3TZHA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(f187a) from vibrio cholerae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
b'SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGAIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 88
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzhA00
3OF2A 4HWKA 1GFSA 1M75A 3A14A 4RF2A 5JO9A 4YQZA 5JPIA 4Z0TA 4YBZA 2EKPA 3DO5A 2EIHA 2HO5A 1X7HA 2O3RA 2HK7A 2VRCD 2R6JA 2NM0A 3S2FA 4AICA 1YB5A 2CSUA 4AVYA 3BMOB 4WOJA 1XG5A 2WTBA 1XWFA 2W98A 1Y8RB 4F6CA 4LCJA 2W2LA 1RKXA 1H6AA 3DBLA 4KZPA 2R00A 2PKQO 2RH8A 4ND1A 3T4EA 4DGSA 3O4RA 4E32A 4IJKA 3JYNA 4O59O 3WMWA 1MA0A 3HDQA 3MJTA 4O5OA 3V2UA 3WLEA 1I10A 3KETA 2B0JA 3PEFA 3GEMA 3FTPA 1DIHA 4TROA 4LISA 3DOOA 4BO0A 4OSPA 2JFFA 1YO6A 1N7GA 1Z75A 2D5AA 2UV8A 3IMFA 1M67A 2IXBA 5HBRA 2ZKLA 1LDGA 2AQIA 4ALJA 2WD8A 1R16A 3GG9A 3I9LA 4RZHA 3TF5A 3STHA 1J5PA 1KC1A 2IRWA 3E9NA 4E13A 1KYQA 2ZQZA 1AN9A 3DONA 1UXGA 1ZK4A 3MJEA 4IDBA 3ROKA 2E48A 3PYLA 5C7IO 2O3JA 5K6AA 2WMDA 2HRBA 3TPCA 1QP8A 1PR9A 2G1UA 5I9NA 1PTJA 4P38A 1OOEA 3QP9A 3QRWA 3RBVA 1Q0HA 4TMFA 1CETA 4NG5A 4ZRNA 4B7CA 1I8TA 4L8VA 4Q9NA 4CMIA 3PLNA 5TQVA 1LUAA 2DC1A 3GPDG 3RBXA 3ULKA 4F6LA 3JQAA 2QZ9A 3BHMA 1SCUA 3BMCB 4KWIA 3NX4A 3DDNA 1LDEA 4YPOA 1PJBA 4UVGA 1BG6A 4BNLA 4E5YA 1HLPA 1X0XA 3PYXA 2GCGA 4TRNA 3WIDA 5CG1A 5COBA 5COQA 1O5IA 3H2SA 4IJUA 3BMQB 1GQQA 5ES3A 1MFPA 3L6EA 4R3NA 4RVFA 4B4VA 1LBEA 3FR8A 4PVCA 4OKNA 2X7HA 1EVZA 3GMSA 1LQTA 4Q3DA 3ZHZA 3MJVA 3GHYA 3UW3A 3GAFA 2YQ4A 3ORFA 5BR7A 1DSSG 1NAIA 2AEJA 1BVUA 1LRJA 3WGZA 1V6AA 4CPDA 4BGUA 1A7KA 5IDQA 5T8KC 1MG5A 1EDZA 2EGHA 2YY7A 3PWKA 3WLFA 2J3IA 4JIGA 4PFJA 1O9BA 5DBGA 4OOEA 3L4BA 2ZYAA 3Q11A 4MVJD 4PG4A 4XDZA 3ZZNA 4OHUA 4OXKA 1V0JA 4FJ0A 3AI2A 3OQ1A 4IS3A 1HDRA 1A72A 4B4WA 4Q3AA 3NRCA 4K6FA 2W2KA 4QT0A 2IEBA 2UUPA 4GVXA 2DPGA 1AXEA 1UDBA 4ZQFA 1KBZA 1R6DA 2DTDA 1W4ZA 3ROPA 3SXPA 1Z7EA 2X5JO 2VUSA 1EUDA 1LLQA 3AU8A 5CDSA 1PSDA 1LU9A 1UXIA 2A4KA 3AY6A 4XJSA 2GO1A 4J43A 1YS4A 1PZEA 1NXQA 1GAEO 3GDFA 5KVCA 1KEVA 1DIBA 2PLAA 3EC7A 3GFGA 3B6ZA 1T25A 2VZ9A 4CMGA 4J1SA 3VAZA 3IC5A 3DZHA 2GUGA 5JSFA 1MXHA 1TEHA 4W6ZA 3GK3A 1UP6A 3AM3A 3K6JA 3E18A 5CDUA 4QXMA 3K30A 2YJZA 4ITUA 1U2GA 7MDHA 5JCJD 1JWAB 1XA0A 2NTVA 4JJIA 4BS9A 4FW8A 1MC5A 4I5EA 3AUTA 4WGGA 1N92A 3HADA 3FCOA 3HB4X 4ZU3A 5JE8A 5H81A 4M49A 1QV6A 1X1EA 3PZRA 1NPYA 4PLZA 4ALKA 4EYEA 5JDCA 5EESA 3U4HA 5T67A 2W90A 4MO2A 4YJGB 4D0RA 2BRUA 2YFHA 2R00C 3B70A 1OC4A 4G65A 1XCBA 3HSKA 4CLRB 1NPTO 1R4NA 1P1KA 1E0DA 4BNYA 1EDOA 4RVHA 3WTCA 1HE3A 5A3VA 3RCBA 3VHRA 4RPLA 3DFZA 4BQRA 4RL6A 3JQGB 2GN8A 1B0AA 3ZU2A 5JNLA 1YOVB 1WZEA 3WQQA 5TJ9A 2VOEA 2DPHA 2Q49A 3G0OA 4U5QA 3VPSA 1P77A 2JHFA 3D4NA 3G79A 5DN9A 4OYRA 3CH6A 3AW9A 1R0SA 1NVTA 4CMKA 3PVZA 3L6DA 4FC7A 3ZU5A 3JD0A 3GRPA 3HG7A 3C7DB 2CF5A 5C7OO 2X1HA 2A9FA 4HUJA 1V3TA 1PZHA 3BAZA 3ABIA 4U7WA 2RH4A 3EZLA 2OFPA 4DRYA 2OGUA 1KC3A 1UXJA 1LNQA 5GZ3A 5IDWA 4A7PA 2FZWA 2J5RA 2NVBA 4UAGA 1QMGA 4CUZA 4II3A 1ZO8A 4N5MA 1GY8A 5GY7A 3IDSA 5IXYA 5IDYA 3WX0A 1CF2O 2V6GA 2O2SA 2NTNA 2RHCA 5B4TA 3PDUA 4XB2A 2IXAA 1C1DB 2BH9A 4TRJA 1Y81A 2X23A 1I32A 3ZNQA 4PG6A 3V2HA 4FFRA 3WNVA 3RUAA 3RUHA 3WTBA 1Y9AA 1PGNA 3FWNA 3TL3A 1V35A 4ID9A 1Z6ZA 4Z0PA 4OO3A 4BO4A 1UAGA 1YJ8A 3SJ7A 5B4VA 5L51A 5L95A 4BKRA 2QHXA 2V6FA 3TFQA 4GX0A 1P1FA 2FWMX 2NUAA 3OFSA 2HU2A 1ZVMA 2GN6A 4C7KA 3UUWA 3VZPA 4XYGA 3VZRA 1ULUA 4BKOA 2DUWA 5KOIA 1G1AA 2E6UX 2J6IA 3PGJA 1NQAO 2DBVO 6LDHA 2Y1FA 3DZIA 2BKAA 1QSGA 2FZEA 1I0ZA 4FQ8A 2GSDA 4BGVA 4YA6A 4NQZA 3U62A 1Y8QB 2GERA 3L4BC 3G49A 2QYTA 4X54A 3R3JA 3W6ZA 3D3WA 1H93A 4ZN6A 5BSGA 4B3IA 4Y98A 5HS4A 3TZKA 1PJ3A 4R5MA 3MJCA 2UYYA 2PK3A 5BT9A 3LLSA 3JYQA 4IZHA 4JBIA 3OIDA 3DZFA 1T2DA 3CZRA 2YV1A 5CPFA 1E92A 2I66A 4RQTA 1BDMA 2VYNA 3D0OA 5EPOA 1E3WB 4O6VA 4WKGA 3ZWPA 4WECA 4XA8A 4AJ1A 3Q1LA 3AJRA 2UAGA 1DO8A 4EZBA 3GVIA 4IGEA 3WG9A 3EHEA 3PIDA 4XR4A 4DQVA 1VM6A 2VHZA 1CJCA 2J5QA 1HDGO 2O3UA 1UDCA 4MVJH 1D8AA 4S1VA 2YV2A 3Q3CA 5G4KB 3UXYA 2X0RA 4CMEC 2DFVA 1AGNA 8LDHA 1PWXA 4GL4A 2YDYA 3WFIA 4J4HA 4LGVA 3S8MA 1KVTA 3CSDA 1SOVA 2FMUA 1EUCA 4LSMA 1VJ0A 3RVDA 4A03A 2PZKA 2D2IA 4WLUA 2YZ7A 4KQWA 3ONFA 4CM6A 3Q2KA 5JYEA 1FK8A 1NWCA 5IN4A 3RAJA 1E6EA 3DEYX 4UEKA 3Q9NA 5JDCC 1BXGB 1YB1A 5THKA 4XRGA 1DIRA 1PQPA 2Y0DA 4BO7A 3COSA 3ZWNA 2ZATA 2JD2A 3ZWXA 2O2YA 1EE2A 4UUOA 4MVJI 4GGOA 3BHIA 4XRRA 2Y93A 4KOAA 3KYCA 1ZMOA 2YFQA 3WSWA 4E6PA 3RSHA 4GQAA 4W7IA 2YUTA 2I76A 4L0QA 3KO8A 4DTIA 3QW2A 4H16A 3RUEA 1ZH8A 4CUJA 2PGJA 3A9WA 2VOJA 4L75A 2F1KA 3MWEB 2DT5A 3PZBA 4O1MA 4Z3DA 3R3SA 3D5TA 4G2NA 4R68A 3MWDB 1V3UA 4XD2A 1VRWA 5IN5A 4FFMA 4Z3KA 1I3LA 4OJNA 1BMDA 1PS0A 2VUTA 5EERA 5FWNA 3BHJA 4YEDA 3VVBA 4DLAA 3OBBA 4PLVA 4CMHA 1J4AA 3VZQA 1PZFA 4D41A 5L53A 3LC7O 1W8DA 4JN6B 4ZRMA 1QXSA 1ZEJA 1Y5RA 3K8ZA 3ZWCA 4B8WA 1YB4A 4CODB 1ENPA 4RCVA 2JAHA 2FP4A 1PIWA 3TJRA 2PKRA 3D4OA 4BMNA 4M55A 1GUYA 3ANMA 3DMYA 4CQLA 2D1YA 3GPIA 4URFA 4P4LA 5C37A 5JC8A 4MIYA 2NVWA 1IUKA 1ML3A 1ZXLA 1ZFNA 4CM4B 4RORA 1CRWG 3O9ZA 1GPJA 4FPXA 3PFFA 3QWIA 1WAMA 3ETGA 4CQMD 3S2GA 1HYHA 2GNAA 1PJSA 1LSJA 2NQTA 4CM1A 1XDWA 1NQTA 1NM5A 3KSUA 3FBGA 1E77A 2O3SA 4BO8A 2J5KA 4PG7A 3E9MA 5LCXA 2C7VA 3WYCA 5TLSA 3DHYA 3KLMX 1Y7TA 4NHEA 3OJOA 1A71A 4M1QA 1MGOA 1EEHA 1GD1O 1Q2XA 3WNQA 3QV1A 4YAEA 1V3VA 4ZQGA 4ZGWA 2IYPA 4QTZA 3ZV3A 1ZIDA 4TQGA 3G1UA 4NFSA 1XLTA 1MUUA 4I1IA 1AE1A 3RI3A 4Y8VA 1HXHA 5A9TA 4IINA 2R2GA 5JAMA 1B8PA 3ZW9A 1FDSA 4IY1A 1EMDA 4JX8A 1D3AA 3GN1A 4D43A 1ZEMA 4BVAA 3JYLA 4F3YA 2OBYA 5L7YA 4H7PA 5KKAA 2QW8A 3P19A 4NU6A 2ZCUA 3PP8A 3U0BA 1CQIA 1BGVA 4FFPA 4E2ZA 2JCVA 1HSOA 2JFHA 2RAFA 5KNLA 4KQXA 1IL0A 3WOHA 4IQ8A 4RPGA 3UKOA 2B4RO 4JNKA 4NIMA 3OETA 1L7EA 3DZJA 3F1KA 2CD9A 4WPGA 2NNLD 5G0UA 4DUPA 1BTOA 3CTMA 4JROA 1P1RA 1V8BA 4D0SA 2POQX 3S1LA 5ITVA 3OJ0A 2EP5A 4EDFA 2AA3A 1WDLA 1LJ8A 1GZ6A 5BSEA 3K2BA 4R5HA 4AJ2A 3PHJA 5DBIA 3A4VA 1P44A 3K31A 4WEOA 1YL6A 3K92A 3OHSX 5EQFA 1Q0LA 1GZ3A 1HE5A 1T26A 3FD8A 4NBVA 3DQPA 3I3OA 3PYMA 2ZQYA 1V9LA 1YVEI 3EDMA 5FI3A 1PWZA 3NGLA 1HWYA 3ST7A 1DOHA 3ZHBA 2NU9A 1E5QA 3TQHA 2DAPA 5JLAA 1PL8A 3V2GA 1JKJA 1DFHA 4OXNA 1MB4A 1SEVA 3ASUA 1ZK0A 4CLXA 1U7TA 2C82A 3FHLA 3K96A 1DRVA 5KWEA 3ON5A 1VE9A 3PWSA 2WYUA 2ILTA 6ADHA 5AVOA 4Z6KA 3AI1A 1YBAA 2IE0A 4ONEA 3ZDFA 4ND5A 3NAQA 5AQ1A 5IJZA 3QY9A 4RLHA 2I3AA 1YL5A 4UEJA 2GF2A 1GEEA 1LEHA 2GDZA 1JAXA 3AM4A 3RJ9A 2I9PA 4RPHA 3MZ0A 4OGWA 3PJGA 4D3SA 1GL3A 1R4MB 1O89A 4LK3A 3TOZA 3ICCA 3C7CB 4GVLA 1H6DA 3BMOA 3HJAA 3U9LA 1TLTA 4EJ6A 1DRUA 1F17A 1QR6A 1Y8RA 3K9QO 4HY3A 1K6IA 1TT7A 1KEWA 1ID1A 1O8CA 3SLGA 1Y9EA 3I23A 1G0NA 1RPNA 3OEYA 2DQ4A 1E6UA 4QUKA 3T7EA 2CUKA 5LDHA 4LN1A 3EVNA 1ZSYA 3MTJA 2PFGA 2Q3EA 3BZUA 4PCVA 4NK5A 4EGFA 3IL2A 3ENNA 1NHGA 3GOHA 4D42A 1WWKA 1IZ9A 3LK7A 2OL4A 4JBHA 1PL7A 1DC6A 4WCFB 1BXZA 3DHNA 1WMBA 4G5HA 4KTTE 4NR0A 4W99A 1C0IA 1NX6A 2AE1A 3O26A 3WIEA 2ZYGA 3JQ8B 4FIZA 1NP3A 2OORA 3CPSA 4OXYA 1EFKA 3DAFA 4IUYA 3WGIA 3LLVA 2AQ8A 4BB5A 3DTYA 2BI7A 5KVSA 3QVTA 4XB1A 1NFFA 4HXYA 4LMPA 1NFRA 2BFMA 3S2IA 1C1XB 4AG3A 4GSKA 5ITWA 4BKPA 1HSZA 4XIYA 4JK3A 1HE2A 1NVMB 2X0JA 2VTEA 3PHGA 4XYEA 3T7CA 1OBFO 2B5WA 1X1TA 4Z9XA 3W1VA 3AUSA 1Q1NA 4J1NA 2HAEA 4QFDA 1G0OA 4DIFA 1IY8A 1LLDA 3EVTA 3BMCA 5EINA 1D7OA 5A4DA 3DFUA 3S2EA 3GT0A 1EVJA 4ZQBA 3Q2IA 1HEUA 3PK0A 1ISIA 2BI8A 1XKQA 1IE3A 4IIUA 4YT2A 4WNCA 1LDYA 1QLJA 4Q3NA 4TZTA 4IGFA 3V1YA 1HF3A 2F00A 2FOIA 1AXGA 1OAAA 2O50A 3G17A 3KM0A 3I6IA 4GX5A 3B1FA 3TZHA 2NVUA 1H5QA 1SMKA 4QEDA 4HFNA 5TJHA 2WJPA 4KUGA 4QO8A 3PJEA 3N7UA 5TRTA 2B5VA 1Y1PA 3WGGA 4D3FA 4ZA2A 3RBZA 4JXKA 4BO9A 3GLQA 3TRIA 5DF1A 3E48A 4FOSA 1BXKA 3U5TA 5CAEA 1U8FO 4A10A 3GZNB 3ZWAA 1FDTA 3CMMA 5F1PA 2OXIA 3F1LA 1SC6A 3KSDO 2BGLA 4K26A 5ICMA 3W8DA 3PJFA 4NK4A 1T24A 1ISHA 1NVGA 1DHRA 3GMDA 4E21A 2EV9A 2ZK7A 3JCZA 4YJFB 3ZWMA 1AUPA 1IULA 4RDHA 3JYPA 4RLSA 4E5NA 3UICA 1P74A 4AJJA 1NR1A 2Q2QA 3H3JA 2D5CA 5DULA 3QWBA 4PLWA 4OKIA 4PLHA 4RF5A 3SC6A 3BMNA 1S7CA 3PIIA 1B26A 3RIHA 4Y6PA 1SO8A 4YDRA 1ADCA 1P1IA 1LSSA 1QYCA 2O3TA 2X58A 1DC3A 1OFGA 4TZKA 1NHWA 4TKLA 5HWSA 2XAAA 4PZCA 5BQFA 3GH3A 3ZWBA 1LC0A 1H6BA 4GSLA 1SBYA 4C7JA 3GDGA 1I3NA 4RF4A 4RVUA 4QECA 3W6UA 5A02A 1VLLA 3BTVA 3DHEA 3BXXA 2VHWA 5JXWA 1FXSA 1LLUA 5T57A 1WNTA 4J9UE 4ZD6A 3IS3A 1GQYA 3FNHA 4ROSA 1XQ6A 5L7TA 3AUAA 2Z1MA 1F06A 1I3KA 1F12A 2FSVA 1HYEA 1A4UA 4CQMB 3F6YA 4XGKA 2BGKA 5I8ZA 2EHDA 4C4OA 1GV0A 4RJTA 4KDEA 5DP1A 4JLWA 3WGHA 1PJCA 3A1NA 1P31A 4LW8A 4OL9A 2ZTMA 2GZ1A 1J49A 3UFXA 2VCYA 5IAAA 1S6YA 3DBRA 1MG0A 4A27A 4YJGA 4CMBA 1E1KA 4CLRA 2ZB3A 3GY0A 3Q0EA 3LDHA 4EITA 4B79A 1X0VA 3OIFA 3DZGA 4XEHA 3U4DA 2C2YA 3ZWVA 3ZNNA 4HV4A 4E2WA 4FBGA 4HFJA 4GKBA 3OH8A 1IHYA 2BHLA 4FR5A 2Q1SA 3JQGA 3RKRA 5JAZA 2DFDA 3AM5A 1R0KA 1XGKA 5DZSA 1YOVA 4LSWA 3TNLA 2I3GA 4IDEA 3NT5A 5JS6A 1K3TA 4J7UA 2PD6A 3FNEA 3U49A 3ANNA 4HFRA 3VPHA 1GCUA 4JP3A 3H6KA 3VKVA 4I5DA 5AXDA 1XSEA 1X15A 3H3FA 2A94A 4BNUA 3PI7A 2H63A 4U0JA 4IZIA 5TNXA 4BHTA 1VC2A 1ZK3A 1LXCA 2I5PO 1GQ2A 3FNGA 4NI5A 4I9UA 3P2OA 3L4SO 3N74A 2FR0A 3IIEA 4E30A 1GZ4A 3OIGA 4MKRA 4FD3A 3H5RA 3TZQA 4NPCA 4EJ0A 2WM3A 3L0DA 4MKXA 4TVOA 5GZ6A 3IOYA 4E12A 1U5CA 1EQUA 2BFOA 4R41A 4S3MA 3F9IA 4FN4A 3BA1A 2EEZA 1ARZA 3RJ5A 3JQEA 2XF8A 1F14A 2G5CA 1XIVA 1E3SA 1UZMA 1WMAA 2Q50A 2RBEA 3O8QB 4MVJG 3MCVA 2ZJ0A 4WUVA 1QORA 1DAPA 4IXWA 1XHLA 2W8ZA 3JYOA 4PLCA 4BB6A 4D45A 3QJ5A 4IS2A 5F21A 5FF9A 5EMHA 3GEDA 3VPXA 4BNMA 5I7FA 2WDZA 3I9KA 3EGOA 3R1IA 1ZSNA 4IMPA 4R3WA 1PJTA 1JW9B 1SZJG 4UVIA 4XKJA 5F5NA 3ZWYA 3IQDB 4M87A 4E5MA 1I2ZA 1KVQA 2JHGA 3UVEA 1LC3A 3OA2A 3L07A 1DC5A 1UR5A 4CLOA 1F0YA 3VPGA 1PS9A 3QVSA 3NKLA 3HN2A 5JO0A 2ZCVA 4TKMA 3JD1A 4CV3A 4MVJP 1VSVA 2VRCA 2W2KB 4CM3A 3ICPA 2Y1GA 4E33A 4YVFA 2FY8A 2NACA 3PPIA 1GU7A 4FJ2A 4H15A 4PLYA 4DPMA 5K6AC 4QX6A 1DB3A 4D46A 1U3WA 3OMLA 3H7AA 3KYBA 3C3XA 2O48X 3I9MA 4QSMA 5TC4A 1QKIA 5TT0A 3ZI0A 4CM7A 5JW6A 1WDMA 3EUWA 2X86A 3HNPA 3N58A 3K73O 4RDIA 1R12A 3H4VA 2VUUA 4IPTA 3HHPA 4CMAA 3PHLA 4YCAA 3WGTA 3AOGA 3RFTA 3WYEA 3LT2A 5KIAA 2QG4A 2ZB8A 4ND4A 3FWZA 5G4KA 3PGXA 1PGJA 2A92A 1FF9A 1QLHA 5KVQA 4J7XA 3DOCA 1PL6A 3SJUA 3DOJA 4GMFA 2P5YA 3OQ6A 4I9NA 4IDGA 4LRSB 4UUNA 3W8FA 3ZV4A 1CEQA 4B3JA 2AQHA 2AMFA 3M1LA 3C1TA 1YE3A 2DTXA 1ZW1A 2PNFA 5JFOA 1C0PA 3TDKA 4DPLA 3PXXA 4R16A 4B4UA 4BOYA 2JJYA 2AW5A 4BNVA 3H8VA 5TS3A 1P9LA 1R4NB 1B16A 5L4SA 1BXGA 2H6EA 4OSOA 4LCEA 3C8MA 3AY3A 3AOEA 4RVDA 2EGGA 4MKZA 4R4JA 3I9NA 2ZTLA 1N9GA 2HCTA 2H1SA 3WBFA 3NUGA 2CMDA 2JCYA 4N18A 2PKQP 3R0IA 1Z82A 3DAGA 3OM9A 5KCZA 1KEPA 2DUUA 3OJLA 4JJFA 2GLXA 3QWHA 1EE9A 2BD0A 3ASVA 2C20A 1NWHA 4D79A 2YHIB 2CDBA 1WZIA 4FS3A 4WJZA 2HSDA 2CVQA 4Y9DA 1HT0A 1DEHA 3WB9A 9LDTA 4XJTA 2FHSA 2X5KO 4JP2A 2VYVD 1GYPA 4NMHA 3H2ZA 4L76A 3E9QA 3V5NA 2OOSA 5GMOA 3ONDA 1ONOA 2P68A 4FGWA 3RU7A 3AK4A 1Z7BA 1WXDA 4OIMA 2O7QA 3MJSA 4NZ9A 3W4KA 3AFNA 4EI2A 1Z74A 5DOVA 4YRAA 3ETDA 3EY4A 5G0TA 2I65A 1IB6A 1N1EA 1HDOA 2VQ3A 3GUYA 1UXHA 1XEAA 4MVJA 2GGSA 2O23A 5CP8A 3SEFA 2J3JA 3JQFA 1PZGA 3WWYA 4CM4A 9LDBA 4DC1A 1FJHA 2EWMA 2HRZA 3CUKA 4Z9FA 2HMUA 1Y6JA 5ER6A 2DKNA 1I24A 3GNQA 3CXRA 1I5RA 2CF6A 1TVEA 2EJWA 2PA3A 2X9NA 2WD7B 3O38A 2VTDA 3KBOA 3Q6IA 3O03A 3IAHA 4E0BA 2Y67A 1UZNA 1LSUA 5DBFA 5C5IA 4RZIA 1N2SA 4AJ4A 4NBWA 3ZHYA 2J3KA 2Y1OA 4CM9D 4XQGA 1U4SA 4CMJA 4UEOA 3E1KA 3KXDA 1PQUA 4YAJA 3I52A 5F3RA 5KTKA 4IDAA 4RF3A 1GUFA 3B1KA 3KTDA 4TSKA 3WWZA 4BKQA 4E31A 5KKCA 1YQDA 2Q2WA 2P9EA 4BO1A 5A5FA 1GUZA 4FCCA 4Q3BA 5T5QA 3ZHXA 1KY4A 3D64A 3HZZA 5I7EA 3NYWA 3P5SA 2AEMA 5JCJA 1TA4A 5C7LO 1I2CA 4MINA 2Y0EA 3DL2A 3LC1O 1EBUA 5B37A 2EW2A 5CEEA 4IXTA 5ILOA 4EEXA 2HMVA 2P9GA 2X0NA 1GR0A 1JA9A 1I33A 1L1FA 5JAQA 5U4QA 5AXCA 2Z95A 2DBRA 5KJEA 3CZMA 4J3FA 4L4RA 2Y1EA 1B3RA 2D8AA 4MP8A 4I8XA 1O95A 1UH5A 2CZCA 3RD5A 4BV8A 5CG2A 1BW9A 4YJHB 1D1SA 2UVDA 3DB2A 4BNJA 3OP4A 4XDYA 4GX1A 2C07A 4YT4A 4CM8A 3D5QA 4YAKA 3HFGA 1WVGA 3ONEA 4BNXA 5HM8A 4CM5A 3ADOA 2W2LD 5F1OA 5CDYA 1PEDA 5AXAA 2ZIZA 4BNHA 1WW8A 5DOZA 4CMCA 3AU9A 4P4NA 1J0XO 3INGA 4LVCA 3DBHB 4HBGA 4G81A 3JTMA 3ROMA 3GF4A 4BV9A 2VHVA 1KOLA 4W9NC 1QG6A 2Y1DA 4K28A 1YRLA 3QIVA 1DC4A 1QYVA 2PV7A 1G6KA 4J49A 1U2DA 1MV8A 1ZK2A 2NSDA 1U28A 2GN9A 3GVXA 5I9MA 2YDXA 3OSUA 3QWFA 5G2OA 2JD0A 3H9QA 5JMPA 3WBBA 4DWVA 3OEWA 1ZBQA 3U4CA 2HK9A 3HWRA 3IP1A 4YYZA 2EJVA 4MP6A 1GV1A 4YAIA 3AOEC 3PQDA 2IYOA 4D7AA 4CL3A 3KYCB 5JMWA 1IZ0A 2I6TA 4U6SA 4FSHA 1DLIA 4ZJUA 2DU8A 3VC7A 4BO2A 1TT5B 5B4UA 3EYWA 4GAEA 1CIVA 1LI4A 1WDKA 4IDCA 5A3JA 3GDOA 1D1TA 4FFNA 1GEGA 1R4MA 5ENDA 3VZSA 1T2EA 4CLEA 2EKLA 4MVJF 4NJOA 4FFOA 1C0KA 3DZBA 2G82A 1VKNA 3F5SA 2WYVA 4GI2A 4MOWA 4XYMA 5MDHA 1ZZEA 1A27A 2HMTA 2YQ5A 4L4XA 1EK6A 3JQAD 3V1UA 3RROA 1KVRA 4O0LA 3WSVA 2VN8A 3A06A 5G4LA 1Z73A 3WYBA 4U6QA 2NU8A 3DR3A 4NFHA 4PGFA 4XQ9A 5KJ1A 3GNSA 2FPGA 1CDOA 3RQSA 3LYLA 5KJCA 1E3JA 3LF2A 4KTVE 3QSGA 4R51A 3ZU4A 1OMOA 4B3HA 4WCFA 2Y68A 4PZDA 2QX7A 1R0LA 1VL0A 1B14A 3C1AA 3NDJA 1ZUD1 2P91A 1NNUA 4I9HA 3JQ8A 2CVOA 4R54A 1YGYA 4TWRA 2BMAA 4PLPA 1GCOA 3JQFC 2Y0CA 2V6MA 4UVHA 4EUFA 1QV7A 2CDAA 3L9XA 1W0CA 4DMLA 1RWBA 3I5MA 3LT4A 1I3MA 3ADPA 3P7MA 3ZWWA 5JBIA 3X2FA 3H5AA 2Q45A 1A4IA 3PHIA 1F8GA 2Y66A 5I9LA 1C1XA 1DDOA 4TRRA 3PRJA 3PLRA 3SBOA 3B1JA 1X7GA 1U1IA 1U8XX 2XOXA 2DBQA 2Y1CA 4GMGA 2X8LA 5F5LA 1EVYA 3AWDA 4J91A 2JFGA 4OAQA 4WASA 5L40A 1JWBB 3JQ9A 2I67A 3I6QA 5TF4A 3KRTA 5JDIA 1ISJA 3U3XA 3FSRA 3SLKA 2IDZA 3IKTA 4UUPA 5G0WA 3VTZA 1YDWA 2ET6A 5JY6A 4GWGA 5A05A 2OUIA 4IBOA 4OH1A 3FI9A 2AG8A 4FGSA 2Z1NA 1VKOA 2D0IA 4P22A 4EEZA 4E3ZA 3GAZA 3OJEA 1EUZA 1QRRA 4E5PA 3NJ4A 4J4TA 4Q3CA 2ZTVA 2AG5A 2CY0A 2O3QA 1H2BA 1PGOA 1GDHA 2EKQA 1C3VA 1UUFA 2C5AA 4E5KA 1CWUA 4XCVA 2H9IA 2Q99A 1NPDA 2FPPA 3AUUA 1ZCJA 1Z45A 4DIBA 1NYTA 3GGOA 3JQ7B 1PJ4A 3QVWA 4IIVA 4R9SA 3GVCA 2BGMA 3GVPA 3HN7A 3C24A 3GZNA 1FDUA 1SAYA 3WQRA 3E5MA 1LX6A 2HJRA 2OO5A 5DCWA 4A2CA 4BGEA 5BNIA 4WLEA 3GRKA 1F8FA 1E1MA 2EF1A 5BNFA 3IUPA 3LT1A 4LRTB 3ENKA 2CDCA 3VH4A 1Q7GA 2GR9A 4YQYA 5JYDA 5AOVA 1YWGO 5A5EA 2CVZA 3F3SA 3C85A 4AJEA 2CNBA 4K1LA 4FOOA 2PZJA 3R6DA 3AI3A 3LU1A 5IZCA 4UREA 1IYZA 4HP8A 3HDYA 3NGXA 2DLDA 1MP0A 3BTOA 1IOLA 4QFCA 2RCYA 4CV0A 2WWRA 4WCDA 4ND3A 4DL9A 2PGLA 4BNIA 2GYYA 5EJ2A 5CDGA 4IQGA 1P0FA 1I2BA 1XU7A 3DAPA 1DAOA 4BO6A 3WS7A 1MFZA 3KYDB 5KJFA 1E7QA 1DBVO 3BMQA 1CQJA 5U9CA 1DIAA 2HK8A 1LDMA 4EW6A 4J0FA 4FB5A 1NBOA 8ADHA 1O94A 1ZKMA 4E2XA 5H83A 1FDVA 5DP2A 2PGDA 4CQMA 2B83A 3ROQA 4HKTA 4WLNA 1U9JA 4HADA 3UCFA 3LC2O 3CKYA 4J4BA 4J6FA 3HDJA 3M2PA 1TB4A 3KB6A 4NH4A 1LDBA 1P1JA 3GGGA 4OQZA 1JAYA 2IEDA 2VT3A 4KP7A 3KLPX 5LC1A 3QHAA 3VPFA 3T4XA 1P3DA 3NTRA 5L4LA 4TRMA 1H9AA 4EJMA 1DRWA 1GYRA 1U5AA 3MEQA 3E5RA 1B8UA 3GQVA 2OHXA 3C7AA 3WDSA 5IG2A 3VDRA 1PX0A 1PQWA 3D7LA 3I83A 2B36A 1A9ZA 1H0KA 1YH3A 4U8GA 3LT0A 1IPFA 2QQ5A 4UVEA 4YTEA 4ZHSA 4F46A 4PG8A 1BHSA 3GN2A 4WK6A 3EAGA 3H65A 1HZZA 3L9WA 1WLYA 1RM0A 2P5UA 3M6IA 4YT5A 4NFYA 2X6TA 1LDNA 4BUCA 4J1QA 4W82A 3PFWO 2NWQA 1ENYA 2V65A 4WCFC 3INRA 3QVOA 3G3EA 4YACA 5K9ZA 4B8ZA 1HTBA 5A9SB 2ZB7A 1EQ2A 4OM8A 1O0SA 1RJWA 1P0CA 4NJMB 1K5HA 2VRBA 5CHEA 3BTUA 2NQ8A 3HUDA 1XU9A 4YR9A 2C29D 2O4UX 2WEKA 3JQDA 1RM4A 3TOXA 2ZB4A 5IF3A 4IMRA 3ZCXA 1LLCA 1E7WA 2Y05A 3ZV6A 4OQYA 2X0IA 4L4SA 3BYZA 1BSVA 1YBMA 1VJ1A 2V7PA 4ZQEA 4D3DA 1GADO 1UP4A 1U3UA 1QYDA 3IP3A 3MJ4A 1N8KA 1SEPA 4N54A 2AQKA 1T4DA 4XQCA 4GPD1 2NV6A 3H9EO 2Q46A 3P2YA 3UCXA 3DBLB 3JQ9C 2FRDA 1YBVA 5JDIC 2LDXA 1XQ1A 2V6BA 5ILGA 3VH1A 2VYND 4DPKA 4MPDA 3PQEA 3ZGYA 3O8QA 2VWHA 4MVJM 5F1KA 4XYLA 3U09A 3GUCA 4A0SA 1YQXA 1Y5MA 1DJQA 5COAA 2RIRA 3FBTA 2NVUB 3ZNPA 4ZICA 1ENZA 4M8SA 1HYGA 4E2YA 5DCUA 5DNAA 5JC1A 3QWAA 3I4CA 1DPGA 1HLDA 2YHUA 4Y6RA 1H6CA 5AXBA 3UCEA 4BO3A 4CJXA 3LZ6A 5U1PA 4Q39A 4J16A 3DXFA 4JCOA 4II2A 1KS9A 2FR8A 4L9RA 4HNHA 4N7RA 2WE8A 1VJTA 4YT8A 5AYVA 1MC4A 3E82A 4IM7A 4ESOA 4RVGA 3LQFA 3QQPA 3RC2A 4DYDA 3HB5X 1K89A 2X4GA 1P45A 1YJQA 1GPDG 4WE3A 4RQUA 2BF7A 1E1NA 4BNKA 1EVIA 4M89A 1KVSA 1M2WA 3BMNB 4RPJA 3IUSA 2D59A 2AHRA 5I7SA 1FMCA 1SPXA 4R1SA 1YXMA 2BFPA 3WMXA 4LMRA 2HKIA 2LDBA 4CMIB 2Q4BA 4I5FA 1P1HA 4M86A 2C7GA 1U3VA 2FSSA 4BNZA 2VWGA 1E6WA 4CL8A 1HDYA 1HRDA 2OP1A 2VHYA 3W8EA 4RPKA 3JQAB 4N5NA 4XR9A 4IDDA 1CERA 5IZCC 3H9JA 3KVOA 4PZEA 1W6UA 1HL3A 3DZKA 5BSFA 1QYWA 3JD2A 4JQCA 1E7RA 4CMEA 5FEUA 2QRKA 3RWBA 2O7SA 2NU6A 3TZ6A 1W73A 1PGQA 3LF1A 5L4NA 1C1DA 1KEUA 1B15A 3SX2A 4KWHA 3LVFO 4L73A 4J0EA 4W9NA 3F4LA 1JKFA 1L7DA 3JQBA 4XIJA 4OMUA 1JQBA 1H94A 1K2WA 1HKUA 3WGOA 5CEFA 3JSAA 3OICA 2J8ZA 3DWFA 1E7MA 2X22A 3UGKA 5A04A 4J1TA 5IXSA 5ENVA 5L9AA 1ISFA 3DBRB 4AJPA 4J7CA 3PHHA 4RO0A 4XWYA 4DREA 2EXXA 3NV9A 1M66A 3OA0A 3ZW8A 1E1LA 1EFLA 3CE6A 5ICSA 2BELA 4H3VA 1BWSA 2YV3A 1E5LA 1Y8QA 4ZQHA 2JL1A 1JN0A 2ZJ1A 3NEPX 5G0SA 4DA9A 2SCUA 1YKFA 2IZZA 3D4PA 3KV3O 3RFXA 3K2EA 3GFBA 4AJHA 1DXYA 1TXGA 5DT9A 5G0VA 5HTOA 5TSDA 1FDWA 2PY6A 3NDRA 4XYBA 2YHIA 4KUEA 1E3WA 1JVSA 2G0TA 2GRAA 2GZ2A 1KERA 4XGIA 2JCXA 5CPBA 4MP3A 3UAGA 4AJIA 1AHHA 5EL0A 5ADHA 3PJDA 2VZ0A 2VNAA 2XPCA 1B2LA 5TGDA 1VPDA 2TMGA 2Q1WA 4PN3A 5A06A 4QO7A 2B37A 3NTOA 4PRLA 3JQ6A 1PS8A 1BVRA 1NFQA 3IJPA 2OBNA 4GH5A 4Z9YA 4U0KA 2P9CA 2PH3A 4O63O 1RYDA 3AY7A 5IZ4A 1B8VA 3L6OO 3E6AA 4AJKA 4XGNA 1X14A 3OJFA 1C0LA 2VWQA 4XX0A 1UXKA 3WXBA 4KDFA 2GD1O 3OQBA 1NQ5A 4JGBA 4YJDA 1HZJA 3VKUA 3ZV5A 1JDJA 3KUXA 2ZYDA 2NTJA 4BNFA 3AFMA 1MX3A 3NTQA 4D44A 2B4QA 4EUEA 1HDCA 2DBZA 1DLJA 2AXQA 3GHHA 4IJVA 1B7GO 3TFOA 2HMWA 4W4TA 3H9UA 3ANLA 3PWZA 2TMDA 3ITDA 4XQEA 2C5EA 2WD7A 4YRBA 3HQ4O 1UAYA 1E7SA 3K5PA 1JVBA 2G76A 2E49A 1BDBA 3TWOA 3Q9UA 3GZ4A 1DFGA 1K6XA 2DTEA 1VI2A 2P4QA 2A35A 2B35A 2QYSA 5TT1A 4CLOB 2HDHA 2P2SA 3QLJA 4YB8A 3D1LA 3IKVA 4DQXA 3KHUA 4CUKA 3JD4A 3WFJA 5K0ZA 2UDPA 5DCYA 2BFAA 1RYEA 3ITKA 1ZK1A 1XELA 1SB9A 3CMCO 4BNGA 1ULSA 1ENOA 1T2AA 3RUCA 4PVDA 5IFLA 1HE4A 3RUFA 4J90A 1ZJYA 4FDAA 3GVHA 4BQPA 1NTOA 1DFIA 5C3MA 2ZTUA 2NLOA 4EUHA 4QQRA 3H5NA 1NAHA 1M6WA 2C54A 3E8XA 4GBJA 1HETA 1GTMA 3GA0A 4DLLA 1SOWA 3C1OA 3VVCA 1Q7BA 5CDTA 1ADGA 3DMTA 4YJHA 3TZCA 1LTHR 3M1AA 1IHXA 2W4QA 1UJMA 2X9VA 4PIVA 2AEFA 5T6BA 5TX7A 2D3TA 1MLDA 2B4TO 4P8RA 2GZ3A 2JAPA 1OI7A 3QVXA 3RC1A 4DXHA 5TIIA 4DBZA 7ADHA 1H2HA 3F46A 5EN4A 5I8WA 4R1TA 4ND2A 2IODA 3VH3A 4GX2A 3ZU3A 1YQGA 2QIOA 1HDXA 4K9DA 4MIEA 2BLLA 3DBHA 3JQBC 1E3LA 3KOUA 1NQOA 2PD4A 3NJ8A 4Z0HO 5T64A 3RASA 3DTTA 5I7VA 4P4GA 2C59A 2D4AA 3GGPA 1P33A 4R01A 4INAA 4BNNA 1M6HA 4TVBA 3HFSA 1JKIA 3KEOA 4GLLA 4IDFA 3G1TA 3SVTA 4R1UA 5HRUA 5GZ1A 4WLVA 4NBUA 4BMVA 3X2EA 3NDIA 4R69A 4YRDA 3ZN2A 4ALNA 4BGIA 4UULA 4YXFA 1N9GB 2OMEA 4R1NA 3HE3A 3D3WB 3PDJA 4BO5A 1PR3A 1PJQA 2NU7A 3F47A 3VDQA 5HA5A 4FJ1A 2C2XA 1I36A 4BL5A 3CEAA 4L74A 1KY5A 2X5OA 3FN4A 3RKUA 1KVUA 2XXBA 4IJWA 4OOFA 1Q7CA 1TT5A 2EG9A 3ETEA 3FPCA 4MVJE 3NT2A 4CR6A 5BNTA 3MTGA 1DIGA 4PLFA 3FTNA 3PTZA 4Y67A 4CV2A 2E37A 1NR7A 2P4HX 3ZH2A 4DIOA 4UVDA 1N1GA 4MDHA 2OZPA 4I5GA 3TL2A 1U4OA 1T1SA 2NADA 3F4BA 1ISMA 1YONA 2FR1A 3RFVA 3RUIA 4A73A 3L77A 1ONPA 2IZ0A 1PU2A 3IJRA 3QA9A 3W4JA 1A7AA 3JQCA 2X9GA 2QRLA 2YYYA 2WSBA 3JD3A 1K6JA 3H9GA 2CFCA 2E4AA 3GC6A 4FC6A 1LA2A 4RV9A 3UF0A 3UOGA 3VTFA 4HFMA 4Q3EA 4XZ3A 3INTA 2PH5A 4CR7A 2HMSA 2QRJA 1ADBA 3RU9A 1VL6A 4IQ0A 5CEJA 2PTGA 1PJLA 1O6ZA 5L3ZA 2VT2A 4NBRA 5ER9A 4DMMA 2PR2A 1EBFA 1HDZA 3DC2A 2RHRA 2HJSA 2YW9A 2FN7A 5A1TA 3LSYA 2DVMA 4GKVA 2JKVA 4EBFA 1E3EA 1NASA 3QE3A 4DLBA 2HUNA 3FF4A 5FI5A 1Q0QA 4AJLA 4YAGA 4ALLA 1N5DA 1BRMA 5JAIA 4NDNE 4HX5A 5FYDA 2VWPA 1ZXBA 2H5LA 5THQA 4ALMA 3PQFA 4FFLA 1JTVA 4BNTA 3V1TC 4GLOA 3BTSA 1GYQA 4JBGA 1WP4A 2GASA 4NU5A 1ZSVA 1QYXA 4MJLA 4WLFA 1LSOA 3UN1A 2HQ1A 5KJ6A 4N5LA 3SC4A 4B7XA 1ZNQO 4RGBA 2PZLA 4AJOA 5H82A 2VZ8A 4BIIA 3EZYA 4J2OA 1R15A 4KUHA 4BKUA 1UZLA 3JV7A 3OECA 4NBTA 3WICA 1T2CA 1PJ2A 1XR3A 3EK2A 3GR6A 5EQDA 3DBVO 3GG2A 3M2TA 3CINA 2FPIA 5FFFA 1H9BA 4KMSA 4NNJA 1ZMTA 1I30A 3EW7A 3U4IA 4CQLB 1KETA 4RVSA 3V8BA 1BW9B 4YWJA 5BSHA 1ADFA 3MOGA 5CFZA 3JQ7A 4CR8A 1CYDA 2WYWA 2JD1A 4CM8B 3UH1A 4B7UA 4CLDA 4DYVA 1C14A 3VOSA 3A28A 3FNFA 1M76A 4PLGA 2VHXA 3HDHA 3DMTC 1T2FA 2I99A 3I1JA 4PG5A 1J6UA 2O4CA 1DHTA 3UHAA 5JY1A 4E4YA 4PRKA 1X13A 4AFNA 1VL8A 1SNYA 4R9RA 2PWZA 3CIFA 1YDEA 5IDXA 2WE7A 2PZMA 3RC7A 1OC2A 4Y6SA 5LDGA 1EZ4A 3WGYA 2DM6A 1ONNA 4MIOA 5J23A 5A03A 2E82A 3WR5A 1EK5A 5DDIP 1U7HA 4A5OA 1UDAA 1JU9A 3WJ7A 4W7HA 1A5ZA 1OZAA 4WNIA 4AJNA 4HNGA 2VYVA 2EP7A 4DC0A 3ZWOA 2J3HA 3FPLA 2UUOA 3ZNOA 1DJNA 2VNSA 5A9RA 3I9JA 3BIOA 3I4FA 4GGPA 3E03A 2C0CA 4BMSA 3WGQA 1SB8A 1TI7A 2HLPA 2EERA 3KZVA 1ORRA 4CV1A 5MGBA 3MOIA 3S55A 5B1YA 4J9VA 1K0UA 4I08A 4DQUA 1R66A 2PD3A 3KYDA 3TN7A 1LRLA 1RM5A 1T4BA 3WJAA 5B12A 1E3IA 2OP0A 4WLOA 3FR7A 1B3BA 3GEGA 4ALIA 2QZZA 1XYGA 3NT4A 1MXFA 3F5QA 1N7HA 5L45A 2B69A 5T8KA 2G17A 3VH2A 5JCXA 4M54A 1ZJZA 2Z5LA 3WQSB 4JJGA 1VSUA 1UP7A 4GWKA 3RC9A 3KSZO 1I01A 4CLHA 4DBVO 2EW8A 4ZVVA 4DVJA 1LQUA 4PLTA 4UUMA 1IPEA 1AHIA 1PGPA 1KIFA 2IZ1A 3FRJA 4WEQA 4CM9A 4YJFA 3GNTA 1D4FA 2Q1TA 2Y99A 4WOKA 3RUDA 4AL4A 2Q1UA 4ILKA 3B20A 1E7YA 3I9OA 4LVUA 4A26A 1RM3A 2GN4A 5L7WA 1YL7A 4J2HA 1R37A 1T1RA 5HS6A 4K6CA 5KVVA 4BNWA 4F45A 2Q4EA 1LRKA 3W4IA 1A9YA 2XXJA 2GPTA 3D3EA 3KEQA 1X7DA 4B4OA 5A9SA 1JLLA 3EMKA 1U3TA 4NJMA 3TSCA 1WPQA 2AE2A 1ISGA 5EIOA 2Q2VA
chains in the Genus database with same CATH superfamily
1CE8B 1LQ2A 3T52A 1HT3A 1WF3A 1KU0A 4HWKA 2XVMA 3SKYA 4QDZA 1ST3A 3FHJA 2POCA 5JO9A 4QM7A 4I9FA 4I4LA 1ECJA 3GDWA 3A1DA 2J09A 2FVYA 3MG9A 5K99A 5B7GA 5AUPB 2R6JA 4ETWA 2JC3A 1O3YA 1YB5A 2CSUA 5AVQA 1YR9A 4HH0A 3HTXA 5CT6A 1G59A 1EU1A 2OFOA 2W98A 1WE2A 1P39A 2WWXA 4BEJA 4F6CA 3LWZA 3URKA 5TXGA 3D4BA 4QTTB 2B1QA 3MRXA 3VISA 1RE1A 4BGDA 2BBOA 3CN7A 2I62A 4P2GA 4R7TA 2K2WA 3HVKA 1P7YA 3U40A 5L3QA 4FS8A 4E32A 3O4RA 2D0DA 4UARA 3WB2A 2VHCA 2CJFA 3WMWA 1NVAA 3F78A 3CVXA 4QBIA 3HDQA 1PQYA 1U8EA 3O2JA 3V2UA 3MWFA 4Q1CA 4KLZA 1P7ZA 4Z7NB 3PUWA 1DIHA 2LV8A 3HEAA 4ZOLA 3JARA 1O58A 3DLIA 1R8XA 1UIRA 4W8GA 4U7PB 1YO6A 2XQFA 4BLTA 2UV8A 2D5AA 1EJ2A 3L4EA 3PC8A 3KZXA 5HBRA 4H1WA 4IRMA 4TN1A 3DL4A 5E9QA 5AKZA 2M1XA 1NONA 4CIAA 2Q3BA 3RIGA 1QS0A 3TF5A 4L4YA 2JA1A 1IEXA 1NMQA 4EKGA 1LPNA 4KFUA 4DSOA 3EZ6A 1H65A 2HYDA 3DUWA 1HNXB 4M0LA 3DONA 5CURA 4B8YA 1C2YA 4KXLA 1DUSA 2QTWB 3I0MA 2E48A 4DCOA 5FOQA 5K3EA 13PKA 2WMDA 2AI3A 5CX1B 1QP8A 3ESXA 1JIKA 2K87A 2OO3A 4RSMA 1PTJA 2WD9A 1XZNA 2ZYHA 1ZJ6A 3QRWA 1VCMA 3K8QA 2NXJA 3LE8A 5HQJA 4D9IA 5GTDA 1OPRA 4NG5A 1I8TA 3OPQA 4L8VA 4KXUA 3T3EA 4Q9NA 3L1KA 4N6GA 3N87A 1IQRA 1H2AS 3PNPA 5BW6B 1VCIA 5AI0A 2DC1A 1SKMA 3GPDG 5F7XA 4QRDA 4WKCA 3RBXA 4FOLA 1ETHA 2FEKA 1S8AA 3BMCB 2VEDA 3C41J 3JQAA 3NX4A 4C0XA 4F4CA 2VPIA 4N6OA 1T4MA 4YPOA 2LCIA 4MWSA 3TE7A 1IIBA 1BG6A 4UVGA 4RAOA 4ZTBA 4D9JA 4E5YA 1K7FB 4ZCMA 2XCRB 3KTAA 3PYXA 3K1TA 1JLKA 1QQ6A 1UZUA 2UVQA 2QM3A 5JRDS 5COQA 2XUFA 3H2SA 4FNMA 3FOZA 1RLOA 1R5NA 1ZOLA 3BMQB 1UC4B 3S28A 1XNJA 4QYIA 1QZXA 1CLEA 3T9BA 4RVFA 1OT3A 2O7NA 4B4VA 4F1KA 5HR5A 4C21A 1Z6XA 1HLGA 5A7GA 4F71A 2XYRA 5JCPA 2E4VA 3KU1A 3GRAA 1LQTA 3L0IB 4KGXA 1N5OX 4P7BA 3GHYA 4TV8A 1P4SA 4B0OA 4CIXA 1XALA 4CKWB 3GEBA 1NLZA 2DOKA 2IJGX 1R9MA 3HP1A 4IQFA 2OHVA 3FUVA 2B4AA 1NAIA 4HR7A 1BVUA 3K4HA 3W5DA 4OQNA 4PXAA 1VYVA 4UMFA 5IDQA 5AKKA 1A7KA 2RGNC 3FCAA 3NKFA 5T8KC 1Z34A 1T6NA 4A8JA 4DILA 3DBOB 2LIVA 1CJTC 2HWXA 2YY7A 4KX5A 2ZIWB 4FCVA 4NH0A 3PXBA 4JFAA 5P8WA 4AC9A 2J3IA 4OHCA 1IXZA 2P6RA 2OE2A 1O9BA 4E5SA 1YZKA 3LP8A 4OOEA 3Q0IA 5BRAA 1KJJA 5FQOA 4WNAB 2XT0A 1LF0A 4OHUA 4Q0MA 2EDCA 4TTVA 2O8CB 4IS3A 1HDRA 4QATA 5CX4A 5LBIA 3TG8A 1PT5A 1EGAA 2D2FA 1RQGA 3KJEA 2JGRA 1J8MF 3EC1A 1Q0UA 2XNCA 2W2KA 3PGA1 1VPTA 4K6FA 1GZHB 2CL7X 4Q3AA 3QSYA 2Q3DA 4NBLA 1DXQA 1V96A 2IEBA 2WSSA 2B9EA 2UUPA 2DRIA 3OQIB 1H1LB 2VZLA 5CFRA 1AXEA 5JZMA 1T8PA 2AMVA 1IC6A 4YGXB 4ZQFA 5AM5A 1W4ZA 5E9AA 2ZRAA 4ZZ2A 5ILQA 4P35A 4UM9D 3T1YB 3K6RA 4FHCA 3V8NA 2GEDA 1TU4A 2IXDA 3UXEA 5CDSA 1PSDA 1LU9A 1UXIA 2AR7A 4XJSA 1Z3CA 3FM9A 4DA0A 3P9KA 1WBDA 3IAM6 1NXQA 3ELYA 5KVCA 1KEVA 3T99A 2PLAA 3EC7A 2A9OA 4KLNA 3ID6C 3HYNA 2YJGA 4Q18A 1ISSA 2VZ9A 1KIMA 4KEAA 4AXBA 2KMLA 4ZAVA 2VK8A 3IC5A 1U94A 1TCVA 1ZOPA 4KR2A 4JC5A 1R0BA 4R1MA 2Z5FA 4NF2A 5BOSB 1H66A 1MXHA 3C8DA 1TEHA 4W6ZA 1G8AA 1O77A 2OZVA 1UC5B 1N2CE 1S4MA 2H9AA 2QJFA 2X6QA 3K6JA 3F6PA 1KGSA 4JY7A 4QXMA 3ZR4B 2HBRA 1DJLA 2QIPA 3NBXX 4W5NA 1AY0A 1JWAB 1XA0A 4M7RA 4PWZA 3TS1A 3TGPA 2OFXA 3TH5A 3OZWA 4BS9A 4FQ5A 4A0QA 2XHZA 2OVFA 3AUTA 4MR7A 3D0RA 3K9NA 3ZKAA 5AW8A 4G1BA 3EX7C 1U11A 4DIDA 3HB4X 5C8YA 1WCYA 4TXJA 1YE8A 1YZUA 1X1EA 2GHTA 4R2XA 4OJQA 5E4TA 3GUHA 1E2UA 4RA9B 1K7EB 2WWHA 1QRTA 5KSPA 1ATZA 2Q5EA 1JR3A 1GIAA 1ZN2A 1TZKA 1B41A 3FFBA 4MW9A 1H5UA 3SDBA 3NOOA 5JT1A 1QPZA 2OCIA 3W90A 2C5BA 1ZCFA 2WQZA 3K0CA 4G65A 1OC4A 2ID9A 4CLRB 4Y0NA 3RVKA 6Q21A 1MVOA 1GZ7A 3K0FB 4GR5A 2OG1A 3Q5DA 4B74A 2WLSA 4RVHA 2W2MA 3C5CA 3VHRA 2O8BA 3W5JA 4BQRA 4KC0A 1T13A 2JI8A 1EWRA 2GN8A 1AUQA 1G5PA 4W5QA 2JF0A 5I7RA 3GCGA 1U0HC 3K0AB 4IIGA 3ZU2A 3THSA 2QZJA 1R0CA 4WK2B 4EPYA 1YR7A 3Q8WA 1IN8A 3TLZA 3LQRA 2EFEB 2JIQA 1KHTA 2JHFA 1STOA 4QWWA 2FN4A 3RM3A 2ZI3A 3SXUA 3TLMA 1P2DA 5EG5A 4BVEA 1CUCA 2JRLA 4MCHA 4JZKA 5FNVF 3L6DA 5LUBA 3S27A 1JBQA 1EHCA 1IVNA 4WV3A 1SBQA 2ADOA 2HGZA 2PT7A 4OUDB 3Q87B 4LGYA 3C7DB 2A8YA 5F5XA 3VRHA 4KH0A 4XWWA 1BN6A 3M4JA 1CS4C 4X6LA 2GM5A 3PTLA 4P53A 1C4KA 1PZHA 3K9LA 3ABIA 2CL0X 4U7WA 3UW1A 1OCEA 1JVNA 2RH4A 1OAKA 5FJIA 3H2YA 4E1VA 4NX2A 2B92A 2BFFA 4DRYA 3P4UA 5CFMA 4KXXA 4X3CA 1MCZA 1G8SA 2FZKA 4N82A 4GQBA 4MEJA 5DGTA 3MTDA 4A7PA 1QMGA 3ZK7A 3AX6A 1GLVA 2OYCA 4I0WB 3N8GA 4OQDA 3BXOA 4N5MA 1GY8A 5GY7A 3WRVA 1S2DA 4RIFA 5H1YA 1E2JA 3HFRA 3VA7A 2GBPA 5CNJA 3IXQA 4G8JA 3SF8A 1C1DB 1L4BA 1Y37A 5DI3B 1O4WA 2CMKA 3M3HA 4XM0A 5IH3A 4E94A 3CC8A 1N5KA 4MX8A 4FFRA 5BN3B 2RD2A 1XMSA 2R7NA 5ALKA 1E2HA 1T3ZA 3D0QA 3GCDA 4MVWA 4LSZA 4QYMA 5CXQA 1HMYA 4JGIA 4Q4CA 1XJWA 3NPAA 4QICA 5JSZB 1YJ8A 5DHFA 1EXNA 3ZCSA 2ZWIA 1F20A 4BV2A 1EGMB 2V6FA 1M7HA 5ADVA 4D96A 2B1JA 3ZJ4A 2NUAA 2RH9B 2P3QA 3E7DA 5DV9A 1OWOA 2PUFA 2HWYA 1X7XA 1SUCA 2H08A 3QLVA 3QUAA 2IEGA 3B52X 3C5EA 3QFRA 4XYGA 2BEJA 4KI0A 3F2VA 4UFPA 2E6UX 1OPXA 2J6IA 3WWCA 5BWLA 1F4LA 1NQAO 2DBVO 1ATIA 4O2BF 2WTEA 2BKAA 2FZEA 1L4GA 1I0ZA 3LHKA 4Y2QA 3W3AH 4CNQA 1XCGB 4KK4A 4HK4A 3RKSA 2HY7A 3SHQA 4CL2A 3BDVA 1TMGE 1QE5A 1U4NA 4MCJA 3MJCA 2IE8A 2EJUA 3G8YA 3LUHA 1B00A 4RPIA 3UAOA 3LFUA 1NIPA 2ZAOA 4IZHA 1Z5GA 2PLNA 4JBIA 5KZMB 1JYFA 2Y4OA 3OIDA 3DZFA 5JS1A 4G86A 1JKXA 3CZRA 3B6IA 4KIJA 2XNDA 4M7PA 2ZBPA 4BQNA 1LW7A 1E92A 4G1FA 2GKSA 1MABA 2WM9B 3JVIA 1SXPA 4DDUA 1YA4A 3FYUA 2P35A 2YWDA 3I04M 1ZD9A 3IJEB 5DTMA 3WLHA 3ZWPA 2AG6A 5LIPA 3CLTC 3KQQA 2EBFX 2H7YA 2W6PA 2Z1DA 3FSGA 3M9LA 3MRTA 4IGEA 4OH7A 2W7TA 3WMRA 3WAJA 5H3CA 2JKYA 3Q8XB 5KWJA 2O57A 3BGSA 2IUFA 2FEOA 5I9TA 2B9VA 5EZSA 1CHNA 4C76A 5T6MA 2BYTA 2FEPA 1VKJA 1O97C 3I72A 5HUHA 2IC5A 2X0RA 3KAPA 2DFVA 5ALNA 2PL5A 2QLMA 1E6MA 1AGNA 5JVDF 1II0A 8LDHA 1PWXA 4WIAA 3T5AA 4QGAA 4KNYA 1VBNA 2MSNA 4LWOA 3IR7A 1EA7A 4J4HA 1JGTA 1OFUA 2Q0QA 3OC6A 3Q98A 4KWTA 3TQSA 3UG7A 3R7FA 3TRJA 5L53A 1WVMA 5H5JA 3IQGX 1EUCA 1WXFA 2XW6A 1U90A 4LSMA 3DC7A 2PZKA 2HREA 3FOEC 2Z98A 4KQWA 2BC9A 2VJMA 3QUBA 3Q2KA 4C6SA 4G5GA 4M0UA 2H4XA 5JYEA 3OQNA 3GPCA 2JDID 1J90A 4M53A 4BPBA 3L1JA 1ZOSA 1YSCA 4HX2A 1XTTA 4ZVNA 1UC9A 1C5KA 2J9FA 3Q9NA 4UW9A 4A0GA 1RBQA 2QLLA 1E63A 1F4VA 2QRVA 3FPJA 4HPJB 1XQXA 2RHTA 2VP5A 1QFSA 2ZPAA 1PQPA 3NOXA 2Z56A 1QWSA 4JAVC 4B6OA 4IHJA 1GQRA 4IIDA 2IDMA 1OFTA 4OQXA 1CV2A 2O05A 2Q2NA 3LDFA 1EFPB 3JQRA 3MT9A 5JASA 3OFKA 4MICA 1BE1A 3AP1A 4YLEA 3KLBA 4GGOA 1YD7A 1M8PA 2ZSEA 4IWXA 2GJSA 5KSZA 4TMWA 4TSRA 4PY2A 4K5QA 4E6PA 1G7RA 3RSHA 1CFJA 3S8EA 2ZM5A 4GQAA 4AZ0B 1KA9H 2PG3A 3IV7A 3SWWA 2A59A 3C6BA 1UM9A 1E0JA 3KO8A 3RUEA 1YCGA 4LE2A 2ZR0A 1KOFA 3RYHB 3VM6A 1YB6A 2AD1A 2AMJA 3MWEB 1NLMA 4M0PA 4W8OA 2JK1A 1SVKA 2PRZA 3R3SA 4IDOA 2WV9A 5D5QA 2WICA 5ELLA 4A6XA 4G2NA 4DMUB 3MWDB 1V3UA 2H1FA 4Q9KA 4R7ZA 1TPZA 1FW6A 1I3LA 4KO8A 1BMDA 1DTWB 2ZSAA 2Z5GA 4GOOD 2GVZC 2JLCA 5KVAA 2O2EA 3O4FA 4GE3A 5REQA 3VVBA 4DLAA 3ZOZA 1KH2A 2OXEA 2W2XA 1A2OA 4M7WA 4CG2A 3TVDA 1HV8A 4HAOA 4B7ZA 3K8ZA 3L41A 4ENUA 2YN2A 1F60A 3R44A 1U2SA 1EXDA 1FU8A 3RVOA 1NXXA 1UM8A 4RCVA 2JAHA 2FP4A 1N0UA 3QXXA 1OXKB 2VP6A 4IZOA 4BMNA 1GUYA 5EJFA 5JARA 1FOEB 3UXMA 4QGBA 1B6GA 3V34A 4H35A 3VR2D 5JQGA 5T7BA 1OU4A 3MJFA 2R66A 3JALB 3GPIA 4QPJC 2ZXUA 4UU7A 2WFZA 3R7BA 2FGJA 2QXYA 1I4LD 5C37A 1JAZA 2ACEA 5GV8A 1A8IA 4GRIA 2AOTA 1IUKA 1O94D 1ZXLA 4CM4B 4XUCA 3MHPA 1ZGBA 2MSLA 1XO1A 2A58A 3DDSA 1NUQA 2CCGA 2FG7C 3ACCA 3HGTA 4MPPA 4FPXA 2NXCA 2AFVA 3KOMA 4ESHA 2JGNA 3IB3A 1PJSA 5IUNC 2IS1A 4OBBA 3PFIA 1CCWA 4ZDWA 3STVA 1NM5A 4HDKA 2QMZA 1QB7A 4K8OA 1CUWA 3M6MD 2DE0X 2FQQA 3QBJA 1N33B 2J5KA 4IEIA 4PG7A 1TGVA 5AMXA 2C7VA 3TR5A 4HVLA 4EG1A 1WPRA 1AGRA 2CHVA 4PYOA 2XLCA 4AXXA 4QDOA 1GD1O 2DP4E 1SCAA 1Q2XA 2NTEA 4ETMA 4F2DA 3U6KA 4MAFA 5FAXA 2QM0A 1V3VA 4ZGWA 1LBSA 4I46A 4TQGA 4QUBA 2O2IA 4NFSA 5DASA 1YKSA 2ZB2A 4DNPA 4EJSC 4X5OA 1XVLA 1Z25A 1AZTA 2B8TA 3RI3A 2R2GA 3U3DA 5AVYA 1B8PA 5JAMA 2QTNA 3TW8B 1GTVA 1T5LA 4P7KA 4IY1A 1FZQA 4L78A 1QP4A 2PUCA 1EMDA 3ZCQA 1FQKA 3DFMA 2JLWA 3BZWA 4OQLA 1NQUA 5H02A 1CUXA 3GN1A 4N03A 4D43A 5HSGA 2X0EA 3RLIA 1GA6A 5DBOA 1CY0A 2I4MA 2Q7XA 1CB0A 4GPTA 4N7MA 4B09A 5C5EA 3W5AA 4IH4A 1HSOA 3LL4A 1Q1GA 2CNNA 3RT9A 3O7WA 1V8OA 3OIUA 2H4YA 4XOIA 4IQ8A 2QSZA 1RJ9B 3TPZA 1BQ4A 1THMA 4NIMA 3VHXB 3OETA 1S96A 2V03A 1ZG3A 3DDUA 3F1KA 2CD9A 5E8JA 4WGFA 2NNLD 1SD5A 2RMKA 1WVIA 5G0UA 3TAXA 1G18A 3H2KA 1V48A 4MLDA 1WCIB 3N2KB 2XJ4A 3F7NA 5EUQB 4YMSA 2AN4A 4D4HA 4GNKA 2NYRA 5ITVA 3RUPA 3C3CA 1YAHA 3QKIA 4TXHA 4WBXC 1G98A 1XXHE 5EKXA 3BL6A 3T35A 3K2BA 5HKOA 4FYVA 4GKKB 1CDDA 1QWOA 4AJ2A 3PHJA 1COWD 3A4VA 1LTQA 2C03A 4ZK2A 3R3HA 2JJ2A 2JCBA 2ZIUB 2F8MA 4HGNA 3TUJC 1R8QA 2NZXA 4NPAA 4B75A 5B1HA 5EQFA 3ESZA 1IHUA 3P0JA 3FD8A 3K1AA 5LA6A 4MO9A 1EX1A 4W5OA 1FP4B 2ZQYA 3I9V1 1XVIA 2PPVA 1S7GA 3EDMA 2O06A 1DELA 1F6WA 2JAWA 1SXHA 1GO2A 5MFZA 1DOHA 3K0HA 3QEOA 2WJ3A 5AOBA 3ZHBA 1E5QA 4NY1A 1DTSA 1RJGA 3CLKA 5JLAA 4WOPA 1C9MA 4EPRA 4EPTA 1QPBA 2ZSBA 3JPWA 1JKJA 2P3LA 3S2UA 4UBJA 2P40A 3ZLJA 1ZK0A 1JIUA 1FBTA 3F6EX 3ER6A 3FCSB 1OH7A 5KKNB 1X77A 1KDTA 3L8MA 1PG2A 1RC8A 3BFJA 2DGDA 1UBKS 2IU4A 2OT3B 3LI2A 2PANA 1P9NA 1SVMA 3PWSA 4L50A 3KV1A 4WXRA 2AN5A 2W43A 2R84A 5DM2A 3T7IA 1ULAA 3ZDFA 3RSLA 2AF3C 3JR3A 3L0CA 5AQ1A 2NYVA 5IJZA 4N0PA 5CLQA 5LZ9A 4G0UA 1QG4A 1WR8A 1YL5A 3TTXA 5CM2Z 3NFRA 2ZM6B 3IUQA 5CIYA 2BSQA 2GDZA 5FA8A 4GRAA 5AWFC 2UUBB 4JC8A 5EP4A 4PRYA 1P5FA 3D6FA 3GMTA 3KZKA 4GPEA 1VIYA 2FX5A 3BH6A 4JJ8A 3AF3A 1LI5A 4D3SA 1O89A 4UPVA 1KSHA 1NX9A 4LK3A 3VR3D 2HFKA 2E4WA 4TSFD 5AVJA 8GPBA 4CEJB 3FG9A 1LB1B 2RH5A 5CDFE 3RRMA 3O84A 4FINA 1KAGA 1F17A 1T6ZA 1AKQA 2P90A 5CK5A 1H22A 2VF2A 3K9QO 1DAMA 4HY3A 1UT6A 3RTEA 3U0VA 1UBFA 1K6IA 1SH7A 2CBGA 4P7FA 3SE0A 2FMHA 2W6CX 1KSGA 3TSWA 3UKJA 1Y9EA 3RVSA 3BK7A 1RTTA 5I5GA 1G0NA 1QK3A 1JEDA 1RPNA 4HO1X 2DQ4A 1E6UA 1POWA 2ZAMA 1A7JA 2CUKA 2GTHA 4QUKA 1BMFD 4LN1A 4YUVA 4X1YA 2XKBA 3M4ZA 5CW2A 2Q3EA 3BZUA 3HO8A 3G0IA 4YAFA 4EGFA 4K86A 1U02A 3RFCA 2G67A 4CCSA 3QXSA 2WIJA 2JB9A 4D42A 2YOHA 3LK7A 2OL4A 5E3IA 3G0DA 2BUBA 3QA3E 4PHTA 3G9TA 4G5HA 1WMBA 3TTYA 4WBNA 3TLKA 3ZHRA 1MOPA 1TYBE 4ITRC 2V7EA 5I48A 3ENVA 3DM5A 3O26A 3CLRC 2ZYGA 4L3VA 2H1IA 2Y6UA 3JQ8B 1G8GA 2R9VA 3UMCA 2OORA 4MR8B 2X15A 4OQEA 1EFKA 4IUYA 3EXFA 4OXYA 3X1JA 2AQ8A 5AVSA 1KPIA 3GA7A 2JZCA 4H0FA 2BI7A 2EG5A 4F3NA 4YFVA 4XGQA 4ZQIA 1X70A 4E5DA 3V8MA 5INTA 4HXYA 1H0HA 4M0FA 4UXHA 1Z36A 3QMWA 1K3FA 4LMPA 4IEFB 4OHBA 1NBWB 1C1XB 3PGMA 1V5IA 1P1CA 1TUIA 1UWCA 4GSKA 4LJ8A 3NEAA 2CN1A 5ALWA 3R7WB 1AHPA 3HV2A 4UKDA 4MGZR 4TYYA 1W49A 1SZDA 1X7ZB 5CW1A 4RU1A 1H2FA 2I7TA 1OBFO 3PPWA 4Q7KA 4WMLA 4G97A 4CGZA 1MB0A 2NPFA 3H0KA 1PG0A 3WWOA 3WLQA 3R8CA 3KWJA 4CU2A 2XZLA 1U8TA 3AJAA 4H1UA 2WIKA 4QOJA 4C0AC 5AI4A 1HX7A 1P4AA 1HO3A 1Y3IA 1D7OA 3U7QB 3S2EA 1EVJA 3Q2IA 4XWTA 3QE9Y 1ZD8A 1KR2A 3QVUA 2QUHA 1ISIA 4MYDA 1RRVA 3OPYA 1TVMA 2Z6VA 4LOAA 1C0EA 1ORTA 1JA1A 4QLOA 4U3JB 3KOOA 4UHBA 5HJ2A 5DU2A 4IGFA 3HCAA 2IHVA 3TLYA 2B1GA 2WJWA 1Y8AA 2FFRA 4LJLA 4WTOA 3MMNA 3KB1A 4RCYA 1Z6PA 3SX0A 3MD9A 1H5QA 1WBJB 4KRXA 4FWBA 3PT9A 4YV0A 1O1YA 1SHTX 2AZDA 2R4QA 1XZIA 2WJ6A 3HO1A 2FEWB 2PAAA 1Y1PA 1NG1A 2B20A 3COPA 4J29A 2J33A 4BWVA 2HZ7A 4JXKA 4XAQA 3TRIA 5BUQA 4IOLA 3IOBA 4FOSA 5DF1A 3BA6A 1FMLA 1L5MA 2F3TA 2R8PA 3ESYA 2I4TA 1AV7A 4X93A 3FOWA 2F64A 2ODAA 2OQ2A 2YZGA 4TLCA 3C4QA 1VJCA 3D8NA 3F1LA 3G02A 3KCQA 3F5DA 3N07A 5ICMA 1W76A 1K75A 4ZO8A 5EY5B 3SPXA 3C3YA 1IH8A 3NIWA 4RTSA 4HQ6A 4E21A 3INYA 3JCZA 2VSQA 4DBLC 5FUYA 1AUPA 4E5NA 3OJXA 4QHTA 2YZMA 2JIRA 2V5AA 1XTRA 1R5BA 4GRDA 4Z1OA 1NR1A 5BWNA 1R3DA 2D5CA 5CFNA 4PLWA 4RF5A 4CEHA 4XB6B 1GQOA 2TMKA 2VSOA 2WZQA 3C5VA 3RTCA 1UFOA 1T5TA 3RIHA 4Y6PA 1YFLA 4JXJA 1V2HE 4TT3A 1P1IA 1NVBA 1SQFA 1T6BY 2BMFA 1LSSA 1EQAA 2X58A 1DINA 4RZ3A 1DC3A 1OFGA 1A4XA 2R751 3WGMA 2YRWA 3MUFA 3UGQA 4MKFA 1Q3HA 4K9RA 3IO3A 3WIUA 2O5CA 2H0QA 4RVCA 1C41A 1ULTA 1V95A 2IXGA 4MPRA 5EWMA 1A2QA 5ALMA 2GRUA 1N2OA 1RLMA 3LRPA 3GDGA 4JL6A 4TXMA 3VHQA 4I8IA 1ZUNB 3EPHA 4RVUA 3OIYA 3LW8A 3EJWA 5TQ2B 5D84A 3AGPA 4ZOEA 1VLLA 5A02A 1XPUA 3BTVA 1GVHA 5HBGA 3COYA 3T0GA 5L3VA 1W4AA 2OO7A 4DV3B 4FD2A 2Y77A 3QLUC 4DJDC 4JFRA 4E5VA 3Q0TA 5L7TA 1RQRA 2OLKA 4RESA 1VYUA 4F1WA 2HN9A 3O95A 1HM5A 2WLTA 4CQMB 4PNEA 2NSYA 3F6CA 2WG1A 4MYUA 2CXNA 2J9ZB 4XGKA 4UM5A 5I8ZA 3V42A 4Y1RA 2PLFA 4FZ3A 3NVDA 4RJTA 1QHHB 3S2SA 1P31A 1JIVA 3IOCA 2HR1A 1V2GA 2ZTMA 3EIQA 3HXMA 1W4RA 2OGSA 2VF7A 3KR9A 1S6YA 3DBRA 4MUYA 3ZLBA 5BV8A 1UDXA 3OJWA 4YJGA 1VE5A 2PFSA 4Z4GA 2I33A 1VA4A 3BXEA 2H1OA 1KMHA 2B5OA 2Z09A 4RQBA 3VZCA 3WLRA 2EC5A 3IVCA 3KL4A 3LDHA 4DY4A 3IH5A 4DRZA 2D2EA 1T9AA 4UTRA 1UWVA 1OA1A 3PDWA 4L95C 2OV3A 3ZWVA 3ZNNA 1X7YB 2C84A 1Y4ZA 4HV4A 4YJ2A 2KM1A 2Z8ZA 3M1YA 1P8JA 4FBGA 1NVVR 4HFJA 4N01A 1IHYA 4QDTA 4FR5A 3FOAA 4PZLA 1BE6A 4EO7A 3Q7IA 2ZIXA 4OV6B 3RKRA 6YASA 1ZXXA 1K3UB 4JT2A 1EFVB 5MF6A 1YOVA 5KOHB 2FQXA 3QFCA 2JI9A 2ZRCA 1JIXA 2EX0A 1G2IA 4KKVA 3K0EA 4PBSA 3EPKA 5ALGA 1ESCA 3NT5A 5FAKA 1D2NA 2XUHA 3O9MA 3VSDA 2Z0MA 5HYVA 2AJ8A 3OZGA 2IHYA 3P71T 2F3SA 1K86A 1DO0A 1GCUA 1P19A 3AEUB 3ANNA 3CZ5A 4WINA 4WN9A 1I7QB 1XSEA 2O8DB 3NHAA 5IH7A 4KU4A 121PA 2G77B 1VDMA 3V7UA 3P1JA 4BHTA 4FR2A 1L6RA 4KRGA 2R6AA 3PQ5A 2HWWA 3I37X 4E1AA 2HHAA 4JT9A 1LXCA 4YRLA 4PAQA 3OX3A 1K5DA 5DHRA 2PEYA 4FBMA 1GZ4A 4BC0A 3PQ7A 3OUUA 2K5UA 1SCUB 1YS1X 4NPCA 4GLBA 4O33A 3D6AA 4J3JA 1PZXA 4E12A 1OV4A 4QVIA 2BFOA 5A1JA 1TD9A 1SUDA 4S3MA 3DG9A 4A16A 3F9IA 1NN1A 3BA1A 1IM5A 4ZI5A 3HCPA 2VPZA 2HXGA 1FYEA 1XIVA 2OGZA 2WHPB 2Q50A 1D5WA 3QPUA 5K3CA 4NCHA 4YHBA 4WUVA 1RVV1 1DUVG 1DAPA 3CCBA 5KYXA 3OESA 2H06A 5E2BA 3HPQA 1YQTA 2G08A 4PLCA 4BB6A 3V97A 3CF4A 4IS2A 4IIEA 1PQ4A 4N9WA 4MRRA 3VR6D 4YP5A 1VHWA 4JU8A 1ZONA 5KTRA 2VJBA 1PLKA 3R6LA 5HRCA 1G38A 2WJVA 4R3WA 4GKJB 4A6PA 5NULA 4FYXA 1LZKA 3IQDB 4EFKA 2O2JA 2V54A 1T3LA 4E5MA 5F77A 4CW7A 1Z4IA 2R44A 3AI7A 3RYFA 4E09A 3HU3A 2QI9F 1V1JA 2HF8A 5AESA 1L8LA 3EZ7A 5DTQA 2PE5A 3QVSA 4IVNA 5H16A 1YULA 1O0BA 3VPBA 3K20A 5JO0A 1V1RA 2ZCVA 3K5WA 5DIFA 3DE3X 1V71A 5E3HA 3KAKA 2VJQA 2VRCA 5DX0A 1Q44A 3RPEA 4JIMA 5EIFA 4TKUB 2VIIA 4JC0A 5G1NA 1BKSB 3AETA 3PPIA 1S9DA 1GU7A 2XY4A 4RMJA 4GQIA 5CA0F 4P4TA 1DB3A 3N2YA 5DLYA 4BLQA 1U3WA 5LXTA 1TF5A 3BAFA 3KYBA 1PKXA 4W1SA 2JIMA 1FMJA 1G8JA 4A2PA 4LZNA 2VBIA 3N3AC 5TC4A 1QKIA 3TLBA 2YV4A 2AR0A 1GAWA 1RQ7A 4ZT6A 2PBFA 4URWR 4CM7A 3EUWA 4CIDA 5KYKA 2EL7A 5CMLA 3V3TA 1CVLA 1EFRD 1R12A 1UBGA 2CLSA 4C6TA 2HDNB 3L02A 4JENA 3HHPA 1P1BA 2J45A 4G25A 1MAWA 2QF7A 4YCAA 4Z4HA 4ZVOA 4OI4A 5FADA 5KIAA 1X80B 5LDDC 5DNYB 1GKUB 3FWZA 2PKYX 1MJ5A 2Q9BA 3H8SA 4I1VA 4X6YA 5PNTA 1K6EA 4O1HA 3PJRA 1OLSB 4N65A 1XTJA 2Z83A 3CU5A 3K32A 4HQNA 3ET5A 3UJDA 4BECA 4GMFA 5HIAA 1BC5A 4IDGA 3WGKA 3SG0A 1ZLXA 4B3JA 5C9ZA 3GBSA 5CB4A 1P5RA 3CCFA 1LJLA 2AMFA 4HH4A 2JJ1A 4D4KA 5CCDA 1ZW1A 2X40A 3ZX5A 1H2EA 4MW4A 3CB2A 4MR9B 4S1OA 2PUTA 3VDMA 4L2IA 3H4IA 1CUYA 3TDKA 3WYDA 3A1SA 1XRMA 3DZDA 3O4JA 3WKAA 5KOJA 2JJYA 2A5LA 3B1YA 4REQA 1RJDA 3H8VA 5DBEX 4OLJA 5AFSA 5AVTA 4GOXA 1BXGA 4PAWA 5LOVF 1JDBB 4OSOA 2EGGA 4FU0A 4PSDA 3VZDA 1G6OA 2FWIA 1LD3A 1W0JD 2IHZA 4QBFA 4UU1A 3G23A 4ZAXA 5B1DA 3PL5A 4U5XA 4FI3F 2HCTA 3U44A 1AHNA 4ML3A 2FKNA 1YS7A 4E51A 1E3DA 4CEJA 5D3MB 3OE5A 2OKCA 1D2EA 4WVLA 5TPWA 1P80A 1U7ZA 3S7TA 1QTQA 1UJCA 2C42A 3OM9A 4V0KA 1R6UA 1I1OA 4JJAA 3WGLA 4PIMA 5AJYA 3HJBA 2W70A 2DUUA 5A0FA 1C9EA 3L7BA 2BD0A 4L28A 2YHAA 4NOJA 1XDDA 1OI3A 5JSKA 1DBSA 3KVRA 2VK1A 2YHIB 1DIOB 1Z4JA 4C5CA 1VIDA 1WZIA 4FS3A 3HCEA 3C15C 2CVQA 3T9FA 3AP2A 2BBWA 9LDTA 2H1LA 4XJTA 4UHKA 2VYVD 4OGFA 1GYPA 1QG2A 3W3ZB 2CLIB 1M2JA 3GRRA 3B1VA 1IN5A 1J09A 1NNSA 4TLAA 3OBIA 1UOOA 4XARA 4DCTA 4EGAA 3R5TA 1E9EA 2P68A 3AK4A 2YHBA 4I50B 1Y1LA 1CSEE 1R4ZA 3PRKE 4LXHA 1Z26A 1JBKA 3W4KA 2QN2A 5DM0A 4EI2A 5J5VA 4TUYB 5FX2A 3GRVA 1F0KA 2L82A 3AC0A 1U2GC 3AR9A 3W5CA 3IJ5A 1S2LA 1EIZA 2WDPA 1FLVA 3UGTA 3UJ8A 3VYVA 1UXHA 1EK1A 3H2IA 1MB2A 3DEHA 3LKVA 3I32A 3O4HA 4XX0B 1HTWA 1SUFA 2Q6KA 5SZJA 2WIAA 1CB7A 2GGSA 3ZJUA 4MS4A 4I1OA 3FMPB 2IWRA 1U5BB 1MO4A 1ECBA 1GFIA 1XF1A 3VYSB 3AHHA 3WWYA 5FHQA 4AWAA 1YRHA 4E2FA 4H60A 4U2GA 1Y3HA 3KJNA 5A5DA 4Z9FA 2HMUA 2I0FA 2WUDA 3GLIE 2DKNA 4O4HB 1WJGA 4RW0A 2P2YA 2EJWA 3AY0A 1MOZA 3QPVA 2PA3A 2X9NA 2XQKA 4PBRA 1KQNA 3D7MA 2VTDA 4JB2A 2BOVA 4O02B 1WB6A 3S44A 2WOJA 5B30A 2F48A 2WVGA 4RZIA 1C8KA 1N2SA 4RTRA 2X8WA 1OXSC 3GJZA 2Y3IA 3UWKA 2QMOA 4CM9D 2QE7A 1XTIA 1ZAYA 3VBCA 1HNWB 3E1KA 1PQUA 1TQ6A 1XZJA 2NSLA 4LHVA 4YAJA 3TLXA 3OZCA 3B1KA 2VFAA 3WWZA 4V24A 1TGYA 1IXSB 4D9GA 3EE6A 4KKXB 2Q2WA 5KAPA 1VZ2A 3NYIA 1G291 2PN1A 2HBYA 2FSUA 3KHTA 4KSBA 5JS7A 1YC2A 3D64A 3KJXA 3NYWA 3P5SA 4ASUA 4ES6A 2J07A 3TKYA 2HADA 4RHCA 5F7ZA 1MDFA 3AHCA 1R4AA 1ZMBA 1L7OA 3PNKA 4TV9F 3GLIB 3DYBA 5IAJA 1THGA 2EW2A 5IYZF 4I1PA 3UK7A 4UCWA 4P6VF 3H8JA 3MELA 2IUEA 1OVGA 2FWAA 2BEVA 2J3EA 3QUSA 4U8HA 5DTJA 2GNOA 3ZE8A 1QTRA 1IUPA 4DXDA 2ZE5A 3OT1B 3ASZA 4X3PA 5AXCA 4BX2A 4OU4A 2XODA 3KAQA 2DBRA 5IVKA 2FMTA 3CZMA 4L4RA 1L5GB 2X2PA 1CS0B 2ZIAA 3VDXA 4DDKA 1O95A 2DQZA 2CZCA 2IPMA 3IDZA 2CMGA 4D4MA 5AUNB 5M3BA 1RWOA 2CL5A 3CRMA 4NJEA 2UVDA 4P5PA 4G5QA 2OSBA 3H75A 2BFDA 3GT3A 2JH8A 4LBYA 1QO9A 2HNAA 4BDSA 4YAKA 1XTPA 5AVXA 3HO6A 5D87A 3ONEA 5JATA 4CM5A 3V8PA 5H80A 3SYRA 1QE3A 2J0SA 3OUZA 3A9RA 1DC7A 3B12A 5DOZA 5DE3A 3V4VB 1IBKB 3LHSA 1J0XO 1Q6YA 1XPJA 4M76B 4P58A 1TCBA 1GTSA 2FJ0A 3QGMA 4LDZA 3GF4A 4BV9A 5DYTA 2AS0A 3O90A 4EFDA 1II8A 3L6RA 4KZKA 4N3CA 3T0IA 4ZCIA 2I4IA 3C8ZA 4LQ4A 2PV7A 3BH0A 4I1UA 5JRZA 3A3NA 3HB1A 5DTEA 5J4HA 3KXKA 1D04A 1U2DA 2GCIA 4KREA 2M98A 1V47A 1QVAA 1OTHA 1U28A 2GN9A 3BM5A 4JLDA 3CLSC 2V5VA 3OSUA 3QWFA 3AIOA 5G2OA 2JD0A 2D5BA 3WBBA 1O96A 2VDQB 1ZBQA 1V4NA 3OEWA 3QKRB 3IP1A 5JWHA 4YAIA 3RREA 1HQCA 3PQDA 5FYQA 4CL3A 4FGZA 2I6TA 4IXNA 4MW6A 4CYMA 1PCXA 2WHYA 1RI2A 3VC7A 2W2QA 2R85A 1YI8A 1M8GA 4GAEA 2V55B 2E5WA 3NHMA 1CIVA 1G3MA 3BORA 4GI1A 1CLUA 3GDOA 4GF5A 4O4LB 4F3CA 1D1TA 2J3MA 3ZJVA 1GEGA 2W0SA 3OZSA 4G84A 5DCLA 2R11A 1T2EA 2Q4TA 4XGRA 3RHSA 4PBTA 2Y2VA 3BJEA 1XU4A 1J06A 2PCLA 4KLCA 3T9EA 3PNVA 5CVUA 2R6R1 3EEIA 4FT2A 3DJFA 4HUQB 3RSCA 2N47A 4GI2A 1UJ4A 1OGJA 4MOWA 5M2QA 1Z5WA 1V7CA 3DFIA 2GBCA 2M6KA 2A5DA 5MDHA 4D5EA 1KDOA 2XDWA 3DD1A 4FR0A 4ZP1A 1OYYA 1OB2A 1EK6A 4ISBA 2WINI 3SIPA 3HB9A 4JVLA 1LK7A 1V43A 1A5SB 4CXMA 2H48A 5KNCA 2R8EA 2IEZA 4FE7A 3AP3A 4U6QA 2NU8A 4RFSB 5CR9A 4B3MB 1Y3FE 4PGFA 4XQ9A 4MWBA 2XOKA 3PPVA 4NESA 5B53A 4RTPA 3GNSA 1OBOA 2UZ1B 1QF6A 3DV0A 3EGEA 3ZLUA 3O4GA 3JWPA 2G5PA 2QTTA 2VYQA 1E3JA 2BUCA 2PAFA 3B7GA 1YMQA 1ZH0A 4YBRA 2OYSA 3ZU4A 2NPOA 1OMOA 3E7XA 3T06B 3WRWA 2XVYA 4B3HA 5IBCA 2R7KA 1U9YA 3DLTA 2QX7A 3OTGA 2QAGB 1IQ0A 4BLVA 1PF7E 4P4SA 3FZNA 4JOSA 2W0MA 3CH4B 1F1BA 3PCTA 1NNUA 4GPZA 4IVRA 2ZXFA 2CVOA 3EWAA 4R54A 1PW5A 1RJEA 1VPVA 5CH5A 5ALHA 4PLPA 1BAPA 3THYB 3H18A 3JQFC 1G9XA 4AS3A 4JMLA 1IOVA 2JBAA 1KI1A 4UVHA 2BM9A 2WJZB 3RIMA 4DMLA 1HEYA 3CJTA 3LT4A 5BWOA 3CZ9A 5BW4A 4ED9A 3P7MA 4DMGA 2WP0A 2A9RA 3COZA 4BVLA 5JBIA 4X24A 1OXUA 1A8PA 3A6EA 4TYWA 3A4TA 3PFGA 2Y66A 3PHIA 2ADMA 1DDOA 4JZYA 5I9LA 3SBOA 4C0SA 4U7HA 4UNIA 1UL1X 2RKBA 2XOXA 1T5SA 3AR5A 3OEHA 2Y1CA 3OFVA 4GMGA 3SY8A 1JALA 4QXOA 3AWDA 4J91A 4MV0A 4B73A 1HURA 1MB3A 4MVCA 2V59A 3MXOA 4GYKA 4X45A 4B17A 3UPUA 2X5XA 5TF4A 3I6QA 2Q9CA 3Q7PA 4Y2UA 3IUMA 3HDGA 5JDIA 3GFRA 3K2IA 3R23A 4EPWA 3FSRA 3SHFA 3NTLA 5G0WA 3VTZA 4ZVSA 4V2UA 3UJAA 5KNDD 3MB8A 5WRFA 2A67A 2CXOA 2HNBA 3CPJB 3QUCA 3FNIA 4OH1A 1WULS 2AG8A 3L7IA 4BP1A 4OI0A 2AC4A 1PR1A 1XVAA 1VKOA 3GRCA 3UA3A 4LF8B 1RWKA 1J39A 5IUKC 4DLZA 2PEZA 2VHUA 4FGLA 4BIMA 5SYAA