3TZHA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(f187a) from vibrio cholerae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGAIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 88
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzhA00
1PGJA 2JFHA 2O2SA 1D7OA 4DGSA 3VTFA 3ZV4A 1LA2A 1P1HA 3DL2A 4MPDA 4W9NC 4CLDA 3V1UA 4ZRNA 2BI7A 1P3DA 2YQ5A 1FJHA 5ENVA 4A7PA 1V3VA 4QFDA 4DLBA 5CDYA 4WCDA 3UKOA 3FD8A 1QV6A 4FCCA 4LVCA 4YRAA 4Y6RA 2Q1SA 4J16A 3I9MA 5IDQA 1T4BA 1NFFA 3WGOA 2VWPA 3GEMA 4YQYA 2YHUA 3O8QB 4GWGA 1QYVA 3SJUA 1BDMA 3QA9A 1GQ2A 3AY3A 4WKGA 3RU9A 4N54A 2QYSA 3E9MA 2GO1A 2ZCVA 4YAJA 3NUGA 3KYDB 4NJMA 2CF6A 2HAEA 2UVDA 4QXMA 3RFVA 3DZHA 2XPCA 4WEQA 1E6WA 1KVRA 2B4QA 3KBOA 4MIOA 3IKTA 1B15A 4U5QA 2EF1A 2W2KA 4EYEA 2NU9A 3RUFA 1RM5A 5HBRA 3U09A 4QT0A 2Q46A 4CM8B 4QECA 5JCJA 2YUTA 4XYGA 2B5VA 4A73A 3M2PA 2PFGA 3GUYA 1PR3A 4E3ZA 3UN1A 1ISIA 1ZKMA 4JP3A 3AJRA 4EJ0A 2QX7A 3E03A 3KTDA 4XZ3A 1EFKA 1X0XA 3MJ4A 3BIOA 2DUUA 4M1QA 4MKZA 2YV1A 3E48A 3WWYA 5H82A 4BNKA 1HDOA 1XGKA 2WSBA 4J7XA 3OQ6A 4UVGA 5BSGA 4TMFA 4CMBA 1A27A 2JD1A 3TL2A 1Y8QB 1UDAA 2HDHA 3WGTA 2ZJ0A 2VOEA 1E3WB 4UVHA 4LSMA 5K0ZA 1HYGA 5KJ1A 4WUVA 3PI7A 4Q9NA 3LT1A 4U8GA 4CM9A 4CV3A 2X0RA 1OFGA 4E21A 4QTZA 1WWKA 5BT9A 3WGHA 4P38A 5JAMA 2I99A 4DBVO 4IJKA 4F3YA 2VTEA 3GAZA 4JCOA 5DBGA 1C3VA 5CDUA 1HE3A 3B6ZA 4XRRA 1BWSA 5F21A 4BO8A 1ENYA 1LNQA 2O7SA 2Q99A 3UGKA 3L6DA 4R16A 3GG2A 1MGOA 3HQ4O 5A03A 4XKJA 5ENDA 5I7FA 1WAMA 2FPPA 1LLDA 4YAIA 5KCZA 4L9RA 3E18A 1PZGA 4UVEA 1YGYA 1PIWA 2J8ZA 4OHUA 2LDBA 3PZRA 5JAQA 3WXBA 3OP4A 4I08A 1OAAA 4IPTA 3JQAA 5FF9A 1IYZA 1SMKA 1C0IA 4BO6A 4C7JA 1E6UA 1G1AA 2Q45A 5I8WA 3OIGA 4CV2A 3K30A 3HDHA 3JD2A 4FD3A 4HWKA 1P1IA 4R1SA 3VZRA 1NR1A 2GN4A 3FTNA 3GEGA 4NZ9A 1QV7A 1HTBA 2XXJA 3F9IA 1KEUA 3KOUA 4O63O 1AN9A 4CQMA 4JQCA 4W4TA 2P9CA 4DBZA 4J90A 4J1QA 4ZD6A 1T1RA 5THQA 5ER6A 2D5CA 3BA1A 2Y1FA 4ZQGA 3ROMA 3JQFA 5BR7A 2IODA 4J4HA 2O3TA 4NFYA 4EDFA 1R4MA 2AE1A 1O94A 3D1LA 4BKRA 4OM8A 2R2GA 7ADHA 2GN8A 1PWXA 3RUCA 1LRLA 3DMTC 3FPLA 4XGKA 5JYDA 4KQXA 1AGNA 4PIVA 1C1XA 2EKQA 1U1IA 5TRTA 4G81A 3C85A 3I6QA 2FSSA 3LT4A 2J5QA 3OEYA 1WNTA 4WJZA 4Y98A 5I8ZA 1V3TA 1XDWA 2AQKA 4DA9A 3NTOA 2V65A 4FQ8A 3QV1A 4NBUA 2IE0A 5JPIA 3N58A 2C29D 5L7YA 3L4SO 4NK5A 5FEUA 4WCFC 1Q7CA 4YQZA 4KOAA 3U9LA 1DIHA 2UAGA 4MKXA 3JQ9A 4R1NA 2WE8A 3G1UA 3ROQA 5HRUA 1E92A 1SB9A 3QVOA 1EMDA 3JYNA 2VHWA 1BW9B 4XYEA 2BELA 4EGFA 1GYQA 1Z75A 1ZJZA 1QYCA 3H6KA 3GNTA 3DZIA 3WG9A 1P74A 2FSVA 3W4KA 1SBYA 2NWQA 4GX0A 2VTDA 1R66A 4RLSA 3JSAA 5JMPA 4YJFA 4W7IA 1DFGA 1LQUA 1J49A 2C5EA 3GVHA 4EI2A 2ZIZA 1HT0A 4AJ4A 5G0SA 2TMGA 3TDKA 4BB6A 2NU7A 5DCWA 5AXCA 3D7LA 4GWKA 1RM4A 2OZPA 3KEOA 2VHXA 3G0OA 4MO2A 4E2WA 1VRWA 4GMFA 4M87A 5J23A 3BMCB 3AY6A 3OEWA 1DDOA 4DTIA 3JD4A 2RBEA 1WDLA 5DF1A 5BNFA 5BSHA 4KP7A 4NPCA 4ZRMA 3IL2A 3GNSA 2BH9A 1LDGA 4O59O 4URFA 2OP0A 5HA5A 3ZU4A 1YL7A 5EINA 5JO9A 2AW5A 1JTVA 3WSWA 4RVHA 1OZAA 2W2LD 3FNFA 3WTCA 2PZLA 3M1LA 1R12A 2V7PA 4LN1A 1HETA 2H6EA 5F1KA 5FI5A 3EHEA 3TOZA 1QSGA 3C8MA 4BKUA 3NYWA 2JCXA 3OICA 4ITUA 2Y1GA 3I52A 3ANNA 4HXYA 1H94A 4L0QA 2X4GA 4FR5A 3PQFA 1PJLA 2YYYA 3C1OA 4CMGA 3AWDA 2IZ0A 1HF3A 4UEOA 4NDNE 1N92A 1SCUA 3WTBA 1Z82A 1GL3A 3W6UA 3ZH2A 1Q2XA 2VHZA 1PJ4A 3OA0A 4JX8A 3UOGA 2QIOA 4RPKA 5KKCA 1C1DA 4TQGA 5A1TA 2Y1EA 4EZBA 3L77A 3RI3A 3OMLA 5KWEA 3BMQA 3VC7A 3MWDB 4E2ZA 1OMOA 4GKVA 2RHRA 5DN9A 3M1AA 3EZLA 1Y6JA 2HUNA 4W82A 3ZW9A 3JV7A 4R51A 3RIHA 2VRCA 3ORFA 1ADCA 1PWZA 1N8KA 2PKQO 3RC7A 2C20A 1CDOA 4M55A 2Z1MA 1WMBA 3WYCA 3L6OO 4XQGA 2CDBA 2TMDA 5G0WA 4E13A 1ZSVA 4XQ9A 2BFAA 3WDSA 1UZLA 2VZ9A 4I9HA 4YT4A 5TGDA 4BGVA 1DXYA 1NQAO 4BNUA 3PWKA 2HJSA 4QO7A 2DFDA 2Y0EA 1U3WA 1E5LA 3NRCA 4GLLA 1LRKA 1E1KA 4HFNA 2DLDA 1ZUD1 4B4OA 3BMOB 1UDCA 1QG6A 3FSRA 1W73A 2WMDA 4BNJA 1CQIA 3FBTA 5TX7A 3WLFA 2HMVA 3ZU5A 1PL6A 3NJ8A 3UCFA 2CVQA 2AG5A 1XU9A 4U6QA 3RC1A 1KVSA 2YFQA 4PFJA 1NX6A 3QHAA 4M54A 3ONFA 4J91A 3ITKA 1XELA 4NHEA 4UAGA 4OQYA 3KLMX 1BGVA 4TVOA 2OP1A 2WD7A 4ROSA 4EEZA 5KJ6A 4IIUA 3TFOA 3WICA 3RUIA 3AU8A 2BGKA 4UEJA 1W6UA 4JLWA 2P2SA 3JYLA 3ENNA 2PH5A 4BNTA 4FW8A 5DCUA 1T2FA 1DIAA 2J3JA 3GA0A 1LSOA 4CM1A 3LC1O 4GX1A 3L9XA 1L1FA 3KLPX 1QYXA 3BZUA 2JFFA 3FWNA 1G6KA 2EEZA 4JJGA 3FCOA 3ITDA 1X14A 4BO1A 2DM6A 3ZCXA 3H5AA 1W0CA 5B4TA 1K0UA 2YDYA 3Q11A 1Z6ZA 3ZU2A 3ZNOA 3PWZA 3UVEA 4CR6A 3ZI0A 3H9JA 3IUSA 3E1KA 1CEQA 3EUWA 1TT5A 5BQFA 3Q0EA 5EESA 4J2OA 1O5IA 4PG4A 1ENPA 2DTXA 2NU6A 1ISHA 4HFJA 5B37A 3GHHA 1WVGA 2PH3A 4E30A 4MJLA 3KUXA 3D4PA 4R68A 4GLOA 2WE7A 1MXFA 3L07A 1F14A 3K92A 3MTJA 4B3HA 2X8LA 4BNLA 3HDQA 3CINA 1O8CA 3DFZA 4D46A 4DVJA 1KS9A 1RPNA 4N5NA 4E0BA 5IDYA 1P45A 1HDYA 1WDMA 3ST7A 2EHDA 5AXBA 1BXGB 4OSPA 4AJLA 3AM5A 1I33A 4TROA 3M2TA 3AOEA 3BXXA 1EBFA 3UH1A 4RVDA 4J9VA 5ITVA 3EZYA 3E9NA 1X13A 5I7VA 2DAPA 4Q3CA 1K6XA 1KYQA 1UJMA 1EDZA 4XB2A 1NAHA 1U5AA 3OSUA 1E1NA 4FFLA 4HADA 3GF4A 4OKIA 4B7CA 4HNHA 4XGIA 1RJWA 3GK3A 3EK2A 3QVWA 1WMAA 2FZEA 4MIEA 4Q3BA 2ZTLA 4PGFA 4D3SA 1DC6A 4ND5A 5T8KC 1YBMA 3PHHA 1EQ2A 3DDNA 3I4CA 1U8XX 2EW2A 4CMAA 3ABIA 4H16A 4PLGA 3UW3A 2ZK7A 2B4RO 4Z3DA 2R00C 4Y67A 1NM5A 4XQCA 1ZEMA 1R0KA 3RFXA 3WGGA 3MJSA 1Q1NA 4M89A 4CM3A 2B69A 4DPKA 2J3KA 3TZKA 2PGLA 1FDWA 2WEKA 4LMPA 3ZV6A 1UXGA 2GCGA 1LDEA 4DC1A 3ZHXA 2VHVA 3ENKA 2OUIA 2C7VA 2XXBA 2SCUA 1JDJA 3NTQA 1A5ZA 4LVUA 1HE4A 3GPDG 1X0VA 1ZK0A 3GPIA 1HDCA 4D3FA 3LDHA 2QHXA 1EFLA 1ENZA 4WASA 4RJTA 1JKFA 3AUTA 1E3JA 3JYQA 6ADHA 3O26A 3VZPA 4DMMA 3GZNA 3PIDA 1B3RA 3I5MA 3IAHA 3WFIA 1Q0LA 2D3TA 3GOHA 4IINA 3WQRA 3A14A 4R01A 4BMNA 3ONDA 4HNGA 4WLFA 2EKLA 1UZNA 3WIDA 1I32A 1T26A 1X7DA 1JW9B 3DZFA 3FN4A 4XJTA 1HE5A 5KJCA 4WNCA 3CTMA 4FFRA 4CV0A 1CYDA 4ZQEA 2J3IA 3TZ6A 3KHUA 3VZSA 4E5NA 5IG2A 4IUYA 3CPSA 2FN7A 1ZZEA 4I9NA 3U62A 4GMGA 2ZB4A 3ICPA 1EVYA 5DULA 5G4KB 3LC7O 2FPGA 2HRZA 4NFHA 4R9RA 3BTVA 2ZB7A 2D4AA 2O50A 4GH5A 4EITA 1UDBA 4DRYA 3LU1A 1VI2A 1KVTA 4YAEA 4YJGB 1S6YA 5L53A 5CPBA 4BGUA 5K9ZA 2GDZA 1ARZA 1KETA 5CG2A 3VVCA 1LRJA 3I9JA 2PKQP 3P5SA 1GUFA 1LU9A 2EJVA 3HZZA 2O3SA 4G2NA 4BMVA 1DJQA 4CQLB 3HWRA 4I9UA 1NP3A 1JVSA 1GR0A 4WLEA 2HK7A 3HNPA 2O3UA 1U8FO 1Q0QA 3S8MA 4MVJA 3D4NA 2IYPA 1T2DA 2WDZA 3CMCO 4NJOA 4A2CA 4AFNA 5JE8A 5LCXA 1PS9A 2O23A 2PR2A 1DEHA 1P1KA 3HN7A 5F1OA 2H5LA 3MOIA 1CERA 2CVZA 1YJ8A 3C1AA 1HL3A 4IMRA 1ISMA 1PEDA 3SLGA 4NBRA 1Y8RB 1BTOA 3DTYA 2ZTVA 1SNYA 4NH4A 3DZKA 3UF0A 3OJOA 1T2AA 5CEJA 3GT0A 4FB5A 4GSKA 5B4UA 3GN1A 3B1KA 5LDGA 1HSOA 4R9SA 1EK5A 2PZJA 1A71A 1Z45A 2VNSA 1G0NA 2HRBA 3AI1A 4YJHA 1W8DA 5IZ4A 3TWOA 3V8BA 1K3TA 4CM4B 3RKUA 3INTA 1YVEI 2AE2A 3KB6A 2NTJA 4X54A 3ROKA 1ZFNA 2AEMA 1OBFO 4B8ZA 4CLOA 1TB4A 4RQUA 3GHYA 1U7HA 2GERA 4R54A 1K6IA 1DAPA 2HMUA 2YDXA 1GCOA 1Q0HA 4RQTA 1A9YA 4MVJP 4CMEC 2Y05A 3BMNA 4HV4A 3GVXA 4WLOA 1I2BA 5JO0A 3I9OA 5AXAA 1DJNA 1FDVA 1LSUA 2FY8A 5JAIA 4ID9A 2BLLA 3DBVO 3PDUA 4O0LA 3T4XA 1XKQA 3VDQA 3W6ZA 1ZVMA 1JKJA 2O4UX 3H9QA 4MDHA 3T4EA 4J6FA 4EJMA 2Y1CA 4ZJUA 3GMDA 4W99A 1UR5A 1K6JA 5C7IO 1VJ1A 2DTEA 5G4LA 3E9QA 1BVUA 2DBRA 2Q4BA 4PG6A 3FR7A 2X58A 5EL0A 4BKPA 4BB5A 2B37A 4YA6A 4Q39A 1U4OA 1M75A 2ZB3A 3WQSB 3JD0A 3QP9A 4WCFB 2AG8A 5L7TA 3N7UA 2JAHA 4PCVA 4J9UE 4B7XA 3JQEA 3O8QA 2C7GA 3PQDA 5HS6A 2JFGA 1BHSA 3KM0A 1C0KA 3TF5A 3OF2A 3F1KA 3S2IA 4XIYA 4LW8A 1NFRA 1GY8A 1UP4A 3KYDA 3DBHB 3CSDA 4D44A 4OXKA 2OO5A 5JW6A 3TSCA 4ZU3A 4DWVA 1ZO8A 1IPEA 1EUDA 5TT1A 1B3BA 1IOLA 4I5EA 4BVAA 4FN4A 1NPYA 4BNHA 1ZSYA 5L95A 1SOWA 2ZJ1A 4D0RA 4QUKA 3H7AA 1MXHA 1O6ZA 4R41A 3MOGA 4A0SA 3VH3A 4Q3EA 2QRLA 1HLPA 4MP8A 1ONOA 2J5KA 3RUAA 1OOEA 3VKUA 2FR0A 2Y66A 3C7CB 4GKBA 1TI7A 4PLPA 1HRDA 1XYGA 1VL6A 4DREA 2ZQZA 1JWAB 4RCVA 1E77A 1YBAA 3JQBA 3F6YA 3AI2A 2Q2VA 5EMHA 4OJNA 2Y0DA 3AOEC 3FNEA 5COBA 4Z9FA 5ICMA 1R0LA 3UXYA 4OAQA 1XEAA 1T2EA 1Y8QA 3GGPA 4BNFA 2GF2A 4FC7A 3MWEB 3HG7A 1HSZA 4IJUA 3AI3A 3WOHA 1KC1A 1IZ0A 3LK7A 3LYLA 3D4OA 4AJ2A 3GVIA 3S2EA 2Z1NA 3QIVA 1T2CA 4DC0A 1N1GA 2HJRA 2NSDA 2NV6A 4AJHA 5AQ1A 2X9VA 2I3GA 1PJ2A 2IRWA 3RKRA 3VH2A 1KOLA 5I9LA 2H1SA 3OHSX 3RBZA 2JD0A 3GY0A 2PY6A 4TSKA 3DOCA 1A7AA 3RJ9A 2E37A 5A3VA 2BGLA 3DEYX 3NDRA 4R4JA 1PZEA 1GZ4A 4D41A 2ZB8A 1M66A 4BNWA 1UAYA 4MVJM 3RC9A 1DAOA 4OQZA 4RORA 4BMSA 3BYZA 4TRNA 1TLTA 1A4UA 3PLNA 3DZBA 4B4WA 3VH4A 3LC2O 4Z0PA 3LQFA 2I9PA 5JCXA 4CR8A 3S55A 1H2HA 4AJKA 2CSUA 4KUGA 2DU8A 5TF4A 3V2HA 4YWJA 3V5NA 1N7HA 4II2A 3PRJA 1VC2A 3VPHA 1OC2A 2HLPA 4RF2A 4PLVA 1LDYA 1P77A 4QEDA 5DT9A 3PDJA 2Q1UA 2CZCA 4BNGA 3UFXA 1SC6A 3ETEA 1I30A 5GZ3A 5I9NA 3I3OA 1ZK1A 3TFQA 4E6PA 4GGPA 4H15A 4L76A 5G0TA 4FFNA 1NPDA 1F12A 4H3VA 1U28A 4PLFA 3ZWMA 4KUEA 1MV8A 4XRGA 1DIGA 2Q1WA 2EJWA 2QRKA 4PG8A 1NWCA 1X7GA 4K9DA 1KERA 2D2IA 2EG9A 4XYBA 1GD1O 1Z73A 3RSHA 1DFIA 2HQ1A 5CHEA 2AA3A 1FDSA 5CAEA 3HJAA 1IY8A 3VPGA 1AHHA 1E6EA 3RASA 2G0TA 1QLJA 3TPCA 1RKXA 5HM8A 3WYBA 2X6TA 4B4UA 1XSEA 1FXSA 3PJGA 2HK9A 4B4VA 1HDRA 1PGNA 2FRDA 1QP8A 4RVFA 4DYDA 3AUSA 3F46A 5CEEA 4N18A 1PQUA 2D8AA 2BFPA 3ZWXA 5F5LA 3GG9A 3DHYA 5C7OO 1BW9A 3IIEA 1WXDA 1WP4A 3WYEA 4NBVA 1F8GA 4I5DA 1PL7A 4D7AA 1HZZA 1MG5A 3D5QA 5MGBA 4RZIA 3LF2A 5L51A 3H65A 4BNVA 2QYTA 4M86A 4FJ1A 4NG5A 3D3EA 1ZMTA 2JD2A 2DBZA 1KIFA 4HBGA 2QZ9A 3U4DA 2G5CA 1NASA 1E0DA 1YL6A 2PD3A 3EGOA 4K6FA 4AL4A 4DIFA 1YJQA 2PLAA 1U2GA 2CDCA 2FZWA 1P31A 1M6WA 1LDMA 2NLOA 4IZIA 4YT2A 3PP8A 3DQPA 4OOEA 4FS3A 5A5FA 3IMFA 5T67A 3JQAB 2DTDA 3JD3A 4GSLA 3BMCA 3LLSA 3PYMA 2IEBA 2VQ3A 2DT5A 3WGZA 3EMKA 2E6UX 4ZICA 1X1TA 3GZ4A 3UICA 2ZYGA 4BQPA 1I3LA 1DRUA 1LBEA 1HZJA 3D3WB 4A5OA 1GDHA 1K89A 4TRJA 5IZCC 4HUJA 1IUKA 5JSFA 1EEHA 1T4DA 3AK4A 1V9LA 1MFZA 4ONEA 4CQMB 1Z74A 1S7CA 3G79A 4BUCA 2EP5A 4A26A 4FJ0A 1VL0A 3MZ0A 1VSUA 3PTZA 4ZN6A 3U4HA 5C7LO 4ND2A 3D64A 4YVFA 1DPGA 4RVGA 1R4MB 1HDZA 1V3UA 3H2ZA 1RYEA 4IGFA 4N5LA 4CMIB 3DC2A 1YO6A 1PS0A 4MIYA 1UP6A 1DRWA 2C0CA 2HO5A 1P0FA 1I36A 3A06A 5JDIC 1C1XB 1C14A 4R5MA 4ALMA 2BFOA 4UUNA 3O38A 1XQ1A 2YW9A 1T24A 3PIIA 4UUMA 5TIIA 1I8TA 3AUUA 4B7UA 4CJXA 3GQVA 3WR5A 2OBYA 5KJEA 2WYUA 5U4QA 2BRUA 1M76A 3OM9A 5A06A 2UYYA 4ZQFA 2O2YA 1GEGA 3U4CA 3NAQA 4OSOA 3JYPA 4CLHA 4J0EA 2RCYA 4L73A 2PD4A 2CF5A 3AUAA 1A4IA 1M6HA 2UDPA 8ADHA 1NHWA 3AFNA 5A05A 4TWRA 3WIEA 1I24A 2GZ1A 1PGQA 1QKIA 3S1LA 2PGJA 4QSMA 3RC2A 3OETA 5DBIA 3WGQA 1T25A 4FIZA 3BHJA 4CMJA 2XOXA 3QVSA 4RV9A 3BMOA 2HU2A 3OFSA 3COSA 3FNHA 4KZPA 5A04A 4Z0HO 2D5AA 4RF3A 2NTNA 2YY7A 4BO3A 4BHTA 5IDWA 5K6AA 3P7MA 1AXGA 3M6IA 3MEQA 4OL9A 1P1FA 3D5TA 2A94A 4IQGA 2ET6A 3GRPA 2PTGA 4DIBA 4EUHA 1LLCA 4BGEA 2B0JA 5COQA 2BD0A 2XF8A 3T7CA 1GUYA 4PG7A 4DUPA 1AUPA 1U3TA 2BKAA 3H2SA 3JQGA 5DDIP 2P5YA 3RROA 2H9IA 4IDEA 3WFJA 2IEDA 1EVIA 5FWNA 1N2SA 2B36A 1UAGA 4K26A 5F1PA 3WSVA 1VJ0A 3ONEA 3PHIA 3STHA 2JHFA 4ALNA 2AHRA 3I9KA 4XYLA 1W4ZA 4J1SA 5G0UA 5GZ6A 4GPD1 4BNMA 4CUJA 4YRDA 1B2LA 4RPHA 1PU2A 3DXFA 1CF2O 2X0JA 1ZK4A 5JAZA 2PK3A 1UXIA 5EQDA 1YDEA 1IE3A 3JCZA 1N5DA 2YQ4A 4J4BA 3W4JA 2Q2QA 2Y68A 3CEAA 5AOVA 3C1TA 3U49A 5KVCA 2IXAA 2DBQA 3IKVA 1PSDA 1YB5A 5CG1A 4NI5A 3ZNPA 2Q49A 5JY6A 4AJNA 1VKNA 1LSJA 3OBBA 4FGSA 3TZQA 1XHLA 3Q9UA 3FTPA 1JWBB 4JXKA 3GDGA 3QLJA 2EW8A 2IZ1A 3O4RA 3I9NA 4M49A 2BMAA 4U0JA 1EE9A 4JBIA 1PZHA 4CUZA 2B83A 1GTMA 1IPFA 4F45A 1ADFA 3EY4A 5L9AA 5FI3A 4JBHA 5JDCA 3IJPA 1NFQA 2V6BA 4Y9DA 1JVBA 1H6AA 2X1HA 2Q4EA 3LT2A 5DZSA 5A5EA 1ADGA 4CL8A 3U0BA 3OECA 2VN8A 2X7HA 4IS2A 1HWYA 5L3ZA 3PFWO 4BIIA 3DHEA 4IQ8A 3L4BA 2GD1O 2HMWA 3BAZA 4MVJH 3R0IA 4FOSA 5CFZA 1JKIA 2WD7B 1WPQA 1JLLA 2J3HA 3LF1A 1RM0A 3DBRB 4GL4A 3RBXA 1JN0A 1MX3A 3V1TC 1EBUA 4GVLA 1PJ3A 2AEJA 2LDXA 3K73O 1A72A 5DP2A 4LRSB 4W9NA 4YB8A 2W2LA 4BO5A 2VWHA 2QZZA 2I6TA 3KSDO 1MC5A 1GZ3A 3I1JA 3CZMA 4B3JA 5IAAA 1R4NA 1U5CA 5CDTA 5C3MA 3PHLA 3FWZA 3V2UA 4D79A 1E7YA 3JQFC 3KRTA 4PZEA 3NDJA 1DBVO 1ZNQO 1PGOA 2VYVD 4DMLA 1DC4A 4IIVA 3CE6A 4K6CA 4QX6A 4DIOA 3NKLA 1Y5MA 3CKYA 4OKNA 3SVTA 1B8VA 1EE2A 4BO9A 1QXSA 3H9UA 1TT5B 4FFPA 1DHRA 1H5QA 5L4SA 2D0IA 2WM3A 3KVOA 3R3SA 3JQ9C 4BKQA 2A4KA 3PGXA 1DIBA 2Y93A 1ZIDA 3VTZA 4EW6A 1CRWG 4PZCA 5CEFA 1RM3A 3AY7A 1ONNA 3ICCA 2W8ZA 1V6AA 5KTKA 4Z9YA 3EYWA 3RBVA 3R6DA 5ICSA 3JQDA 4J2HA 3CIFA 1J5PA 4DXHA 4XQEA 3GC6A 1WZEA 4J1NA 3P2YA 3GDFA 4L4SA 4E32A 4IDBA 4LCJA 1LEHA 1XIVA 1YOVA 1MUUA 2VWGA 3IS3A 4YJGA 4BKOA 1CJCA 2EIHA 1NNUA 1P44A 4E33A 1D1TA 1I3KA 3OQ1A 1E7WA 2I65A 4PZDA 4Y6SA 1ISGA 2VYND 2EERA 2ZTUA 3WBFA 4L8VA 3LVFO 3QWHA 5JLAA 3OA2A 2X23A 2GRAA 2FR8A 3WMXA 5KOIA 1NTOA 2GUGA 3GR6A 1I3MA 5JBIA 4TKLA 2PZKA 1E7RA 3DBLA 3NEPX 4OIMA 3NT2A 4J7UA 4XDYA 3B20A 4O5OA 2GZ2A 2VZ8A 4NU5A 4JN6B 3OQBA 5A9SB 3TZCA 3JQ8A 1ZH8A 3R3JA 2O48X 4E12A 2A9FA 2VZ0A 2JL1A 2OMEA 4Z6KA 3WGIA 2O7QA 3C7AA 3QVXA 2PKRA 3JQ7B 1YKFA 4IMPA 1QRRA 5DOVA 3E6AA 4ND4A 3F1LA 1ULUA 1R16A 2NVUA 3SBOA 1Y8RA 3ZWAA 2RAFA 3FNGA 1EQUA 1B0AA 1Y81A 3H5NA 3QWIA 2WTBA 3HE3A 1B8PA 4ND3A 2OFPA 4LGVA 3AU9A 4RDHA 4DYVA 1VJTA 3GGOA 1JU9A 4FGWA 4NQZA 4RZHA 3RUEA 4KTTE 2GR9A 4NR0A 1U3UA 2V6FA 4XD2A 8LDHA 2NM0A 2VOJA 2DFVA 4CM4A 1G0OA 5IF3A 2E4AA 1LLUA 3L6EA 4WLUA 5JY1A 4WNIA 4OXYA 4S1VA 3V2GA 1NPTO 2D1YA 3ANMA 4XYMA 1P9LA 1DOHA 4KQWA 1KEWA 1PQWA 4WE3A 4NIMA 2UV8A 3Q2IA 4JJFA 4CODB 5JCJD 4OO3A 3UCXA 3JQCA 2YHIB 4UUOA 1K2WA 3EW7A 4A10A 4BNIA 4IJWA 2WJPA 3HADA 3O9ZA 1BRMA 5JS6A 2FP4A 3DMTA 4BO4A 3BHMA 3IP1A 3LZ6A 1HE2A 4CLRB 3LT0A 2C82A 4BGIA 3MCVA 1LDBA 4BO7A 1GQQA 3G49A 2CUKA 2NACA 3ZWVA 5JC1A 4CM6A 3K2EA 2B35A 2Z95A 3UCEA 3NT5A 2C54A 4OH1A 4L4RA 4CMCA 3WS7A 4FBGA 2DC1A 2X5JO 3WQQA 2EGHA 4CR7A 4WLVA 3VKVA 4CM9D 2PV7A 4IDFA 3W8DA 4GBJA 4XR4A 4ZA2A 4K1LA 1UH5A 2X9GA 2J6IA 1ISFA 4YEDA 5IFLA 4EBFA 4XEHA 3TQHA 4D43A 3DBHA 4W6ZA 4JIGA 4YDRA 1FF9A 4YRBA 1GU7A 2IZZA 5JXWA 5COAA 5ILOA 5HWSA 4EUFA 2YV3A 4UVDA 1B7GO 3K96A 4J49A 3I83A 2BGMA 4HKTA 2HKIA 3TRIA 2O3JA 3OH8A 1PJQA 1B14A 3WLEA 2VUSA 4IDDA 1N1EA 1QORA 2X22A 4DPLA 4IZHA 3ZHBA 2RH4A 2HSDA 3SEFA 3FHLA 4J0FA 3G17A 3RWBA 3JTMA 3JQAD 5T6BA 1BSVA 3QWAA 3DZJA 4RF4A 5JMWA 1I5RA 2NVWA 3ANLA 1DFHA 1NXQA 2FMUA 1EDOA 3GN2A 2OGUA 3QWFA 4HFRA 4FSHA 5JDCC 4Q3NA 1KY4A 5KVQA 4CLXA 4IJVA 2IXBA 2O4CA 3HHPA 4B3IA 4CLOB 3F4BA 1B16A 5BSFA 4JNKA 3UUWA 2I5PO 3QY9A 4S3MA 4CQMD 1FK8A 5A9RA 2GYYA 3W4IA 1JAXA 1NR7A 1ENOA 3L4BC 4HX5A 1WZIA 3GEDA 3BMNB 1N9GB 3H3JA 1DB3A 3SLKA 2FOIA 3PHGA 1ZSNA 3VVBA 2QRJA 3HSKA 5EERA 4CM8A 3C24A 1D1SA 1IHYA 1ZJYA 2W4QA 2GPTA 2AEFA 3ZZNA 4E5YA 3MJEA 4YPOA 4RVSA 1Y9EA 4MP3A 3WNVA 5AYVA 1HXHA 4A03A 1NBOA 2PZMA 4YR9A 5EPOA 3KYCB 5KKAA 3DO5A 5H83A 1R15A 1HKUA 2GGSA 4NBWA 2EGGA 5A9TA 2Q1TA 2HMSA 3GAFA 3W8FA 4D3DA 5H81A 3VPXA 4I1IA 4WPGA 5BNIA 2YZ7A 1YS4A 5TT0A 3EC7A 1Z7EA 4WLNA 4LK3A 4DLLA 3ADPA 4I8XA 5IXYA 1E3WA 4PLWA 1BXZA 1ZK2A 1WW8A 5G2OA 4H7PA 4J1TA 1UP7A 9LDTA 1ZEJA 5THKA 4LISA 3NX4A 4R1UA 4E31A 3K9QO 2F00A 3NJ4A 2W98A 2Y1DA 4PLZA 1LSSA 2I3AA 3ADOA 4U7WA 2FHSA 2X0NA 1XCBA 1PZFA 1KEPA 3UHAA 2YV2A 3MJCA 1H9AA 3VHRA 3BTSA 3ZN2A 1LLQA 4IQ0A 2GN9A 3PWSA 3H9GA 3RFTA 1H6BA 3HFGA 4ZQHA 3ETGA 4L74A 5IN4A 4Q3DA 1CIVA 3KEQA 1AXEA 1DLIA 2X5OA 3QQPA 4BO2A 1YE3A 4E2XA 3DZGA 2F1KA 1Z7BA 4NFSA 4F6CA 3HB5X 4B8WA 4YT8A 1MG0A 4ALLA 2GLXA 2CY0A 3H9EO 1U3VA 1XA0A 1UXJA 4N7RA 2FWMX 2FPIA 1P1JA 1CWUA 3INGA 2QG4A 4PLYA 4B79A 2ILTA 5KIAA 4NJMB 3SX2A 2CD9A 3DR3A 4BNXA 4IGEA 3FPCA 5I7EA 4G5HA 2UUOA 1PL8A 1GADO 3FBGA 3PVZA 4TKMA 4JP2A 4OGWA 3WMWA 2W2KB 2WYVA 3IDSA 4P4NA 4PG5A 4ZVVA 2Q2WA 2NUAA 1VKOA 1KY5A 2V6MA 2DUWA 2ZYDA 4R69A 3HN2A 2G1UA 1IHXA 2WD8A 3WNQA 2JKVA 3WJ7A 5G0VA 5ES3A 2PA3A 2WWRA 1TVEA 3GFBA 5EN4A 2ZKLA 4F6LA 3VH1A 2DPGA 2DQ4A 3Q6IA 5KJFA 3ZWNA 1KEVA 3HB4X 1QYWA 2G82A 3PYLA 5L4LA 3VDRA 1K5HA 1MFPA 1VE9A 3BHIA 3P2OA 4MVJF 4P4GA 2EWMA 1BDBA 2GZ3A 3RUHA 1T1SA 1LQTA 4LRTB 4ND1A 4Y8VA 4GQAA 1EVZA 1IL0A 3DONA 3Q9NA 1JA9A 3ZWWA 2Z5LA 3Q2KA 2BI8A 4PLTA 3QW2A 3PZBA 1X15A 2OL4A 3I23A 1F0YA 2DPHA 3MJVA 3H8VA 2VHYA 3JD1A 1E3SA 2GASA 2ZATA 2VRCD 3Q3CA 3W1VA 2VWQA 2O3QA 5ILGA 3F4LA 4MP6A 2CFCA 2AQ8A 1E1LA 1HYHA 1ID1A 1ADBA 1B8UA 2RHCA 1ULSA 1VL8A 3F5QA 1CQJA 1LC3A 1IZ9A 3D3WA 4CV1A 2EKPA 3IC5A 3NGLA 5L45A 4GX2A 1WDKA 2RIRA 1ONPA 4E4YA 4OXNA 4MKRA 3V1YA 3FR8A 1PR9A 1F06A 4MOWA 3H3FA 3ROPA 4BNZA 3C7DB 4AJ1A 1YONA 2C59A 1X1EA 2Q3EA 3IP3A 4QQRA 4YCAA 2W90A 1GAEO 4CMIA 4M8SA 4RPGA 1GFSA 3ETDA 4KWHA 4BOYA 3MTGA 3ZWCA 3C3XA 4CLEA 4WK6A 1XWFA 3ZNNA 1QR6A 2YJZA 5JYEA 1AE1A 3I6IA 5T8KA 1SEPA 6LDHA 4NNJA 3X2FA 1NAIA 3P19A 2R00A 1M2WA 2D59A 4FJ2A 3VOSA 5EJ2A 4ZGWA 3HDYA 3QRWA 2NQTA 2Y99A 4BV9A 2GNAA 5AXDA 3DOOA 3DAGA 3E82A 1P33A 3PPIA 1NQOA 5GMOA 5C37A 1JAYA 4XB1A 3NT4A 4PLHA 5F3RA 3B70A 3IJRA 2AQHA 5T64A 5U1PA 2OHXA 4YAKA 3BTOA 4RLHA 1H2BA 4UUPA 3RVDA 3FI9A 1PJSA 1DSSG 1NHGA 1I2CA 2EV9A 1U9JA 4GGOA 3DHNA 3HFSA 3VPFA 3AW9A 3TZHA 1MLDA 1XG5A 4AJJA 4J4TA 2V6GA 3NV9A 4PVCA 3DOJA 1OI7A 4CMKA 4OMUA 3ZHYA 2VUUA 3RQSA 3ZV5A 1ML3A 4RF5A 3KETA 4NMHA 2G76A 3L9WA 3K5PA 1H93A 1LI4A 2J5RA 2OBNA 4YJDA 4TRRA 1I0ZA 3PJEA 1NQTA 4CPDA 3CXRA 1UXKA 4TZTA 4LSWA 4E5PA 3T7EA 2VCYA 4GVXA 3W8EA 5DBFA 4YACA 1GYRA 4YJFB 1ZXBA 2QW8A 1YH3A 1C0PA 3TN7A 4P22A 3ON5A 3AFMA 2G17A 1GPDG 3CMMA 2DKNA 3HUDA 4JBGA 1ZXLA 4XX0A 2X0IA 1DIRA 3BTUA 3VZQA 4BL5A 3WWZA 2E49A 4XIJA 3RJ5A 2HK8A 2DBVO 3OJEA 4MVJG 2NNLD 4FFOA 1ZCJA 2NTVA 1J0XO 4DQVA 3FRJA 4GI2A 1DO8A 3N74A 3QJ5A 4AJPA 5BNTA 1H0KA 3JQBC 2NU8A 4FFMA 5TNXA 1XU7A 4J7CA 1NVGA 4Z9XA 1B26A 2IYOA 4WOKA 2XAAA 9LDBA 1HEUA 3OIFA 3EVTA 5A02A 3WGYA 4GAEA 2PWZA 4AVYA 3KSUA 3OJFA 3G3EA 1Y7TA 2Y67A 5I9MA 3U3XA 1GEEA 4DLAA 1DC3A 3FF4A 4IBOA 4IXWA 5TJHA 1NVTA 3IQDB 4E5MA 4OYRA 3GMSA 1SPXA 4C4OA 4Z3KA 3DAPA 3EAGA 4ZQBA 3Q1LA 4RGBA 1YRLA 4FPXA 4RO0A 5IJZA 3OJLA 4FC6A 3CUKA 4I5FA 5L40A 3PK0A 2OORA 3QVTA 2VT2A 2JJYA 1UUFA 4BO0A 4CL3A 4ZHSA 1C1DB 1D8AA 1TEHA 4XJSA 4W7HA 1NWHA 2ZTMA 4CMHA 2AXQA 2Y0CA 4JK3A 1E7MA 5A4DA 5JC8A 5DNAA 4MINA 1A9ZA 3BMQB 1EUCA 4DPMA 3EDMA 4I5GA 1GV0A 2I66A 3KSZO 4UEKA 4CMEA 4YYZA 3DFUA 4P4LA 1PTJA 1PS8A 1EUZA 1ZW1A 5I7SA 1Q7GA 2CNBA 1L7DA 3ASUA 4KUHA 3TJRA 4BS9A 3HDJA 1LX6A 4C7KA 4FOOA 3DBRA 4YXFA 5L4NA 2P68A 5F5NA 1EVJA 3AM3A 4D45A 4EEXA 4XR9A 1GZ6A 4XWYA 1BXGA 3JQGB 4AJOA 1LDNA 3GH3A 5KNLA 4J3FA 4E2YA 1P1RA 2B4TO 2ZCUA 4TRMA 1GPJA 2Q50A 1PGPA 5IXSA 3WX0A 3QWBA 5C5IA 1HLDA 2H63A 4BQRA 2P4HX 5T57A 2P5UA 5KVVA 1YWGO 4KDEA 3ZGYA 3QSGA 3H5RA 4YTEA 5AVOA 4CM7A 3CH6A 1FMCA 5DP1A 3NDIA 1MB4A 4R3NA 4MVJD 1KBZA 1P0CA 3R1IA 4PN3A 2WYWA 4XA8A 5TLSA 1LTHR 4D0SA 2P9EA 4RDIA 2PNFA 3DWFA 1EZ4A 1GQYA 1I2ZA 3GUCA 4R1TA 3PLRA 1ISJA 3SJ7A 1LXCA 2X9NA 4AG3A 2VRBA 4U6SA 4MVJI 2BF7A 5JNLA 2E48A 3PGJA 1OC4A 2P9GA 2NVBA 4KWIA 2VUTA 3VAZA 4AICA 3ZWOA 4WGGA 4IXTA 2VT3A 3A4VA 1NVMB 1YQXA 1Q7BA 2POQX 3GRKA 3NTRA 3I4FA 4IM7A 1HDXA 2GSDA 4CUKA 1KVQA 2JHGA 4UULA 3KYBA 3CZRA 4WOJA 4Y6PA 1BG6A 2C07A 3DTTA 3INRA 2AMFA 3JQ6A 4L4XA 1YBVA 1VM6A 4WECA 3ZW8A 1R6DA 2YFHA 2BFMA 4ALKA 2P4QA 1DC5A 1I3NA 1VPDA 1UXHA 2EP7A 3RCBA 3PJDA 1YL5A 4BNYA 1QLHA 1UZMA 4R3WA 5B1YA 1I10A 4QO8A 3WJAA 1BXKA 3ZHZA 1ZMOA 1SAYA 3MJTA 3UAGA 4EJ6A 4L75A 5U9CA 4RL6A 3ZV3A 1D3AA 4DL9A 1TA4A 4MVJE 5TS3A 1PQPA 4RVUA 2X5KO 3S2GA 1O95A 3RUDA 1H9BA 5IDXA 5G4KA 5A9SA 1SZJG 1YQGA 3TL3A 1H6CA 2CVOA 3E5RA 4PLCA 2A35A 3ASVA 3F3SA 3NGXA 1L7EA 2NADA 4BNNA 1E1MA 4DQUA 3JQ7A 4JGBA 4UVIA 1V35A 3ZDFA 1U7TA 3LLVA 2OXIA 5HS4A 1DRVA 4WEOA 3K31A 1R4NB 3JYOA 4PVDA 4YBZA 4XDZA 3TNLA 1IULA 1QYDA 2CMDA 4FDAA 4LCEA 4ALJA 1SEVA 4TZKA 3ZWYA 1GCUA 1ZBQA 1FDTA 1EK6A 3D0OA 4O1MA 3K6JA 5TC4A 2HCTA 3F5SA 4AJEA 4CQLA 1DLJA 3IUPA 3GLQA 4O6VA 5DCYA 3KXDA 3QE3A 3GVPA 3SXPA 3KV3O 4KMSA 4DQXA 3WB9A 5KVSA 1D4FA 1E3LA 1X7HA 5TQVA 3A1NA 5CDSA 2IDZA 4JJIA 1C0LA 2EXXA 2E82A 4RPJA 5MDHA 2PGDA 1A7KA 1MC4A 5ITWA 1E7SA 2A92A 5FYDA 4HFMA 1XLTA 2CDAA 3G1TA 1YB4A 3GFGA 1J6UA 1TXGA 2C2YA 4KTVE 3TOXA 7MDHA 5JFOA 4RPLA 5TSDA 3ZWBA 2YHIA 2JCYA 1AHIA 3PHJA 1LC0A 3B1JA 4U0KA 2JAPA 3PFFA 1DHTA 1V8BA 4JROA 3ZNQA 5GY7A 1U4SA 1WLYA 3RAJA 2BHLA 1YQDA 2AQIA 3KO8A 2QQ5A 1YXMA 3K2BA 3PJFA 4UREA 5TJ9A 1XR3A 5EQFA 4YT5A 4CLRA 2VNAA 3WBBA 4IS3A 1PJTA 2RH8A 1M67A 3E8XA 1HYEA 1YOVB 1Y1PA 1RYDA 3A28A 3GZNB 1XQ6A 4QFCA 3PQEA 2UUPA 1VLLA 1SB8A 4YAGA 1GV1A 3U4IA 4OOFA 4A27A 4ESOA 2Y1OA 4K28A 5ER9A 2C5AA 3OIDA 4IDGA 5B4VA 5K6AC 3S2FA 2GN6A 1SOVA 3DBLB 4IDAA 1Y5RA 4XGNA 4P8RA 1HDGO 1E3IA 2I76A 4G65A 4D42A 3A9WA 4HY3A 3EVNA 5CDGA 1R37A 3PEFA 3JQ8B 3I9LA 1U2DA 1KVUA 3SC6A 4IDCA 1NYTA 1V0JA 5LDHA 1R0SA 3OJ0A 3ZWPA 4LMRA 1LUAA 1Y9AA 1NQ5A 1PJBA 4II3A 1E7QA 3U5TA 3X2EA 2NVUB 2ZQYA 1VSVA 1IB6A 5LC1A 3GNQA 4WCFA 1JQBA 1E3EA 2FR1A 2NQ8A 1ORRA 2VYVA 5FFFA 3B1FA 5DOZA 4Q3AA 2OOSA 2B5WA 3E5MA 1O89A 3DB2A 1E5QA 5A3JA 1SO8A 3ULKA 4KDFA 1GUZA 3GDOA 3SC4A 3DAFA 3VPSA 1TT7A 1O9BA 4NK4A 1O0SA 4R5HA 4EUEA 3KZVA 3F47A 4PRKA 5IN5A 4ALIA 3L0DA 5GZ1A 5IZCA 2ZYAA 1H6DA 1PX0A 1FDUA 4NBTA 2R6JA 5BSEA 3PYXA 1LJ8A 1RWBA 3GGGA 4AJIA 4XCVA 2HMTA 1F17A 4Z0TA 1N9GA 1BMDA 4PRLA 3AM4A 3AOGA 4ILKA 1CETA 2DVMA 1QMGA 2P91A 3RU7A 2O3RA 4F46A 3LSYA 5L7WA 3RD5A 5CP8A 3ZU3A 2C2XA 3GVCA 5JDIA 1PJCA 1J4AA 4HP8A 4YJHB 3KYCA 4BV8A 1ZK3A 5B12A 3IOYA 5ADHA 1I01A 5EIOA 1N7GA 2JCVA 1MA0A 5HTOA 1MP0A 4IY1A 1YB1A 1GYPA 4NU6A 3O03A 2PD6A 2VYNA 2X86A 4GX5A 5CPFA 1BVRA 4E5KA 1F8FA 3DMYA 1YDWA 4INAA 4CM5A 3K8ZA 3H4VA 3PXXA 4TVBA 1KC3A 4N5MA 5T5QA 4J43A 2I67A
chains in the Genus database with same CATH superfamily
3N9IA 4US0R 1D7OA 5HKKA 2E6KA 4YJ2A 3T7JA 1P1HA 1PCXA 3AHCA 3IDAA 2OSVA 1T9ZA 4MPDA 4W9NC 4MI3A 4CLDA 1X1QA 2X0KA 2BI7A 4LVNA 4ZRNA 3KZXA 2YQ5A 2F1RA 3AMVA 4NMXB 4DLBA 4IVQA 5AK6A 5CDYA 4XASA 4N47A 1I6MA 3NS7A 4WCDA 1QV6A 4NYJR 2PT5A 2Y92A 1XK6A 2Q1SA 1Y3HA 4J16A 1OX6A 2JGRA 3BRQA 2IH4A 5DB4A 1JBKA 1NFFA 3WGOA 3JWIA 1LX7A 5CYGA 1IY1A 3IQGX 1JIVA 1KP2A 3AHIA 3PENA 4LHSA 4BMYA 2WICA 3OCUA 3QA9A 1GQ2A 3RU9A 3BB4A 4LHXA 4RHEA 3WMGA 3D6HA 4N54A 3EODA 5SYNA 1OXMA 4HRYA 1VMEA 2O2HA 3D7RA 4JHLA 3N6VA 2YN2A 4LQCA 3NUGA 2RONA 1JG3A 4NJMA 2UVDA 2HBQA 2MR6A 2VCEA 3CF6R 4QXMA 3WZMA 3ZXUB 2EYUA 2XPCA 4F96A 2RGCA 5LXTB 4Q03A 1E6WA 1FE8A 1P4SA 1H8HD 1KVRA 2NUPB 4IHQA 4MEJA 5B3LA 1DC7A 4BVHA 4C0AC 2R97A 2VSOA 2EF1A 3Q0TA 5E6UA 5EJ9A 2WYIA 1W29A 3Q7QA 2CXXA 3D8HA 5SICE 3IPRA 1AQNA 2QY6A 1UIRA 2XA2A 2O8EA 4JT8A 5HBRA 4HGPA 5DJ5A 1Z5VA 2FMIA 2Q46A 4TTSA 4YGYA 4IJQA 4CM8B 5IHPA 4BMPB 2ECQA 1C7FA 3M2PA 4C08A 4D4JA 2PFGA 3GUYA 3ESXA 4DHWA 3UN1A 1RAFA 4WSOA 2BW0A 1ISIA 3C3DA 2B8EA 1ZKMA 2PL5A 4GXNA 2BSAA 4ZYXA 1I7NA 2C94A 4EUEA 1D2GA 1Z63A 2HRRA 3PTLA 3F73A 3DSRA 3GT4A 1KGSA 3LYAA 2BM9A 3BIOA 1C0EA 3GJ4A 2CNKA 2EL9A 5C8XA 1C2TA 3GWGA 4M1QA 1YZNA 1BCRA 2VT7A 1J22A 3TR5A 4BE4A 4O02B 3WWYA 3DKIA 4ZPJA 1XAGA 3GROA 4MIKA 3WLOA 2WSBA 1P5JA 2G06A 2OAP1 1Y8QB 2HWWA 2XVXA 3I76A 1UDAA 2HDHA 1ECJA 4X8LA 2XQIA 2ZJ0A 5DLPA 3SZGA 3UHJA 3WGTA 4WY2A 3SF0A 4BV2A 5K0ZA 2JBAB 1NTRA 3VO2A 1HPLA 2IIVA 3LT1A 2C0QA 4MRNA 2F8MA 1K08A 3GMIA 1OT3A 2HQBA 4DLXA 3PJRA 2JEYA 2RKWA 4L9SA 4F4UA 4G0YA 1FXWA 4YLYA 2CNWA 3R7LA 3G7SA 3QPWA 4P38A 3UXHA 5BR1A 5JAMA 3SSMA 2I6FA 5DYTA 5T4BA 4F3YA 1A1SA 4G0NA 4S1OA 3PWTA 2P35A 1YC5A 3HB9A 5DBGA 3EXFB 4FX2A 1HE3A 4XRRA 4WZAE 1H3FA 3G85A 3MUNA 2H59A 2R66A 3RJMA 3HZRA 2Q99A 4DV1B 2XIJA 2IOFK 4XGRA 4TYQA 3KYJB 1WM1A 1Z6TA 2ZI3A 3IB3A 4B82A 4EPVA 1VRCA 2UZIR 4PX9A 1E2KA 1CXZA 3H97A 3RB8A 3M6UA 4A8JC 1ORHA 1KK0A 3E18A 4ASUD 4M36A 1NQWA 1O9GA 4Z3OA 2CB9A 5INTA 4OHUA 1PIWA 1WZCA 2J8ZA 3PCXA 4RKEA 1SQ0A 3M81A 1E1RA 2G72A 3N1UA 5FF9A 1SMKA 2XEDA 2BFCB 4KXUA 2ZS7A 3M49A 3FCXA 4LYDA 4O3FA 5I8WA 2AF4C 1Q50A 1SXJB 4D80A 3K30A 3OQIA 2BKLA 4ADSG 1W88B 3HDHA 4MR9B 4KV7A 4BQEA 2C2KA 4V0LA 2I22A 2AMYA 3GGSA 4RGQA 3FTNA 3GEGA 2XXAB 4EB8A 2E4VA 3F6SA 4Q82A 4EO7A 1WBDA 3IUJA 3KOUA 3F9IA 2J9ZB 4B81A 3FUWA 4O63O 5CDHA 2CV0A 4AJ9A 1K8XB 4OHMA 2Y71A 1MU0A 4PSUA 3W78A 2JHPA 4EHFA 2FB9A 5BSVA 4ZD6A 5ER6A 2CJXA 5E6SA 1UQTA 2H2FA 3BA1A 3VO1A 4BQOA 2QVXX 3CNNA 3RFUA 3ROMA 2J7PA 4FEAA 4NFYA 2VKTA 1P7WA 2O3TA 4J4HA 4EDFA 3RYCA 5CM9C 1O94A 2DQZA 3D8UA 1KYZA 5D87A 1XTPA 2R1TA 3GLHB 3Q3JB 4XCXA 3ER8A 4GBED 1BS2A 3A1TA 3DMTC 1QWOA 2R6R1 1OTYA 1RHQA 3R5SA 3X1YA 5HOQA 5JANA 2VQEB 2YWDA 1MB2A 5C3UA 1ZOLA 3L6UA 4G81A 4QFBA 2C99A 3LT4A 3NASA 3OEYA 1XXHE 4WJZA 3KXLA 4K05A 2VP4A 3L7BA 5JADA 3REQA 1BFDA 1V3TA 3NBXX 2AS0A 4TYMA 3NTOA 2V65A 1BCSA 4FQ8A 4RHUA 3ZDQA 1UBUS 2IE0A 2HOQA 4KN5A 3N58A 2AI1A 2FSHA 3L4SO 3GYGA 2DHCA 4NK5A 4AYTA 1OLXA 2C9MA 3L18A 3OU2A 4Z4GA 1A8IA 3NORA 1FFDA 2N9UA 2B94A 4KOAA 1DIHA 2UAGA 3I0ZA 4AP9A 2Z6QA 1F9EA 4YGXB 5AJTA 3ROQA 1U5BB 4I4IA 1FYXA 3LDUA 4FMCB 4QJ3A 1E1CA 5NLLA 1FMLA 3SZLA 5GQSA 4YUVA 1S3SA 3JYNA 3QTBA 4MS3B 1BW9B 1OLUB 3HA3A 1UOOA 5DT2A 2O7VA 4D9MA 1GYQA 1OYYA 1Z0IA 3IDOA 4REOA 4DIUA 1Z68A 3H6KA 4JI0B 2PR7A 3DZIA 3VMMA 1YNSA 5EZYA 1JJBA 2O2JA 2LE0A 2H11A 5EHIA 5JZOA 4IOMA 1H4VB 4EB6B 1R66A 4MUNA 4WOPA 4YJFA 2P2YA 5JBNA 1CEYA 3V9PA 1EWYA 2OQIA 2QMEA 1LQUA 4LF9B 2OFWA 1FRZA 1B6RA 2C5EA 2WHXA 1Z5ZA 4M9QA 4F93B 4AJ4A 3TDKA 4TOIA 2G3YA 4P9NA 4PYLA 2D54A 2NU7A 5DCWA 5HE8A 4CKBB 3AETB 2VHXA 2G80A 4UTRA 5LPNA 1U2TA 1Q20A 3ZUGA 1BEEA 3V1LA 4E2WA 5LZ9A 2WUVA 3ZJTA 2DHRA 3BCSA 1TRKA 5U4XA 1O96A 3EWAA 3WL6A 3D4BA 5J23A 4EX7A 2IYVA 3ZY6A 1PBTA 3OEWA 1TA0A 3TJMA 5H4GA 3JD4A 2G9ZA 2HF2A 5IFKA 1ST3A 1WDLA 3AQIA 4NC9A 1JPJA 3E7FA 4NPCA 2XMSA 5G3YA 3T9CA 3U3ZA 1LDGA 4URFA 2J9XB 1OZHA 5HA5A 1W47A 3IAXA 1GO2A 4BZQA 3WSWA 4MGEA 3SS9X 2OC9A 2PZLA 3M1LA 2V7PA 5DK4A 5F73A 1JFLA 4LN1A 3JPYA 3VHQA 1C30A 3O8OA 2OGSA 1KE1A 1E1QA 2P9HA 3C8MA 5SY9A 5F3DA 4MUYA 2FA9A 5B2ZA 1IG3A 4BKUA 3ENWA 4PR3A 1X9IA 5KSWB 4ITUA 4BYMA 2Y1GA 1V11B 4HXYA 2HUPA 4DLWA 1BHQ1 3G0CA 3ZKWB 4TS1A 3U0VA 3PDIA 4C0XA 3JAKB 3N86A 1D6SA 2IOHA 3PQFA 4KPUB 1PJLA 1U2EA 2WW8A 4PFQA 3VNVA 3C1OA 3KK0A 2IZ0A 5DM1A 2NV0A 2P27A 4C04A 1XTTA 1CU1A 2YXBA 4IW3B 1YUMA 4K6GA 4EY8A 1VG9B 1HT2E 4DBLE 1Z82A 1GL3A 2AJDA 3W6UA 3ZH2A 1NXVA 5BMVA 2VHZA 2O52A 1PJ4A 4RDXA 3UOGA 1FSPA 5HF9A 1CYEA 1P72A 5KNBH 5DE3A 2Y1EA 3L77A 5FHRA 2BMFA 2ISQA 3CZ5A 2WWFA 4LOJA 3OMLA 4U2KA 4B32A 5KWEA 2C2WA 1BD3A 4P7BA 1OMOA 2QGNA 4Q9LA 3S68A 1NDHA 1XD8A 1ZIPA 2JJ1D 1E2FA 3P0IA 4J1TC 3D3QA 3JV7A 2QVBA 3B9PA 3BSYA 4JEUA 4R51A 3RIHA 2OPBA 2VRCA 1ADCA 1MW8X 1M3SA 1A2QA 3VBEA 5JYCA 2ZAOA 3EEIA 5H4HA 3R9WA 1C9DB 3RC7A 1GJRA 1YZ3A 1WMBA 3L6OO 1ZD2P 4FIDA 2MTBA 1YRBA 2JHAA 1XEFA 4YDSA 1RLTA 1QAOA 4YT4A 1Z8NA 3BWEA 3FIUA 4R5HA 1NG9A 4BGVA 1DXYA 2HY7A 2YXDA 3GRRA 3P9YA 3PWKA 3R6TA 3W6OA 2HJSA 5ELXA 4NCNA 1NOIA 1U3WA 4OBWA 3VTKA 5GZ1A 1LRKA 3DMDA 4B4OA 3K0FB 5K4GA 2FPWA 4ZYUA 1F0KA 1M0WA 1W73A 2WMDA 4BNJA 1RWVA 3FBTA 4P7FA 4XLTA 5TX7A 2R7NA 3NAZA 3WLFA 1PL6A 4ZYVA 2NSJA 1U81A 5D00A 5DHPA 3OZWA 3VUFA 1EG7A 3JQRA 3A3YA 4U6QA 3FFXA 1JJ7A 3T4PA 1T36B 1RQNA 1EGHA 4N8SA 3ABZA 3QHAA 4M54A 1QIHA 4ND8A 3WWDA 3A6GA 1XELA 3AWIA 3ITKA 3Q6MA 2VYQA 5FT9A 3TSAA 2D2VA 5L6LB 3T3OA 1LS6A 3R0JA 4LRWA 4ROSA 3SHFA 4MUKA 4IIUA 2AWNA 5EQJB 4DR4B 1WXQA 3EFBA 1MOPA 1ZD9A 4I1SA 4L57A 3GIWA 3JZMA 2PE5A 4QAJA 3T5PA 1JB9A 4R9VA 5LJIA 4KMOA 4Q4JB 3SPXA 3HZOA 3JYLA 1U11A 3BT7A 3N8DA 2EZUA 1A4RA 4TKVA 3RYFB 4N41A 4HN4B 1T2FA 1DIAA 2WMNB 1ICEA 1SIOA 2NV2B 2NW6A 3B3GA 3G2JA 3LC1O 1Q1ZA 2PBRA 4A9AA 4CM1A 3L9XA 3BZUA 1P0QA 1S89A 4BB0A 3KKPA 4WIAA 4CU5A 3AKCA 3DCYA 2MSKA 5J58A 1VJDA 5DYYA 1IOZA 3J7TA 2VH2A 1FFHA 4RQBA 1JIIA 3MLBA 1TVKA 3NHLA 3PI6A 4JT2A 5FPTA 1J8MF 1X14A 3CZCA 3FIJA 4UBJA 2AV6A 2DM6A 3FMGA 2B2NA 4BDSA 2MT9A 2X2EA 3H5AA 3U6BA 4KL8S 1T4CB 1KAOA 2YDYA 1Z6ZA 2PIAA 3Q11A 5AKIA 1GTVA 1YS2X 4CR6A 1EWRA 3IUSA 5DTJA 3VJKA 3OEED 3WBKA 3W5HA 1CEQA 2QD3A 4YCCA 3ZI7A 4LF4B 5HKLA 3BWCA 4ID3A 4EKEA 3T3NA 1EUCB 2CCJA 4J2OA 2VNKA 1DBWA 2XNDA 1O5IA 2EBWA 4LOAA 4DYHA 5CA0A 3ME5A 4PG4A 1TW2A 2DTXA 2FAXA 1ISHA 3L46A 3OT1A 4ZYTA 3GHHA 1GGEA 3GJTA 4MJLA 3ZOZA 4BTLA 4ZKDA 3A1EA 1OAKA 1VP9A 3CN7A 5K3FB 4LX0A 3TH5A 1SUWA 1MXFA 1G6OA 2XTZA 1R9MA 1TK3A 1XMSA 3L07A 1MHPA 2Q6IA 2WFZA 4IHJA 1F14A 3U13A 2X8LA 4BNLA 2P65A 2I2WA 3T0IA 2YZNA 4JSYA 4DVJA 4EFLA 4IIDA 4MWGA 1JNXX 3K0AB 1WDMA 4NL4H 2KW5A 2VXBA 1FEZA 4X8OA 4O8ZA 5D85A 3ST7A 3SYKA 3VYVA 2EHDA 5AXBA 1FRNA 1GM5A 4YRGA 2CL0X 4AJLA 4FUQA 3SQXA 2YJ4A 4TS9A 5M29A 5JLJA 5AOAA 2YUIA 3AOEA 1EBFA 1VE5A 2ZBRA 2ZPAA 4QC2A 4R31A 1WF6A 2CSXA 4HVLA 3BIWA 2ZU0C 1X13A 5EIXA 3KZ1E 2PS0A 2QOEA 4R1LA 1THZA 1DPFA 1CZHA 3DNMA 2Q3FA 3QHPA 3I1YA 1UPBA 1H0RA 1U5AA 3BF8A 4QASA 5A0TA 3DR5A 2A5FA 3KAPA 2VK1A 2WWIA 1ZCBA 4U9UA 1DCTA 4B7CA 5BOVA 4N9QA 3LP5A 4YMVA 1CHNA 4XGIA 1UBJS 1RJWA 2B98A 2BHSA 3T99A 1JJFA 1YJBA 4ZT2A 2C9YA 4J29A 2BGGA 4W1SA 4Q3BA 2J3LA 3G2PA 2IYQA 2ZSHA 2JPDA 3IBYA 1Q14A 5ESRA 3O84A 4ZHQB 1BIFA 1K6EA 3DDNA 1C29B 2B8NA 2AIRA 3ABIA 4PLGA 5K20A 3UW3A 4BLVA 5L3QB 2ZK7A 3U56A 2WQ7A 1J97A 2IGTA 1C7EA 1C3OB 4XQCA 1ZEMA 3C14C 3UC9A 2CZGA 1AS3A 3NP9A 1YCGA 4DPKA 4UNQA 3OLZA 2J3KA 2PGLA 2WEKA 1QVVA 2PS9A 1YKSA 1NW9B 4KG7A 4LMPA 1LDEA 4DC1A 1NNSA 1DKOA 2FYTA 1AQIA 5EP2A 3ZHXA 3T7KA 5JJIA 2C7VA 2ZIXB 3S3TA 1U90A 1XNJA 1NZFA 2C4TA 2QN6A 3D2AA 3GFPA 4P3OA 3OCCA 2V59A 1HDCA 4ZCQA 4D3FA 1BFUA 2QD2A 3LDHA 4N3AA 2QHXA 3N0TA 4GWLA 13PKA 5HQ3B 4HWTA 1IM2A 3OLWA 1RQPA 4P32A 4U63A 3H87A 3LQYA 5E6RB 3FDFA 1AMNA 1CS4C 3LRPA 1J24A 3O1HB 2H8GA 3A14A 4HNVA 5TMPA 5J4YA 1TQ4A 4BMNA 2UUBB 1T13A 2Q8PA 1NXXA 1PDWA 3DZFA 2Q6VA 1V8PA 3FN4A 3GIDA 1S2OA 3LE8A 5LB2A 5KJCA 4C0KA 5E3HA 5GJBA 3HY3A 4KQGA 2VQSA 2H1HA 3TLXA 1H69A 4JJAA 4GQIA 2ZRPA 3W7VA 1CYDA 3KT3A 1ESCA 1KFJB 2JGFA 4NG4A 3RSQA 4EPYA 5IG2A 3F67A 2JK1A 5C34B 4IUYA 3CRRA 2FN7A 3B82A 4HRXA 4IH9A 3U4QA 1U0BB 3KQPA 3N05A 1WKCA 4O2BA 5DWDA 4TYNA 1JDBB 3OMWA 4GMGA 2XDAA 2GETA 3IHTA 3JWEA 1RWQA 5G4KB 4CTKA 1XJCA 2HRZA 5F98A 3BTVA 1LJLA 1XTVA 1KGDA 4BFXA 3M6VA 4EITA 5HJ5A 1V2HE 4J0JA 2PKCA 1WV0A 4L6IA 1VI2A 3SDZA 5CXSA 2O0LA 1HURA 2O1XA 2XMGA 2ZUBA 3DLIA 4QUDA 3RSZA 5CPBA 5L53A 3PC4A 1BGXT 5CG2A 5SZKB 1E0KA 5BYAA 3FVQA 4GVPA 4IJ6A 1T0BA 4C5BA 5HIMA 2O5EA 1E3DA 1PUIA 1GUFA 1X80B 2GZHA 2P9BA 3HZZA 4PZPA 4I50B 2XGMA 5EVCA 1USIA 2FWJA 3D6TB 5K3AA 4GXRA 2G9RA 3PEVA 2IBTA 4A0FA 3ILVA 4DIEA 1KEKA 2APJA 1QH0A 4X61A 4AG5A 3IEIA 4CHTA 2P77A 1RI2A 4DDHA 3LD9A 4MRMA 1VA4A 2HK7A 3W2FA 1Q7EA 1FVOA 3MAJA 4N0DA 4LXTA 1LV8A 2GTHA 4BFUA 4DEXA 5C8YF 1YBHA 3D4NA 4MVJA 5KSOA 3OC0A 4GEGA 2DCMA 3CMCO 4WZZA 5JSKA 1DQRA 4A2CA 1EWVA 4H7HA 4MV3A 2JGLA 3L7YA 5ALRA 4JYAB 1UOQA 3SZRA 5HIJA 5DM70 3L79A 5F1OA 2OHHA 4FD2A 3SZMA 2H5LA 5E8RA 4CE6A 2ZDHA 2ZUUA 3C1AA 3DCNA 4MRPA 5CVTA 1L3IA 2GBPA 3I05A 4FEGA 3MMXA 4EO9A 1ISMA 2OWEA 3I2KA 1EFPA 5K7SA 1Y8RB 2J7KA 4QYIA 2ZTVA 2K7ZA 1NULA 3ISJA 1VMKA 3EXG1 4KN8A 5K09A 1EK0A 1NN5A 3A1CA 1UOEA 2PMCA 2I78A 3AR6A 1L2TA 4GSKA 2DY0A 2WSLA 221PA 1GZ7A 4HDCA 5LDGA 3RVRA 4B0OA 3S8YA 3ZVMA 2H52A 3H5WA 1EK5A 1LV7A 2RHGB 5BNWA 1L7PA 1S8FA 4PZAA 3FLBA 2QPTA 2VNSA 4EA9A 3L0OA 3AI1A 1C7QA 1QZUA 4X84A 5IZ4A 3TWOA 4QM6A 3JZFA 3DDUA 1K3TA 5A7FA 3RKUA 3LBAA 4KJXA 2IP1A 3OM0A 3X1ZA 1QH9A 1E32A 5BUCA 2NTJA 3KVRA 3NP7A 1OKKD 4UHFA 5IU6A 1OBFO 1TB4A 4JFAA 3GHYA 1U7HA 4RQUA 3ZZTA 4DOMA 1I51A 1I5OA 2PGNA 2DKFA 2VG8A 2WG2A 4J3JA 1DAPA 4Q9KA 1EDBA 1NUUA 2YDXA 1GCOA 1Q0HA 3QBVA 5AM1A 1A9YA 4MVJP 4CMEC 1P3Y1 4HWGA 2IXFA 1U8TA 4HAOA 2M9MA 5FNVA 4B3XA 2FQ1A 5CFQA 4WLOA 3TNYA 2PWPA 5J63A 1QF6A 2YIJA 5JO0A 4TV9A 4NARA 4B8YA 1DJNA 1YKGA 1FDVA 1OQAA 2SKEA 4ID9A 4ARUA 1QRTA 3BXGA 1C4XA 2QLBA 3DBVO 4B44A 3PUJA 5A2GA 1UPUA 1XKQA 3MB8A 3W6ZA 3FDJA 1ZVMA 4R8VA 4MDHA 1VB5A 2XZLA 4J6FA 3DE3X 2Y1CA 2ZANA 3BL5A 1UIMA 3MJRA 1K6JA 4I66A 1OREA 2DTEA 3H11B 4N40A 4W1PA 3W1WA 4M0DA 3RRMA 2QQ0A 4PG6A 1S8NA 1Z0AA 2X58A 3FVWA 2H1WA 3R3WA 5EL0A 1NW7A 4BB5A 1SQGA 4C88A 4YA6A 1XNGA 4G8BA 4HNRA 3S1AA 1O1YA 1ZWLA 3MK31 3WQSB 1FPQA 3HCWA 3BM5A 3O5AA 4LZZA 5DHAA 2C42A 1F8XA 4AS3A 4R8MA 2QR5A 3L0YA 4B7XA 4DG5A 3ED1A 3O8QA 2C7GA 5FUXA 3B2NA 5BW5A 4PZZA 4DR7B 4HLCA 3EEQA 4QDZA 1BHSA 3L4KA 1O03A 2EL7A 3H1FA 1XP8A 1SXJE 4QEKA 3T3HA 2WQ6A 4HQKA 3LDGA 2ZSUA 4G86A 2XMQA 4XIYA 1AV7A 4RKRA 4B1FA 1V1RB 1NFRA 1GY8A 2GCEA 4MR8B 3QVJA 2BEVA 3DV9A 1P4HA 2YNMC 3HV0A 2WOOA 3FPAA 4HN2A 3RSLA 1DU4A 1U0OC 2ZBUA 3UJ6A 5TT1A 3UGTA 4ZJYA 3KUKA 2FSPA 5SZHB 5JIBA 2I87A 2ZBVA 3FTQA 4Y2YA 1KNQA 4FZJA 2TSYB 2PGIA 1NPYA 4BNHA 1ZSYA 2RDMA 1YDHA 1S2NA 3NH9A 5AM0A 2IPNA 3JATA 7ABPA 4FYXA 5LNK6 3VH3A 4M0KA 3HKCB 1W35A 1QWSA 2DQYA 1O57A 1SK8A 3GZTB 3HFRA 4G8CA 4MP8A 3E3AA 3SHOA 1R0YA 4AKTA 3GLHE 5LQUA 1DIOB 1PNQA 1GZUA 3CXUA 4DJJA 1NJ2A 1EGQA 4JSTA 4HLDA 3RUPA 4CGZA 1PK9A 3LGAA 4DREA 2C03A 2J85A 2R25B 3JQBA 721PA 4M0UA 3W9SA 1E9CA 1G9TA 2AJCA 5K05A 4FBLA 2OXCA 1L5RA 3I73A 4UU8A 4DRXA 3AOEC 1UBFA 3FNEA 5COBA 3TIFA 2VVTA 1MQ8B 3LT5A 4Z9FA 3WLRA 2G0NA 4BVGA 5LU8A 2WJGA 1R0LA 4OAQA 1VL2A 4U02A 4TXLA 1XEAA 2LCQA 1ZN9A 1CBUA 3ACCA 2GF2A 1G3UA 4MPJA 2PYIA 3MWEB 1LPOA 2HRCA 1Y3FE 2WUEA 3JVUA 3WOHA 3LK7A 4AJ2A 2AWOA 3D4OA 3NKFA 1EXMA 1SZPA 3S2EA 2KS6A 1F3OA 2ID8A 2IPLA 2RBKA 2WMOB 2YWEA 1Z33A 1SHZA 3OPMA 3F4KA 1WS6A 4RQAA 4AULA 1QIJA 5ALDA 3W79A 2PWYA 1F48A 5B58T 2NV6A 3HDTA 2I3GA 3GUVA 1WMFA 3VH2A 4M38A 4R7ZA 3VFDA 2LZ0A 3LY5A 2GT1A 5KCMA 3BFVA 3GY0A 4MTCA 5EZ5A 2I7VA 2E37A 5A3VA 3SKYA 3DEYX 4R4JA 1PZEA 3W06A 2XBLA 2ZR8A 2AR7A 4M9CA 1M8FA 4AS1A 4GZ3A 4YX9A 1YR9A 2BF4A 4OQZA 4NX2A 1UC8A 4LTDA 1FQJA 4HAWA 5ABPA 4RH0A 4BFTA 4NCJA 3T3EA 1UL1X 2DULA 3PLNA 1Q5PA 3VH4A 3FZEA 4M4SA 3FNRA 3LQFA 1KMHB 2BFFB 1Z0FA 3WO1A 4TGLA 4BX0A 1XDZA 3NHMA 5C8DA 1H2HA 4B2IA 2DU8A 1NY5A 1C50A 4LKRA 3KLNA 3PRJA 1JSLA 2C3OA 1P77A 4ML3A 5EJGA 5JS2A 3HBLA 3B1ZA 2JK0A 3LX8A 1N8NA 4LSGA 3ND6A 4ERXA 2E1PA 4GOKA 5I5EA 2PUDA 1T0JB 4Q19A 4ZMSA 5LIRA 3FWYA 3TFQA 1D4AA 4B3SB 2ON6A 1KRXA 3I37X 4ZAVA 1HE1C 4H15A 4KQCA 4C4AA 4R2HA 1SKYB 1THMA 4FFNA 3I4LA 1U28A 3B7GA 1MNQA 4WCVA 2VP3A 4G0OA 4PG8A 1NWCA 2FPIB 2EG9A 2QGFA 1QM5A 3KPYA 3OE5A 2UXBB 5DTRA 3RSHA 1FC0A 2GKSA 1DFIA 5CHEA 3BD6A 4FP9A 5IC4A 1AOXA 3A27A 2IH5A 4EX6A 4CTJA 1IY8A 3G5MA 4GUAA 4RC9A 4BBAA 3P0EA 3QF4A 1IMJA 3VSBA 5KZMB 3DAOA 3N8KA 4HSGA 3AO0B 2C2ZA 2GCIA 2CE7A 1QLJA 3CY6A 2IEYA 2JGNA 3AR7A 1JEJA 3WYBA 2ZU6A 1ODSA 1AK9A 2CJYA 5J40A 1L8OA 2HK9A 5M34A 1HDRA 2LXNA 2WDPA 2ZS8A 2WUGA 1P75A 3F46A 4UTXA 4WZBA 3IPCA 5LP6C 4PSVA 5CBPB 1NQXA 5TGZA 3S7TA 4E11A 2IYWA 4Q01A 2BE9A 3IIEA 5CK5A 1WP4A 2E21A 2FPSA 4NYIQ 2R11A 4NBVA 1F8GA 1R00A 4I5DA 1U0GA 4QXPA 3THWB 1MG5A 3P27A 4F06A 2PUEA 2FEOA 3DE7X 4U7JA 2EHJA 3E81A 1UQUA 4BNVA 2W2VA 3R7SA 4XIFA 4D4GA 4ZJZA 1XE3A 1SY7A 3D3EA 5B7QA 1VLVA 1VHDA 2WWXA 3K7EA 3LBYA 4MI1A 4PSAA 2DBZA 4AMYA 4GC5A 5FDFA 4P4UA 5KWSA 1CZLA 2YL2A 2RHDA 3QX7A 3R3YA 2A9JA 2G5CA 3LX6A 2FPPB 4HQ6A 4JZKA 5EIFA 4C0HA 4DA6A 1VIDA 5CT6A 1DO0A 3PFGA 1YJQA 2PLAA 1U2GA 2XNJA 2DJ5A 2KE5A 5TMDA 4BBPA 2FZWA 1P31A 1M6WA 1QHYA 1KFCB 3CRQA 1F2DA 1IEXA 4QPJC 1JE1A 4FR0A 1KI6A 2AW3A 1LQ2A 2C4WA 1U02A 5E9AA 1DOZA 3D43A 2IEBA 3DVAB 2DT5A 4Q4HB 3T5TA 3EMKA 2BTEA 4FE3A 3D6UA 1X1TA 1TZMA 2NAFA 4TM7A 3AR8A 1FSFA 2GM5A 3LOQA 3ZX5A 4NLLA 4N5HX 1D4OA 2VBFA 3OOYA 3CS3A 3PV0A 4FI3F 1DRUA 4NPAA 4BU0A 1CQJB 1TJ5A 3D3WB 1J8FA 1K89A 3K35A 3QEOA 1EEHA 5ERYA 4ONEA 4PC1A 2PRJA 4ZV7A 2XSZD 1KYTA 5CYFA 4A26A 1LPSA 5IUKC 3TDNA 5KC9A 1VL0A 3TCNA 1ZVKA 4AECA 3PTZA 4YV2A 3P9SA 1P5ZB 3UUEA 5C7LO 4L78A 3ZTWA 1EESA 3TEJA 2NVOA 3WK8A 1KDPA 2H2DA 3EPRA 4ZRDA 5B64A 3A37A 1D03A 4N5LA 2WV9A 1R6VA 4PAOA 1X7ZA 3L7AA 1YO6A 3T38A 1HOTA 4MIYA 1AA9A 1TOAA 2C0CA 1DRWA 4HLUA 4IIGA 2H1RA 4LJRA 1ZIXA 1M6VA 1C1XB 1HEYA 4HQFA 4MUGA 4R5MA 2BFOA 3CX6A 3FOWA 4UUNA 4ALMA 4E22A 3ICEA 3CVVA 1ZITA 3V46A 4C30A 2YW9A 2FEWB 3PIIA 1I4WA 1QUFA 1EM6A 1YDGA 3KDSE 3GQVA 3LVBA 2OBYA 2QPOA 4QSHA 4B7UA 3VR2A 4CJXA 5IKMA 1HLGA 2I7DA 2XD9A 2UYYA 1QNFA 2O2YA 3U4CA 1H23A 4PHGA 3VISA 4LWPA 4IIJB 1ZCZA 4NCIA 1YJAA 5AI5A 4EJSB 1CNEA 2ZRKA 3OSZA 2QS9A 2MWMA 1Z4JA 2OCXA 1I1OA 5CYPA 3ASZA 4RH3A 3ILSA 5F52A 3AUAA 1G21B 2H29A 2UDPA 2HC9A 4HDQB 1NHWA 3QOYA 3R9XA 1VE7A 1TIBA 4J0CA 1FP1D 3ITEA 3UFBA 5FBQB 1RXWA 2DWCA 3X2SA 1V25A 4EUSA 1PGQA 1QKIA 2P3OA 3N7TA 4JEIA 5B7NA 1RQLA 3GFSA 3HDGA 4ZZ3A 1CZUA 1FDRA 1FDOA 1KI8A 1T3HA 2E0IA 4QSMA 3ZHQA 4IV5A 1U99A 1VDMA 2J48A 3JARB 5DBIA 4RTJA 1K2VN 1NBWB 4QKQA 3BHJA 1G20B 2ZYTX 3KKMA 1Y63A 1V48A 1VFNA 4C0SA 1GPBA 1ZD5A 4N6GA 3ELYA 1YZQA 3IEMA 3FNHA 1PJ8A 2NO4A 3ILXA 1C81A 4H1HA 1CV2A 4C78A 2ZIVB 1DTEA 4M0PA 3LPDA 3ZE6A 4WFIA 2YY7A 1KOJA 3LYHA 3V6LA 2IW1A 1SCKA 2H3EA 4FYWA 1P1FA 2UZ1B 2H51A 3A9SA 4R2IA 2GCPA 1O95D 1QIMA 2F3UA 3FJYA 4QICA 3B3JA 1WXHA 4NYMR 1SJ9A 3TIGA 3ZOKA 2P6RA 4OLAA 1LLCA 2B0JA 1SG0A 2ZXFA 3KUDA 4HF7A 3EXG2 4UBNA 3ND7A 5COQA 5C1IA 4OA8A 4F7DA 3PD7A 1GUYA 4AG6A 1V7ZA 1ZM4A 1H8ED 2P7HA 1E9FA 3T9DA 3F7OA 3LCMA 1WDTA 4EW3A 4U7PB 5J43A 4IDEA 4U2CA 3UMFA 1N2SA 2RB4A 1UAGA 2P78A 1OF1A 2V03A 3G2MA 3OPXA 4RABA 5HIKA 1FJXA 4Q1AA 5CX1A 4C4SA 2WKPA 1H1LB 1VJ0A 1Y1RA 1G5PA 4KBYA 3STHA 3I61A 4MR7B 4ALNA 1Z35A 4QUGA 3RBAA 3I9KA 4B6JA 1UPAA 1OSNA 1W4ZA 2GB4A 4XYLA 3K0CC 3N0RA 4H6VA 1VE3A 2YVKA 2CBXA 5AJVB 2X77A 5JJBA 5ITZB 2A9PA 2C31A 4YRPA 1CF2O 1II8A 4PS0A 4ERNA 1EEXB 4HVAA 1ZK4A 1IXYA 3GBPA 4MDYA 4ACAA 5JAZA 1GXSB 1FL9A 1Y5NA 3AXSA 3EQ7A 4MRAA 2WR8A 1IE3A 3S4YA 1N5DA 2YQ4A 4G8DA 4MX8A 2DQSA 5AOVA 4H0FA 3U49A 2IXAA 4BLUA 1YB5A 4YP7A 1L4KA 2EARA 1QPZA 1TYDE 2VJPA 3P2KA 5DTQA 2Q49A 1R0ZA 1HYQA 3DXXA 3N53A 5ALWA 2GVDC 5DMHA 1E2MA 4AJNA 2Y6UA 3TAUA 3JPWA 4DWWA 4KWTA 1MCZA 3TKLA 4F5ZA 4OX9Y 1LSJA 1W6RA 3Q9UA 2R6AA 1SFRA 1YK1A 3RF6A 2W6ID 5PGMA 4V3CA 4K9NA 4X1YB 3QLJA 4KNWA 3MT8A 4M2LA 4KXFB 5E1BA 3O4RA 5IAOA 5ENZA 2V0GA 4CN8A 3TSYA 2BMAA 4IG4A 4U0JA 3ZD9A 2V7UA 3ZKAA 1JSCA 5KUTA 3OKFA 1I7QB 4BAUA 4BLPA 2B83A 3H1BA 1IPFA 4TKUB 2QX8A 2BBTA 2R8PA 3AG6A 3ZDDA 4JBHA 4QNNA 3AJ8A 4F92B 3LW7A 2QJOA 1RQRA 3TTSA 2DUMA 1N9KA 1T9HA 2ODQA 2V6BA 4DT1A 1QS0A 4PO9A 2X1HA 3UMRA 3HUFA 1FW8A 3QNUA 1ADGA 3GD5A 4XFJA 4M7WA 3VZBA 1IN1A 3E3MA 1R5JA 4X7RA 3DHEA 3WLIA 4EKYA 5KC8A 5AVQA 4IQ8A 4J6EA 3L8MA 1RC8A 1KFKB 4JA2A 1U28C 2OOKA 3BAZA 4MVJH 2J09A 5LA6B 3LIIA 5A6SA 4JLOA 1LS1A 1JKIA 1SCQA 3BE4A 121PA 4TTTS 2GTIA 5HRAA 1QRSA 3CONA 2J3HA 4JFRA 4ER5A 1AHNA 1JN0A 3RBXA 1R4AA 4O2AB 4DDTA 2PS1A 4FEEA 5GVRA 3GLKA 4LRSB 1IBMB 1ECPA 1ZOSA 3LQQA 3W5CA 2W2LA 3CNBA 4BO5A 2YBDA 3PR2B 2R3SA 2C4VA 1GA6A 2OZEA 2JIOA 2QZZA 3LPAA 4BZWA 3II6X 4HNAB 1R0WA 4I8IA 1ML4A 2WB2A 2QL5A 4B3JA 3F8WA 5IAAA 1U5CA 1XEXB 4ZDWA 5ES4B 3CUTA 3CLUD 4D79A 1QZZA 3JQFC 4G36A 3L1VA 4FWBA 3WJ2A 1MC8A 5K51A 1EB8A 1ZNQO 3V1KA 3C6XA 3CJTA 2NXCA 3H2BA 1DE0A 1DC4A 5AKGA 2CLEB 4IIVA 1IQRA 1SVNA 4DMLA 1ZGZA 1R6TA 2VPWA 4QX6A 3X1KA 4DIOA 5ADVA 3NKLA 2C7OA 4W1QA 4ME6A 5DIFA 4E5UA 2XWPA 2K5UA 3DB1A 3KKQA 4LE1A 4J2TA 1OIWA 3NB0A 1P2SA 1P91A 4GZMA 2V9CA 3I1FA 1E96A 4HG2A 4IX1A 1XJ5A 4KMMA 1N6NA 1RLJA 1FZTA 5HYVA 1K9SA 2F8SA 1TT5B 2Q07A 3PUHA 4FFPA 1EX1A 2RHBA 3QX8A 2IUYA 1PUXA 4KLAA 2D0IA 1Y4AE 5J5VA 3R3VA 2YASA 2VL7A 3VSDA 3G23A 4G0QA 3VR4D 2DHDA 1N75A 1NMXA 1T5IA 3JQ9C 4YXWD 2YMMA 5EYPB 4B43A 2FMFA 1MJHA 2BFDA 3CBGA 1QHHA 4PZCA 1S8OA 5FA6A 3ICCA 3RV3A 4K6OA 1T8WA 1V6AA 1ZRMA 2PX0A 1I1HA 3LBFA 2LPMA 3CHYA 1U6IA 2XJ4A 1K5PA 3ZZMA 2R47A 3F78A 1D2NA 3GJ7A 5B2FA 1HORA 1JLRA 1YR7A 1KIAA 2WWHA 3CIFA 2VJCA 2P4UA 2WVAA 1P60A 3IXLA 2NZUG 1GCAA 4N3GA 4P86A 4QRDA 4XQEA 3UM9A 3JAMA 3EIEA 5J4VA 1JPUA 3ORQA 3O8CA 2MDTA 3GDFA 2V96A 5KQPA 1OH6A 4E32A 1NXPA 2QD4A 1NUPA 1XIVA 2QE6A 1K7CA 3BREA 3IS3A 4OSEA 1PN3A 1CJCA 1KEZA 3ZQ6A 5D3MB 3AR4A 2ZE7A 1UWVA 3OQ1A 4MS4A 5JVDF 3PXEA 2EERA 2ZTUA 1FTWA 1XLUA 4EYGA 4KE9A 3LVFO 1FFCA 2QTBA 2PYDA 3I92A 3ZY4A 1OBCA 2H57A 3PBKA 2GRAA 4CNBA 3WMXA 4WFJA 4WINA 1Z0SA 4YFVA 3GR6A 1RXYA 3AL2A 4CF6A 2OESA 1O54A 2PZKA 3D7SA 3O4HA 4WDQA 2DEUA 2PRIA 2ZWIA 1HNZB 3L6CA 3NT2A 4Q48A 5F33A 3B20A 4LF5B 4KREA 2GZ2A 4IUBS 1XZJA 2V7QD 2D2XA 1X86B 3L93A 4RS4A 5LLTA 3K09A 3LFTA 3OQBA 4HAVA 4BBJA 3MSXA 1JEAA 2CYAA 1JQLB 1RLOA 1NT4A 3JRWA 4W8HA 1KA9H 1YC2A 2O48X 2ZAGA 4DQDA 2VZ0A 3D0QA 1T8YA 2EKBA 2ONKA 3PHBE 1RWPA 1V47A 4WL0A 2F62A 2O7QA 3F49S 4INOA 5JHHB 3VDXA 1RADA 5DASA 1N6RA 2WILA 4ZOEA 1MB0A 1NJSA 1URPA 4G5XA 3TQCA 5JNSA 1R16A 3SBOA 4B6FA 1NONA 3FNGA 3HVJA 2FP3A 2A78A 3WRXC 3KE8A 1P80A 1B0AA 1VBMA 1Y81A 2A1UA 3GT3A 5LBUA 4M7PA 4MNTA 5DW3A 3B6EA 1XMJA 2J4DA 1KO8A 2J5BA 3HE3A 3QKSB 3QYAA 4IR7A 4OXQA 1CRLA 1FTNA 3W8NA 3I39X 2PBFA 3GGOA 4Q4DA 1IQPA 1L5SA 2RFLA 5IVPA 4YUXA 4XD2A 8LDHA 1GGNA 3OZSA 2H16A 1J9EA 4I55F 5G1PA 2DFVA 5IF3A 2E4AA 4ZAXA 1FFXA 3PVSA 4OF4A 3W5VA 5ALOA 5JY1A 1GRVA 4WNIA 2LVBA 4OXYA 4LNUA 4WESA 2FW6A 3FLEA 4TLLB 4GP9A 5KDOA 4IZ6A 1P9LA 4ZVKA 4CG0A 1AX9A 2QL6A 3DV0B 4KQWA 1BWPA 1KEWA 3V00A 3WE7A 4BXOA 4TLMB 3Q2IA 4JJFA 4RWZA 4PYJA 1DAIA 2BAGA 3N3AC 1YBFA 2A58A 2A0FA 2YHIB 3K1TA 3ONWA 1G16A 2ZJ7A 3E3LA 4U3JA 3HKBA 5BN3B 1ZH6A 1KR2A 2XB8A 3IOEA 3OIWA 1EK2A 3O9ZA 4MUIA 3GCDA 4XD7D 5H70A 3RTBA 4AY4A 2IU6A 4RVCA 1OA1A 3BHMA 5IK2D 4ZMRA 3KJIA 2C82A 3EOAI 4KWCA 4NMWA 4BE7B 4IIBA 4US2R 3LCUA 4EFKA 3K70C 1R5BA 4K2AA 4ZI7A 2LTAA 1FNCA