3TZNA

Crystal structure of the yersinia pestis dihydropteroate synthase.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
243
Chain Sequence
b'SHMHLTARGLTLDLSRPQVMGILNNLDQALQHAQRMLSAGATLIDIGGELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 85
structure length 243
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tznA00
3BOLA 1Q7QA 1TWWA 1Q7ZA 2E7FA 4MWAB 2Y5SA 3MCOA 4NHVA 4G9PA 4MWAD 4D8ZA 3H26A 2DZBA 3H2EA 1F6YA 4MWAC 3H2NA 4DJEC 3K13A 3TYBA 4S23A 2Y5JA 2DQWA 4PZVA 2Y0FA 2VP8A 4CCZA 2DZAA 4C1NA 3V5OA 4DAFA 4DAIA 4MWAE 4S3BA 1TX2A 2H9AA 4S3AA 4O0QA 2YCJA 2YCIX 4O1FA 3H22A 3TYUA 3H2AA 4HB7A 1AD4A 4C1NB 2VEFA 3H21A 3TYZA 1TWSA 1AJ2A 3TZNA 2H9AB 4DJFA 4D8AA 4NILA 3TYCA 1Q85A 4DJDA 1AD1A 1TWZA 4NIRA 4S3CA 3NOYA 2YCKX 4S3DA 4NL1A 3H2FA 3TYEA 4S3EA 3MCNA 3H2OA 3MCMA 4O1EA 4S39A 3H24A 3BOFA 5JQ9A 1AJ0A 4DJFD 3TR9A 2OGYA 2BMBA 2YCLA 4DJDD 4DJFC 4S38A 4D9PA 3TZFA 3H2CA 1EYEA 4DJDC 1TX0A 4DJED 4MWAA 2VEGA 3H2MA 3TYAA 4DJEA 1Q7MA 4DB7A 1Q8JA 1AJZA 3H23A 3TYDA 2YCLB 4S3FA 1Q8AA
chains in the Genus database with same CATH superfamily
3CHVA 3VX0A 1IZJA 4CEUC 1SFLA 4O15A 2I17A 3QPZA 5LSMA 1U5JA 3XISA 4MWAD 1LT7A 3QLDA 1ITQA 2MUCA 5E93A 1F6YA 5C71A 2WPGA 3DCPA 2CLOA 4Z08A 5C70A 4ATDA 1BSLA 4KS0A 4FOKA 2HWGA 4A4AA 3EEGA 1EJUC 2AQOA 1UPPA 1UQZA 2G8ZA 3QMSA 4HU0A 3LPGA 1IQ8A 2DT0A 4M7TA 1V08A 1E73M 2V2CA 3S5YA 3T81A 3PM6A 1CGWA 3WH9A 4EE9A 3ABRA 3B4YA 4AVFA 3QJAA 1KM3A 4L80A 3O7UA 1GHRA 3AYVA 4GA8A 1Q6EA 5HJXA 4ZXLA 3NR0A 3PZMA 3EKGA 4B3LA 1UR3M 4GYJA 2ONEA 1YDNA 4JIEA 3E0LA 1FWWA 4JFTA 5LXEA 2E8ZA 1AQ0A 4L6HA 3RF9A 2J8GA 3O3RA 3W0KA 1KTNA 5DFAA 1YLVA 3M0MA 4Y9AA 4MSSA 3CZ8A 4FX8A 1FFRA 3WQ8A 4XAFA 1G7VA 1EZWA 2XZ9A 1DXIA 1TPDA 1VFOA 2YLAA 3SN1A 1E4NA 1Q8JA 4J9JA 3BAKA 3P8IA 1C8QA 4UTIA 3HJZA 5BW6A 1EUNA 2DUAA 2VGFA 1IEVA 4Z2GA 1EGMA 3MUIA 1XLBA 4CNPA 1DJHA 1E3ZA 2PURA 1IIGA 1SO6A 1E4IA 4ZFMA 1FWGC 5DCBA 1E3XA 2XM1A 4Y9NA 3QY6A 3HURA 3KCJA 4AZHA 1EX5A 1Q13A 4JTKA 4ZQNA 1XJBA 4UTTA 3VGFA 4WR3A 6REQB 3OGSA 2P10A 4UMCA 5E9AA 5KITA 1H49A 1B90A 1F61A 2YYUA 3D3FA 4IZGA 4ML4A 2QQ6A 4K7VA 3MZ2A 3R1ZA 1KBLA 4NIRA 1CXKA 1MXDA 2XVLA 5G4HC 4WQ6A 3P80A 3DIPA 2FZDA 2QJHA 3S2NA 3REQA 5H1WA 1UASA 2OJPA 4AHQA 5GVJA 1KBIA 4Q4MA 2O4QA 5FOOA 2GJXA 3ITXA 5E6YA 1NWTA 2XISA 2Q8LA 1BYCA 1C9DA 3I3DA 3WQWA 2VQUA 3T7VA 1OSEA 3MKKA 1MW1A 1PBGA 1CLVA 1T96A 4JTTA 1OY0A 3C8NA 2INEA 3MYPA 3QQWA 5GJNA 5DCEA 1TV2A 4R85A 1G69A 4W9TA 1CXHA 3M0LA 1DOSA 2VVSA 3C4UA 3E02A 4YWIA 3S9YA 1YBQB 2G4FA 1GYNA 1VQTA 3PPHA 5FF3A 3GZAA 2ZC8A 3ZWSA 3CZKA 2EKCA 2WJFA 5CAHA 2OZTA 3DAQA 3L4WA 4V28A 4J3WA 2VEFA 3W74A 3ITVA 2GOUA 1VFFA 4ACZB 1XH2A 3MP3A 4PUWA 4Z2IA 1TJ1A 3W7MA 3NEVA 2NWRA 3IJDA 5XIAA 1QXLA 4XD5A 3STGA 1NDZA 5HNTA 3MUAA 2WZTA 4XD4A 4D8AA 4H9MA 4O13A 3SRHA 4AZBA 3W70A 4FLSA 1R7AA 1EP2A 1UR9A 3BAIA 2P3EA 3ISIX 3N11A 4J1OA 1BQCA 4OU1A 2PC8A 1VCVA 2O7QA 4TUFA 4A3YA 1W2VA 1R47A 5F1VA 4R27A 4Y9OA 3G1DA 3HGSA 3PG9A 1WOBA 4MYXA 5JBFA 2J74A 4U33A 3UA4A 2VC6A 5C8BB 4XZBA 9XIMA 2ZRZA 3KE0A 3LMZA 2DZWA 5LKYA 1Q7QA 1XPYA 3M07A 3WL1A 1XH0A 1JYVA 2Y5SA 1E0VA 1E1CB 3R8RA 1ZQ5A 4R9XA 5AHLA 3PBWA 3F4NA 5JBDA 4JIPA 4H8UA 4S23A 2Y5JA 4BHYA 4DRSA 4XTDA 3KAOA 3ZYZA 3A4WA 2FVMA 1R3VA 2EEXA 3ARQA 1T7LA 3KL0A 3NPXA 1CGUA 3BMWA 2F8QA 2CZVA 3NA8A 2VCCA 1IHIA 3UESA 1EHNA 2E4TA 3EPMA 1QNQA 2QYGA 4GFSA 2J25A 3NYZA 1AW1A 3R11A 4LBUA 3VNMA 1LRTA 4EVZA 2ACSA 3PJTA 2C18A 2PDMA 3N9KA 1XLAA 2PWVA 1VB9A 3GSMA 1NFGA 2D23A 3LCIA 1IWPA 3QHNA 1IIHA 3VIJA 3LGEA 4DJFD 5A6LA 3CLWA 3ABOA 3LENA 4NNBA 3VDAA 2VX4A 2DIKA 1TPWA 1G4TA 3KM8A 3CHDA 4ALDA 3ZSTA 1RV8A 5GNXA 1F3EA 5DCDA 4ATWA 4AXNA 5F4SA 4QTGA 4JZ5A 4GI6A 4XAGA 1MXGA 1WUEA 4JTQA 3ID7A 2BG5A 1WYIA 3PBGA 3ORWA 2ZZ2A 3K1DA 1UUMA 3RJYA 3G8RA 3WUEA 4GQBA 1A80A 1RY8A 2VR5A 3N6QA 4N2YA 5LIUX 3I6EA 3K13A 3TYBA 3CL6A 1JF5A 3JS3A 3VDCA 3VGDA 1B0IA 3KOXA 1RQHA 1B3VA 3N1AA 3I3EA 3CUXA 3O9NA 2I5GA 4MOZA 4MY8A 4UXDA 1ZRQA 4QP0A 5U7SA 4HB7A 2QCGA 4C1NB 3RHGA 1Z42A 4G56A 1XDJA 3E12A 1OYCA 4KCVA 1FKWA 4IMDA 1XYAA 4A05A 3IJ8A 4MPQA 4LAKA 5M3WA 1QAPA 3AZRA 3G18A 1NH6A 3BC9A 3TOYA 2WZIA 3FVDA 4G2DA 1ISXA 5DRIA 3N34A 3PZ9A 4DO7A 4DM2A 1FWAC 4C6BA 5AYBA 2EO7A 3E0FA 3HIJA 1QPOA 3ARRA 3BV7A 5CKSA 2WCAA 1QRQA 5KSWA 4NQ1A 3PTDA 1AMYA 4I90A 3VIFA 4MPKA 1DHKA 4N02A 3NSMA 2OZ3A 1POKA 4MVAA 5DRCA 3QN3A 5TD4A 2Y7DA 2ZWZA 3PANA 4RCXA 1B31A 2DVUA 4QGCA 1J5TA 1EP1A 3EA2A 4KQNA 1OQFA 4GXMA 3VU2A 2HBXA 3A3XA 1XIDA 4L4OA 1VCFA 3N14A 4HMDA 4PULA 4FA3A 1J0JA 1J0ZA 3WQEA 2E25A 3WFZA 2BBFA 1CW2A 3WK3A 3VKAA 3MWAA 2DH2A 2L5HA 4F9DA 1VPYA 3OBEA 5LA2A 3SCOA 3EX6A 3FXGA 4GJJA 4NZJA 3GW0A 5LXXA 5K7JA 1AZ2A 2PWUA 4CNOA 1CXLA 2OFJA 3I6TA 3W24A 1JDDA 3LHVA 5ABTA 4U2YA 3T55A 1XLFA 2NLYA 4FP1A 4NX0A 1Z7AA 2X8RA 1X38A 4H1ZA 1EJ7L 3B0PA 5M1TA 3THAA 7PTDA 4L6OA 1KM5A 3ZT5A 4AY1A 5TNVA 3TW7A 1MRAA 2WVUA 5LGZA 4PCPA 4XZMX 3MANA 4V33A 3OBAA 4US5D 1XC6A 4IPJA 3LERA 1HVQA 2VZOA 1DIEA 1ONEA 3ZIZA 1BWKA 2ZTJA 1MSSA 4GBUA 4H00A 3TCSA 3TX9A 3OLIA 1XL9A 2AKZA 3Q67A 4WKFA 1R6WA 3ALFA 3IANA 4B9ZA 1D7KA 4DO5A 4FI4A 2ISDA 3VD7A 4DUOA 3HZ3A 1C91A 1QNOA 3W2LA 4R7WA 1DWFM 2X1RA 5HNUA 2REQA 1QR7A 4A8LA 4OUEA 4ZQMA 4AZCB 3XIMA 3S1UA 3TLLA 4ZGYA 2W67A 4IGNA 2AAMA 4I7UA 4ZSTA 1GHSA 2OTDA 4PMYA 3KWXA 3RNDA 2YPIA 3EWUA 2NV2A 3H8AA 2Z7KA 1YE6A 2D2GA 5C55A 4W7VA 1KLZA 1X1OA 2BFGA 2WMKA 1Z32X 1DXFA 5CZTA 3TWBA 2V5JA 3W28A 1AH3A 3TYCA 1XLHA 4FK9A 4NKCA 1KNWA 1Q45A 3VVGA 3MSRA 4LV4A 1JCMP 1M9HA 1BPLB 4C5ZA 2WNQA 4QQUA 4GZEA 4YTTA 1M6JA 3IUDA 5E5CA 1YDYA 1BVNP 1P0DA 2CPUA 4PE8A 5LNSA 4W8AA 1M03A 1XLMA 3IIZA 1Y5WA 1BXCA 2XIJA 3TTSA 2QUVA 1UD4A 3G1HA 1PZ0A 1GQIA 2W9MA 3CU2A 5I3HA 4B90A 3FHQA 4TIMA 3T42A 1VR6A 3EX2A 1FHVA 2ZUSA 3RN6A 4GPNA 3PFRA 3RCMA 4ZA0A 2A3CA 2FHBA 3L67A 4JFVA 1OK6A 4XO6A 4MG4A 1P0EA 2OODA 1UKQA 2R1MA 1Y7VA 1NJJA 4YIWA 2WHKA 3U3HA 3QH2A 1OHLA 1RXOB 2OMAA 1H3GA 4P8XA 4GYPC 4LUIA 5D09A 3PAJA 3W1AA 1LT8A 3M46A 1DWGM 2OOGA 4I9TA 3ZJ7A 3QFEA 5F2LA 2PGRA 3W7EA 2GSJA 4W85A 1OJXA 4CQ8A 3NQMA 1V7AA 1TYGA 2KX9A 4K39A 2VX6A 4GIEA 4QE5A 4QIUA 1I60A 4KEUA 4PTMA 4OV9A 3RITA 1JFXA 2R6OA 4RDVA 1UKTA 1V3KA 5CXPA 1UZ1A 2Z1SA 3SIZA 2YXOA 1Q85A 4HOWA 3GUWA 4W8LA 3LD5A 1XSKA 2E77A 4OIFA 1JCXA 6TIMA 3BK0A 3POCA 3WH5A 2F6XA 3HMJG 4GY1A 4JTUA 3WF3A 4GIAA 1EQCA 1RQBA 2NXHA 3KHJA 1L8PA 1E51A 4U10A 4B92A 1VYPX 4N9EA 1J0YA 3M0YA 2X1TA 1SYTA 4HTBA 4G9PA 3BLPX 3PY2A 2DZBA 3SUWA 4EWJA 3AHXA 4KRTA 5HK4A 3K8MA 1YPIA 3HFTA 3F03K 4A2RA 2JF7A 4TO8A 2XWEA 3O07A 3HPAA 1XLLA 4KBXA 4C1KA 1KB3A 4ROPA 1GGOA 4GQQA 3DU0A 4JQ1A 2Y6ZA 2X05A 1JG9A 1NEYA 1JZ8A 5DXYA 3R8HA 1UA7A 4GFIA 2E5DA 1WZLA 1V77A 1IXPA 4OOZA 3BGAA 4WD0A 1C3FA 1GOKA 2DZVA 1W5QA 2ZWYA 5G5IA 2Z1XA 3W25A 4Z2KA 1RP8A 1H60A 4KFNA 3N6HA 1XLCA 1VKFA 4W86A 3MJMA 3VIHA 5CH9A 4DZ5A 5JUVA 3UZXA 3H2OA 2OT1A 4O1EA 4ATLA 5FESA 4HBKA 1VPQA 4XAPA 4YTQA 1QJWA 2YZRA 1G5AA 3RMEA 3R7MA 1LLZA 2IQTA 5CSSA 2GSEA 2I56A 2B0MA 3S83A 1BG9A 1Y65A 1UKSA 3UR2A 1W32A 1J6OA 2UY2A 4UNIA 4S3FA 3L23A 1OABA 2WK2A 3S2CA 4JQ2A 5J5RA 2XGBA 1RQEA 3FV9A 1E4MM 1KQYA 3LU2A 1OFQA 4D8ZA 1LM1A 2D2OA 2E68A 4REQA 5CPQA 4GQ0A 3GXMA 2ASHA 3S5NA 1GONA 4M6PA 3EXTA 3G1SA 2VRQA 1HJSA 3NQCA 2D22A 1X6UA 3HJEA 3WLPA 2H9AA 4C6PA 2VFDA 1US0A 5J5DA 4I9JA 4ZO7A 4QRNA 4JIQA 1XF0A 3VDHA 2FTYA 4EPBC 3OEXA 1W54A 1I1XA 3AFBA 4WCJA 4FIRA 1XYLA 4J2MA 3PF3A 5HAOA 2QCHA 1A49A 1EO5A 4YCOA 1WQ5A 4H9ZA 2PDUA 3W7CA 2FVLA 4D6CA 5CPMA 3CV7A 3B05A 2WB5A 3IJQA 3G22A 4ZOAA 4KWOA 1NARA 3RG6A 3WQVA 1DVJA 4Z1YA 3W01A 4H6KA 4NF7A 1QNRA 3O16A 2POTA 4Y9PA 1JZ4A 3G1XA 3WJXA 5L6UA 4PMNA 5AZ1A 3E0VA 4PRWA 4JX5A 2Z24A 3PTKA 3SJNA 2ZQ0A 3OB8A 3QYQA 3C2YA 4Q7NA 1M1BA 1WOAA 2WMIB 1M65A 1RD5A 2VRJA 1EBGA 4DJEC 2IPWA 3B9OA 5B7ZA 4WDUA 3WSUA 4HA1A 4O8RA 2WNNA 3SM0A 3VD3A 1JAKA 1XLGA 1LTDA 4FXJA 3QTGA 3B3DA 4A22A 4OFCA 3QLLA 3AMDA 4H7VA 2FDSA 4GKLA 4JTEA 2WHLA 1Q6GA 1QCWA 3QQ1A 1V93A 4OQVA 2QVHA 4MNJA 5EFDA 2WCGA 5RUBA 4P7NA 4RE3A 1S2WA 1O5RA 2OLHA 3GBEA 3MBFA 4F0MA 4IF2A 4N6FA 4CD6A 3ELFA 1D3GA 1R7OA 1TZZA 4F2BA 2ABAA 3MTWA 4UZSA 3BTNA 3GTIA 4UIOA 3RCYA 2VR2A 1ONRA 4RW3A 3F2DA 3BO9A 5G1MA 4B5TA 2BX7A 4BF5A 3H4GA 4Q3MA 3E2QA 4QNEA 2GGIA 3KLKA 2NQHA 3H7VA 4S38A 1DWHM 5AC4A 4V27A 3HG3A 3CT7A 2CXEA 3T2OA 3LCHA 2VDHA 4AF0A 4LAUA 2AGKA 1A4LA 1IT0A 6A3HA 4ZFCA 1T8QA 2ANUA 2PP3A 3ZVIA 3ABZA 5KEZA 4GH3A 2FVKA 2GPTA 1RBOB 3NPVA 2QHAA 3NQ6A 1LQAA 1GZGA 3CQJA 4I5RA 2QUMA 3MV11 3AO0A 3TKFA 1TIMA 3NQDA 1WDRA 2ABBA 2YOCA 3DFPA 2PE4A 4IP4A 3WK0A 4R5EA 4LEQA 2R1PA 1U1UA 2O9OA 4LUJA 2B7PA 5AECA 3PSVA 3M0VA 2NSOA 1TJPA 2E6AA 3CZLA 5K2ZA 1J5SA 1WZAA 3EWZA 2OXNA 2ISFA 1L2QA 1WBJA 2D20A 1BYAA 3HG2A 1ODZA 3FDGA 4JAWA 2ZOXA 3KTCA 4JKLA 3V5CA 3E0IA 1IEQA 3LHZA 1H7WA 4C6NA 4WDWA 1FWFC 1VEOA 2UY4A 3UJEA 3PPGA 1B30A 3WLKX 1KV8A 2IQ0A 1YMYA 4EIVA 9XIAA 1UWUA 3W7JA 2HNEA 4OBSA 2BOFX 3CIVA 1A0CA 1P5BA 4MKVA 3S2LA 5DELA 3IRSA 3W29A 3K5XA 1PXGA 3PUGA 1G1YA 5I06A 1QI3A 3THUA 4E8DA 4LVFA 1MWOA 1QW9A 4NAFB 4GUFA 3QR1A 1P0NA 1UC5A 1X8FA 2HISA 3KL3A 2ZRYA 3KTSA 4KETA 4RNJA 4QISA 2A3AA 2X7VA 3TLQA 4HOXA 4J40A 3KDNA 1UWIA 2CZFA 3ARZA 3P81A 3S5OA 4URIA 5G2WA 5H8MA 4AISA 2PWGA 3ARUA 5I0DA 3D6NA 3RPTA 1JL8A 4AD0A 3PBUA 4HK5A 1FWTA 2VXNA 3WX7A 1S2CA 1NOUA 2CWNA 3H21A 1TE1A 3CPGA 4HU4A 4AAJA 4S3KA 3VCCA 1ITXA 2PMQA 1I6NA 3L12A 1XIJA 4LUTA 4IM4A 1JI2A 3T05A 5I07A 2DSZA 1W1B1 4D6DA 3RX4A 3LBMA 3NUKA 3P74A 4TTGA 3H7UA 4LB4A 1KRCC 4IMAA 2BHZA 3TN3A 3UERA 4XBKA 3UGRA 1W3HA 3VM7A 4GXPA 3AS2A 1EWDA 3TC6A 3RXZA 5C9ZA 1RHCA 4IWWA 2ZBTA 5AC7A 3OZMA 5AB3A 2ACRA 5BMWA 1SZRA 2WBKA 1NAL1 4UFLA 1SO3A 1FP9A 3GXDA 1XDLA 5K9XA 3N73A 1U22A 1DIDA 3R94A 3A13A 4U2ZA 1WXJA 1FVPA 1Z48A 2Z28A 2VT0A 4R3UA 2E7FA 3AUJA 5M17A 4CCDA 2EPHA 5HXMA 1HT6A 3RR1A 3ABQA 1ITCA 4DX3A 3D0CA 3CYJA 1XHGA 4XG1A 2BNJA 5CGQA 2FGZA 4TX9A 3GG7A 5E6ZA 5A2CA 3TN6A 2BVWA 1SJDA 1ZUAX 2OOFA 5AC8A 2Q8XA 1SW7A 1A0EA 4W7UA 3INPA 3P61A 4WRHA 3GNRA 3CB8A 1ZY9A 4MKNA 1XDMA 2HVOA 3H6OA 5A8OA 2ESCA 2QJGA 4ZODA 2BY0A 3VMNA 3R79A 3I68A 1DJZA 1ZB5A 3RR4A 3VK5A 3EDKA 4L65A 4O28A 2POZA 2WO5A 4Y6GA 1MQPA 3VC5A 3PZOA 3QZAA 5HWNA 3A3HA 4ZE5A 3BW3A 2QS8A 1A5AA 3E2RA 2NQ9A 3AICA 1JDEA 3OJGA 1FTXA 1W56A 4I5UA 3SCTA 3QOMA 4PB5A 3V75A 3W7PA 1OGSA 4ZTYA 2PZNA 3A3WA 1ZAIA 2EBNA 5FEPA 3OVPA 3FVMA 5G1YA 3CPUA 3P62A 2F61A 3SCVA 1E40A 4A21A 2DEPA 3EWBX 1XFCA 3ARSA 3KVLA 2OWWA 1K7FA 3L7RA 3W23A 4B5XA 2FMOA 2VUYA 4EPEC 1JCYA 2YA1A 2XDFA 2GVEA 1VHNA 1XPGA 5I00A 3VO0A 2WLZA 2Z7GA 4HCLA 3G1YA 1P6CA 3O0KA 4BQ3A 2D3LA 2OKOA 3VNIA 1PCKA 1S5TA 2DZPA 1OB0A 3S2JA 4WDXA 4LCQA 1TFVA 3GTXA 2Q02A 3GY1A 1XYMA 5I03A 4X0NA 1TMQA 3R13A 5CZSA 5HULA 3SB0A 8A3HA 2ZX6A 4C7DA 2Y61A 3NL6A 4O0KA 2HNHA 1H7OA 2CWXA 3WLRA 4IIBA 3MO4A 3H4WA 3VDGA 2JBMA 4AZ6A 1TA3A 3QV9A 3G1FA 2DQXA 3VNJA 4B5WA 2FZ9A 4DJDC 3IV8A 4F0SA 1ZENA 4S3GA 2OSXA 3EBVA 3H2MA 2PS2A 2NX1A 3C2OA 1V79A 3VUSA 1JAEA 1P4CA 2X1IA 1LLOA 1TWSA 1Z44A 3F5KA 3SI9A 3W26A 1DWJM 1UZ4A 3NEHA 2J6XA 1DE5A 4S2BA 4L4LA 1EJSC 3OHIA 4OHQA 1ZLPA 1SMAA 5EKYA 5LNWA 1IF2A 3RU8X 4DXKA 2KAUC 2WQDA 4I6VA 3NDYA 2QMKA 1A5NC 3E5BA 4DNMA 3E74A 2CNCA 3A64A 2E6FA 4HJFA 5JH1A 5CLWA 3PAOA 3KVJA 2NQJA 1AH4A 1QUMA 3NIYA 4GGBA 2P3ZA 4TTUA 4GIYA 1J01A 3LRKA 1H09A 1MFUA 3VNZA 2OYMA 1XUUA 3BAXA 3AC0A 3PZIA 2Y85A 4NJHA 4IMFA 3USBA 1BHGA 1JPDX 3QSTA 2A7RA 4JCMA 2I9UA 1KFJA 2H8ZA 3KP0A 1PIGA 2WZMA 3V16A 3CC1A 4JY8A 4LFYA 2XZ7A 3MSGA 3NSNA 1ONXA 1QPKA 3AI0A 3KBVA 2XIOA 3L0GA 3TSBA 3I7SA 2PU0A 1EP3A 4K6AA 2QAPA 2GWNA 4B5NA 3WFAA 1EYWA 3R5EA 3U5YA 4GNKB 4L4PA 2BTMA 4WVXA 1A3HA 3KVKA 4E3VA 2PDIA 3QV6A 4P8WA 3PHAA 1RY0A 1S1RA 4XZLX 4JBRA 1K9FA 1A3XA 1XIGA 3STEA 1FWJC 2C79A 1R8LA 2QF7A 5EBUA 1H11A 3I7QA 4K8HA 4KW2A 1X6NA 3M16A 5PTDA 3ZMRA 1V3MA 3ECQA 4NT0A 2D0GA 5A6TC 2J24A 1PZ2A 1UWSA 4HP5A 1H1NA 1QNVA 4PTWA 2YCJA 4LYRA 2YL8A 2G3NA 3KOFA 3L5MA 1WKEA 3MKVA 5KETA 1BTCA 2OKTA 1AJ2A 4GVIA 1LG2A 1PL9A 2X0YA 2Y2WA 2WCSA 1NSJA 4CEXC 3S6DA 3LI0A 3M5XA 4E6MA 4RE2A 3AIWA 3AMLA 2A3BA 4KMQA 1HL2A 3ITTA 4Q8WA 1JDFA 1Z6KA 1EIBA 4AX7A 4HHPA 4NJKA 4I9MA 4C5YA 3PULA 4MF4A 2FTPA 4QXIA 4BS0A 4IFKB 1XYZA 1E9LA 3PN8A 2QCFA 1JGIA 3CL7A 3HPSA 5DBTA 1E0WA 4XZWA 4JQAA 3IUIA 4BQ5A 4HHMA 5AYYA 3VA8A 3VKBA 4JNZA 1PS9A 3W85A 3KOYA 3KBNA 4CQCA 2BXVA 4F8XA 3GVGA 1Z3NA 1XIEA 2Y7GA 3WNPA 3CAWA 3W2MA 4HK6A 4EX4A 3CM4A 1XIMA 3TTEA 3GG8A 4WGXA 4XO7A 1C7SA 1T99A 2H3BA 3GNXA 3T09A 1GOIA 3FA4A 1MDRA 4O0QA 1K8YA 1KBBA 1SZFA 1FP8A 1IZKA 5DF0A 3LSBA 4N9DA 1Z69A 3B06A 3GXPA 2IKGA 4M82A 5C7VA 2PB1A 5FEZA 1FWDC 4PTVA 1M5WA 1GJPA 2X2GA 1JQVA 1R3TA 4Z0SA 1V03A 3CQHA 4XBSA 1Q3NA 4DM1A 4G7EA 2RDWA 4GACA 3B4UA 2BOEX 2HXTA 4UTTC 5ABFA 2XIBA 1GVYA 2OLSA 1X98A 1S38A 3MCNA 4ENLA 3IJ6A 3BOFA 2C7FA 4PTXA 2JE8A 3UR5A 1BVWA 1OT2A 1ZALA 1O12A 4M81A 1DJIA 2ZZ7A 4GY0A 3LHTA 1ICPA 3M5VA 2OVLA 1Q4NX 4M24A 3WMCA 3DC0A 1RCOB 1XG3A 1J10A 1QT1A 2E8YA 2WOQA 3OO2A 2FGLA 1KM4A 5DEZA 1I0DA 3PZNA 3CBWA 1KCXA 2DZUA 2VENA 3IAPA 3BMXA 1W3LA 1XM3A 3ME3A 4NHVA 4ZB2A 1AVAA 1AUSL 3SQLA 1TV7A 3TQPA 1OG6A 3KL5A 3AUOA 2Y63A 3TK7A 4JX6A 1CEOA 3BLLA 2BSLA 2Y1HA 3NL5A 3W3OA 3FAXA 3UWZA 4IUGA 2VD9A 2R8WA 1R86A 5A94A 3TU9A 1IEIA 4O8AA 3OLEA 3CNYA 1GG0A 5DT7A 1WXYA 3VC6A 3WLLA 3P84A 1YDOA 1JRCA 1WKFA 5E09A 1DIKA 2WJEA 5G2HA 3ABSA 1V02E 3B8TA 3OZYA 4GUIA 3UD6A 3HB9A 3OIHA 4MZ1A 1LOLA 5I77A 1W1TA 4IP5A 4NILA 4EAYA 1EC7A 1ZJHA 3OZOA 1ISZA 4EK7A 5CC3A 3CZEA 1CDGA 1WUFA 5AKQA 2PLJA 1XG4A 4FXSA 4PUMA 3NJ3A 3H2FA 4FAMA 1NDWA 2VEKA 4AIUA 1PZ1A 1LBFA 3P0WA 4E38A 4M5PA 2RH9A 3ARTA 2WWCA 5BU6A 4PB3A 4B5SA 4I8DA 4DB7A 1RP9A 5CPLA 2G96A 1YADA 3U2EA 3MB9A 3EMZA 4C6QA 3DXIA 4WUIA 1GKQA 1UW9A 7REQA 3LPOA 3T07A 4LC6A 3BJTA 1U33A 2CLHA 1PTAA 3NZGA 4NJJA 4HIBA 4B5VA 2P88A 3W71A 3TWAA 1HFBA 4C6OA 1VBGA 4UTFA 2ZXAA 2REQB 1TPFA 1PZ3A 2Z1KA 3AIUA 3UEQA 1ZBWA 3M4HA 4YPJA 3P2VA 5CPOA 4FLOA 1P0KA 1UKPA 1F5ZA 2ZRXA 4HZ7A 1RJPA 2QT3A 4G6CA 2BV9A 4WHBA 3V3WA 5C54A 4O10A 4MUPA 5D4YA 5BXPA 3EPNA 2J4GA 4KWUA 2I9EA 1XFBA 3N17A 4BY3A 3LZ3A 3KFTA 4S3EA 2OG9A 3QR3A 3A24A 4F3HA 3EKLA 1NDYA 4IGHA 2VCBA 5EBAA 2QW5A 2P76A 4M6QA 3D47A 3UY8A 2QJMA 1MW3A 2OZ0A 3SCPA 5K3VA 2FFIA 4O12A 3B9AA 3SIMA 1X97A 4PSPA 4EACA 4IJCA 5DXXA 1Q8AA 3TQVA 1CTNA 5CCZA 2ADAA 3CQIA 4A2SA 3LX9A 1LBMA 3LV5A 4BZYA 3ANVA 4C6MA 5EYWA 1UR4A 1F7BA 3MUZ1 1KRAC 2J75A 1DWIM 4RDWA 4HNNA 3V4BA 6ALDA 2ZC1A 3GTNA 3UWQA 1XH1A 2XVKA 1WP6A 1WA3A 4UB9A 1HG3A 4FNSA 3HGJA 4PC8A 2WANA 4M1BA 4IJRA 1UJPA 5ABEA 3LGGA 3SAZA 3GD6A 2WWDA 3AHYA 4O54A 3OPSA 4O4VA 4JNYA 5A6MA 1EC8A 3CK5A 3ES7A 2DW6A 1JPHA 1UROA 2D73A 1UD8A 1G67A 1CGYA 2QPXA 3QFWA 3LTSA 3TDFA 1H63A 1E70M 3NNTA 2QUNA 3L4VA 1LBLA 1V0KA 3WK1A 4FR6A 3WLTA 1NVMA 1KWKA 4H8HA 3PP7A 1GOOA 5C7HA 1GYLA 2XYLA 3ONCA 2HROA 1EF3A 4NXSA 1DWAM 3N25A 4LRSA 1PTGA 3UZZA 1VGAA 1ZP4A 4XSLA 4LY8A 3QHMA 3G0UA 4E2OA 5KZ6A 4FR1A 2P8BA 3OP2A 3MT1A 2V68A 3UCCA 3MCOA 1J0IA 3S1GA 1GORA 2WSRA 4ZMGA 4HMEA 1OVDA 1QOQA 4JIRA 5EMYA 5FL1A 4PEEA 1ZAHA 3R43A 5HOSA 4DWSD 2OX4A 3A5VA 1CNVA 3NPUA 3KTXA 1W3TA 1GTEA 1XP3A 2WSYA 5F2IA 4B5UA 3P60A 2ZYFA 3SCWA 2Z29A 3QOKA 2PD5A 5D9PA 4LUSA 3W88A 2PTZA 1F6PA 2V5DA 2VELA 4HPGA 4ASTA 1CYGA 1HKJA 2Z2BA 1RA5A 3QW3A 1V0LA 2YJQA 1DORA 3QV7A 2QPUA 4IXHA 2J7CA 2AAAA 3WEOA 3U48A 2XVGA 4JFWA 2OWCA 2JGYA 3U2ZA 4AEEA 3MS8A 4GJIA 1EJRC 3W86A 3AXMA 3SRDA 5CSRA 1KA9F 3W2JA 1B3ZA 1PX3A 5CC7A 5CC6A 4MYAA 3WUBA 2D3NA 3OBKA 3C3UA 4G7FA 4Q8PA 2PDFA 3WDJA 2QKFA 4IOTA 4JIHA 4JEJA 2EG8A 1RPXA 3QM3A 5AHNA 3ZR6A 1YTEA 5AC5A 4A6GA 1TV3A 2HVNA 5A8MA 1JNEA 4IMCA 1PDYA 1EL3A 1WAUA 3B8IA 4ACYA 4QLLA 1A50A 4XAYA 1T8XA 3R58A 1XV8A 1BXBA 2PDPA 3GNOA 4C65A 4GJ1A 1S2TA 1W1A1 3B8WA 1I2RA 2W66A 2MNRA 1VP5A 3L2MA 1QI2A 2WHMA 2Z1VA 2PWDA 1IGSA 1D3HA 5FAGA 5D37A 1XLJA 2VOMA 4P5UA 4O53A 3EX4A 1L6FA 3LY0A 4A3RA 1F4AA 1P48A 1V3HA 3WELA 3L0NA 1C29A 4REQB 3PZVA 1F3TA 4O1DA 2GQ8A 4Q4KA 2QJNA 3SADA 2WYSA 4JY9A 3C56A 3KW3A 3N13A 1H1YA 3UGVA 4UBPC 3AYRA 2H9AB 3A21A 4ICMA 2H6RA 3SUSA 1D3CA 4V1YA 3GNPA 5K9DA 3WQPA 4KCTA 1YRRA 2VGIA 2PWHA 1ZU8A 1ZBVA 2FB3A 4Q22A 3FHAA 2ZVRA 2V30A 4E5TA 3MCMA 3LQGA 4H41A 3QKEA 4LU0A 4YN5A 3AXHA 2DSKA 4CQAA 2GFTA 2RJHA 5LA0A 3S1WA 1A5UA 4X2RA 3N2TA 5I78A 4R88A 3NURA 4AD3A 4LQ1A 1E5NA 4OUIA 3UG8A 1Q66A 3NL3A 3PZGA 5FJUA 4EAMA 1XBZA 3WIJA 1TQJA 3W81A 2ZRVA 3ZR5A 4KEVA 2PZ0A 4Z1CA 5HMDA 4LC8A 3NL2A 1WE5A 2WNWA 1LJYA 1OX5A 4L9XA 2CERA 2DT2A 1T6MA 1S5NA 2ISWA 2TMDA 1CB7B 1M01A 3SGZA 3CIXA 1EZ2A 1YDVA 2O9RA 1LROA 1DXEA 3K1GA 3W53A 3VNDA 3MVTA 2ZX5A 1TE6A 3P0XA 4UR8A 1QNSA 2CHNA 4H8NA 1J18A 2J7GA 4FPSA 2J47A 4L1GA 5CC5A 3GC2A 2A6NA 3ZVHB 2PDBA 3NO1A 5A3HA 4I9AA 2DV0A 4RXFA 2VO5A 5D04C 3W7RA 1JXKA 1XRVA 4S1FA 2CLPA 5CGMA 1UZDA 2OQYA 3TQKA 1LRNA 1YKWA 4YTRA 3GZ3A 1BF2A 3CIWA 3M41A 2QUTA 5C2XA 6PTDA 3WBEA 5JIWA 3PNZA 2E0PA 4IGMA 4QROA 3UVAA 3VX1A 2OGYA 2RJGA 3TP4A 5A6SA 2Z2AA 3C52A 1JR1A 4J3SA 3QPEA 2GK1A 4IFOA 4MB3A 2EPNA 1RJRA 1DJGA 4MWAA 1UB3A 2VEGA 4Q8QA 2YL9A 1RK5A 4HTYA 1LG1A 2XIQA 3TW9A 1ITUA 1RVKA 4HNCA 1C90A 4BI6A 1I9CB 4BF9A 4GHRA 1H7RA 1Q2RA 3CHCA 4W7WA 4AF0B 3VZZA 4E3TA 3GYCA 3VFLA 1CGVA 1DBTA 3N4FA 1KM2A 4CCCA 4PCFA 4D6FA 4O17A 1B3OA 4ADSA 3G0SA 5DANA 3T40A 2CCRA 4J27A 3MI2A 1VAHA 4O52A 3CGTA 3PTMA 4H9XA 3C5QA 2WQPA 4KF1A 1E9IA 1TJRA 1TTJA 3CT2A 3UNTA 2OLAA 3M0XA 2Y89A 1XGEA 4IUOA 1UWAA 5FCZA 2YXGA 2VQTA 1MYRA 1I1WA 3W87A 4YLWA 3F4VA 1OD8A 4GIRA 4PYSA 4TVUA 4MJZA 2PLMA 3NGFA 3VKKA 2R24A 2OSYA 1ZTVA 4RDYA 3ICJA 3B8SA 1N8WA 3BOXA 1E0XA 1BTMA 4IPPA 1SR9A 2FYMA 3UPWA 4M7SA 3THCA 5C9WA 3L21A 3DERA 5EL1A 3ZFHA 4CD5A 4IL0A 5AYXA 2I7GA 1VD6A 5B80A 1Q6QA 2C0HA 3HPXA 3R8GA 1TTPA 3EOEA 2GDUA 3DX5A 1W9UA 5HNNA 1G01A 3WY1A 3FCPA 2V8ZA 4NZ5A 2DP3A 1GZ1A 1R87A 1PE1A 1BWLA 1OGGA 4QQ3A 1XRSA 4C6JA 1V6VA 3LCLA 1REQB 2O55A 1R85A 1ZCCA 3DHFA 5I3GA 1HGYA 3LPFA 3HPZA 3VD5A 3KS6A 5FSEC 3WLJA 1ZPTA 1WAWA 3MA8A 4LVAA 3E96A 2X40A 5CJ5A 1V6TA 2TODA 4G8TA 3SFWA 4OECA 2WMHA 4AD1A 5AYZA 1QDSA 4O14A 3BV4A 2CESA 3VXGA 3S4TA 4LAZA 5HR6A 2ZFAA 4HQVA 4MUZA 4GNVA 1R3WA 4FIQA 3CWNA 1D8CA 3CQ0A 1XBVA 2JGQA 3OW1A 1JPKA 2GDVA 5H91A 4ZOBA 4GK8A 2PGFA 3JU2A 3OQEA 3Q4DA 3W1TA 3K4WA 3KZSA 2I14A 4YJ5A 2VURA 2W91A 3D3AA 1XSIA 2PTXA 4H6EA 3RX2A 4NX5A 1US3A 4TQTA 1MNZA 4QAWA 1PKLA 4HNUA 1VFSA 1N55A 4UOJA 1CT5A 4LUTB 4TOQA 2EQDA 4ZO6A 4C6IA 1C92A 1M7OA 2O56A 3O1NA 4Q8MA 4CU6A 5KZMA 3EWXA 2HS8A 3HQ1A 2F2KA 3SUVA 3UETA 4EF8A 3NYDA 3BSMA 4Z1BA 5FEXA 3FYYA 4AVNA 2NVCA 1TB3A 3NDOA 5FAJA 1BQGA 4JCLA 1QHPA 3THDA 5CZJA 3MHUA 4NYUA 1X1ZA 4WDTA 4LX4A 2VD8A 3SGGA 1QWGA 4QJ1A 4PCTA 3K2GA 3DYPA 1K8CA 4HYRA 1SPQA 3UXAA 4MZYA 1S5MA 2DZAA 2J9XA 3CAKA 4F40A 4H7CA 3A47A 1QHZA 1S2UA 5HJLA 1XQKA 3SRFA 2VNCA 1YBQA 3NQEA 4AH7A 4MADA 3WJSA 2CYGA 3EXRA 1E6RA 1H62A 1F8MA 2ZZ1A 2DIEA 1HJQA 1UUQA 4MNMA 1SO5A 2HEJA 4BI7A 2QDGA 4HMNA 4M1RA 5D2XA 4ACZA 5DMNA 3W7GA 5BWFA 3EX3A 1BEUA 2QJIA 4LVDA 2NQZA 1Z89A 1ISYA 5BYWA 3ITYA 4ADUA 3GWQA 3WQ6A 2GUBA 3PK7A 1KM1A 4LF2A 3O63A 4I7WA 1BWVA 4RDZA 3AMGA 4DUWA 2WVTA 3I4EA 4PL1A 3KBMA 2R91A 3BL3A 1D2KA 2DJXA 4IJBA 1PX4A 1JD9A 1E72M 1VBUA 2WZHA 3Q37A 3RFAA 3MPGA 3H2CA 5FJOA 3BZJA 1VJZA 4NAEA 2XN0A 4ZO8A 2CZ5A 1GUVA 4W87A 4EKJA 4H9VA 2EGZA 1DQWA 1H61A 4QDMA 2X30A 3S42A 3U4FA 1FFQA 1GVEA 4AXKA 1WDQA 2ZDRA 4JX4A 2X0HA 1EEPA 3LG3A 1ELSA 1SO4A 1M7PA 4ZQCA 4MFDA 4RLIA 3LN3A 5BZAA 3QMRA 1G0CA 3SECA 3WLSA 1XCFA 2ZKMX 3QPYA 2DSUA 4WX2A 3WEZA 2CETA 4GI4A 4JGDA 4G1NA 2JEQA 3Q2DA 5D2YA 1UOZA 3KBJA 4QAIA 3SY1A 3FN9A 1EC9A 2IUZA 3QHOA 5T9BG 4DJFA 1ME7A 1SJCA 4D1IA 3OVQA 1JD7A 4PFHA 3WQGA 1I2QA 3G8EA 3TQ0A 3GTHA 3MZNA 2XTKA 3UWEA 1YHTA 5D9NA 1HF6A 2J6VA 4KIRA 4QM1A 4ZL1A 3FGCA 2W92A 4FF7A 4KFPA 5A5WA 1FY6A 5IM51 3HGRA 1OZMA 1GQNA 4F0RA 2R94A 1U83A 3G77A 3ZXWA 3XINA 4TVCA 3W7OA 1DEDA 3SUUA 3KXQA 3VKJA 1TJ2A 1TA3B 3UXIA 2ZE0A 3DN5A 1DQUA 3TA6A 4JTSA 3EA1A 2QUUA 4F0HA 5G2IA 1IE7C 2PF0A 2MANA 4HHHA 4AD5A 4GABA 2HPMA 4RKAA 2QV4A 4KWWA 3OVRA 3CH9A 1RAKA 3O0FA 3HGOA 4UTWA 3PUEA 2R82A 1OFAA 3VMPA 1N2VA 3VIMA 1H1ZA 2ZA1A 4FX7A 4UR9A 4PMOA 4JTCA 4S3AA 3HG5A 4ZCWA 3ZT7A 2BHYA 3LCXA 4S2CA 1TV8A 3VOJA 1Q4WA 2F6KA 3SURA 1BSIA 3NZPA 3R0UA 2CHOA 2Z25A 1ZJAA 4MB1A 4AVOA 1JRBA 3MI6A 4AUBA 5FF0A 2BS9A 1CGXA 4KKXA 4LSBA 3PUDA 5H8UA 5BRBA 4B2DD 1XYFA 2VUNA 4R34A 4D6IA 1ADDA 1KXHA 1F07A 1XIIA 3TAKA 3S9ZA 2CZDA 4DWDA 2NW0A 4JFSA 1JUBA 1TMHA 1EJVC 2FMNA 1NOWA 2VDGA 2ATMA 3DG6A 2W27A 3LK6A 5FJRA 3BZGA 3TYAA 3WJYA 4FO4A 4LNCA 3ZR4A 1SFSA 4BQ2A 3S6OA 1VS1A 3RIKA 3LLDA 2NXIA 1ECQA 4O11A 2V38A 3LPPA 1LCOA 1OADA 3TNBA 3KRUA 3NG3A 2AKMA 1L9WA 2E1DA 3T44A 4ONVA 5D02A 2VM8A 1OFEA 1TIWA 2VC5A 2WSPA 1JYWA 3CEPA 8RUCA 4Q4QA 3A5FA 1TZ9A 1JZ6A 3DUGA 1JFHA 4N4QA 2FPYA 3W1PA 1WDPA 1XWYA 2A21A 1BGGA 1DIOA 4WKHA 3ERPA 2O92A 3B03A 3NAVA 3F5JA 3UNDA 4FALA 1QFEA 5HR7A 2WSQA 2HE5A 1BD0A 5CJMA 1PHQA 3FFSA 4HNVA 2E6DA 1DHPA 2E6YA 3BUVA 2XINA 4AHOA 1X8CA 3P8JA 4QE1A 3S8HA 4US5A 1ZAJA 2Q8ZA 2DZSA 4HZ8A 3BCJA 3ZOAA 5E0KA 4FF5A 1LL7A 3L65A 1WKDA 2H8XA 3MMUA 1UIPA 4CQDA 1CZ1A 4GBDA 3KOZA 3QGAC 3GVWA 1PYMA 3AAMA 1EUAA 1RJQA 3DYOA 3B40A 1S5WA 4Y9MA 1ZBKA 3E0WA 4XD3A 5ENLA 4ZE4A 1C7TA 2XSAA 2FJUB 1QW8A 3LXCA 4DXXA 1I45A 1J0KA 3W27A 3RAOA 3F2CA 3LA4A 5DBUA 1V8EA 4Z2HA 4AW7A 3D5HA 5FKYA 3VIOA 5LIWX 4JTGA 4AZCA 4V15A 3NTYA 3LTYA 2HRWA 1RLDA 4EXBA 1K6WA 2WMJA 1FH7A 5CG0A 2ZRUA 4HVXA 5C9RA 2H90A 3DKLA 4CQBA 4KERA 1O1HA 1H41A 2Z6IA 3C2RA 3NPWA 2BLEA 5HATA 3IVSA 4P8VA 5AHMA 3BPWA 4UCFA 1AW2A 1A5BA 4D72A 3BAJA 1CLXA 3TR2A 2B7OA 1P0BA 3NQAA 2V2HA 4J5NA 5T26A 1S1PA 4QNWA 2FFCA 4ES4A 5HJYA 4FOUA 1PWLA 5K4XA 3GXIA 4HNLA 4G7EB 4XIMA 3NQ2A 4Z0JA 4WF7A 1HKKA 5ABFB 2V5LA 1OYBA 5A8NA 2ZX8A 4QCEA 4A8RA 1RK6A 1IR1A 4LYKA 3UJ2A 4JTDA 3FJ4A 5F4XA 2ALDA 5E1QA 4LWWA 2WV8A 2ZADA 4W84A 2OPJA 4Z17A 3FA3A 5A6BA 3CHEA 1MXSA 3UWYA 1J0HA 3TW6A 1QASA 3NQ8A 3RGTA 1U5HA 3GU2A 1XIFA 1KR1A 3WF1A 1WNOA 1CB2A 4Q4RA 5I3DA 3G2GA 3LTPA 3AMCA 1E6QM 3W1RA 4LOCA 8XIAA 3LV6A 4AIBA 5HMFA 3CTLA 1X39A 4UFHA 4D8LA 3RM4A 3LBCA 2FB2A 2YDSA 1JYNA 3GS6A 2OO6A 4GH1A 1A5KC 2RDUA 1VYSX 2VRKA 2E5BA 3V0UA 3WFLA 1QATA 2G95A 1DQXA 2X42A 2P53A 1BRLA 3AHVA 1W5PA 2V3GA 5KZDA 2YCKX 5TIMA 1QWKA 1SUXA 4RNHA 4KEMA 4POCA 1KXTA 5I09A 3PWAA 4S39A 4U5IA 1LUCA 3NQ7A 1Q2SA 5LYRA 2YXXA 3K30A 2D24A 4HPHA 4DUVA 5MHBA 4GVHA 3G1RA 4L4MA 2NZLA 3N2XA 4JDYA 3QBUA 2HK1A 3P6LA 2V2DA 3RM9A 4UUIA 1PYFA 2YFNA 4C6LA 3UP8A 4MM1A 3GNNA 4RXGA 1SZEA 3F5LA 4ZZ9A 1UG6A 3GB6A 3QVQA 3W75A 3IJ7A 1OWQA 3NOEA 3WNLA 1B3WA 2YIHA 1UJQA 1IR2A 1I75A 1HGWA 3K8KA 4JNMA 7REQB 4GRSA 4C6EA 3TE9A 2NUYA 4Q7IA 1QPNA 1MQRA 4NASA 1UMLA 1QW7A 3RLVA 5HDRA 4JHMA 4INFA 3PWGA 1OM0A 4QEHA 4TV6A 3KBSA 4RX0A 1PDZA 1X7IA 1V0MA 3IIVA 2V5BA 1RZMA 2QEZA 2QCLA 4U3CA 4TXEA 2NVDA 3GAKA 3USZA 1VCGA 3IK2A 3PJXA 3UYIA 5JIPA 1EGVA 3CASA 1BF6A 4AG0A 3N9RA 1OBAA 4FB7A 5FF7A 4IT1A 4DQWA 3NVTA 3TAOA 1V51A 1NOFA 1GYMA 4HD5A 4PR4A 2AMGA 2PF8A 3DHDA 1UC4A 2VEPA 4UTHA 3LM7A 3W1LA 1QI4A 1GKPA 3LXBA 1US2A 2QAFA 1NP2A 2VFFA 3CUFA 3QRHA 3OYXA 5TBOA 3EAUA 2F9RA 4H7ZA 4F4RA 1M41A 1WV2A 3HU7A 2NT0A 2WJZA 3V36A 1P1XA 5A95A 3OG3A 2XVNA 2PGWA 4MY9A 3FA5A 4DI9A 3SCQA 1AODA 1PVNA 1EQPA 2ACUA 3SW6A 4QCFA 1UR8A 4UTMA 4ZVJA 4K7YA 5JH2A 4WXZA 1JZ7A 4O19A 2Y7FA 1FH8A 2PDGA 1K77A 3VILA 1D8WA 3KEHA 4D6HA 4B15A 4HSHA 3TYUA 1TCMA 2YDQA 2Z0IA 2XU2A 3VZYA 2JKAA 1IV8A 2VX5A 2ALRA 1ALDA 5BWAA 1JZ2A 2F6UA 2Y7EA 3SEPA 3WDQA 2B7NA 1XSJA 4LUYA 1TV5A 1N7KA 4F2UA 1G4PA 3ITGA 5EY5A 1TWZA 3BGJA 4HJWA 1HKWA 5M03A 2WKLA 6CGTA 1W37A 1RBLA 2BP1A 1WDWA 2W62A 3ZSSA 1KCLA 3CLMA 3TR9A 3WMLA 2QCNA 1LWIA 1XIBA 3UZJA 2GUUA 1FCUA 5CSUA 4LPCA 4AZGA 3RYSA 4ZTXA 3TN4A 2VTFA 4RUBA 4CD8A 3DFOA 3F7JA 4GI8A 1A5MC 3LB0A 4HN8A 2X41A 3V1PA 5A6BD 1VPXA 1Q5MA 1XBXA 1W9DM 3LNPA 3BCDA 4GE8A 3H26A 3KDOA 2EF9A 3R25A 1GK8A 5IRPA 3Q45A 4GLEA 4F9JA 4XZHA 4CLMA 2G50A 3BJSA 2EG6A 1T0OA 1VIZA 3KRBA 1RD6A 2O0TA 1UP2A 5FJIA 4AZ5A 3U2OA 2ZA3A 4PRRA 1S3HA 2NX9A 3A22A 5DO8A 2ZE3A 1Q6DA 3GW3A 4JIIX 4LUSB 3RLGA 3BGGA 5I3IA 4JN7A 4FNPA 4Q4PA 4ROQA 1MEWA 3FXYA 1E6PA 5AHEA 3DBNA 3BLFA 3ES8A 3SJ3A 1RBAA 4XBJA 2FQIA 4N4PA 1HIZA 2GZXA 4OE7A 1UD3A 3GG1A 3LCGA 2E5CA 1KO0A 1VIWA 4ZOEA 5C2GA 4QS6A 3FNDA 4MFEA 3NZ1A 3VIGA 3ITOA 5FD0A 3BXWA 3I10A 3MKCA 4GUJA 1K9EA 3BSHA 4HZ6A 1MMFA 1MUWA 1F3XA 1FWNA 3CV2A 2YLLA 3FKRA 2JIWA 4W8BA 2ZCGA 3WF4A 3OQ8A 3TV8A 4QJ4B 3MV01 3TJLA 1W1ZA 2QDHA 4W89A 4JN6A 1KGXA 3H2EA 1HW6A 3AXXA 3NFUA 4DELA 3IWPA 4W4QA 3PWIA 5CBIA 2WMGA 1TVLA 3EMQA 2UBPC 4BWLA 2EKGA 1V3JA 2YL6A 3MJYA 4GVGA 3W00A 5JU6A 3C2FA 1DL3A 3U5UA 4ZXOA 5AOUA 2ZICA 3UG4A 1DE6A 1OINA 3B0XA 2BY2A 4EXQA 1WZKA 4UTLA 2WMFA 2ZZ4A 4LXFA 2WXDM 3ZJ6A 5CGTA 4FLRA 4YNGA 1CENA 4BFAA 5HQLA 3G6LA 2V3FA 3UG3A 3UWVA 3SDOA 4CGTA 4FMVA 3CYVA 2OELA 3TN5A 2VR4A 3T1GA 2NX3A 4M0XA 1W5OA 4AY7A 5H2ZA 4YVVA 1HVXA 1GPFA 3GR7A 3CMGA 5A2BA 1AL7A 2E67A 1BAGA 3F4CA 3VTRA 4DUXA 2DDXA 1LL6A 1H0GA 3WH8A 3H7RA 2NLIA 5D8WA 1TVPA 4U28A 4IH3A 4E8CA 4WIWA 1CECA 2ZUVA 3HM7A 1Q6RA 3B0VC 4IQLA 4BF7A 2HMCA 4HA3A 1MDLA 5CSYA 4WOQA 3N12A 1TKKA 3EPOA 3UT0A 1K8XA 1W9XA 3BARA 1XQLA 4PODA 3SSJA 1A5SA 1AH0A 1E1FA 4DZIA 4CVWA 2ZUNA 3U4AA 5A6KA 4FHAA 3C0LA 1RA0A 3AYSA 1O4UA 4MWAE 2W63A 1GT8A 1NF7A 1TO3A 5EPDA 1UH4A 4CNTA 3FSTA 1KXVA 1W17A 2Y88A 5FF4A 1JDAA 5EA9A 2EPLX 4KPLA 2AMXA 4NRRA 3N29A 4HKPA 1H7XA 5J04A 1GJUA 4QBXA 3U6WA 5I7GA 3G6MA 3EOUA 3C3NA 2G4JA 3M47A 5TQLA 1EHAA 4AQLA 3GNDA 3OGRA 4B4HA 1SQ7A 2BB0A 2XJ7A 2W79A 3LZ5A 3UZWA 4NU7A 5IXEA 1G4SA 4QE4A 1EBHA 4PBFA 1GG1A 3TSDA 1KM0A 4LANA 3W6YA 4PMUA 1K4GA 3VUPA 2PRLA 4Z2LA 4F48A 5A6AA 3GR8A 4WY0A 4NZ4A 4AB4A 2ACQA 3WNOA 1GQLA 4GXWA 2EPKX 1V0NA 4QSHA 4XAZA 1HKMA 3ANYA 1AJZA 3GLCA 3VYLA 5HA7A 5BRPA 3NO3A 3TTOA 4R33A 4OV4A 3BURA 2GK1B 3LCWA 3WQ4A 3C6CA 4MWAB 1PJ9A 4UQEA 2YL5A 1ZCOA 1CPUA 3UU0A 4PB4A 2HJPA 3AMKA 3PPFA 1V6UA 1KGWA 3HTWA 2VP8A 1JPMA 2WKJA 1KKOA 3FSUA 3U0HA 1UKOA 2Z1WA 2J78A 5EMLA 4Q8VA 2INZA 1NFPA 3UXDA 1H2JA 1XXXA 4JTIA 2I16A 2YCIX 4UR7A 1GVSA 3WUFA 2E9MA 4AMAA 5H6HA 5DMLA 4TMBA 3OTRA 1YQ2A 2A6LA 4RNFA 1EH9A 2BDQA 2X1UA 2JFEX 4M56A 2BY1A 3W7DA 2KZHA 1R30A 3C8FA 4AMCA 2Y70A 3JZEA 1E56A 3TYEA 1GOMA 2J79A 8CGTA 3GKFA 2QR6A 3F1QA 2V0TA 2PDYA 3FJNA 2DUXA 4CCEA 1VC4A 2C8NA 2LLEA 2C1IA 2E3ZA 3QEZA 1VFTA 1U1HA 1K6AA 1IT8A 3PFMA 3M0HA 1O94A 4J3TA 4Q8TA 3E38A 1IXOA 3PNUA 1V3LA 1WB0A 2C13A 3UWUA 3VE9A 3NDZA 2A3EA 2CW6A 2QULA 1S2AA 1TUXA 2IPGA 2TAAA 5D2VA 5CPSA 4Y96A 4A29A 3AZTA 4HCDA 5L9FA 4JYDA 1CGTA 4HCHA 4RZ5A 1MEIA 1ECEA 2YDAA 3OOQA 5A6JA 3TJIA 3GH5A 4BCEA 3DC8A 1VF8A 2PDNA 3AQUA 1VRXA 1YNYA 2GSHA 2IPJA 2A0NA 3RILA 4PMZA 1HJUA 4CCZA 1TSIA 2A3LA 4CD7A 3DZ1A 3KZPA 4F2TA 4BQ4A 1F2JA 2A5HA 4A3QA 5I3KA 4XSMA 2CBIA 3W7HA 1QK0A 3UR7A 1VBRA 2CLMA 1UR2A 1HJXA 2C1HA 1AD4A 1UHVA 4ZEPA 2W6RA 2Y4SA 2TSYA 4C6CA 4E2VA 3WJZA 1KXQA 4H3DA 3ARXA 6TAAA 1FWIC 2OR2A 5IBXA 1CXEA 3Q94A 4DF0A 2PDLA 1KRMA 1F05A 1R2RA 2VX7A 4JTHA 5M5DA 1BXNA 1MZHA 2AGTA 3LBOA 3CMFA 2HSAA 2PDJA 2RFGA 3HQPA 1P7TA 2YB1A 5JQ9A 1J12A 1SU5A 4P7RA 3UJFA 4G1KA 1R9YA 4DJDD 4Q33A 4H04A 4NG3A 3BMVA 4H2HA 2G37A 4ZSUA 3EKZA 4UCGA 4LBRA 2YX0A 2VI0A 3SCRA 3IK4A 3O05A 2P5NA 1EGZA 1FWHC 3OU8A 1IWBA 2IQDA 4JL1A 1LQ0A 2GGEA 1R3SA 1EXPA 3W9ZA 3M1ZA 5LA1A 4J28A 1W1IE 3QC0A 4GINA 5CLTA 2O9PA 2VFIA 3FAWA 2XGZA 1DYSA 1VZWA 3NO5A 4HGXA 1TRDA 2ZXBA 4UNLA 4FNTA 5H8PA 3U8GA 5CG7A 4QDWA 1V6YA 1JIBA 4YL2A 1B5TA 2ZUWA 3SUTA 1EJTC 1HP4A 4LCSA 2R14A 1I2NA 2AL2A 3GYEA 9RUBA 3WBWA 1VH7A 3KCLA 1F73A 2O9TA 2WBGA 4DF2A 4AD2A 1DPMA 3N6JA 1RCXB 2OO0A 2GLKA 1VJSA 3AALA 3O15A 4DBWA 2PWEA 4XKYA 3WL0A 2FIQA 5TF0A 4XUYA 2A2IA 5K4ZA 4J3XA 1SZGA 1FHLA 3WCZA 4GCAA 1UWQA 3MI3A 4AZIA 4EXAA 4TR9A 1J79A 3CPRA 3TTYA 1F6KA 4X9YA 4AIOA 1OC7A 4OZOA 1XUZA 3DHPA 1NFBA 5LZLA 3LGDA 3IIPA 3OZPA 3GU1A 1R9XA 2GWGA 4GISA 2XUCA 4E0CA 1OC5A 2NQLA 2VKZG 4NYYA 3TMLA 1GEQA 4MB4A 4JKKA 1PO9A 4LW7A 1OCJA 3ANUA 4AWSA 2E40A 1QK2A 1G94A 2GVLA 4QITA 3EWCA 4O0ZA 1LOSA 4DBUA 5MKGA 2J88A 5HNRA 4JQ4A 2XH0A 3BANA 3T0TA 4GC3A 4NAEB 2J62A 4JPGA 2HE8A 1NF0A 4MWAC 5LHFA 4M8UA 2D69A 1UMYA 1TPVA 2DSWA 3TSMA 2BY3A 2GDQA 1PTDA 1KGUA 1OX6A 3V5OA 2PDCA 4UQBA 2J7BA 4GYFA 4GZJA 4PCSA 2IKHA 4ADTA 1BYBA 3UZYA 4NY2A 3RM8A 2PRMA 1GOXA 3BVJA 3TYZA 3DECA 2FPTA 2J77A 2QCEA 3MUCA 1SMDA 3L4UA 2FZNA 1JYXA 4LTSA 1JULA 4QEEA 1YXYA 3MY9A 4DPPA 5I02A 1FHUA 1M7JA 4S3CA 1ZZMA 4L56A 4NL1A 3ALGA 4ORMA 5HWMA 2DZTA 2O4MA 1UBPC 4WSHA 4MJMA 3UR8A 1DJWA 4XZ9A 2GYIA 2IKIA 1UQYA 2YZ5A 3EOOA 1VLWA 3GH7A 4LAMA 3FDKA 4KEZA 4MGGA 4IFKA 3GIQA 1WKYA 1LLWA 3N4EA 4QFUA 3RLHA 3UJRA 3FGCB 3R4IA 4RK8A 4OJYA 2XIIA 4DYEA 3AS0A 2PDKA 1EF2A 4RE0A 4M51A 1VBHA 1L6GA 4RV8A 3ONBA 2ZXQA 4LB3A 3W2UA 5C6MA 4LS2A 1W0MA 2A7NA 2QCDA 2VCAA 5LHEA 1GNXA 4M6UA 4NZ1A 3R0KA 4UC5A 4OBTA 4CUCA 1AFSA 4CVUA 4IXXA 1L2UA 3FYPA 1XLEA 3QGVA 4KESA 4PBGA 3WH6A 4IX0A 4NSBA 4C91A 2NVAA 3ZZ1A 2TPSA 3DBPA 1AQMA 3EWWA 1XLDA 5LNUA 3WLHA 4W5UA 2XH7A 4UOZA 5DMMA 4FNRA 1AD1A 4MLJA 1HNYA 2V6AA 5FIPA 5DT5A 4LBSA 4M29A 3REQB 4YYFA 4PUDA 5XIMA 4FLQA 3VMOA 5C9XA 1QBBA 4FX6M 3LLFA 3BE7A 1OK4A 3NXLA 2HZGA 4WJ8A 3GH4A 4JTLA 1QMLA 4H83A 1KM6A 5D03A 2GJXB 3UY7A 3CL8A 4H9UA 1O5QA 3EEZA 1TR9A 1WPCA 4Q4SA 1OFRA 3LI1A 3T6CA 3OA3A 1EOMA 4XZNX 4P2VA 2WC4A 3LRMA 4NUWA 1A0DA 1ADOA 4LGXA 3T8QA 5XINA 1FRBA 3TJXA 1YYAA 3FY1A 3V7PA 3NM1A 4QJ5B 1LORA 3WBAA 5HUPA 3PBYA 4UWMA 4IQDA 3O6YX 2XWDA 3AIQA 2GOKA 2PA6A 2CLFA 1JNDA 3TC3A 2ZA2A 3CV6A 2G3FA 5KTLA 4Q6JA 3VDBA 3AZSA 3T0BA 2RAGA 4F66A 1UH2A 1KBJA 2J27A 3SQSA 3E2SA 3BDKA 3T0CA 4GNJA 3CTTA 3GO2A 5BNKA 4WJXA 4PH6A 1TRIA 3W76A 3SSZA 3DG3A 2OCZA 3NQVA 4YTUA 4J3UA 2D2JA 1UZHA 4LY4A 1PKMA 4QLKA 2WW5A 4GG9A 2A7PA 2YA2A 1Y5XA 3GDRA 3PB0A 2J7EA 4JYEA 2Q71A 1NIUA 3BLIA 3EDEA 3GM8A 2YCEA 3B04A 2BMBA 1GQJA 5FJJA 3N19B 4JTFA 3EDFA 4L64A 1V6WA 4P61A 2OEMA 1U2YA 3HBLA 2BVYA 3JUGA 4QLJA 2Z27A 3VZXA 3MP5A 3CXOA 5EMUA 1J9YA 2E09A 5C9UA 1H4PA 1J8VA 3MQTA 1BLIA 3DH7A 5F2MA 1E55A 1EB3A 4PMJA 4PGLA 4X2PA 3GE7A 1S39A 3JR2A 4ERGA 1ZL1A 2PDXA 1BKHA 4XISA 1A5OC 3VI2A 4L1XA 4PFMA 1FOBA 4M3PA 1RVGA 2E9LA 1NQKA 4MJ2A 1JGMA 4FXRA 5LIKX 3AHZA 3H2NA 1X7FA 1EA0A 3IEBA 3BLOA 1TCDA 2XG9A 3TNOA 4IG2A 1OEPA 2R1NA 5JXQA 3T9PA 1YIXA 3O6AA 3W73A 2QLYA 3F4WA 1V02A 4JDBA 1JUKA 1P1MA 1RR2A 3UPMA 1XRFA 1TTQA 2YBVA 1IWAA 5IHSA 1EDQA 3PC0A 2RGLA 3KWSA 3R0DA 1L6SA 4Z42C 4BI5A 2CITA 3VINA 5K9CA 3II1A 4AYSA 3QZEA 2FJKA 4MAVA 2A1YA 2FGBA 1T5AA 3PSWA 3W1NA 1AMKA 2VFHA 1H7PA 2DT1A 3M0KA 4PBEA 1GJWA 3LHYA 4A35A 4QSFA 4NZCA 4NNCA 3GFYA 3WMBA 4R7JA 5D9MA 1MNSA 4HHLA 3ARYA 2F7FA 1GKRA 1MQQA 2DIJA 2HXUA 4DJFC 3EX1A 5CPNA 3QV8A 4F0LA 2DJLA 3W84A 1E71M 1R0MA 3BQ5A 3LUTA 3AIBA 5I3FA 4N42A 2D1ZA 3H23A 1HX0A 1OX4A 1ML1A 1EJXC 4RPQA 1TREA 4FEZA 3K8LA 2BZNA 1POJA 2BGQA 3HG4A 2DSVA 3WN6A 3L66A 3TFXA 1GOQA 1FA2A 3W72A 4K8EA 4J7RA 3PZTA 1UCWA 3C0SA 2XIMA 1Q63A 1E6XM 2CZEA 4PN2A 3WF2A 5KMYA 3K46A 3M5YA 3T0AA 3HPFA 1A4MA 3GHTA 3LS9A 1R9ZA 3IGSA 3HA1A 1UIOA 3ATYA 1GWJA 1EWEA 3M6YA 5IFTA 4DAFA 1HP5A 3GK0A 4UOQA 1RCQA 1YPXA 2XGIA 3AISA 1Y0EA 1H50A 1TPUA 3CS2A 4HZMA 3WDHA 3LCFA 3HO8A 3DGRA 4N9CA 3HMCA 3WLQA 1AZ1A 1Q6CA 8TIMA 1XIHA 4RV3A 2VFGA 4JOMA 5CJNA 3C0JA 2XH2A 3GRIA 4UTWC 4K37A 4TX6A 1NELA 3M0IA 3AIVA 4KH2A 3WLMA 4ZR8A 1N82A 2VC7A 3O06A 4XWUA 1QI0A 3MHFA 3PR2A 1FWRA 4N7QA 3R2GA 5AVNA 4MTVA 3IGHX 4AZ7A 2W4XA 1MI3A 1GOWA 1WXZA 2PBGA 3ENLA 4Y2WA 2B7QA 1BRLB 2FHCA 3TJ4A 3M5ZA 2WJDA 1GVIA 3RPDA 4BJHA 3CH0A 1IZCA 2YBTA 2C16A 1LUCB 2TYSA 1EPXA 4DWSA 4XUGA 2GJLA 3W6LA 4L5ZA 4MDPA 4L6DA 5HQEA 4CKQA 4J3ZA 3CAVA 3GXFA 3NQBA 3OGVA 1UPMB 4AEFA 4HU3A 5HBFA 2QNEA 4AY8A 2YKKA 1OCBA 1EX1A 3STFA 3FX4A 5EGRA 1TPC1 3AYTA 2IXVA 1LF1A 5JMUA 1FH9A 3MVIA 4JFUA 4X61A 4QG8A 4IQEA 5EMKA 4ZB0A 4H2CA 3MO7A 2A79A 4RE4A 4UMAA 3CWOX 1XR2A 3EZ4A 3GC5A 2YB4A 2HDJA 3TUUA 3WQFA 2IS7A 3KS5A 1U5VA 1J93A 2YA0A 3ARPA 4H01A 1EDTA 3U9IA 2QMJA 1L6YA 5I6SA 3KLLA 1LZOA 1GW9A 4N9BA 2ZUMA 4XVDA 3W37A 2CEQA 3AXIA 3VIPA 3WD2A 2EAWA 2JALA 3GAYA 4HN4A 4S3DA 3VKDA 4LRTA 4XZIA 3BLEA 1MEHA 4X22A 2BGNE 1OT1A 2G3MA 1KR0A 1Z8AA 2PU1A 4YHEA 3DHUA 3VGBA 2I5QA 2OX1A 4AC7C 1SFTA 5D38A 1Q7MA 1M7XA 2WVVA 1Q6LA 2X0SA 3L9CA 1ZP3A 4DN1A 4PMRA 2P50A 4WKAA 4MZ8A 1J11A 4X9SA 1GEHA 3QGKC 5DQPA 3W38A 1JXJA 1ONWA 4JHZA 4ZOCA 2UZ9A 1HO4A 1KCZA 4LVBA 1SSGA 2EXOA 2D0FA 5FSDC 1D9EA 2G0WA 2W3ZA 2Z4GA 1PHWA 3SN0A 3S5SA 4UTJA 1ISWA 3RLUA 5BU9A 2ODOA 4Q8NA 3TH6A 3LQLA 1OIMA 3DDMA 3MMDA 2A3HA 2FZMA 2VMFA 3PJUA 3OIXA 2AQWA 4RR4A 1KWGA 3WQOA 5FEWA 3LLXA 3RK8A 3RO6A 1AW5A 3S46A 4XD6A 1UWRA 2HTMA 4Y8EA 1L0PA 1J6PA 1XS2A 4WEVX 3SZ8A 2F38A 3CAQA 4QDPA 3BW2A 4AEOA 1UH3A 1ZJIA 3W6MA 4KFOA 5CZKA 3DFHA 3BG9A 4J2PA 4PRTA 2UY5A 3C86A 4BEQA 3FJLA 4PEKA 5GPRA 3SQMA 1FCQA 3HV9A 3HQNA 1OZQA 1UA3A 2OEJA 3PUOA 2V81A 2HBVA 4GY7A 3WUGA 4V2XA 3EDDA 3VAVA 3ARVA 3IACA 1KV5A 1S5VA 2IMRA 4IPNB 3W7IA 2G5WA 2DT3A 2XM2A 3V0SA 2E1WA 3M6DA 3CJPA 2CLLA 2VFEA 1S3TC 3ATZA 1VEMA 1KFWA 5KINA 4K8GA 3TOPA 3WLOA 1WO2A 1XRTA 3WG6A 2PLCA 2Q09A 4DI8A 2J13A 4NRSA 4AWEA 3B9EA 2V5KA 2OGJA 2CKRA 1XKYA 1F76A 1LRQA 2Q01A 1C93A 5FA5A 3U7BA 1E0UA 5GNYA 1V6XA 2B31A 4A3UA 4GWEA 4K1GA 4WLCA 2YW3A 3G5EA 3BAYA 1GVOA 5J8LA 2RDXA 1HZYA 3AS3A 3NGJA 3MDWA 3VFCA 1NTHA 3QY8A 3CWHA 4C60A 2XPKA 3EB4A 4NJGA 5CBBA 3ZVHA 3IIOA 1OCNA 5GQBA 1W9BM 4MNKA 3O8AA 4PUNA 1AQHA 1RH9A 1MUMA 5EU9A 2GQ9A 4QX4A 4HOZA 1RPKA 2VEMA 4D2JA 3V18A 5BRQA 3KX6A 5EMMA 4U4MA 4LNYA 1XGDA 1K02A 2WLYA 3UWWA 3W7KA 2Y24A 5FL0A 3DI1A 2V82A 4HSNA 3URAA 3AWOA 3VKCA 1VFHA 1FWSA 4YYCA 2WHJA 5AZ0A 3CHFA 2C91A 2TRSA 2OT0A 3VNKA 4L9YA 4YXGA 1B4KA 4OGZA 3B0UX 3L4YA 3C0QA 3BSGA 3D46A 2C0AA 3QXBA 3C2VA 3GX9A 4UQCA 2GL5A 3UFYA 3GFZA 1Q6FA 1W5NA 1FCBA 4DBDA 2JEPA 4FZIA 2PEVA 1MVYA 2OZ8A 4IPIA 2WC3A 2X16A 2EPOA 5LGXA 3H2AA 1R2SA 2J9YA 3O6DA 4KRUA 2P1FA 3RCNA 3UG5A 1R3QA 3EOSA 4UQAA 1O5XA 3B9NA 2PLKA 1J2BA 2CU0A 2ZRWA 3N04A 3FW6A 3A4XA 1Z41A 2PPGA 5DY2A 1M53A 1ME8A 4YHGA 1CWYA 5C0QA 4HPNA 1I2PA 2FPVA 2I57A 1VFLA 1O95A 3CUJA 3UCDA 3SBFA 4HMCA 3SN4A 1TMLA 2XHYA 4WJEA 5CZ0A 3FEMA 2PC4A 4D1JA 2CLIA 4KT2A 3IGXA 1FQ0A 3GVQA 3WJWA 1PWMA 5CQ1A 1WX0A 4XK2A 4IMEA 2OQHA 4LT9A 5F7UA 1SW3A 4IIFA 3UCQA 4C1LA 3SCUA 4UQDA 3MUY1 4TV5A 4H4IA 4LCRA 2VZTA 4A3HA 4ILSA 4C90A 4EWND 4PMQA 1WDSA 1AK5A 3GG0A 3APYA 1C8VA 1NWRA 2QDDA 1QI5A 3Q65A 3P7YA 1THFD 2VL4A 3PJWA 1REQA 2J8TA 2Y0FA 1ZNNA 4IICA 1KQZA 4PA8A 2NSXA 2BVTA 2PDWA 3W1MA 3UQNA 1FXQA 3M7SA 2WM0A 3A12A 3TTQA 2C71A 3ITCA 1UD2A 3WK2A 1I0BA 1OD0A 1ADSA 1SM9A 2HCVA 5ECUA 4O1AA 1N8FA 1H5VA 4ORIA 3ZLFA 1W3NA 4K38A 3P14A 4XX6A 1GPWA 3MBDA 4EPDC 3QYSA 5A8QA 4N6EA 1DJXA 2O7SA 4DLMA 4ICCX 3H12A 1YW1A 3NOYA 1O6IA 4HYVA 5FJPA 2Y8UA 5REQA 4B3KA 4A8NA 4IP7A 1YEYA 4UNKA 3W22A 3WD3A 2YCLA 1HQTA 3M64A 2Z2UA 5T91A 1LWHA 3QMTA 2JKPA 4M6VA 2QDEA 3FS2A 6XIAA 2VYOA 3OLGA 3G1VA 5CBJA 2BOGX 4WY0F 1XC4A 3IAQA 4WY0B 3MC5A 3IJIA 3HOJA 2ZX9A 1PIFA 3A23A 4AYGA 5D32A 1R3YA 1UWTA 5F2GA 4YWSA 1KCKA 4DZAA 3IS4A 1KD0A 1UUOA 1K8ZA 1K7XA 5BOFA 1IT7A 3DI0A 4JKMA 3VD4A 4GX8A 5BXSA 5F1UA 3QQ0A 3LNMA 3FEQA 4K2SA 3V35A 4TX8A 2BVDA 1JVNA 2QGYA 2DORA 5HPCA 3L4TA 1JF6A 3IJLA 2Q3RA 4NZFA 5E9XA 2CBUA 1JZ5A 1RLCL 3A9IA 5BCAA 1S46A 2ZTKA 2PGEA 2PD9A 2SFPA 4RJEA 4OOUA 3LEPA 1YXCA 2EJ1A 1LOQA 5ECVA 2DW7A 4NJIA 4FNUA 1W31A 3CQKA 1W6TA 2WPBA 2C14A 6XIMA 3WD4A 2AQVA 3WQDA 4IX2A 2ZDSA 1FX6A 4ERIA 3GBDA 1X1NA 5ABHA 4C6FA 3H55A 2YGYA 3LHUA 3DESA 3SCNA 3T0DA 3N2MA 3AU6A 1TPB1 1Y8BA 2BXZA 1R3RA 1VRDA 2HV5A 4HNTA 3QY7A 3TFCA 5LIYX 1CCWB 4TVDA 3CUIA 3GIPA 1IXQA 3MMTA 2Z26A 3N2OA 4JN8A 1QOXA 3DKJA 3PZQA 2NWSA 1B3XA 2J7HA 3W1UA 4WK9A 3URBA 4GX9A 4DNHA 1ENUA 3E6EA 3A4JA 3U2CA 2ZZ5A 1IEXA 3VOCA 4UFMA 4NI3A 1E9ZB 2A4AA 1ICQA 3T8LA 4B4FA 3S1XA 4BWLC 5JBEA 3TROA 3B8UA 3PPCA 4K1WA 4GQGA 4XVEA 1EO7A 4M80A 2QGHA 3EA3A 4DYKA 7A3HA 4I3GA 1QO2A 1I8JA 3AROA 2C6QA 1UR1A 3T08A 1OIFA 2INFA 1W3KA 3M43A 3O6CA 3EXSA 1KLYA 4LVGA 4HU8A 3GTFA 2G3IA 3JZUA 1X6LA 3GDKA 4HNOA 3GDLA 1CLKA 3GDMA 4MHBA 4NVTA 2PFHA 1GQKA 1P7TB 1KC7A 1VFUA 1TTIA 2V67A 5D33A 5AFDA 3EWDA 3TIMA 3BOLA 1XICA 4NXKA 3W7QA 3TMQA 1RALA 2GVGA 2PAJA 4IIDA 4CNSA 2PDQA 3WNKA 1XD1A 1TVNA 4EPKA 2H3DA 4PZVA 4PUJA 1B1YA 4DPQA 6REQA 2VGBA 4AHPA 1TWIA 4O57A 3SGUA 1L8NA 4J4KA 2PI6A 3UXLA 3DFNA 3GQYA 1A5LC 4B2DA 4O1FA 3VGGA 3SY5A 5BOOA 4HPXA 2P0OA 4KGJA 5T8GA 3WDPP 3W4RA 1BVZA 4Y90A 2AOSA 2NT1A 3NCOA 4U31A 3BCFA 2QZRA 3A6OA 1MO0A 2VGGA 3DEQA 2AL2B 4RW5A 1M3UA 5HINA 1C9WA 4GC4A 1IGWA 4GOAA 4OBRA 2ZZ3A 2HK0A 4UZUA 5GJPA 1E5JA 1QO5A 1T41A 5KZEA 3F4DA 3MUXA 5D9OA 5BROA 2VZUA 3UA3A 4XKYB 3L5LA 3GDTA 5U4NA 1PSCA 1SR0A 4PMVA 4NI8A 3VOHA 4X0VA 3ZLGA 1HXJA 2DVTA 4D9PA 5D2TA 2VHLA 1K4HA 4CN4A 4GUHA 1FDZA 1JI1A 3COTA 4CNUA 1Q6OA 3WQCA 4FXFA 1BFNA 1NM9A 1LWJA 2YSWA 3CUZA 4MLRA 3MMWA 2Q3OA 3FLUA 4LH8A 3N3TA 2CXGA 2PP1A 2UWFA 4LJ3A 2RKXA 2HS6A 1KFEA 1UD5A 3RRAA 1XGZA 3AS1A 4GD0A 2W0UA 2V9DA 4H6QA 4K36A 2PTWA 3M0ZA 4HYWA 5MKGB 1BGAA 2C15A 2J9ZA 4F79A 2OWXA 3GVRA 3GHRA 1OF6A 5CAKA 4Y7EA 2I1OA 2JKEA 3WD1A 1CXIA 3VIIA 1FDYA 3UZ5A 1KFBA 1UOKA 2DH3A 2GGHA 7ENLA 1B57A 2C1GA 3R89A 3SCSA 1W9VA 4X63A 5FACA 3HN3A 3IVTA 2QXWA 1FHDA 4PMXA 1GTHA 5HQMA 4D6JA 2WSKA 5C5YA 3GXNA 3CO8A 4YMZA 3PBMA 6ENLA 1D7FA 4LALA 3T2QA 1C8YA 3RX3A 4C6KA 2FH8A 4U3AA 4Y8FA 3M0JA 5DY3A 4C6DA 1VYRA 2V3EA 3CMJA 1H5YA 1J2WA 2CC0A 2XSBA 3L2LA 2PDHA 3ZJKA 4EP8C 2GJNA 1YE4A 3DFYA 1F4HA 3W07A 2X09A 1ME9A 1JCTA 4J3VA 2R1KA 3RDKA 1PV8A 4KIEA 3VOIA 4E8GA 1EYEA 5D05A 2VJXA 4FNQA 1CBGA 3DENA 3T78A 4WZHA 1E1CA 3I7RA 5G1TA 1EJWC 5LNVA 2B4GA 2YDRA 2QIWA 1QPRA 3FIGA 3H4XA 5SWUA 5GJMA 2R1LA 3G3MA 1J4EA 4CD4A 2YYTA 3NWRA 1E1EA 3APGA 3OG2A 4BA0A 3BW4A 4I8YA 1KTBA 5BMXA 3M7WA 1F3WA 3FK4A 3MSDA 3MWCA 4JS3A 3L0KA 3S9IA 3RRXA 2F2HA 3IUHA 1ZSXA 5HMEA 4RZ4A 4E2DA 2QCDB 3POHA 3KUMA 3KOWA 4EF9A 4I6KA 1SSDA 3WZ0E 1U30A 1A47A 3ZT6A 2NUWA 1YXDA 3PS7A 1QBAA 4UFIA 3BJFA 1ESWA 1W9PA 3LMYA 2D0HA 5HWJA 3AWNA 2X1SA 1QVBA 1JJKA 4MDOA 3MSYA 4IMGA 3URQA 3WDIA 1OYAA 5HUOA 3LHWA 4LYQA 3S6TA 2EPMX 4DEFA 2WNZA 4UQ9A 5IBXC 1XCWA 3DGBA 3TXZA 3OVGA 5I2UA 4GYPA 3RMJA 2V3DA 3LYEA 3WQ5A 5I5RA 4B9YA 1CX9A 1QHOA 4AWTA 4BEUA 5MF5A 4B3ZA 1VFMA 1JCLA 1VJIA 3EDJA 2CLEA 3ZJ8A 1WCGA 4GYKA 1AA1B 1PIIA 2FHFA 1FWBC 2VC9A 1HTIA 3GUGA 4ZQOA 3GDBA 1P6WA 7TIMA 4EANA 4GCXA 4B16A 4DBSA 3U57A 1KFLA 2XSXA 1HKIA 1A3WA 4J35A 2QF8A 1TZ7A 1EOKA 2QIIA 4C1NA 1XD0A 4H9TA 3HQOA 3APTA 4H8VA 4OT7A 1AL8A 2UV8G 1KRBC 2F84A 2Y8KA 2VOTA 5M2FX 3E2VA 3L5AA 1TPH1 3UW6A 4MY1A 4QG9A 4HK7A 1QOPA 1PUDA 2DVXA 3HF3A 2VZVA 2XFYA 2PRHA 4CNNA 2BWGA 2ZZ6A 1E43A 3AJ7A 1YX1A 3E3HA 3BH4A 2CFFA 4K68A 4Z1DA 4GQRA 1K9TA 2ZUUA 4I5XA 1QU4A 5AYIA 3NXFA 2W5FA 4H19A 1TELA 8XIMA 1T40A 5HANA 1AG1O 4ZO9A 4AX6A 3R12A 4ZB5A 1XISA 2YW4A 1ZJBA 4AFYA 4KWVA 1LL4A 2ZXDA 2OYKA 4NZ3A 1UR0A 3S5ZA 3GFXA 4DBEA 2ZIDA 5IHRA 3LXAA 3DG7A 2D2HA 1FBAA 1O7AA 4OKDA 3L4ZA 3CV1A 2BGSA 4YCPA 1MW2A 2VEIA 1KFCA 2GUYA 3PBVA 1EFZA 3VCRA 4G5DA 1XKJA 3RO8A 1W3IA 1CIUA 1M04A 4XTIA 1OC6A 1L6WA 5I3JA 3IARA 4JQ3A 3KHDA 3S0CA 3C61A 4O1CA 2BODX 1E6NA 1G6CA 3LM3A 3WMSA 4LS1A 4MNLA 3W82A 4BR1A 2XFWA 3MU7A 3N2CA 1P6BA 2PWFA 2Y8VA 4IG2B 1F8IA 1OFBA 2G97A 1H51A 4YVXA 2WAGA 2B81A 2PSNA 4OWGA 4XIAA 1B4EA 1PKYA 3STCA 1JZ3A 4AC1X 2XFRA 2PCQA 4W5ZA 1U1JA 3CEUA 3AHTA 1NWUA 5DX7A 3N9SA 3VPLA 3DFQA 3VNYA 4PUEA 4A8IA 2G41A 3O2LA 3PVFA 1W8GA 4DHGA 4PCNA 2C3ZA 4ZENA 4OVXA 1KBKA 4E2BA 3JRKA 1FCVA 1G9HA 3MHGA 3WD0A 4PUUA 3P5ZA 3N4AA 4ZQRA 5G4EA 3V1HA 3OYZA 2VZSA 1MFVA 3TEVA 1YPFA 1AQFA 1V5XA 4YU1A 1Y5VA 1V7YA 2J66A 4DO6A 2VWTA 4JYFA 3MW7A 4R9OA 1QTWA 5DLCA 3R10A 3WNNA 2PP0A 2X7WA 4LF1A 4CU7A 4LV9A 1NDVA 1BYDA 2GJRA 3UXKA 4I7VA 7ODCA 1OX4B 4AU0A 1HO1A 4CU8A 2IPFA 1DJYA 4ERAA 5FJTA 3VD9A 2GQ3A 4E4PA 4OTKA 2RDTA 1ZHAA 2EG7A 2FKPA 4D6EA 5D30A 1FWCC 4JTRA 5IDIA 2J8FA 3SO7A 4PMDA 1HUVA 3GHUA 3BLKA 2ICSA 1SJBA 1FWEC 4IISA 2BXYA 5IFPA 1JQXA 3M9YA 3FYOA 4EOUA 5I23A 1R46A 2P8CA 1VHCA 1PB0A 1UP0A 4LYPA 1HJVA 1UD6A 1EDGA 3EGJA 4RL3A 4O50A 1X96A 3C2EA 1CI1A 3GR4A 2VWSA 3OA5A 3PZUA 3QF0A 2WZEA 2QV5A 4IQJA 3ZQ9A 4X60A 4GKTA 4CQ9A 3G24A 3NVDA 4MMWA 3VGHA 4ZBCA 3H24A 4Q6XA 1HKVA 4Q7BA 2EHHA 4D71A 2XN1A 4Q8OA 3QTPA 4WSKA 2JQXA 4Q8UA 3T2PA 4XV0A 4DJEA 3IVUA 3AIRA 3GIYA 5F4WA 2E9BA 5D8ZA 1OF8A 1FXPA 2QCCA 4GZIA 3B97A 1VLIA 3L4XA 1W8SA 3NM3A 3VNLA 4DIAA 1K70A 3V0TA 1GVFA 1QNPA 3QSRA 4DWSB 2GVJA 1DV7A 3WEMA 5C2CA 2Y62A 4R7OA 3DYMA 1OFPA 4GI9A 1OCQA 4PSRA 3ZS4A 2Q6ZA 3G3DA 2VVNA 2FDMA 1O68A 1E6ZA 3AOFA 4Z2JA 3EMCA 1B9BA 1NY1A 4DLFA 1XX1A 3OHMB 1UP3A 1DTUA 2UY3A 3E49A 2RGMA 3KBWA 4GO9A 4HT3A 3YPIA 3GU9A 4UMBA 3AJXA 1A53A 1DTNA 1MRQA 2YR1A 1DJNA 1TJ0A 4Z1AA 3JVAA 1JDCA 5BOEA 3B8DA 3I6RA 3LOTA 4UFKA 2GGJA 1AJ0A 1WBHA 4ICNA 2E28A 3W2NA 3G1AA 2FZBA 1DKWA 1O1ZA 3FOKA 4GGHA 1SW0A 3P82A 4O18A 1R5YA 1YNQA 4DZHA 3DFSA 3BG3A 1XLKA 3VOGA 1EXBA 1JPIA 5I79A 2IW0A 4M19A 4S3JA 1R2TA 5CEWA 3WENA 4BKNA 4W93A 1B3YA 2PODA 4L9ZA 2WVVB