MUNA 1QP8A 4JBLA 2E5WA 4ZPJA 5DSZA 3ILYA 4EY5A 4AT1A 3F97A 3ZTTA 5TIIA 5FI0B 1W59A 3KJQA 4TSKA 5BOVA 4RADA 2IUTA 3ZIAA 1HWYA 1MO2A 3K16A 1C7IA 1I7DA 1KO1A 2ON6A 1WAMA 1X94A 3RV3A 3L4BC 3O4HA 4MV4A 2EDAA 4I6EA 2VWGA 3ROZA 1I7QB 3R6TA 3Q3HA 2AXQA 3Q3JB 4HSEA 5F9HA 4FQ5A 1GUZA 1ABFA 3KVVA 4WKNA 1Y1PA 2XDQA 5L95A 1N9GB 3NYWA 2GK3A 4FW8A 2EGGA 4JWKA 5JADA 4YRAA 2BH2A 1XO1A 3KYCA 1X8JA 4PX9A 1DAMA 2BBWA 3PLRA 4O5OA 3QU5A 3G1WA 3STWA 5IKXA 5E9JA 1AQUA 1L5LA 1LSUA 2CD9A 1QLJA 2V3WA 1T0PA 2JCYA 1HE5A 2ZT7A 4Q9KA 3DEYX 4B6QA 1XDWA 1CWUA 4BQPA 3ABOB 3O0DA 4CTKA 1OIWA 3GC6A 1PV4A 4HDSA 4LDPA 1SCNE 5K3DA 5B12A 2PZLA 2JCXA 1I4LD 1TNDA 2XE7A 1G7SA 2JGDB 4QE3A 2WWGA 5HF6A 5C0OE 3QMMA 4NE7A 3BWEA 1KNXA 2VBIA 1Y8QB 1FJ2A 3BGVA 3EGXB 2WWXA 4G63A 3TTUA 4M1YA 4WBNF 3V5NA 3INYA 2VKTA 1OVGA 4Y2JA 3K0SA 3N2KA 4Y6LA 1MMFB 3DOIA 4PAGA 4BQFA 4QM7A 5CLQA 2AGVA 1OXMA 3HCOA 4WLUA 3DULA 1P5ZB 1QFYA 4XR9A 2WF5A 2Q4RA 4JUIA 1NV8A 5IHXA 2PSSA 1OU4A 3NDBB 1WBJB 3EGOA 4K1LA 4B79A 3ITEA 1TMKA 4Q4CA 1UEIA 3JXEA 2YWFA 4AMBA 1PEKE 1PR3A 2GZ1A 2VC2B 4ESEA 3ONFA 4XCXA 2PLRA 4DJAA 4B3GA 3GXOA 3ZZUA 3HVIA 5FBVB 1GFSA 3QG5A 5E6RA 1PZMA 3G5TA 2XV1A 1L3BA 3AM3A 4KLCA 1AKQA 2NUAA 4NS1A 4R9UC 2I2DA 4CODB 2QE7D 3R76A 2G5PA 4KR6A 2V0NA 1KI1A 3I04M 4ASUA 2X2OA 4WK4B 5B1DA 4HFNA 5FBWB 3ZVLA 1C14A 1W75A 1ZQ9A 2AKAB 4NYIR 3SFVA 1KO5A 3VYTB 1L7PA 1YT5A 4E5DA 4BFUA 3Q2IA 5A3QA 2VZ8A 3QVGA 3OT5A 4OP2A 2PQ2A 4D4MA 1VQ1A 2VTVA 2IQIA 1YKSA 4V0RA 5GV8A 1O5OA 2PUAA 4QYMA 1Z83A 2FFHA 1GNSA 2WIBA 4EYOA 1U0FA 1DTEA 1ZU4A 3KFXA 3R7AA 3ACCA 1PL7A 4UMDA 1LBSA 3I2GA 1IVNA 3W77A 4DMGA 4KFRA 2WF9A 4ZCQA 1YACA 2GCNA 2WTUA 1CC1S 1SXGA 2QROA 3MCVA 4O2AB 4GRIA 2ZRCA 5DNCA 4KHPB 2Y4OA 1KO4A 5DF1A 5F3DA 2PRKA 3QJ5A 4G24A 1KC1A 2D1YA 5IFKA 1Y6FA 3HKEB 3MF4A 3BJEA 5IANA 3ELUA 1NNLA 4AY4A 4YP5A 1ZGZA 1YR6A 2I6GA 2IX3A 1FNNA 2AUTA 1JEOA 3LDUA 1P3JA 2V7GA 1JFFA 3PFBA 5JNSA 2AVDA 1QU2A 3SCZA 1NW3A 1PJ4A 4L27A 4ZV4A 1GKIA 3GRAA 3MLBA 5IU6A 3VU0A 4EYEA 4HYTA 1CQJB 4ZOLF 2VDJA 4I8DA 3KB8A 1SXJC 2KLHA 1FRFS 1Z38A 1YZKA 4PWZA 4DLBA 4P4TA 3E81A 2C94A 3TL6A 1KTIA 4CF3A 5WRFA 1OA1A 2CFSA 1T36B 1OX4B 3CB2A 1N4AA 5I7FA 3PUJA 3WXMA 1KQPA 3QMVA 1XXHE 1M6YA 4NZYA 3WV4A 4GYYA 2DR0A 5HZKA 3EPHA 5KVVA 3BRWA 4E4YA 3TOCA 4BDSA 3QI2A 2Z1MA 3OOJA 1V2HE 4EJ6A 4K88A 3WBBA 4IICA 3V9AA 3W2GA 4D9CA 3ZGNA 1MRZA 4EGQA 1C1XA 4BX0A 1O3YA 1XI2A 2BJHA 2O8VA 2ZB7A 3ANNA 4EY8A 3TLYA 1C3JA 2YVQA 4C3ZA 3EVGA 1CQIA 4LTDA 1GPAA 4M98A 4NEGA 2I2CA 2R1UA 3KKNA 2C4UA 3IT3A 2JK1A 2R7LA 2QP9X 3N6XA 3PI7A 3RBZA 2CBGA 3HB4X 1CZLA 1HR0B 1IHYA 2Z43A 1VJGA 2OY0A 1S7GA 3CBQA 1CUHA 4IDNA 3RYT