3TZNA

Crystal structure of the yersinia pestis dihydropteroate synthase.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
243
Chain Sequence
SHMHLTARGLTLDLSRPQVMGILNNLDQALQHAQRMLSAGATLIDIGGELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 85
structure length 243
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tznA00
4S3FA 1Q7QA 1Q8AA 4DJDD 3H26A 4DJED 1AJ0A 4DAFA 4D8ZA 4D9PA 4HB7A 4S38A 3TYAA 3TYZA 1Q7ZA 3MCMA 3H2OA 2H9AB 1F6YA 4G9PA 3TZNA 4DJDA 3TYCA 4S3EA 4DJEA 4S39A 1TWSA 1Q85A 4C1NA 4MWAA 4DJDC 4O1EA 4S3BA 2Y5JA 1AD1A 2VEFA 4DJEC 4S23A 4DJFD 1TWWA 4MWAC 3H22A 4MWAD 5JQ9A 3H23A 2Y0FA 3V5OA 4DAIA 2Y5SA 2YCIX 2DZBA 3H2NA 2VP8A 2YCKX 4S3DA 3H2AA 4DJFA 4NILA 1TWZA 1TX2A 3K13A 4NHVA 4NIRA 3MCOA 3BOLA 2YCLA 4NL1A 4DJFC 3MCNA 2E7FA 3H2FA 3TYEA 4PZVA 4S3AA 3TYUA 4D8AA 3TZFA 1TX0A 4O0QA 2DQWA 3H2CA 3BOFA 4S3CA 1EYEA 3TYDA 3H2EA 2YCJA 4C1NB 1Q8JA 4MWAB 4CCZA 3H2MA 3NOYA 2YCLB 4DB7A 2VEGA 1AJ2A 2OGYA 2H9AA 2BMBA 1AD4A 3H24A 2DZAA 4MWAE 3H21A 4O1FA 3TR9A 3TYBA 1Q7MA 1AJZA
chains in the Genus database with same CATH superfamily
4GQGA 3FHAA 1KCZA 3U9IA 1JYXA 2ZXDA 2Y7GA 4XZ9A 3LV5A 3GYEA 1HJWA 3MSRA 1Q7ZA 2E25A 1JNEA 4MFEA 4C6OA 2A0NA 4IX2A 3LLXA 2QGYA 3FFSA 3CO4A 5HULA 3M47A 2AQWA 2Q6ZA 1NFBA 4LYKA 5C70A 2JGQA 2QCEA 3C3NA 4CNUA 4PSPA 4JIQA 1HVQA 1W1TA 4WUIA 4HPGA 4LS2A 2E28A 1UR2A 3UG4A 2OMAA 4KH2A 4PFHA 4PE8A 1DEDA 5FJJA 3OPSA 4RW3A 4WY0B 5EA9A 4B5NA 4V1YA 3MI6A 1MDLA 5IHRA 2FGLA 3GVQA 2XIJA 3K8LA 4U31A 2WB5A 5HDRA 4A05A 5D09A 4GXMA 3GTIA 2J8FA 1BXCA 1XIMA 4NNCA 5AC5A 3NSMA 4JFSA 4QS6A 1DJQA 3VNLA 3SIZA 3CQ0A 5LGZA 1RJRA 1DJGA 1W3JA 2V5LA 1VHNA 2V3GA 1IGSA 1B3XA 3SGZA 3KZSA 3SJ3A 3PJWA 1FWSA 1O1ZA 4G8TA 3QQ0A 1OYBA 3IACA 3E0LA 3QHOA 4P5UA 3W7NA 3SDOA 4O4VA 2WWDA 1E4IA 1KCLA 4QM1A 1Q7QA 1TJRA 3QC3A 1S1PA 1ZPTA 2NUWA 3HA1A 1QBBA 3NDZA 7TIMA 1GOMA 4PMQA 1WKYA 3QPYA 1GONA 3ZMRA 4CLMA 4RXGA 3GU2A 2DW7A 4B5TA 3LM7A 5G1TA 2QR6A 4NJGA 1OWQA 1P0EA 1WP6A 1R47A 3CNYA 3VKDA 1W5OA 4XD3A 4BI5A 3U0HA 2PFHA 2OZ0A 1DE5A 4B15A 3LG3A 2YBUA 2MANA 1TV4A 3M46A 3OP2A 2FZ8A 4H6EA 1RCQA 2REQA 2E9BA 2DT3A 4GIEA 4H04A 3ZM8A 8RUCA 4WQ6A 3U7BA 2WMKA 3BJFA 3GS6A 3V7PA 4CEUC 1Z32X 1GOIA 4YU1A 3VYLA 3L66A 1NF0A 1OYAA 5H1WA 2QLYA 4WDWA 2YB4A 3O3RA 3SRHA 5HQMA 1DE6A 1N7KA 3Q45A 3WLKX 4U10A 4ZXOA 1IWBA 3A64A 2VEMA 4POCA 3QM3A 4RNJA 1VEOA 2VFHA 1W1PA 3CTLA 3N2TA 5I3GA 1Y0EA 4S3CA 4JYEA 1I1XA 4ZBCA 1W1IE 5A6JA 3DAQA 5DXYA 5AC4A 4OBTA 3OA5A 5ECUA 1HG3A 1V0NA 1UZ4A 1XM3A 2V8ZA 4HU0A 3IV3A 3CAVA 5A2BA 2DT1A 2BNJA 2EPNA 4WCJA 3WCZA 1D8WA 5DCDA 1CWYA 5EL1A 1UA3A 4HJFA 4AD4A 4FHAA 1F6PA 3FOKA 4DXXA 4DIAA 3EMQA 4DAFA 4J3VA 3DG3A 3UA4A 4QEHA 3LBMA 2AL1A 2D0HA 4D6EA 2ALRA 1WX0A 3QOMA 2QCMA 1VPYA 4B9ZA 1H7PA 1JQVA 1W5QA 2VEIA 1R46A 2BXVA 3BSMA 4UQCA 5DXXA 2QQ6A 5LIWX 3ARXA 3F1QA 3BO9A 1XLDA 3KVMA 4TV6A 4B3LA 4R9XA 3FVDA 4V28A 2BX7A 7REQB 3RU6A 3AHVA 1KM4A 3ATYA 4JL1A 4C1KA 4D6JA 3KS6A 2HWGA 1RP9A 4B2DA 3FAWA 3TROA 2VGFA 4L64A 2NQ5A 1NFPA 3ITLA 4CQCA 3C4UA 1SVDA 1KM0A 1ZGDA 3RHGA 3VIIA 3EMZA 1V3JA 2WANA 4D8AA 3GQYA 3ZJ8A 4ZQPA 3N12A 2ZTJA 5AHNA 2X42A 3HF3A 1XINA 5CZSA 3BLOA 4BI6A 4O54A 3FA3A 3JZEA 4NI8A 3W1UA 3P80A 1UD5A 5C55A 2P0IA 1IR2A 1B3OA 1RY0A 2VX7A 3M7SA 3PULA 3OBEA 1FH7A 1OGGA 1DJIA 2VGBA 3FYPA 4PMZA 5AZ1A 1IE7C 4RPQA 2V5DA 4Z08A 1BRLB 1KA9F 4UQDA 5BOEA 1MFVA 2V0TA 2FZNA 2Y8KA 3WFAA 4HOZA 2J88A 3UJFA 4HB7A 2YFNA 4Y96A 3GDTA 1XG3A 4ZOAA 1P0BA 4HN4A 1JPKA 1GQJA 2Z7GA 5M03A 4J28A 2ZVRA 4A21A 4W8LA 4B5WA 4RCXA 1N2VA 4TX9A 3VC6A 1TV5A 1JZ6A 1TVNA 5I3KA 2WMJA 4FXSA 5JU6A 5HMFA 3NZQA 1XPGA 4TUFA 4DELA 4E3TA 3G3MA 1TMHA 3WLMA 4Q6XA 2ACQA 3C61A 5FA5A 3OBKA 4NL1A 5H8UA 5K9DA 5CLTA 3QHNA 1M3UA 1TPC1 1Z41A 3CWNA 2INZA 4Y6GA 3ABSA 4EXAA 2Y24A 5M17A 1JYVA 2DUZA 2BB0A 1UKSA 3NVTA 3MWAA 4H8UA 4ZO7A 2QPXA 5EBUA 1OCBA 3PG8A 9RUBA 1JCJA 3CYVA 1A80A 2HS8A 1O94A 3GXMA 3MANA 3G5EA 3T40A 2FGZA 2F9RA 1P7TA 1RQEA 4XTDA 1SR0A 1VBJA 1I4NA 1K4GA 1WXJA 1WZAA 3EOSA 4OOZA 4KQNA 1OJXA 1T8QA 4ERGA 4JTKA 4PMNA 1ZAHA 2FJKA 1JXKA 4REQA 3UF9A 1R3VA 4HA0A 1T99A 4CVWA 2CLPA 2O9OA 5CZJA 4GWEA 1XGZA 4FNTA 4ORIA 3MW7A 3PZQA 1TMQA 4XSLA 4LGXA 4M5PA 5E1QA 1ISYA 3VKAA 3W25A 1E72M 1FWTA 3SM0A 3EPMA 4MPKA 3N2MA 4H19A 3L5MA 1TPFA 2GVEA 8XIAA 1UMYA 1A4LA 3QLDA 6TAAA 3VDBA 2QCGA 2FQIA 3CPRA 1CTNA 1CDGA 3CS2A 3O6CA 3WQ6A 1KBBA 3FXGA 4JKLA 4ICCX 1OX4A 1TRDA 2ONEA 3WQPA 4G1NA 3HPXA 3WJZA 1HJVA 3TV8A 3UESA 4LAMA 1R3TA 4IOTA 2G0WA 3QKZA 1KM1A 2VURA 3S5YA 2IQDA 4U2ZA 4EF9A 2QJHA 2YW3A 3N14A 1PB0A 3NL3A 2DVXA 1E1CA 1RQBA 1NDYA 2KAUC 2C18A 3H2OA 5LHFA 3ZJ6A 1PSCA 2CCRA 4LNYA 4JDBA 2DH2A 3UVIA 3RGTA 4WY0F 2OWCA 2E6FA 3SRFA 3TWBA 3CB8A 3HMCA 1QMLA 3YPIA 3B8IA 1VLWA 3PS7A 4CD4A 2NLYA 3C2RA 3ITOA 2BVYA 5G4WA 3FVMA 5EYWA 3E12A 5FF2A 5K3VA 4MKNA 4N42A 1ZFJA 5LA0A 5FF7A 5FJPA 1F76A 4KFOA 1V7YA 1HVXA 3DHDA 5JH2A 3KW3A 1G9HA 5F2MA 1OGBA 3WL0A 5G5IA 1XR2A 2E7FA 3MKVA 3W7IA 1QTWA 2FZBA 3HOJA 1B3YA 3WK2A 3L4XA 1QK2A 2G5WA 4W7UA 3W7OA 3IEBA 4PULA 4S3JA 1SZEA 1A0DA 1R6WA 4NZ1A 3QHMA 1MWOA 3QY8A 5EU9A 3QPZA 1OZMA 1QO5A 2BP1A 3URAA 5TIMA 3AXXA 2EPKX 3AISA 5HR6A 1CBGA 2R91A 1W9UA 3MSDA 3T42A 4HYVA 1ICQA 3IJ6A 2G8ZA 1H51A 4K8HA 5DT7A 3PG9A 1FWEC 4G7FA 4J2MA 3PWIA 1TQXA 3DKJA 1LM1A 5BYWA 9XIAA 2YOCA 3TX9A 1UR8A 4I9MA 1WUFA 2EJAA 1JZ8A 3LXBA 4O11A 3LLFA 2CBJA 3CB3A 4PMDA 4M80A 2CEQA 4HIBA 1W5PA 1V3IA 4WKAA 1QBAA 2GSEA 2QUUA 1LL6A 1X6NA 3II1A 1IZKA 1WV2A 2GQ9A 2WNNA 3F2CA 4DF1A 3NZGA 1D3GA 4B3ZA 3AXHA 1SFLA 5CLWA 3MHGA 1H7XA 5CC6A 3W76A 1MXGA 4US5A 3LY0A 4MYXA 4LXFA 4GVGA 1M68A 3N34A 1NH6A 3UA3A 1L6FA 3M6YA 1TWIA 1TPVA 2I17A 5HOSA 1OC6A 3EXRA 3AIBA 3L2MA 3B4UA 4UTWA 4XB3A 1IQ8A 3OJGA 4EE9A 3RYSA 1OY0A 1TR1A 2PGFA 4PB3A 1ITCA 1RALA 4PMVA 6A3HA 4C91A 1YLVA 4JTJA 4FF5A 1TELA 3S2MA 4IIBA 1IR1A 4LY8A 1GZ1A 5DY3A 1E1FA 5F7UA 4J4KA 5CG0A 1MUWA 2FTWA 1V02A 1XLEA 2O55A 3EKZA 3CEUA 3DH7A 5FJIA 3WEMA 4UOZA 4TIMA 3GDMA 5I3FA 1DJNA 3CH0A 3PZ9A 3Q58A 5DN1A 1KXQA 3ONCA 4ZCWA 1REQA 3W53A 4GJ1A 3NZRA 3ABZA 3I6RA 5HPCA 5LKYA 1BSLA 3WD3A 2X1IA 3T8QA 2NX9A 2F61A 3KP0A 2QJNA 1WZMA 5AYZA 4H8VA 5F1VA 1RCOB 3F03K 2X2YA 3TSMA 2BDQA 5BOFA 1KR0A 4K38A 4Z2HA 3AYSA 5CGMA 2WNWA 5I07A 2ADAA 3VOJA 1KFBA 1ML1A 1UD6A 3ATZA 1FXQA 3V1PA 4NJJA 4FO4A 1CYGA 4JKMA 4C6FA 1M01A 2DT2A 4GKTA 5HXMA 2NXHA 1ONXA 3KBSA 4JXCA 5JBDA 4N6FA 2VFDA 1N55A 4A8IA 3T7VA 3D3AA 3L4YA 4CCZA 5I6SA 3UZXA 1CXEA 4GQQA 2ODOA 3CZJA 3EWYA 5CH9A 4NX0A 2FJUB 1D3HA 2J6VA 3KTXA 1OK6A 1FDZA 4Q7NA 4Q22A 4HNNA 3R79A 1VFHA 4O4WA 4L9XA 3TE9A 3NIYA 1EEXA 2A7NA 3UJRA 3P62A 1R7AA 2WNZA 1DHKA 5AYIA 3TYZA 3ARVA 4DYJA 4UTLA 2E67A 1FWBC 4UTTA 1RY8A 4NVTA 3VGDA 3CHVA 2CIPA 1XIJA 4U3AA 1VRDA 4G2DA 1V6UA 1XJBA 2VTFA 2G95A 1DVJA 2PE4A 1KKRA 4JIEA 3RR4A 3EWUA 3W9ZA 3ONBA 5AKQA 1G5AA 4UC5A 4X2RA 1Q3NA 1OBAA 4LS0A 9CGTA 1M7XA 3GFZA 3E0FA 1UZHA 1X1OA 3CQKA 1Q6LA 2VXNA 4RE3A 2QJMA 4GKLA 4AZIA 2PBOA 1W8SA 1NY1A 1R9XA 4C5ZA 4WHBA 3W1QA 2D24A 2Z1BA 2GGGA 2PWFA 2WHKA 4Q8UA 4FS9A 3W7QA 1R9YA 2YBTA 4I5RA 3BAXA 2XSBA 3AO0A 5KINA 4Y8FA 4AY8A 4CCEA 1LT8A 2GK1B 8TIMA 1R2TA 2PURA 4B3KA 3CHFA 1NQ6A 2GSJA 1O7AA 3L21A 3SCPA 3AALA 3L4VA 3TOPA 2FVKA 1GVIA 1OG6A 2PD5A 3CM4A 1ZS2A 1I60A 4JQ1A 4L4PA 3SUSA 1YDYA 1TPB1 4C90A 3CUFA 3EDFA 3WNKA 1Q63A 2VZVA 4PUMA 4ZQOA 3R1ZA 3NM1A 2ZDSA 3TCSA 2GWNA 2J13A 1OCQA 2PWEA 2VFGA 2WVSA 1FWIC 4GK8A 3WUFA 5D32A 1HP4A 2EGZA 3M44A 4LH8A 1G67A 4AY1A 3KM8A 1PPIA 1G4TA 2DZXA 1RBAA 4IL0A 4DWSB 4RZBA 4YL2A 4EPDC 5ABEA 1FFQA 4JTFA 3W85A 3FSTA 4LUIA 1C92A 3NSNA 3G22A 3FJ6A 1EGMA 4S3DA 3KBVA 2HVOA 4H1ZA 4G56A 2DIEA 4CGTA 1AW1A 4HNLA 5C7HA 2VMFA 4JHZA 4QNWA 4E2BA 2FB2A 2OSWA 3VI2A 3FDKA 3H2FA 4Q8OA 1CT5A 4N4PA 1NIUA 3AU2A 1W8GA 3O1NA 3LTSA 4L1XA 2GGEA 4FNSA 3O6AA 3PJUA 1TPEA 4R9OA 4UR9A 3VNZA 1A0CA 2A7RA 2OJPA 1AQ0A 3PTDA 1BKSA 4BFAA 3UWZA 1AZ2A 3LS9A 1Q66A 1MNZA 2VEPA 4Z0JA 4TU1A 4YN5A 3WH6A 3AS3A 5BXTA 1EF3A 1UIPA 2UY3A 4I5XA 1A5NC 3SY5A 4AZ6A 4Q4OA 3QQ1A 3OGRA 3KOYA 1QO2A 3TYCA 1WBJA 5GJNA 4HNTA 4RZ4A 5HJYA 2W6RA 1G0CA 4PRWA 1YE4A 3QR1A 3RJXA 3W3OA 3W6LA 3ABRA 2VELA 5BXPA 3VINA 1QU4A 1WDSA 1P43A 3ZQ9A 3C8FA 3JVAA 2E8YA 1FWGC 1VFLA 2QPUA 4P8UA 4J3TA 2INEA 4LEQA 3XIMA 3K13A 2XM1A 3PR2A 3CIWA 1RSCA 2BOGX 4Q4RA 2GVGA 3MP3A 4IGMA 3TYUA 2WKLA 1MNSA 1V79A 3S2LA 5CJNA 4ZOCA 3TTEA 1HXJA 2PDIA 4XVEA 2XH2A 3SB0A 3AZRA 1MVYA 1DYSA 3U2ZA 1S3TC 3EKLA 4AAJA 2E9MA 1IZJA 1QJWA 4QE4A 1R2SA 1PE1A 1H7RA 3THDA 2BOEX 4AEEA 5DMYA 4IMFA 4WD0A 4GVIA 2CXGA 2WZHA 5F4WA 3WBXA 2QCLA 1UOZA 1GVFA 4D72A 3NQEA 3CZ8A 2IUZA 1QPOA 1A53A 1K7EA 4ZB5A 2X30A 2D22A 3G8EA 5FIPA 4DI8A 3GTHA 1DWHM 3AMCA 1LT7A 2NV2A 4XK2A 2PLKA 3JR2A 3KVJA 3QZEA 1WDDA 2FHCA 3FNDA 2ZZ3A 3CZKA 4FLRA 3RM9A 3K5XA 4PEEA 3HTWA 4GI4A 1EXBA 3IANA 2ESCA 4G5DA 4IMEA 4RXFA 4HU8A 1UWQA 1BTCA 1MXDA 1KFCA 1MRAA 4D6GA 3W75A 5DBUA 4M1RA 3RMEA 4J35A 3KTSA 4NG3A 1PO9A 1G1YA 3E0WA 3WDIA 4PCFA 1ME9A 2Y6ZA 1IEIA 1E6PA 2WBGA 2J66A 1VYPX 5EMJA 2Z0IA 4LUSA 5HK4A 1OFRA 1UA7A 1PIGA 4ATDA 2JE8A 3PB0A 1WDWA 3WMBA 2OEJA 3DHPA 2GVJA 4GA8A 3QMTA 1JULA 4FSAA 2G96A 2FZMA 4IMDA 1K77A 4KWUA 4DEFA 1EP2A 2WJZA 4HPNA 5D2VA 1Z42A 1YDNA 2V30A 1KM5A 2O9RA 1EJWC 2BSLA 3HFYA 3GNRA 3H12A 2ZC1A 3NPXA 2P3EA 3HM7A 5C9WA 1GOQA 1LG1A 4NT0A 1J0HA 3WD2A 1E3ZA 2GWGA 2P0OA 2VI0A 3FGCA 2VOMA 1QI4A 2PDHA 3WF4A 5ABGA 3URNA 3MY9A 5JQ9A 1FHUA 1P4CA 3VKCA 5HQLA 4UCGA 3LEPA 3CZLA 1EA0A 1RPKA 2J27A 4HJWA 2Y70A 4F0SA 1XLAA 3FIGA 3PJTA 1IZCA 4MPQA 6XIMA 3W4RA 1UJPA 2WK2A 1H1YA 4LVFA 1XLGA 3WIJA 1GNXA 2TAAA 3S5OA 4FLOA 3CAKA 5D05A 3L4UA 1BKHA 1MW3A 2GJNA 1ZUAX 4AZCB 2YLAA 4Y9AA 3I68A 4UMCA 4X22A 4E4FA 2IPGA 4QDPA 2YCJA 2W27A 4C1NB 3RDKA 1M5WA 1E4MM 3BMWA 1EGZA 1VP5A 4DZIA 2QKFA 1GW1A 4PBGA 3QYQA 2B7NA 5IXEA 2TMDA 2JFEX 4ZOEA 3KBJA 4GE8A 1OC5A 2I16A 2C7FA 4KEVA 3UCQA 3A4JA 1IT8A 1LTDA 2ISDA 3MUXA 3G6MA 4I7VA 2WVVA 3GW0A 4NYYA 2P3ZA 4R88A 2JF7A 3LERA 1QNQA 4AIBA 3R43A 1I2OA 1P6WA 3MHUA 4IICA 2AGTA 4HA3A 3BWWA 3RPTA 3HGJA 6ENLA 5B7YA 4RNFA 3T0BA 2D73A 1ENUA 4KEZA 1TUXA 3RR1A 3W2KA 4PTWA 4HKPA 1E55A 2WZTA 3DFTA 2XVPA 1F3XA 3K30A 1HTIA 1W5MA 1UZ1A 2NXGA 1JPIA 5EGRA 4QG8A 3UVAA 2XINA 1R38A 5CGQA 3G1YA 1GKRA 3MMTA 2YA0A 3EKGA 5MKGB 3BL3A 4B5VA 3LBOA 4S2BA 1JYNA 5A8GA 2V6AA 4MTVA 1ISWA 4DUVA 3RIKA 1NTHA 4H2HA 2Q09A 2VUNA 2OQLA 4Q8PA 3H7UA 4FB7A 2E0PA 4C7DA 1IIHA 5E6ZA 2EG7A 4ALDA 2H9AA 4MUPA 2NSOA 2J8TA 3I7RA 1VBRA 3MS8A 3DXIA 2ZUVA 1S2VA 1G4EA 1XYLA 1I8JA 4GI9A 3PTKA 4LYQA 5HNTA 4XUGA 5D9NA 1W9VA 2GUBA 4HZ8A 5I3HA 1M7JA 4H4IA 3THCA 2XVGA 2YIHA 4ML4A 3OIXA 1IHIA 3AYVA 2YDRA 2DFAA 4WOQA 1BXNA 1CIUA 3OGVA 3I4EA 4ILSA 2HTMA 3QSTA 1MEHA 5EBAA 1MW1A 3EAUA 3A3XA 2PDLA 1QI5A 1F61A 3DENA 4O18A 1EZ2A 3WFZA 5C2XA 1AH0A 2D20A 2J6XA 4LJ3A 3N1AA 3TOYA 1X7FA 5EB8A 5CBIA 3D6NA 3O15A 3GDKA 2JKAA 4JTUA 3W07A 3EPOA 4V33A 2J7HA 2CW6A 1ISVA 2XZ7A 3WSUA 3TTOA 1YMYA 3ALGA 4JQ2A 3WUBA 2PWHA 4ACZB 4QQ3A 3T05A 4Z42C 4JTGA 3MPGA 2QDHA 3VOHA 4PR4A 4C6PA 2XSXA 1O5QA 1K9DA 3GU9A 1NJJA 3UPBA 2OWXA 4DN1A 2V3DA 3G24A 1L6GA 2C91A 5B7ZA 3RX3A 2UY5A 1JFXA 2TRSA 4ZSTA 3L2LA 5I5RA 2HZGA 2CLKA 1H4PA 2OEKA 4PCTA 4RE2A 3OG3A 4GFIA 3QSRA 3P8IA 3SUVA 4F0RA 5A2CA 3W7MA 3O6DA 3ENLA 3ZVHA 3EOEA 3BK0A 4OWGA 1X38A 3NZ1A 1OFOA 2CFFA 3QKEA 4NZFA 1E6RA 3N9SA 4P7QA 1XLLA 5JMUA 4KCVA 1QPRA 1C91A 2J7GA 1UQYA 4NJIA 4UFJA 1GOKA 1ZJAA 1E0TA 2PMQA 2QCDB 2A6LA 4BEUA 4R5EA 1PS9A 5LNUA 3B8WA 1RAKA 2ZX8A 1CCWB 1UP2A 3ITCA 4M7TA 3W70A 2CLOA 2BY0A 4W8BA 5K4ZA 2NX3A 2XFRA 5AC6A 3P3BA 4JICA 4DBDA 2V82A 1QNVA 2P53A 4Y2WA 1RLDA 1U5VA 2QDGA 4C65A 1OCJA 2OKOA 1Z7AA 3EB4A 2C0AA 1UWRA 3S9YA 3DERA 1VEMA 1NM9A 3PPGA 1FVPA 1NDVA 1RH9A 3OW1A 3NOYA 1WNOA 2KZHA 3BANA 1DL3A 4E4UA 5HJXA 2A4AA 3C2EA 4S1FA 3ZLFA 1OG0A 3MT1A 1TA3B 4PMUA 2OYMA 2X0HA 2UZ9A 5CSRA 3SAZA 3APTA 3M6DA 4ZE4A 3GXIA 3O63A 4D6CA 2O0TA 4ICMA 3A12A 3WZ0E 4D1JA 1FDJA 4GFSA 1LZOA 1FY6A 4IUOA 3TVAA 4N7QA 4L65A 3MVIA 3ZSTA 3STFA 4JS3A 3AROA 1VBHA 3WQFA 3R94A 1AA1B 2HNHA 5FF3A 2WVUA 4WX2A 1O5XA 1BWLA 1W54A 2QEZA 2CWXA 3GTXA 3EA3A 2AL2B 1EC9A 1CLKA 2WOQA 3BC9A 1KQYA 3WBEA 8XIMA 3ELFA 5ECVA 2PTWA 1FUYA 3DU0A 4DI9A 2O92A 4X0NA 1S1RA 2G3IA 2HS6A 2UY4A 4BKNA 1F6KA 3G1SA 1ZLPA 1J0ZA 1JR1A 1YPIA 2PRHA 1RCXB 4WIWA 3TK7A 4O53A 2R6OA 3WD0A 4LAOA 1WKEA 2OYKA 3BOFA 4B9YA 1VZWA 3VKKA 1GVSA 3TA6A 4KCWA 1RJPA 2D2GA 1XDMA 2MNRA 5E9XA 3W2LA 1J11A 1KFLA 3VIHA 3N29A 2EBNA 5D38A 5BU6A 2E1WA 4IG2A 3S2CA 1GGOA 1GTHA 4AZGA 3EX4A 1W1ZA 4JR5A 1BYCA 5JBFA 4A3UA 2W67A 3UR5A 1AJZA 1JI2A 4YHGA 2PF0A 1KGUA 3WX7A 2A21A 3HGRA 4IM4A 4PB4A 3BURA 4GQ0A 3H26A 3H4XA 4W88A 1U1JA 3WLQA 3P84A 3QV9A 1F2JA 2Y5EA 3PFRA 3UG3A 5GNZA 2CPUA 3BSGA 1L8PA 5EMUA 2ISVA 2PSNA 4YTUA 3UU0A 3NPVA 2F7FA 1FHLA 2FPYA 3M0XA 4H3DA 3SURA 3TC3A 3BCDA 1F5ZA 4E2OA 3IIVA 1ZP3A 5FF0A 1CENA 1Q6FA 5AECA 3FK4A 3RLUA 4E8CA 2PDGA 1IGWA 3RO8A 1AUSL 4HN8A 2H6RA 3R11A 4MJ2A 4QG9A 1JUKA 2ZXQA 3DC0A 3LHZA 3LPFA 3DCPA 3FEQA 1JFHA 5CPSA 1EJ7L 1GG1A 4EOUA 4AX6A 3MCNA 3KOWA 1EP1A 3LBCA 1VFMA 4RZ6A 2ZX9A 1PVNA 4IH3A 4X9YA 3VVGA 4W85A 3FSUA 3N2XA 2PC8A 1XCFA 4J3ZA 4ECLA 2YBVA 1A5SA 1BQGA 7TAAA 1Y5WA 1YKWA 4C6QA 3N04A 2ZA1A 3WLHA 5SWUA 4QE1A 5FOOA 3F4DA 1UWUA 4KKXA 2F6UA 2CLEA 3AHZA 5D30A 4IP7A 4JN6A 4OBRA 1VBGA 2WLZA 4QDMA 3BAWA 4DPQA 3CL8A 4XISA 3NFUA 4WY0A 1W9XA 1UOKA 4PMJA 3VXGA 2E5DA 4DM1A 2WHLA 2X16A 2I9EA 5FESA 2VD8A 1HJXA 4HTBA 5ENLA 4DO7A 4KETA 4Z2IA 4U33A 1GKPA 1L8NA 3CIVA 3N3TA 4CNSA 1QAPA 4CQDA 1YTKA 1RHCA 1XUUA 1FKWA 2RJHA 4UZSA 2VZOA 2RUSA 3TC7A 1LBMA 3GM8A 1PZ2A 4B16A 3LN3A 2ZA2A 3QY6A 2Q02A 4O14A 4UFIA 1MO0A 5HMSA 2WBKA 4LF2A 2Y8VA 4CKQA 3L5AA 3AJ7A 3W00A 3THAA 2BXYA 2E8ZA 5JXQA 1EF2A 3CHDA 3WF3A 4ZSUA 3ARWA 4CU7A 2A3BA 4MWAE 3URQA 1HZYA 4DWSD 1GQIA 1F73A 1FCBA 3LK6A 5CZTA 2CLHA 1B2YA 4EACA 4ERAA 3L0NA 4BQ5A 1UUQA 2VR4A 2ZX7A 1FKXA 4AZ7A 3M0JA 1QDSA 5FACA 1XKJA 2DSKA 2W61A 1T0OA 4M1BA 2O7SA 3SUTA 3WN6A 3AXIA 2QVNA 1GJUA 3N2CA 3NTYA 3NYZA 3I3DA 1MZHA 1UD3A 3LGDA 3A9IA 3LCGA 5LNWA 4N02A 3SEPA 4I9TA 3BCFA 3VGFA 1VCGA 3W86A 5HR7A 1HX0A 3PZUA 4HSHA 5IBXC 3G1DA 4DVOA 2PDXA 3IK2A 5D9OA 1JUEA 3GUGA 2QCCA 3KCJA 2YL6A 1BXBA 1E3XA 3LSBA 1KLZA 3WY1A 4GI8A 1SYTA 3ZIZA 2PA6A 4M29A 5LHEA 1AQMA 5CQ1A 2OSYA 1BG9A 2EO7A 4QCEA 3IAQA 2CLFA 2NX1A 1E56A 1CXKA 3E9AA 2Q3RA 3RRXA 2OLAA 3O16A 3BLEA 1U5JA 1Q6RA 2HVMA 2J47A 3EOOA 1Q8JA 3DFPA 3UXIA 3TCEA 5BNKA 1NELA 4JTQA 1XGEA 1EBGA 3GG1A 4PBFA 3LYEA 3FJNA 3H21A 1A5CA 1XSJA 5H8PA 4Z2GA 2AMGA 2OODA 5XIMA 5A94A 3F4WA 4NJHA 4YXGA 4IFKA 3UWQA 1AH3A 4F79A 3SECA 3WH5A 3VPLA 3GFXA 4S38A 4NRSA 7REQA 4DRSA 2Z6JA 6CGTA 2CLIA 2PDWA 4K68A 3NQDA 4DNHA 1O6IA 1R2RA 3MB9A 3AYRA 4L61A 3C5QA 4Q32A 5ABHA 4LCQA 4JNYA 4ZENA 1S3HA 3C8NA 5TBOA 4CNOA 3R6IA 1PWLA 4WGXA 4BI7A 1OSEA 1E4NA 2ZUUA 3UJSA 5KZ6A 3U48A 1QPNA 4LRTA 1A49A 5DELA 3DYOA 4W9TA 4DO4A 4PCNA 4O0KA 3WQ8A 1I2QA 5AYXA 3A4AA 2XZ9A 3TQ0A 4JQ4A 5D2XA 4YPJA 1CX9A 1UH4A 3W88A 4YVPA 3WFLA 1VBUA 2IMRA 1BRLA 3VD9A 1VJZA 4UIOA 5LIUX 2JF6A 2YA2A 2XVNA 3CUXA 1E9LA 3GKAA 2BLEA 4CQBA 1Z44A 3FEMA 1Q6QA 1ZP4A 5I2UA 3EXTA 3PY2A 5E6YA 2PUZA 5T91A 2Z1KA 3W6MA 4XG1A 2DQXA 1R3WA 3MJYA 5CPMA 1Y5XA 3BW2A 3TJLA 4CNNA 4EWND 3FW6A 4M82A 3VIOA 4QX4A 3EA2A 3VIGA 2PWUA 3I4KA 4WR3A 3R10A 4YYFA 1EJTC 1M53A 3T1GA 3BE7A 4CN1A 5E0CA 2ZRYA 2OOFA 4JIHA 2HVNA 3NQ8A 5EMYA 3WDPP 3GIYA 1UWAA 2J7FA 1BFNA 4RLIA 3NAVA 2R82A 4GH3A 3SIMA 1ELSA 4YTTA 4O19A 1DIKA 3VUPA 1HGYA 2YCIX 5HUOA 5I77A 3NJ3A 2RJGA 5F2LA 4YJ5A 2C13A 3SI9A 1QPQA 1XIIA 1ZAIA 4ONVA 3M07A 1AODA 2XGIA 3W1NA 3DBNA 3WH9A 4XKYB 3H8AA 2QJGA 2R1KA 2FHFA 3ITXA 2VC9A 4ZQCA 3SN0A 1V6TA 1MQRA 3A21A 5AHFA 4W5UA 1M03A 2DZPA 3WENA 1OFQA 1XYFA 4D1IA 3RPDA 1KFJA 2E5CA 2AGKA 5IRPA 3LM3A 4Q4MA 3OHMB 2QUVA 1M41A 2EXOA 3M5ZA 4HVXA 3M0LA 4RDZA 3PTMA 2NQHA 1UR3M 1H5YA 1I0BA 3VNDA 4ROPA 1CXLA 1OF8A 3WK3A 3PZVA 1BF2A 4ACYA 3PJXA 4HD5A 7CGTA 3N13A 1U1HA 1WDRA 3Q4DA 3NL6A 1HIZA 3NQ2A 4KS0A 4ZVJA 3VE9A 2PDCA 3IJ8A 5C5YA 5LSMA 4DJFD 5DRCA 3GRIA 3TN5A 3VAVA 1A3XA 4O17A 1RUSA 4IGNA 5HBFA 2WMIA 3VGHA 3B4YA 3FX4A 5FAJA 2ALDA 3VFCA 3QF0A 3RFAA 5A6BD 4TR9A 3THQA 2PGRA 1UQZA 4YHEA 1GVOA 1RV8A 2CZ5A 2EF9A 3ITYA 2PBGA 1QNSA 4HMNA 2WZMA 1DJZA 3C2YA 2HEJA 3SCOA 1PTAA 3JS3A 4FX8A 4GYFA 6PTDA 1OX5A 2PCEA 2WJDA 4P61A 2VRKA 5IDZA 1GVRA 2VCAA 2ZE0A 4EXBA 1IEWA 2YLLA 1YXDA 3SCRA 1NARA 2NT0A 2OO0A 4EKJA 2DUAA 5DF0A 1I2RA 1S2CA 4QLKA 2NVDA 4MIMA 1EO5A 1JD9A 4GBUA 3S8HA 4UTUA 4QJ1A 3OVPA 3EPNA 3CXOA 4DPPA 2OWWA 4GISA 3WNOA 4K7VA 2WAGA 3M0YA 1T41A 5AC8A 1H7NA 3OBAA 4IZGA 2VX5A 5D4YA 4JX5A 3U3HA 2FH8A 3CV7A 4HTYA 4XWUA 3M16A 4IIDA 3AHYA 5I79A 3IJLA 4DLFA 5DRIA 3KBMA 2ZA3A 3P2VA 4PCPA 3V0SA 4DZ5A 4YVVA 2IPJA 2VP8A 6ALDA 1TVLA 3GR8A 2Z27A 2I5IA 2WC4A 3W02A 4HZ6A 1TTQA 4J7RA 1JQXA 4WJXA 4V2XA 1SW3A 5A95A 2QV4A 1FWJC 3RX2A 1JDDA 4YTRA 3TMQA 1ECEA 2I5QA 5HQEA 4MYAA 4BWLA 1QI0A 2VRJA 4JNZA 2BGSA 1AQFA 4KW2A 4JYFA 5KEZA 4CD8A 2WSRA 1OEPA 2YZ5A 4IMAA 1HNYA 3HPZA 4US6A 3HG5A 2OT0A 2XFYA 2PF8A 3V3WA 2NLIA 3IIZA 3L4WA 2PDNA 5RUBA 2WMGA 1H62A 3KCOA 4Q33A 3VCCA 3QYSA 1A5BA 4CQAA 4CCCA 3M0HA 3PAJA 2PLJA 4G7EB 1H09A 5LNRA 3BMVA 4WKHA 1KTBA 4JQ3A 1GZGA 1L2QA 3D0CA 4S3GA 5FCZA 1LUCB 1J0IA 2Y2WA 3LLDA 3MV01 2XN2A 3DFOA 3LCHA 1YIXA 3CMJA 3N73A 3IJ7A 3OA3A 2J75A 1WZLA 1BSIA 1XI3A 3HQPA 3EDDA 3VIPA 3W23A 1SO4A 5CG7A 3T81A 2Y85A 2C1IA 2X8RA 2OCZA 4PUWA 3P5ZA 1SFJA 2E3ZA 1V3MA 1LRNA 3R0UA 4GXPA 3G77A 3NR0A 3P14A 1SPQA 2VEKA 2ZRZA 3L4TA 1V93A 2ZRXA 1NOWA 1O60A 3H54A 3E74A 3T2QA 3BGGA 2QHAA 1ME8A 3N19B 2GJRA 1H1ZA 5AYYA 1CLVA 3POCA 4P7NA 2QW5A 2A1YA 2YXXA 3EXSA 1ODUA 3ZR5A 3DC8A 1F9CA 5CBBA 5A6LA 2VZUA 4LAKA 3GH5A 3QV7A 2ISFA 2E9LA 1JPMA 1SR9A 2W3ZA 4JIRA 1KXVA 4HHPA 4GABA 1B30A 3M5YA 4WVXA 4JHMA 4WDTA 2GJPA 3TH6A 2Y5JA 1D7FA 3DOPA 1KRAC 4AYGA 3IVTA 3OO2A 5J5DA 3LRKA 4JIPA 1UUOA 2CLMA 2IPWA 3NQ6A 4JYDA 4FNRA 3LNPA 3U2CA 1VJSA 4ZMGA 1W3TA 5C71A 2IS7A 1EPXA 4LBUA 4AC1X 1HKKA 4OVXA 2YDQA 1US3A 4QLLA 3TONA 3LGEA 3FS2A 4PC8A 2HROA 3IJIA 4BQ4A 4A8RA 2CLLA 4EF8A 2VENA 1Q65A 2ZZ6A 4OZOA 3VGEA 4F0MA 3TYDA 2PODA 5CPLA 2X2GA 2OKTA 1WAUA 1DQXA 4NI3A 3OVQA 2YCLB 4UNIA 1Z69A 3MUIA 3R89A 2D2OA 3UZ5A 4A2SA 1ONWA 1MMFA 4O1BA 2QV5A 3LTYA 4MY1A 3W2MA 1D8CA 4LQ1A 2QNEA 5J8LA 3TMLA 3KAOA 2YXOA 3W24A 3VDCA 3C0LA 1CI1A 3RAOA 4AD5A 3V0UA 2ZUSA 1FH8A 2J7BA 1RA0A 4JFUA 1YTDA 1LWJA 3E02A 5I24A 3QTGA 4NF7A 3MCMA 4FNQA 2XH0A 1GJPA 4O50A 4W8AA 4S3EA 3WQGA 4JD4A 5JIWA 4GINA 5CAHA 3E6EA 4HK7A 5IFTA 3TXVA 5A1AA 1NOUA 1Q6DA 4MWAA 3N4FA 3SCUA 3F2BA 2FTPA 4TTGA 2DUXA 1XIGA 1K9FA 1VYSX 1FWRA 1RVKA 4HCHA 4ATLA 3G1RA 1JDFA 2OX1A 2WMFA 2XVLA 1V02E 4C6JA 1VQTA 2SFPA 5LYRA 3WBAA 1SW0A 2V38A 1X8FA 5C54A 5G2HA 3TTQA 3UP8A 2ZIDA 4WOZA 2NQJA 1XYZA 2FVLA 3GHTA 4JTIA 4S2CA 3ES8A 1K3UA 1H0GA 4UQBA 2V2CA 4C6CA 5AC7A 5BWAA 4PN2A 1R3YA 1ZNNA 3GG7A 4W93A 1REQB 1X96A 4K3ZA 5BZAA 4M6UA 1LLZA 3GXNA 2DQWA 4JCLA 3VNYA 1E40A 7PTDA 3NPUA 1EEPA 4AYSA 4UTWC 1UR1A 3OVGA 4HQVA 2WJEA 1HN1A 2V5CA 2TPSA 4NNBA 2YKKA 3AXMA 1H7OA 1WUEA 1CNVA 4XAYA 2DIKA 3M1ZA 3OLIA 1VH7A 1VRXA 3AAMA 2ZUWA 4JQAA 1C29A 2E5BA 1NP0A 3VNJA 3TLLA 1NAL1 5PTDA 1DP0A 3QBUA 3KEHA 3PBWA 2DZVA 4I8DA 1FXPA 2W63A 1KC7A 1IEXA 3V75A 4J3WA 1TV3A 1SJDA 4AG0A 3BVJA 4QSHA 1DHPA 2OLSA 4DWSA 3N6QA 4J3XA 4D9PA 3TYAA 4NXSA 4OFCA 4QHRA 2VL4A 1P0NA 4UOQA 3VMNA 3KP1A 4LC8A 1A5KC 3SY8A 1F07A 4KPLA 3IV8A 3K46A 1J0YA 4NASA 2DZTA 2W62A 1B4KA 3LGGA 4D8LA 5C7VA 3WQ5A 1D7KA 3OZOA 1UR9A 4R85A 3E1F1 3ZR4A 3NCOA 1H61A 1RXOB 4HZ7A 2RKXA 4O57A 4MLRA 3KCLA 2A3CA 1EB3A 3EBVA 5EMMA 2PDYA 3W1XA 2ZZ7A 3KVLA 1Z8AA 1W91A 2ZTKA 4L5ZA 4WZHA 2G97A 3ID7A 1N8FA 3RX4A 1V0KA 3W7HA 2WV8A 3VM5A 1HO1A 4U3CA 3T78A 3FA4A 3R0KA 1ADOA 3F4VA 4OBSA 4XSMA 4RR4A 3RMJA 1UZDA 5KSWA 3A3WA 1HL9A 4Q8QA 1QOQA 5A6AA 1VIWA 4O16A 3P60A 4NZ5A 2EPMX 3QFWA 2YZRA 5K2ZA 2VNCA 1R8LA 5FEWA 1JF5A 1O4UA 3J7HA 1RBLA 1UD4A 4XZBA 1OADA 1KM3A 2JEQA 2C3ZA 4CU8A 4DJED 5HANA 1G01A 1XIEA 4HA4A 1F4AA 1KQZA 1OIFA 1JCTA 4O1AA 3LQGA 1A50A 2GYIA 5AHIA 1L6YA 2DORA 2YPIA 3KHJA 4W84A 1ZBWA 5KZDA 4UTTC 5FF4A 4J5NA 4IPIA 4KFPA 4Q3MA 3TNBA 2O4MA 3HURA 5DMLA 3ZT6A 2ICSA 1LBLA 3VD4A 4LF1A 3O05A 4A29A 2FDSA 3CK5A 1QWGA 4M81A 1Q2RA 3WH8A 1B9ZA 4UTKA 4HOWA 3N3MA 4P7RA 3UGVA 4MADA 1KB3A 1LF1A 4DF0A 3THUA 2XU2A 1JL8A 5G2WA 2FDMA 1UD2A 2PWGA 1ISZA 1JZ7A 5I00A 3HJEA 1W0MA 3QPEA 3F5JA 4MF4A 1QI3A 3AU6A 3UCDA 4MDOA 3U5YA 3B03A 2PZNA 4XAPA 3GO2A 2VR2A 3R2GA 1AD4A 1SO3A 1OB0A 5EPDA 3WDJA 3UBPC 3RK8A 4XO7A 4RV8A 2XIIA 3TN3A 4C6DA 4N4QA 4OTKA 3UR2A 2DIJA 4JN7A 4KWWA 1AFSA 1H50A 1B57A 2Z2UA 1FWHC 4F48A 1TFVA 1EOMA 3L68A 3L65A 2O7QA 3BV7A 3HFTA 1RP8A 4B90A 1B3ZA 1B5TA 2HXTA 4MAZA 2JKEA 3UXKA 3ZLHA 1ICSA 2HV5A 2ABAA 2Z29A 2BHUA 3SQSA 1VCVA 5ABTA 1DWGM 1BYDA 4ZFMA 3WO8A 2RDXA 1JGIA 3RCNA 1B90A 3DECA 3PBUA 3CQIA 5I06A 1ZJHA 1PHWA 4Z17A 1VFTA 2G3JA 4H01A 1RK6A 3WJXA 4NIRA 2QVHA 3BOLA 4QROA 4ZB0A 4MB1A 5CXPA 4I90A 4L7ZA 3VK5A 4PUNA 1TE1A 1PCWA 3AIRA 1W3KA 3TP4A 4IGHA 4CU6A 1GQLA 2GUUA 2DU2A 2WJFA 1LOLA 1H1NA 1PYMA 1J96A 4Q4SA 2VFEA 1HJSA 1B3VA 5BRBA 1J10A 1V8EA 2VCCA 4PMXA 3ORWA 1VD6A 4AXNA 2BGQA 3PBYA 1PDZA 4EIVA 4DBWA 4M0XA 3HGSA 4DJDD 4DO5A 4GCXA 3T4WA 5EMKA 3T0AA 3OZYA 3G1HA 3GK0A 3N6JA 5M3WA 2FYMA 4QG6A 1QNOA 1DJXA 7XIMA 4KRUA 3GC2A 3N25A 2J7CA 4DBEA 2VGIA 4MZ8A 4QS5A 2IW0A 3MMWA 3M7WA 4L4LA 5I02A 1QFEA 2HJPA 1TYGA 5FL0A 3E5PA 3WDRA 1S5WA 2HPIA 3LNMA 2HISA 1X1NA 4ASTA 3ZYZA 4DZHA 2PC4A 4V15A 4M3PA 2R1PA 2Y89A 3GX9A 3F2DA 4AZCA 3CHCA 4E6MA 3W37A 1XKYA 3UWYA 3WJSA 4DJFA 4PRTA 3VCNA 2J7DA 1EQPA 1ZZMA 2Z1XA 3W7GA 1W31A 1GOWA 4F0HA 1AL7A 2NVAA 1I9CB 2JIEA 4ZQMA 3S6DA 1EJUC 4HHLA 3W71A 4Z2KA 4NKCA 1YBQA 2GVYA 4MKSA 1K8CA 1DWIM 2ZZ2A 3AFBA 4PYSA 3CHEA 4IJCA 3LHWA 4GRSA 5CZKA 7ODCA 4MB5A 5E0FA 5AB3A 1XLBA 4RX0A 4GYPA 5KZEA 3W72A 4LT9A 1FH9A 1EJXC 2ZE3A 1JRCA 4IFOA 5CSYA 3UPWA 4MGGA 1QW8A 3GE7A 1XRTA 2WLYA 2XYLA 3ZT7A 3S6OA 4OU1A 1XX1A 3QMSA 1UKOA 4H9ZA 1LBFA 2CESA 2C1HA 1YEYA 3REQB 1UB3A 2E1DA 3DFYA 2JIWA 2R9RA 3BSHA 4CUCA 3CWOX 4JTSA 1E5NA 1XLIA 3ZLGA 4MUZA 4F40A 3LD5A 4TX6A 1PJ9A 1V77A 4MKVA 1O66A 5MKGA 4GG9A 2VFFA 3M0VA 1C9WA 4FNUA 3KFTA 4P7LA 3PM6A 3AIQA 1E5JA 2VOTA 3KLKA 4B2DD 4A35A 5LIYX 1XBXA 1OD0A 4JTCA 1WOBA 1ONEA 3O0FA 2IXVA 1SSDA 1TV7A 2BTMA 1UROA 1XC4A 4UMAA 1P6BA 1XIFA 1ZALA 3WNMA 1EKOA 2XIOA 2RAGA 2ZYFA 3B06A 5LNVA 3MO4A 1US2A 5T26A 5G4HC 2QCNA 1KV5A 4EXQA 4RE0A 4IL2A 1PWMA 1KXHA 2ZZ1A 2WNQA 1EUAA 2XGBA 2BVWA 4Q8WA 3ZWSA 3UWVA 3W38A 4HPHA 3CLMA 1UBPC 3PZGA 4UUIA 4O15A 2GLKA 2EG8A 3W7CA 4MB4A 1ALDA 4OECA 1MQQA 4K39A 2PDMA 4QR6A 1A5OC 2FPTA 5IOBA 1GVEA 4GI6A 3OU8A 4F0KA 4MB3A 2V9DA 4LCSA 1QT1A 4LS1A 3VKJA 3OEXA 3QGVA 2Q01A 3TZNA 3A22A 3WNNA 1RVGA 3AS1A 2ZZ4A 1E9YB 4C6BA 4Y7EA 1S5MA 3BGAA 4RJEA 2ZVIA 3UW6A 4Z1AA 4WDXA 2JKPA 3P5YA 4UB9A 4RL3A 1OFPA 3V5OA 1ZHAA 4I5UA 2J74A 1UKQA 3DFNA 4ACZA 4FEZA 3C2OA 3Q94A 1I75A 3VNIA 3B8SA 4IIHA 4ZFCA 3C86A 3QEZA 3FJLA 4LY4A 4IPLA 2V2HA 5FKYA 1AH4A 3GVRA 4J2PA 4JX4A 3ES7A 3GHUA 1SU5A 1EYEA 3H2EA 4IP4A 4LALA 4WGHA 4XZLX 2TYSA 3LRLA 3MI3A 3SCQA 4LRSA 3DESA 2J77A 3F5KA 5DCBA 1KD0A 2RGMA 1ICPA 3I3EA 1TR9A 3NO5A 2PI6A 1P1MA 4KEUA 2QPSA 3BW3A 1KFEA 1ZY9A 2KX9A 3CPGA 4EPBC 5C6MA 1XYAA 1A0EA 3M43A 3MP4A 2J7EA 1Z3NA 1FWFC 5CGTA 3SQLA 3DDMA 2WC7A 4F0LA 2QCDA 8A3HA 4L4OA 4KWOA 4WJEA 1QRQA 1K6WA 3VZXA 2DSVA 4S39A 3WMSA 2XFFA 3WQCA 2Y7FA 3M9YA 2ZWYA 5CPQA 1HKJA 1WE5A 3ITGA 4NZJA 1B0IA 2FFIA 2YX0A 2Y5SA 2CKRA 3QXBA 4A3YA 3DUGA 2CC0A 3NNTA 3EWBX 4GUIA 3MO7A 4LUYA 5D2WA 3BAJA 1HJQA 4U4MA 2JBMA 4W7WA 1UWTA 1VCFA 2YR1A 3PAOA 1DJWA 1TA3A 3SCVA 1CZ1A 5HWMA 2GFTA 2XISA 1PZ1A 4JTRA 1XH0A 2E6AA 2Z25A 1TKKA 3B8UA 1R9ZA 3IJ9A 3V4BA 3SRDA 3H2CA 1W9PA 3WBYA 2E09A 3P0XA 1DORA 1VLIA 1B54A 1XISA 1KBKA 2W0UA 4ZE5A 1C7SA 5BU9A 3NPWA 1SO6A 1ZBCA 5REQB 1SW7A 1VFOA 1XCXA 2HBXA 2FZ9A 3HMJG 4AX7A 4UWMA 1UPPA 3C0SA 5BXRA 4UMBA 2W79A 1GEHA 3W2JA 1PX4A 1JF6A 2VM8A 2VDIA 4NAFA 3AWOA 4QCFA 1J4EA 2YSWA 3W7JA 3MKKA 2PP0A 3B97A 1FOBA 1VPXA 4RDYA 3AZSA 2VX6A 3NL2A 4FA3A 4XIMA 4AD1A 1E4LA 1NWRA 4K8GA 3EOLA 1QW7A 2V3FA 4AZ5A 1DKWA 2EHHA 3EWCA 3MBFA 4HMCA 1NDWA 2XH4A 4B92A 4JOMA 1EIBA 1JNDA 1W3NA 2D2HA 1K6AA 1Y7VA 3KTCA 2HNEA 2PD9A 4RK8A 4AUBA 3T09A 1AK5A 2CETA 3CZGA 1K03A 4IJBA 4IXXA 4LB3A 1MEIA 3HQ1A 1R86A 2QF7A 3M0MA 2YCEA 1F4HA 2UV8G 4MOZA 1CGYA 4UTIA 4YTSA 1ZB5A 1C9DA 4GC4A 3LCLA 3HG3A 1HT6A 3INPA 1PTGA 4DUXA 3O7UA 4AY7A 1MUMA 3LCFA 3HJZA 3VGGA 3ZVHB 3BZGA 5GVJA 2VGGA 3UWWA 4U28A 3URBA 4K1GA 2EJ1A 2PGEA 3WEZA 3GC5A 1MW2A 2GSHA 5HUPA 1TIWA 3QGAC 2BODX 2C16A 2ZZ5A 1KGXA 1TUFA 2GVLA 2BASA 4PMOA 3GTNA 2MUCA 4DNMA 1MXSA 3S1UA 3GUWA 3EMCA 3VIKA 5M2FX 4H8NA 1S2AA 2J9XA 4OV4A 2FLIA 4IIFA 5J5RA 5G2IA 2OSXA 1DWAM 2WVTA 1XH1A 2DVUA 2FTYA 3OZMA 2PZ0A 3I6EA 5CC5A 3FKKA 2R94A 1TWWA 3PPFA 4LVGA 2X40A 5CPTA 3P93A 2YDSA 1RK5A 4LBRA 2TSYA 5GQBA 3CUGA 1SJCA 1SUXA 3APGA 2NUYA 1EX5A 4H7ZA 1R87A 5DFAA 1E0VA 4LPCA 4JFVA 5JUVA 3BPWA 1Q5MA 4H9YA 1QI2A 4IMGA 3SJNA 4US5D 3BZJA 4A8LA 4D6FA 1E15A 1UG6A 3DHFA 5L9FA 1IXOA 3PUOA 1JGMA 2Y1HA 4R33A 3V16A 2CITA 3IIOA 3LXCA 4O28A 1GYMA 3WG6A 5KTLA 5D33A 1WXYA 3IPWA 5H6HA 3PWGA 2QUMA 1XG4A 1PEZA 1VC4A 1EGVA 3IGSA 1CXHA 1IXPA 1FWDC 1GJWA 4L1GA 3GKFA 4LAZA 1H0IA 1YYAA 2BHZA 4GPNA 3ARRA 2GGHA 4J9JA 5BW6A 1QHOA 4WF7A 1JDAA 4E8GA 2GGIA 1CXFA 3AS0A 2C6QA 4CVUA 4YNGA 1R3QA 4AC7C 1GVQA 1CPUA 3WLOA 2AKMA 3LXAA 1OHLA 5I3IA 4DJEA 4E38A 3B9OA 4QJ3B 2YFOA 4AEOA 2VRQA 1QR7A 3IARA 1UMLA 3RCYA 1TE6A 1TJ1A 5JVLA 3VA8A 2XJ7A 2CBVA 4DYKA 3MUAA 2V67A 2PDKA 4IG2B 3KWXA 3H2NA 2F6KA 2R1NA 2RDWA 3HU7A 2Q8XA 5IBXA 3B0VC 1HW6A 3M0ZA 4HNOA 1UBSA 1WOAA 1HKMA 1ODZA 4MZYA 5CZ0A 3BGJA 4ZZ9A 4JTHA 2ON3A 5A3HA 4B4FA 4TQTA 1LORA 2QUTA 4H9UA 3I7SA 4PTMA 2VX4A 4LWWA 4JBRA 5A8MA 3VABA 3CAQA 3LPPA 4NZCA 5GJPA 1IV8A 1RA5A 5ABFA 1XIHA 2VEGA 4PMRA 5C0QA 2ACSA 1XLJA 3TSBA 3DYPA 4A6GA 4DQWA 1Q6OA 2OFJA 4OKDA 4UFMA 2C14A 3S0CA 3MKCA 3DN5A 2V3EA 4FLSA 4KRTA 4S3FA 3SGUA 1AW5A 3LHTA 2WW5A 2XGZA 3LUTA 2DV0A 1JEZA 1L2UA 5A6KA 4I7WA 3UG5A 3XINA 2VR5A 1LOSA 4GIAA 1T5AA 3MSYA 1UR0A 4UOJA 4JZ5A 2WMHA 4FOUA 1YQ2A 4HNCA 4Y9PA 4MSSA 5HNRA 4S3BA 3C0JA 1XL9A 3Q67A 1ITXA 2G41A 3OOQA 5D03A 2DVTA 3ITTA 1DWFM 3ICJA 3OVRA 3FN9A 2B7QA 2V63A 1S46A 1TJ2A 3GH7A 2PEVA 4YS1A 3GNOA 3WNPA 2P8BA 2PDFA 3WYZA 4ERIA 3AWNA 1NF7A 4F3HA 2PTDA 4GVFA 3RM8A 1P0KA 1TX0A 4KCTA 3IIXA 2PDBA 1TO3A 3QLLA 4DBSA 1P6CA 4IPNB 4ZB2A 5CSUA 4LUTB 1J93A 3KHDA 3F4NA 4UFHA 1BTMA 2DH3A 1TV8A 4KBXA 3H4WA 5E93A 3CMFA 1GWJA 2RGLA 2W5FA 3O2LA 2NQLA 3DI0A 1GQNA 5FL1A 3LQLA 3PZMA 4TVUA 3VMPA 5CC7A 1FWAC 3RCMA 1FP9A 2XM2A 1DPMA 1YPFA 5LXXA 2HXUA 4IWWA 1S2TA 4FK9A 3WDQA 4AU0A 1W2VA 4OJYA 1Z48A 4K8EA 2BY2A 1TCMA 3AS2A 1RBOB 5T8GA 1J2WA 2FHBA 1F6YA 3AOFA 1T8XA 1S38A 4DJDA 1XC6A 5DCEA 2AKZA 1Q85A 3CIXA 5AHEA 1I2NA 2VD9A 2UBPC 3TSDA 4M24A 3TKFA 4EWJA 3K1GA 1EP3A 1Q6CA 2H3DA 4GGHA 4GZEA 1EJSC 2E6YA 4PUUA 5JIPA 1F3EA 4O1DA 1UC5A 2Y61A 3DI1A 3HV9A 5C8BB 3WQWA 2A85A 3SY1A 1SSGA 4PUKA 3K1DA 3V5CA 1O1HA 3V5FA 1H7WA 4F2BA 3TEVA 1E9IA 4LANA 3KBNA 5HWNA 4OUIA 4M19A 3U57A 4GY0A 1H2JA 4U2YA 2J4GA 4LVDA 1W3IA 1H41A 1QCWA 1DIEA 3W26A 3AYTA 3WLPA 4G1KA 1UYQA 3FAXA 1UKTA 1QNPA 1NWTA 3LPOA 2Y7DA 1EIXA 4QRNA 4AD0A 4C7FA 3I7QA 4H6QA 1QXLA 2WPGA 1JG9A 1M7PA 1KV8A 5CAKA 1VFFA 2DW6A 3CQJA 1W9BM 5AY7A 1MUCA 3LU2A 3JUGA 1LLWA 1ZJBA 3RJYA 1FTXA 3O6YX 1M65A 3DIPA 3ARTA 4I3GA 4RKAA 1UW9A 3GC4A 4V1XA 4AWEA 4ROQA 1H3GA 1A4MA 1XSIA 2PLMA 4UNKA 1E0UA 2Q8LA 3TTSA 3TW7A 4GUGA 3P6LA 4AZHA 2QIIA 3W7DA 3CQHA 3G0UA 2FB3A 3T2PA 3RXZA 2XIMA 1OT2A 3WUGA 4BJHA 4FX6M 4Q8TA 3IWPA 3I65A 3W7KA 4ZODA 1MZRA 3AJXA 1JPHA 3TAKA 4XKYA 1CLXA 3KOFA 4HA1A 1PKLA 1PX8A 1PZ3A 5TNVA 3VCRA 2OTDA 2I57A 3B0XA 4IIGA 3NWRA 2B4GA 2YYTA 2Z7KA 4FXRA 3GVVA 2ZC8A 4WDUA 1TTPA 3VX0A 3S2JA 2UWFA 4IFKB 2GGJA 1MYRA 1SJAA 1XFCA 4V27A 2NZLA 2O9PA 3BG9A 1VEPA 1FWNA 4PODA 4DUOA 2Z6IA 4NSBA 3NXLA 4GD0A 3U2OA 1PZ0A 2OPJA 1X39A 3ARYA 3KOZA 2VC6A 4PUJA 2NXIA 4GNKB 4GX9A 1LQ2A 4DB7A 2QJJA 4EAYA 2VO5A 5CJ5A 1R3SA 3V1HA 1A5AA 5AHMA 5KETA 1QHZA 1XLFA 2Z1VA 5GNXA 1KR1A 5H91A 3RILA 3W29A 1BLIA 1WAWA 2XG9A 2PCQA 3AUOA 5A69A 4OOUA 2PRMA 2HE8A 3KOXA 3W7PA 3R4IA 1LQAA 5TAOA 3EWXA 2QDDA 2VYOA 4EK7A 3OQ8A 3E3HA 4GO9A 4D8ZA 3OGSA 3FYYA 3IVUA 3O8AA 2E68A 2OR2A 1NQKA 1H60A 3TU9A 3VUSA 3AMDA 2I1OA 3OYZA 3MI2A 4FIRA 1K7XA 4AD2A 1EA9C 1YW1A 3NA8A 4AXKA 4LV4A 4WJ8A 3UD6A 3A24A 2Z2BA 4M6VA 2C15A 3STEA 5BWFA 3FXYA 5C9XA 2WZEA 4C5YA 3T07A 4ZTXA 4XAFA 2NWSA 4YWSA 4PCSA 3PWAA 1LG2A 1BWKA 3H53A 1XV8A 3T4CA 3T0CA 4P8XA 2IKIA 3OZPA 1KWGA 1XP3A 2PTXA 3I6TA 3RNDA 1G94A 3CV2A 2PS2A 4KCUA 2OQHA 2H3BA 5GJMA 2ACRA 1L6WA 3DEQA 4EANA 2VWSA 4X9SA 2PGWA 4LW7A 2Z28A 3WLLA 3GAYA 3M5VA 3ALFA 2ACUA 1BGGA 1BG4A 3AIUA 1QW9A 1Q4WA 3GW3A 4TTUA 3EOUA 5DQPA 3A9BA 4QLJA 1CGWA 3GNNA 2QULA 4CNTA 1CEOA 3WLSA 4WXYA 2PPGA 4CD7A 3K8KA 1DOSA 4Q7BA 4NAEB 2CZFA 3GXTA 1I6NA 2X1UA 4NXKA 5I03A 1CXIA 3TR2A 3RPMA 3KWSA 1TZ7A 1FCUA 2ZRVA 3OB8A 4ZL1A 3MA8A 3ZFHA 1M04A 1XLKA 4MDPA 3W81A 1IEVA 4OE7A 3T8LA 3A3HA 4URIA 3B0UX 3A4XA 1XWYA 1J12A 1J5TA 1XLHA 4F9JA 1PX3A 1J6PA 1TTIA 4XZMX 3CYJA 3H7RA 4MNMA 1KM6A 3A4WA 1ZJIA 1EHAA 1AW2A 3UNTA 3MZ2A 2G4JA 4ML9A 1MSSA 4UTMA 2D3NA 3MMDA 4KRZA 2V5BA 3E2SA 3AQUA 4WSHA 3NDYA 1TPDA 2BVDA 3MUY1 1OGSA 3T0DA 3UCCA 1A3WA 2TODA 4O0QA 2ZX5A 5F1UA 3P0WA 1RLCL 3U8GA 4F66A 2VVSA 1LLOA 3VC5A 2FPVA 2GOKA 1KW1A 4HMEA 4GO8A 1U22A 2IPFA 4G7EA 5DBTA 1CECA 5CEWA 1R85A 4XAGA 1FWCC 3E2RA 3TR9A 5I7GA 4AVFA 2WMIB 1L0PA 4KIEA 4GXWA 3HQNA 1LUCA 1JDCA 2ZQ0A 4Z0SA 2NV9A 2DP3A 4IJRA 2DDXA 2ATMA 3C3UA 4XBSA 3LPGA 1JZ4A 1Y8BA 3NG3A 1TPUA 1W3LA 4DHGA 3UYCA 2Z00A 2ZCGA 4KESA 3OG2A 1EPVA 3HPFA 3E0IA 4O0ZA 1E51A 4O1EA 1AD1A 4GIYA 2WC3A 2P76A 4S23A 3MMUA 4C6NA 5E09A 3SR7A 4XD5A 1VPQA 3A13A 4XAZA 5FSDC 3MUZ1 2POTA 3AMGA 1DXEA 4HMDA 1BHGA 3E5BA 1VB9A 3QMRA 3L23A 3EX2A 4K1WA 4IT1A 2YCKX 2QDEA 2WM1A 4WKFA 3OLDA 2Y63A 4MNJA 4QAIA 2CZVA 3GG8A 4UFKA 3NYDA 3W1RA 1R0MA 4Q4PA 2C71A 3AHTA 3F4CA 3P82A 4JEJA 4ZA0A 1XFBA 3U5UA 4C6EA 2V81A 4JEQA 1WYIA 2CKSA 3W6YA 3WL1A 3LENA 4WRHA 4HP5A 4X63A 1K9TA 3AIWA 1Z6KA 5DMMA 1FHDA 1TMLA 1XRSA 1TB3A 2EPHA 1P0DA 1C7TA 4EP8C 1HKVA 3IGXA 2GQ3A 4DXKA 1XUZA 3HIJA 3SCSA 5A8OA 2XTKA 4UQ9A 3MYPA 1F74A 4HYWA 4U5KA 1XXXA 1WO2A 4GVHA 6TIMA 2PWVA 4TO8A 4NRRA 3T0TA 4GZJA 3BOXA 4JNMA 1IEQA 3GY1A 5G1MA 1QOXA 4JKKA 3MP5A 4FR1A 4F2UA 5MF5A 1C8QA 3A6OA 1AL8A 2ZADA 2GJXA 3GNXA 2VEFA 2XH7A 4Q4QA 1OFBA 4XUYA 3SUUA 2A5HA 3P7YA 3UETA 2ZUTA 2HK1A 2WQDA 4AH7A 2OELA 2PTZA 4J3SA 4BF7A 3N11A 4AIOA 3GLCA 4GLEA 4MLJA 4MM1A 1TWZA 1PYFA 4UFLA 6REQB 1JI1A 2YCLA 4PL1A 5EFFA 3Q37A 1X98A 4S3AA 2YL9A 1V6XA 1UHVA 4GH1A 3GYCA 1DWJM 3VDHA 4BR1A 4IP5A 1JPDX 5H8MA 1FFRA 3F5LA 1GG0A 4B5XA 1GTEA 4O8RA 4BWLC 2CHOA 1W3HA 4NU7A 3EYPA 4GZ7A 1KRBC 5G1YA 3LI1A 1JZ2A 3CL7A 2NT1A 2YW4A 4LX4A 3WQEA 3BDKA 4HZMA 2DY3A 3GNPA 2X05A 3P81A 1DJYA 1ONRA 4E4PA 5BXSA 4KEMA 2WCGA 2QAFA 2FMNA 3EB2A 2B7OA 3R13A 4XD4A 1TPWA 3W22A 4ADSA 1GQKA 2CBUA 2AQVA 1GVYA 2B7PA 4PEKA 1EL3A 3BH4A 5EFDA 3CAWA 1X6UA 5B80A 1FHVA 1TZ9A 2R1MA 3KZPA 1C8XA 1U33A 1TTJA 2VFIA 2YYUA 5TQLA 3H23A 2VQTA 4J40A 4AHQA 3IUHA 2EKCA 1ITUA 1XD0A 3L7RA 5BROA 3VD7A 4I7UA 2DGAA 5HJLA 4AZBA 4LSBA 4F2TA 1ZQ5A 4AQLA 1UJQA 1K8ZA 2E40A 2C79A 5AHLA 4E0CA 2E4TA 3RITA 3W01A 4GACA 3F7JA 4JFWA 1Q4NX 1E1EA 3CEPA 3NOEA 4PFMA 3B8TA 2P10A 2HDJA 5EKYA 4B5UA 3NQ7A 4NZ4A 4C7GA 3N9RA 3NSXA 1QASA 2AMXA 4LFYA 1OX6A 4OQVA 4WXZA 4LYRA 1Q13A 3P74A 3LCXA 2GDQA 3AMLA 2QXWA 3LHUA 3EB3A 3CUIA 4NNAA 2QZRA 2CHRA 3HQOA 3BJSA 4P8VA 1W2PA 1V51A 2OZTA 4RNIA 3M5XA 1FX6A 1ZCOA 2CHNA 2WSQA 4DO6A 4YLWA 4H2CA 4BEQA 1DTNA 3S9ZA 2X1SA 1QPKA 4AIUA 2XN1A 5DX7A 2CERA 3TWAA 4G9PA 1G7UA 1ZTVA 2I9UA 4TX8A 4UNLA 1V3KA 4L9YA 3S1VA 2V5KA 1HP5A 1PBGA 3MV11 3PSVA 1GK8A 2D69A 1O5KA 4B5SA 1K7FA 2DSWA 1B1YA 1T96A 3DX5A 5A6MA 3QZ6A 2D0FA 4AF0B 3PB2A 1A5LC 3GG0A 4NHVA 3LOTA 2Y62A 3TC6A 1JZ3A 3WF2A 3NQGA 4A3RA 2VUYA 4PZVA 1YE6A 1W6TA 4K2SA 3ZO9A 3GIQA 2CWNA 4BS0A 1D2KA 4FLQA 3ZS4A 3LSCA 3FCPA 3NGJA 4W4QA 3VOIA 3QZAA 2AAMA 4MWAB 5XINA 2JALA 4BHYA 3CUJA 3CJPA 1GPWA 5D9MA 5IFPA 4ATWA 1BWVA 2GOUA 3IJQA 4FNPA 4GC3A 1ZU8A 4QXIA 3NGFA 3C2VA 2CYGA 1QVBA 4C6MA 3WD4A 1KBIA 1THFD 1KLYA 3S3GA 4W89A 4JAWA 5T9CE 5FI8A 1GKQA 1V5XA 1KBLA 5D9PA 4PRRA 3W1PA 4F4RA 2WXDM 3VIMA 5M1TA 3R7MA 3B9AA 2X41A 4LCRA 5DLCA 4NZ3A 1V03A 3WD1A 3W83A 3QR0A 7ENLA 3IRDA 2D2JA 3PBVA 3UPMA 1EZWA 1W1VA 4GYKA 3PFMA 2A3EA 3T55A 1W37A 3RO6A 1KO0A 4MWAC 3MVTA 3HPAA 4BZYA 5I78A 4AVNA 2P88A 2HPMA 3W2NA 5K4XA 4IHCA 1XSKA 2YGYA 1ZENA 3A47A 2NQZA 3OHIA 4Q8VA 1QUMA 2PP3A 4GJJA 5HAOA 3WQVA 3LX9A 1JJKA 4Z1DA 4JX6A 4L1WA 4KGJA 4PBEA 3W82A 2J24A 2CZDA 3S5NA 2RFGA 1BAGA 3G1XA 1VENA 3KL3A 3CWHA 4L4MA 2XPKA 4GUJA 2PP1A 5XIAA 3WH7A 3UZYA 4GQBA 3WK0A 3D47A 3OODA 4HPJA 3E96A 4PL2A 3G1FA 3W73A 4I9JA 4Z1CA 5D37A 1EWEA 5DANA 1Q7MA 4A3QA 2F6XA 2DZSA 2XWEA 4LU0A 3RM4A 4Y9NA 2I14A 3KBWA 4PTVA 5H2ZA 4IFRA 2D23A 1FRBA 1OVDA 4AMCA 4GZIA 3CLWA 3BUVA 4Q6JA 4DWSC 3EZ4A 4GIRA 3KRZA 3UWEA 2W9MA 3QV8A 4KWSA 3VTRA 3GDRA 4GBDA 4X0VA 2EAWA 3PUGA 1BGAA 4QQUA 4PSRA 3VFLA 1OFEA 5D2YA 5L6UA 1NEYA 3CTTA 2J79A 4JY8A 2CNCA 4BQ3A 3FHQA 1O95A 1X1ZA 4QISA 4L80A 1J6OA 3GXPA 4B91A 2OX4A 3Q2DA 4QE5A 3ANVA 3H55A 1H5VA 1XYCA 2OEMA 2REQB 1XPYA 1V3LA 2G3MA 5AVHA 3S2NA 3RLGA 4IQLA 2YXGA 1NP2A 1OIMA 3UR7A 1JCMP 3UFYA 3G3DA 1M1BA 1UCWA 2B81A 5EY5A 1HKIA 3GBDA 4KWVA 3BLKA 1Q2SA 3LZ3A 3CV1A 2DZAA 3S6TA 6XIAA 2FIQA 1KNWA 4K37A 2HK0A 2ASHA 1OK4A 1B9BA 2OOGA 3IUDA 4BY3A 3KE0A 3IRSA 1MW0A 1T6MA 3ZJKA 3R8RA 3U6WA 2QUNA 3VO0A 2DJLA 2QJIA 5C2CA 2OO6A 4FP1A 1KBJA 4HHHA 1YNYA 1DXIA 4FALA 3PZNA 1V6YA 4DF2A 1JXJA 2NQ9A 1XDLA 3CGTA 4GYJA 3NO1A 4RZ5A 2A2IA 1TIMA 3WDHA 2A79A 5I3DA 1R5YA 4WSKA 1VIZA 3M0KA 3NURA 5IDIA 2J9ZA 1YXCA 4HPXA 2JGYA 1A3HA 2HQAA 4NUWA 1O5RA 4IQJA 1S2UA 3GU1A 4Q7IA 4L6OA 3NQFA 4NILA 4MG4A 4IQDA 1KFKA 3BMXA 4FAMA 5GPRA 3BG3A 3W27A 3L0KA 2ZXBA 1F8IA 4GUFA 1RD6A 1IWPA 5TD4A 5I09A 1CB2A 4JY9A 5HNUA 3R8HA 4WEVX 1KGWA 1JZ5A 3FY1A 2NUXA 3HPSA 4HGXA 2V5JA 1EUNA 3S5SA 1TSIA 2OG9A 1JVNA 2VZSA 4KT2A 2BFGA 3LHYA 1L6SA 2UY2A 3REQA 2Q8ZA 3G1VA 3UZZA 1BF6A 2WSPA 4QDWA 4AD3A 4TXEA 2Y8UA 3QC0A 3QFEA 5HINA 4DWDA 5AVNA 2EKGA 1T7LA 2VC7A 4TVCA 5I0DA 1GCYA 4C6KA 1C93A 4KERA 1UH2A 2J62A 1JAKA 3MTWA 1O12A 1I0DA 1PIFA 3NDOA 2VDHA 1JRBA 4AWSA 1YRRA 2XUCA 4H7CA 1EFZA 3PHAA 3E49A 3C6CA 2OYLA 3IIPA 3WLIA 3H2AA 3FV9A 4P8WA 3VILA 1IYXA 5FSEC 1DIDA 3PTQA 3UG8A 2WSKA 1LQ0A 1VF8A 1AG1O 4MFDA 3VMOA 3PVFA 3W74A 1MQPA 3SGGA 4W87A 3V36A 3VIJA 3UXDA 3WF0A 4HSNA 2AQOA 3VD3A 1NOFA 4P7OA 4PGLA 4O52A 1W1YA 3EWZA 1PKYA 4O13A 4PMYA 2I56A 2XDFA 3PUDA 3SSZA 2GPTA 3UNDA 5AN7A 4XX6A 2YL5A 3T9PA 3B05A 4AHOA 4BCEA 2IKGA 3STGA 3GXFA 4JL2A 4MNLA 5F4XA 4KMQA 2AAAA 1LWHA 5KMYA 2X1TA 4ZEPA 4XZNX 5A6SA 2P8CA 1HJUA 1QWKA 3SO7A 4Z1YA 2NWRA 3LV6A 1OF6A 5GNYA 3TQKA 4MY8A 1EX1A 3SBFA 4A2RA 4PTNA 4TMCA 4HK5A 2OLHA 4NP7A 4FOKA 2QS8A 4HNUA 1RQHA 2DT0A 3SN4A 2F38A 3ABOA 4XZIA 3LI0A 2VKZG 3GTFA 1YBQB 3U2EA 3QOKA 4AB4A 3KDNA 5A5WA 4NY2A 4PA8A 3LA4A 2CU0A 3HV8A 3TTYA 2VT0A 1P7TB 4O10A 2G3NA 2AOSA 2C1GA 3STPA 3ZSSA 3CO8A 4C60A 4JHOA 1OFAA 5U7SA 2PDUA 9XIMA 3VE7A 3SSJA 3PANA 3VNMA 1ZCCA 4UQAA 1K02A 4E8DA 3D3FA 2WO5A 2O56A 1Q6EA 3ARPA 3W1MA 1W56A 1F3WA 4RE4A 4YVXA 4DJFC 4QJ5B 2QYGA 3BICA 4REQB 4MZ1A 5MHBA 2DZWA 4CNPA 4CN6A 1XIBA 5HNNA 3IGUA 2H90A 3TJXA 5CKSA 3KLLA 3IAPA 4FF7A 3A5VA 3SFKA 1PKMA 3RU8X 3CUZA 3LRMA 4JCMA 4JDYA 2X1RA 1I45A 8CGTA 1P1XA 5FAGA 5BMWA 1FCVA 1JDEA 3VNKA 4E5TA 1E70M 1OFDA 3QVQA 3TA9A 3NQVA 5HMDA 1NSJA 4HCDA 2GL5A 4GYPC 4LTSA 2QCFA 4GCAA 3QH2A 1IT0A 2XIQA 3OTRA 2HCVA 4UZUA 3OQEA 1ESWA 2F8QA 2FH6A 2Z1WA 4JN8A 3UT0A 2G50A 3KRSA 1OX4B 3T44A 2NV1A 2PDPA 4JIIX 2IKJA 1W9DM 2V69A 1TZZA 1PIIA 1HF6A 5F4SA 1J18A 4H9TA 2X7VA 3DG6A 4JFTA 1YDOA 1SJBA 1G69A 1SMAA 2CBIA 1E1CB 5HA7A 1XLMA 1FWWA 1AZ1A 3S47A 3GDLA 1SFSA 3ERPA 3MDWA 4HOXA 1YDVA 2INFA 1HFBA 3VKBA 1ZSXA 4M6PA 4FXFA 5G4EA 1Q6GA 3O0KA 3STCA 1TX2A 1C8VA 3HB9A 1GUVA 4MY9A 2PLCA 3WK1A 3AI0A 3BV4A 1FA2A 1GW9A 5REQA 4DM2A 4PB5A 2XWDA 1X8CA 1KCKA 2ISSA 3POHA 4HNVA 3NQBA 1IXNA 1KM2A 2WCSA 3SQMA 3HBLA 4EAMA 3KS5A 3BTNA 2Z4GA 4L6DA 1WDQA 4R27A 2QAPA 1AQHA 3QN3A 3H2MA 4EPKA 1B4EA 2G37A 3CUHA 4IX0A 4K36A 1W1A1 4BF5A 4YCPA 3NVDA 1K9EA 2VVNA 3ECQA 1FQ0A 5BOOA 1K70A 4I9AA 2VWTA 1POJA 1W5NA 3GVWA 4IF2A 3G2GA 1VHCA 3HZ3A 3NUKA 2VC5A 2RDTA 2L5HA 1WKDA 2ZUNA 3WELA 2RDUA 2WKGA 4R34A 1SZFA 4MJZA 2WHJA 1E6XM 4XQ6A 3CU2A 1XCWA 1POKA 1LJYA 1XBVA 3B8VA 1ZBKA 1UC4A 3K4WA 1UP3A 3ARQA 4ZO9A 3R0DA 3H22A 3TNOA 1N8IA 2J78A 5LA2A 3QQWA 2Y0FA 1LRQA 1TPH1 3CL6A 3NO3A 3ZOAA 3AIEA 3DGBA 4GMEA 1ZBVA 1KFWA 3GVGA 4FMVA 1I1WA 1K8YA 3A5FA 1VYRA 4LC6A 4GJIA 2JEPA 4HSOA 3AXKA 3WMCA 4E2VA 2G3FA 1UPMB 2FVMA 4W5ZA 4X60A 4IMCA 3GNDA 1RJQA 2PRLA 3G0XA 4ZTYA 3GZ3A 4LV9A 5LIXX 1SO5A 2QF8A 3TJIA 3QW4B 4XBKA 3VZZA 1JIBA 1GHRA 3U7VA 3NQCA 2XN0A 2PWDA 2B31A 2ISWA 1JCYA 3ARZA 4UXDA 3N9KA 1BVWA 3KX6A 4K6AA 1P48A 1TQJA 1UP0A 3HN3A 2BOFX 4MVAA 4O1CA 4M56A 2Z2AA 3LTPA 4EVZA 2OQYA 2WPBA 1WQ5A 4PH6A 3MC5A 4DXVA 3WNLA 1Z89A 2Z1SA 3E2VA 1YADA 4CCDA 3CT7A 3WF1A 2QMKA 4RPPA 2VJXA 5CPOA 3NEHA 3H70A 1MFUA 2GK1A 4Y9OA 1J2BA 1DQWA 1XQLA 3SW6A 4XD6A 5E5CA 1G4SA 3RUBL 2DEPA 4N6EA 1AMKA 1XW8A 1BYBA 2ZRUA 1J0KA 3PPCA 1GYLA 1V4YA 3NL5A 3AZTA 3P8JA 4NAFB 5BRPA 1NDZA 3UZWA 5HPOA 5E70A 3GIPA 3UGRA 1E43A 1CGUA 3VOGA 1UIOA 2HMCA 3W7EA 2IQTA 4QJ4B 3WLNA 1E6NA 1JCLA 1QATA 3GD6A 4ZGYA 4AISA 4N0RA 3QJAA 1JYWA 1F3TA 4XVDA 3IVSA 4MAVA 2PB1A 2OXNA 1OYCA 4UBPC 2WCAA 4ZOBA 1AJ0A 1IF2A 1LP6A 3AHXA 2OZ8A 2Z24A 3E0VA 4OT7A 3EDKA 3GR7A 4X2PA 1CGVA 2GZXA 2BG5A 4PTDA 3TFCA 4F8XA 3GDBA 2BWGA 3MWCA 4N9BA 2FFCA 1E73M 3NQMA 2V68A 1ISXA 2GQ8A 4ZQRA 3GAKA 2Q71A 4Q4KA 1FCQA 3H7VA 3V18A 4INFA 4RDVA 1PHQA 3N6HA 2YB1A 1QNRA 1GORA 4GUHA 4NJKA 2D0GA 3RF9A 2PDJA 3I3BA 5A6TC 4AIEA 1KWKA 4PTXA 4XKMA 1LL4A 3BARA 1MRQA 3GWQA 4O12A 4KFNA 1B3WA 3C52A 4JTLA 5AZ0A 3LDVA 3VD5A 4H9MA 3ZT5A 1WXZA 2CZEA 1UWIA 3B04A 4FXJA 3R8GA 3S42A 3ZJ7A 4NQ1A 1Z9AA 3FA5A 3WQDA 5FEZA 3EX6A 1TRIA 1D3CA 1XBZA 4ORMA 1GYNA 4RDWA 2R8WA 4L56A 3WQOA 1E6ZA 2J25A 1C3FA 4NYUA 3DFSA 4IGSA 4Y90A 1YX1A 4GY7A 1F7BA 4DYEA 2W66A 4UR8A 4LEFA 4ZR8A 1Y5VA 5LIKX 3BXWA 1NU5A 3DKLA 3ANYA 4GNVA 3WBWA 4A8NA 3GB6A 1EHNA 1OZQA 1TWSA 5J04A 4UTHA 3COTA 4AVOA 3R5EA 1WBHA 2QCHA 4MWAD 1GT8A 4QAWA 4TVDA 1KXTA 1S5NA 4AEFA 2F2HA 4YYCA 4HU4A 4F9DA 2BHYA 4I8YA 4GOAA 3PN8A 1DXFA 4LUTA 3ABQA 4CN4A 5C9ZA 3DFQA 3LMYA 2PAJA 3PP7A 3BAKA 3QRHA 1E9ZB 3CASA 2DZUA 3MDUA 3MCOA 4G6CA 1WCGA 2HRWA 2FGBA 3ABXA 3MUCA 2OZ3A 3NEVA 3SZ8A 2YA1A 2O9TA 5DEZA 3CPUA 3IS4A 1J9YA 4WK9A 1ITQA 3ZZ1A 1BVNP 2DJXA 3TQPA 3M41A 1EC8A 1BVZA 3GZAA 4J1OA 3EEZA 4XIAA 2ZWZA 3A23A 2BVTA 1JAEA 1H63A 5FD0A 4LBSA 3GHSA 4RUBA 1LDCA 2BMBA 1JD7A 3KXQA 3C56A 3UEQA 2J8GA 2P1FA 5K7JA 1C90A 4YMZA 2HE5A 3SCWA 4XZWA 1UASA 4A4AA 1QOPA 4OHQA 1N82A 2XHYA 3TJ4A 3NXFA 4S3KA 3TW9A 3BLFA 2R14A 3I10A 1ADDA 4D6HA 1XH2A 2VDGA 1HO4A 4AWUA 1F8MA 4OIFA 4DJEC 3C0QA 5HMEA 1KRCC 2VQUA 2ZBTA 5ABFB 4KF1A 3KRBA 3DBPA 2DPEA 3L0GA 5FEPA 1DTUA 3EEGA 1VS1A 2GDVA 3CT2A 4R7WA 2F2KA 2OU4A 3PUEA 1PAMA 1EDTA 3HG4A 3PZIA 4R3UA 4CQ8A 4DBUA 2DSUA 2YDAA 3W28A 3CC1A 1J5SA 4GQRA 1D9EA 1UWSA 1EDGA 1V0MA 3VU2A 2ZFAA 4M8UA 2CXEA 5E9AA 3OIHA 1Q45A 3L4ZA 1U5HA 3LZ5A 3JW7A 3GR4A 3H4GA 4HBKA 4ICNA 5K9XA 1R3RA 3P61A 2EEXA 4E3VA 3OLGA 5CSSA 2OGJA 3W0KA 4LVBA 4MJMA 1VFSA 3AMKA 1OM0A 3T08A 4LB4A 4W86A 3PF3A 2VCBA 4AFYA 1GOOA 4N9CA 4FOJA 1PXGA 4GHRA 3UQNA 3EWWA 2J9YA 4R7JA 4GY1A 2OVLA 2W92A 2WHMA 4CD6A 2Y88A 1VR6A 1QHPA 3HG2A 3HO8A 2X7WA 3V0TA 3ISIX 1YPXA 3W2UA 4H41A 3S46A 3VDAA 4C1NA 4D6IA 4WLCA 3S1GA 1MI3A 3S4TA 1S5VA 3AUJA 3UY8A 5LGXA 5HWJA 1SZNA 2E6DA 1DV7A 5F2GA 4XBJA 1A47A 4DAIA 4GX8A 5A6BA 4J27A 4DZAA 4JTEA 1M9HA 2DZBA 2WQPA 1ME7A 4D71A 1US0A 3G8RA 1V6WA 4QIUA 3W87A 1E0WA 5BRQA 5C9UA 4DY1A 1XD1A 3B9EA 4L6HA 5AYBA 3TYEA 3KUMA 1WB0A 1EC7A 3B0YA 3SUWA 1KKOA 4B4HA 2A3LA 5BCAA 5DY2A 3MJMA 4JTTA 2H8ZA 2BY1A 2WYSA 1BEUA 3TFXA 3DG7A 1E0XA 2VHLA 3R25A 5CCZA 1HGWA 3KRUA 2OGYA 1C8YA 3UERA 1JCNA 4C6IA 5FJRA 3UZJA 3H24A 1U83A 3TDFA 1PKNA 1Q8AA 4Q8NA 4LUSB 2IXUA 5LA1A 2GUYA 2IKHA 1HQTA 4IQEA 3ZXWA 3L67A 4LYPA 4ENLA 5DO8A 4R53A 3L5LA 4JPGA 1W32A 1GEQA 1W17A 4DJDC 3LB0A 2FKPA 4ES4A 3O07A 1I2PA 3RG6A 3DFHA 1J79A 3VGBA 1SZRA 1XLCA 4IISA 4YTQA 3JRKA 2ZICA 1EXPA 4OGZA 3N2BA 4N9DA 5I23A 4BQ2A 1DJHA 2FZDA 4LNCA 1XRFA 2QMJA 2JQXA 1SZGA 1UKPA 1RD5A 3FGCB 4O8AA 5EMLA 3S9IA 4KGLA 5U4NA 3TW6A 3B0PA 3WUEA 2XFWA 2A6NA 3W1LA 4M7SA 4K7YA 1NFGA 4QITA 2ZDRA 3PZOA 3C2FA 3MHFA 1JUBA 1J0JA 1WZKA 1PV8A 1VKFA 1YHTA 2D1ZA 3MZNA 4AWTA 1XQKA 3ANUA 1LCOA 2RHGA 3EWDA 1HL2A 4BK9A 4A3HA 4HU3A 3W7RA 1NWUA 1SGJA 4NAEA 4QSFA 3EGJA 2I7GA 1OCNA 5HATA 4ZO6A 1V0LA 4P2VA 3R12A 3GSMA 2EPLX 1TVPA 2GQAA 3WJWA 2A3HA 1LYXA 1XYMA 1FDYA 4IPJA 5LXEA 1DIOA 3TQVA 4BA0A 3FJ4A 4XTIA