3TZNA

Crystal structure of the yersinia pestis dihydropteroate synthase.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
243
Chain Sequence
SHMHLTARGLTLDLSRPQVMGILNNLDQALQHAQRMLSAGATLIDIGGELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 85
structure length 243
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tznA00
4O1FA 3TR9A 3H2MA 4PZVA 3TZFA 1TWZA 1AD1A 4MWAD 2DZBA 3H24A 1Q8JA 2DQWA 4S38A 3MCMA 1TWWA 3H2FA 1Q7ZA 1EYEA 3TYUA 4D8ZA 1AD4A 4DJDA 3H26A 3MCOA 3H21A 2E7FA 4G9PA 1F6YA 5JQ9A 4S3BA 3H2NA 4NIRA 4S3AA 2VP8A 4DJFC 3TYZA 1TWSA 4S3DA 3V5OA 2OGYA 1Q7MA 1Q85A 4NHVA 4MWAE 1AJ2A 3TYAA 4S39A 4S23A 2YCKX 4C1NA 4DJEC 4DJFD 3TYBA 4O1EA 4C1NB 4MWAA 3TYDA 4D8AA 3H22A 2Y5SA 1TX0A 2YCJA 2YCLA 4MWAB 4DAIA 4NILA 2VEFA 4DJDC 2YCLB 1Q8AA 1TX2A 4DJED 4DB7A 4S3EA 2YCIX 4CCZA 2H9AA 3TYCA 4DJFA 3NOYA 3H2AA 4NL1A 4O0QA 4D9PA 4S3CA 2H9AB 3H2EA 1Q7QA 3H23A 3K13A 4DJDD 1AJ0A 3H2OA 4S3FA 3TZNA 2Y0FA 3BOLA 3MCNA 3H2CA 4DJEA 4HB7A 2BMBA 4MWAC 1AJZA 2Y5JA 2VEGA 4DAFA 2DZAA 3BOFA 3TYEA
chains in the Genus database with same CATH superfamily
1VZWA 3AJXA 3PBGA 4L1XA 2W67A 3MMTA 1JZ8A 2F61A 2NSOA 1GKRA 5F2LA 3SBFA 1GJUA 1UH3A 4JYDA 1LORA 1Q2RA 3OGVA 1TQJA 3SCUA 3ZYZA 1PXGA 1MO0A 3OBAA 4WJ8A 4LV9A 3CPGA 3LCHA 4KESA 2HSAA 4XO7A 3N04A 4FF5A 2Z7GA 4MOZA 1HKKA 3AS2A 1H63A 1RQBA 1ZY9A 1FCQA 2ZQ0A 4MWAE 1FWGC 5HQEA 1UZHA 1JCTA 4IGNA 1KTBA 3QGKC 2ISSA 3UA3A 2V3EA 3TP4A 4JZ5A 1VLWA 1HP4A 4WGHA 1EDQA 4C60A 2YCLA 4RE2A 2PS2A 5AC7A 3U57A 1V08A 3IGHX 3NO3A 2G3FA 3ZT6A 1UG6A 3CTLA 4ZE4A 4HTBA 2GSJA 5TBOA 4DBSA 1J11A 2HE8A 4XSMA 3PUEA 1EUAA 5EB8A 2OOFA 1PCWA 3XINA 1M01A 4LYQA 9RUBA 3EDFA 2VGFA 3SGUA 5BXRA 1TPC1 1X1ZA 5AC4A 2AOSA 1OFDA 3TXZA 3GVQA 2C1IA 1OWQA 3M47A 1AG1O 1NQ6A 4EX4A 4DAFA 1DTNA 1ME9A 1P0KA 1W5MA 3BJTA 3B9DA 1R2TA 3A9IA 3PULA 4B4HA 1KTNA 4ZQOA 4CQBA 1W8SA 5BOEA 2NT1A 2X42A 2RFGA 5D04C 4NG3A 4MGGA 3M5VA 3S2NA 5H8PA 3AOFA 4GKLA 4DJDA 2W63A 4UTTC 2E9LA 4AVOA 1HZYA 2R6OA 3ZVHA 3BW2A 1TPUA 1XL9A 1Q6GA 4LY8A 4TIMA 2ACUA 3UJEA 4F48A 4GQ0A 2NW0A 3DN5A 4JTKA 1AJ2A 4YLWA 4GJJA 4QNWA 3VMOA 3TOYA 3WF4A 4DLFA 4KKXA 1Q5MA 1OSEA 3MYPA 2EG7A 5J5DA 2OR2A 3G1DA 1SFLA 1WBJA 1P4CA 1CXLA 1FH7A 1TX2A 3RPTA 3RM9A 5C71A 1HN1A 5DRCA 4HU8A 3WQ5A 2Z24A 2I7GA 4J3XA 4HA4A 4ACYA 4IL0A 2NV2A 4W85A 2XIOA 2C1HA 3P93A 4IXXA 4HB7A 1UUMA 4DM1A 2J74A 1W2VA 3TXVA 2FH6A 1W9UA 3G1AA 4XVEA 1YDOA 3BOFA 4M7TA 3M4HA 1EBHA 3WBYA 1Y5WA 3W7CA 2WBGA 4BF9A 1J5SA 5ENLA 1OFRA 1XLKA 4QXIA 5F7UA 1R30A 1KCLA 1OK4A 3WFZA 4D8ZA 3L4UA 1WO2A 3GZAA 2BY3A 1QNRA 4LUIA 2GZXA 5G2IA 2XZ9A 4H41A 3GTHA 2XPKA 2CWNA 3OZPA 2PI6A 1GPWA 2P8BA 1K4HA 1H7RA 3G8EA 1BGAA 1MW1A 2O9PA 5HJYA 4C6LA 2GUYA 3W85A 4X9YA 1LT8A 4ATWA 5K2ZA 3U4FA 2FHFA 2PMQA 4GABA 3W7GA 4GYKA 2WVVB 1GHRA 3DERA 1GK8A 3EA3A 1Q66A 3BGJA 5DELA 2PDLA 3B0UX 4PTNA 3LM3A 2NWRA 5FF7A 4A6GA 3NQGA 3DEQA 4FO4A 3C2EA 2PSNA 4DJED 1XKYA 3SSZA 3AFBA 4KWVA 5E6YA 3JZEA 3GE7A 3CNYA 4CQ8A 1OGBA 3GG8A 3RF9A 3G0UA 4GC4A 3GQYA 3WEMA 1E5NA 4TMCA 3M0LA 1DV7A 3K4AA 3PSWA 1I2OA 2PWGA 4A2SA 4F0HA 5DMMA 2P3EA 3C6CA 4FMVA 1XLAA 4C1KA 3GKAA 5DX7A 4KT2A 3B06A 3JRKA 5M5DA 5LXXA 1Q3NA 2X2YA 4L9XA 1XIMA 4AIEA 3V1HA 3V1PA 4EIVA 4A3UA 1E9YB 5CC6A 1YNQA 3PM6A 3PTQA 1XIEA 2Y8KA 4YWIA 2PZ0A 4ZBCA 3NYZA 4C90A 1T8XA 4AWSA 3T08A 3NL5A 2FFCA 2IUZA 4WDUA 2PRMA 4AMCA 5AVHA 2PTZA 4PYSA 1PZ0A 2OQLA 3TYZA 3V35A 1V0NA 2OLSA 4TMBA 3IK4A 4AQLA 5C7VA 1XD0A 1MXGA 1NDVA 2V5JA 2DZXA 4TU1A 3ABQA 3GUWA 4J7RA 4ZB5A 1OGSA 4DNHA 1V77A 3WNKA 3BW4A 2Q3RA 4MFDA 3UXDA 3G5EA 2OWCA 4ZB0A 2OLAA 4UOZA 3DGBA 2VDGA 2IPJA 4LB4A 4UFIA 1OX6A 3RO6A 1GYLA 3SCSA 3CPUA 1BHGA 4TVCA 1OABA 4CCDA 2PDUA 3FK4A 3EKGA 3W02A 1LG2A 4Q8PA 4QE1A 1OC5A 3R10A 1JCNA 4DB7A 1C9WA 2BBFA 3QHOA 4H9ZA 1LUCA 2R1KA 5DCEA 1WAUA 5T9CE 4KIEA 1FKXA 1S2WA 3VGDA 1QI2A 1UD5A 3RLHA 1W1ZA 3MUZ1 3W3OA 3BJFA 4Y2WA 1JCJA 3S5NA 3VCNA 4HPJA 4JTFA 4KS0A 2P0IA 1E5JA 3TU9A 1LWIA 1QHPA 4A8RA 2J8TA 1ZQ5A 5JIWA 4A35A 1CCWB 1LL6A 2ZX7A 3FJ4A 3STEA 3N6QA 1E9IA 5KEZA 2ISDA 4GYFA 4H9MA 5A69A 3H7RA 1Z44A 4AZGA 1PVNA 3DXIA 3H2NA 4OUIA 3FDGA 3QHNA 4JY8A 4ZOAA 2YX0A 3U2CA 3WQGA 3WLMA 3GC4A 4R5EA 3RU8X 1DXEA 3S42A 4GK8A 3MDWA 4NHVA 1NM9A 3SFWA 4HSNA 3SR7A 1G94A 3JZUA 4WX2A 1JYNA 3B8VA 4NI8A 3W83A 3OGRA 2D1ZA 3PUOA 1EEXA 1MUMA 3NQEA 4MNLA 1QDSA 3RXZA 2GVJA 3VNKA 3S1UA 2BVYA 1DQXA 5C2XA 2YXGA 4IGMA 4N6EA 2RGMA 3AXXA 1G69A 4Q3MA 2OYMA 2Z2BA 4KPLA 2HVMA 3CMJA 5J04A 3OLGA 2PF0A 1V6YA 2ZADA 1DJZA 4RZ5A 4Q8MA 3THDA 3DKLA 4AX7A 2PGRA 1EJ7L 3L4TA 3MU7A 3CTTA 2MNRA 2O7SA 3EZ4A 1JCMP 3ARWA 1IE7C 1PKLA 3VD5A 1MZHA 5JUVA 3FJLA 2REQB 5FL1A 3BGAA 4Z2IA 4I7UA 2VOTA 1AW2A 4M1RA 1B3WA 1G5AA 1YADA 2GSHA 3NO5A 2BLEA 1QBBA 4GGHA 1Y0EA 2Q6ZA 2CBVA 3I6RA 2AL2B 3KLKA 4CD6A 1O1HA 2ZE0A 3ITTA 3VA8A 4CEXC 1Q6RA 5AHIA 2QAFA 1FBAA 2YW3A 3V7PA 1T8QA 2BTMA 4PEKA 4QQ3A 3PWAA 3WEZA 3T8LA 1GKQA 4QE4A 4UMBA 3F1QA 2VQUA 1ZZMA 1EX5A 2OGYA 1E43A 3CZJA 1XSKA 4S39A 4DZ5A 3GXPA 4IGHA 3CL7A 4CLMA 4CQDA 2DSKA 5CJNA 3B0XA 4F8XA 5E0FA 2YCJA 1TQXA 3COTA 3ICJA 3MP5A 3BVJA 1V3LA 1HW6A 3WJYA 2CW6A 3UGVA 3S5ZA 4KWSA 4XZHA 4UOJA 3BV4A 3OEXA 4GACA 4E6MA 4TX6A 2CKSA 4O19A 2UZ9A 4AYSA 2ZDRA 2J78A 4O17A 4US6A 1ODZA 1YX1A 1B3XA 1UWIA 3LGEA 1AMYA 3CM4A 3ARYA 4IM4A 2IPGA 3ZFHA 1ESWA 4IPJA 1R9ZA 5CZJA 1O6IA 3RMJA 3IPWA 3VGBA 3RG6A 1UKOA 4HVXA 4F4RA 9CGTA 1LWHA 5FI8A 3VGEA 1DJXA 2VC6A 4UB9A 1ZCCA 3A64A 3IJIA 2HS8A 4AC1X 1YE6A 2BWGA 2D2HA 1CIUA 4IHCA 4NASA 1KXVA 4ORIA 3HPSA 6A3HA 1MYRA 1J6PA 5HAOA 4C5YA 5BRPA 3DYMA 1TMHA 3LRKA 4JTQA 1PTAA 1IWBA 4ZFMA 1WV2A 3LLDA 5JH2A 2YBUA 1NAL1 4PTXA 4GJ1A 4UWMA 2WKGA 4I5XA 3UGRA 5LA0A 4WF7A 4ZOEA 4P7RA 5RUBA 1IR1A 1YTDA 4D6JA 2OX1A 5D9PA 2CC0A 1IWPA 2TPSA 4P8XA 1E6ZA 2VFGA 2WMJA 4Z08A 4YHGA 4ZQRA 1QR7A 4I5RA 1O5XA 4CD5A 3W00A 5B7YA 3QMTA 1DL3A 5AC5A 1TV2A 2R1MA 2R91A 5LGXA 3TA9A 1J6OA 3PG8A 3U48A 2GGEA 4DWSD 2VYOA 4FSAA 1CGYA 2VEKA 1J2BA 4V28A 3W1PA 1FHDA 2DY3A 3EPNA 1LQAA 3NQ7A 4MADA 4UTFA 1GYNA 5CZTA 4NZ1A 4LPCA 4EWND 1V0MA 1JAKA 3LDVA 4K8EA 3LI0A 5TNVA 4KGJA 1E6RA 1P5BA 4U3AA 5EBUA 2VEIA 2OSYA 1CZ1A 2WSPA 2DJLA 1V0KA 1TELA 3BG3A 1ZB5A 4EF8A 3SN0A 3C2RA 4NAFA 2DT2A 1IV8A 1DIOA 3O15A 4LTSA 4RW5A 4GQQA 1JULA 5DF0A 4BF5A 3TQPA 4J2MA 2A79A 1REQA 4X63A 5A6LA 4JD4A 3CUHA 3VX1A 4R7WA 4UFHA 3UYCA 2OGJA 1I2NA 1RY8A 3CQKA 4FPSA 1R47A 1S38A 3UY7A 3JUGA 4PBGA 1A5OC 3DOPA 3BAJA 4UNKA 3P67A 2GGIA 3VDCA 3MUXA 4PMYA 1JPHA 1KLZA 3V0SA 1IT0A 4JIIX 4Z0JA 4ZODA 1CXFA 2ABAA 3E0LA 3H2OA 3NDYA 2C16A 4P7NA 3ZSTA 4IL2A 3TZNA 1QT1A 2FTWA 1E6SM 2XWEA 1HP5A 7XIMA 5CAKA 4D6CA 1U5HA 2DZSA 4FA3A 3UXIA 2W5FA 3WJXA 3W76A 2QUMA 4B5VA 2DZAA 1EJWC 1O68A 1W1VA 3P6LA 4R7OA 3LSCA 4XD5A 3VI2A 5AFDA 3MHFA 3ECQA 3R0KA 4BQ4A 3EOLA 1ICSA 4IIGA 3VKCA 1XLEA 3JVAA 1A5MC 3CGTA 4ATLA 2YL9A 5IM51 2ZZ1A 3URQA 3KZPA 4XQ6A 1QVBA 4F2TA 4CVUA 4M8UA 2E6YA 3OVRA 1J5TA 4IZGA 2H6RA 2HBXA 4ZMGA 3G1SA 1O94A 2XH7A 2I5QA 3FXYA 4KMQA 2FPTA 3DFQA 1WDPA 3GG1A 4K3ZA 4YTRA 2J13A 4QJ3B 4GRSA 3HURA 3G0XA 1H09A 2Y88A 3KOWA 2J79A 3VUPA 2G50A 1QBAA 1Q45A 4LAOA 4UFKA 4UNIA 1F76A 1W54A 3R94A 3EWCA 3ZMRA 1Z48A 3NZ1A 2ZA1A 2YLAA 3HO8A 1ADDA 1P0BA 4P8VA 4O0ZA 1YTEA 1FWEC 1GGOA 1XIJA 3ZWTA 5D37A 3U9IA 4IX0A 5EMYA 1ZNNA 2HMCA 3A22A 1LOLA 3R8HA 4PGLA 1VYPX 1U1JA 1WXZA 2Q8ZA 3DENA 3QPEA 1H4PA 1VBHA 4O1FA 4LC6A 3R7MA 1UR1A 1V6XA 3RM4A 2X1SA 4X3ZA 1Z3NA 3UWEA 3AMCA 2E1WA 5XIMA 3EXTA 4MIMA 4H9UA 1WKFA 3POCA 4NUWA 2VVSA 1QTWA 1XLGA 2VZTA 4JFSA 5D9NA 1M7OA 4LUTB 5FOOA 5A6KA 5G1TA 2ATSA 4DM2A 1JZ6A 1E4LA 1QI4A 2DUXA 4GO8A 4YVPA 4XISA 4S3GA 5C5YA 5JH1A 4EVZA 4JTCA 3AALA 2YXOA 3VKBA 2GUBA 5GJMA 4G2DA 1XRTA 4F0KA 1M7XA 3W2KA 2R94A 5K4XA 3DUGA 4AFYA 4IMAA 1KXQA 4XTIA 4C6NA 1QHZA 5E93A 1QK0A 3T4CA 1RPXA 3C8NA 5HATA 4IJCA 1H3GA 2H8ZA 4XB3A 4EANA 2PDQA 1AMKA 4S3EA 3RCMA 2H9AA 3HJEA 2J9ZA 4NZJA 3BLKA 3NAVA 2RHGA 3BQ5A 5AYBA 4NAEB 3IS4A 2TMDA 3HZ3A 4IMDA 4QS5A 1KR0A 1M53A 2VZSA 2Y4SA 3K1DA 5GPRA 3OQEA 3WLLA 4WKHA 4AWEA 1X1OA 3G18A 1C29A 1BXBA 2Z7KA 3VNMA 1Z6KA 3F4CA 2BASA 3FVDA 4AZCA 3LLFA 2EJ1A 5TF0A 1D3GA 1KTCA 4HT3A 4AXNA 3TWAA 2PCEA 4Q8NA 1E6PA 1EO7A 3DFSA 1H61A 4EPKA 1EZWA 4UR9A 2XVKA 4C6OA 1OZMA 4Y7EA 4GC3A 2WV8A 2QUUA 4HCLA 1UWAA 1BYBA 3UQNA 3FEQA 1ZALA 4S3KA 3VIKA 1QPKA 1W1B1 1TPFA 4WOQA 1S5WA 1GPFA 5JBEA 2NSXA 5I79A 1ZRQA 2DIKA 5E5CA 1HKVA 3H7VA 3M41A 3AI0A 2A3EA 1P43A 1OFAA 1WKDA 4WLCA 4LF2A 3CS2A 4O16A 3TQKA 2VFHA 4CNOA 4AD0A 1WQ5A 4C6JA 1PHWA 2C0HA 5EA9A 5D09A 1GOQA 2Y7EA 3C0QA 1VFTA 3T9PA 4M80A 1Q6DA 1GTEA 1RCOB 3OA5A 3L67A 3AS3A 5IBXA 1LL4A 3W7PA 3N13A 2WOQA 3P5YA 3A24A 3CWNA 4H9XA 1G4SA 4D6IA 1YTKA 4WUIA 2D3LA 4NT0A 4L4MA 4M7SA 1HKMA 3BZGA 1LCOA 4AWUA 1E9LA 3BO9A 1JDCA 4DXXA 3HPAA 3WH5A 1AH4A 4M82A 3ZSSA 2WXDM 4WDXA 2BY0A 4XK2A 3DGRA 1TJ0A 1TPVA 3ATYA 4WD0A 2QHAA 1GQNA 5DCBA 2PWHA 1F9CA 3ES8A 3VKKA 1IR2A 4LFYA 3FS2A 3CL6A 1ZPTA 2ZRZA 1FRBA 2BODX 1Q6LA 4BEUA 1EXPA 4RDZA 3KL0A 3ZIZA 3GR4A 4AZBA 3M7SA 1R3YA 3PJTA 1LZOA 2VCAA 3H70A 4TOQA 5D8WA 1TVPA 3KFTA 1F2JA 2VR4A 4CUCA 4E8DA 5A8OA 1KW1A 3UFYA 4QG6A 1TV4A 1HL9A 2CLPA 1BYDA 3OZOA 2C13A 3CXOA 3V36A 4MWAC 1PSCA 1UA3A 3Q4DA 1VFSA 4ICNA 4P2VA 1A5KC 3PP7A 3UR5A 3AXMA 4WJXA 4TTGA 2BOGX 2FH8A 4LVFA 3LA4A 2WVTA 1T40A 2DV0A 3GU2A 1Q63A 1A5LC 4G7EB 1IHIA 1BRLA 3PG9A 5CJ5A 3SW6A 3WMSA 3VABA 1LBFA 4IFRA 1JZ7A 5LNRA 3AIRA 4W8LA 2Q8LA 4W8BA 4Z1BA 4BA0A 4ADTA 4WKAA 3EAUA 4Q7IA 3PPCA 3FJ6A 4MPQA 4EP8C 4OECA 2BY2A 4HHHA 3N1AA 1RVGA 4RE4A 4ACZA 1LYXA 1VEOA 4F2BA 1NY1A 1EJVC 3NIYA 6ALDA 4GUFA 2QEZA 3GXNA 1WZKA 3O9NA 4F0SA 1ZJIA 1U30A 4HZ6A 2YCLB 4PMZA 4ICCX 3WH8A 4PMRA 2PA6A 2PDWA 3GG7A 5D30A 4B91A 1OT2A 2R14A 3EWDA 1O95A 3IJQA 1SZEA 2XN0A 3H2EA 4DUWA 3O16A 4R9OA 3ARPA 4S3FA 3SB0A 4JN8A 1MRQA 3L4ZA 3LCLA 4QGCA 1F07A 3CB8A 1Q65A 3WD1A 2JKAA 3LTPA 4JNMA 2ZRWA 3TLLA 2D73A 3ZQ9A 1B3VA 1DYSA 4CN1A 3KBVA 1IIGA 4LRSA 4GVGA 4MMWA 2O56A 2BHUA 2WMKA 2PWEA 3C8FA 1KQZA 1VBJA 3WQDA 1W56A 1VAHA 3NSMA 1UIPA 1V6TA 1T99A 4PUNA 2UBPC 4LJ3A 1ML1A 4N9EA 4PR4A 1XRFA 1GWJA 4XIMA 6CGTA 1ZJAA 5C9UA 4RL3A 1LDCA 5EMKA 4O52A 2E4TA 1JRBA 4IXHA 1HVXA 2CHOA 1PAMA 3RHGA 5L9FA 3A21A 4Z1CA 5D2WA 4HK5A 1N8FA 4DX3A 5M2FX 4G56A 5LHEA 3TTYA 3UR2A 1QPRA 3W7KA 3PZQA 3PC0A 4DO7A 4OOZA 3O6AA 3WK0A 2YJQA 4MG4A 4DJFA 2NLYA 3R0DA 1MSSA 2ZZ7A 2PP3A 4S2BA 3WDQA 3GDBA 3OBEA 2JIWA 1LBLA 2HXUA 2E9BA 5DY2A 1OYCA 3UWZA 3N2MA 2ZDSA 2YXXA 4WK9A 3W7OA 3N2XA 3K5XA 3IARA 5KTLA 1KBIA 4HU4A 3CC1A 3PZNA 3WL1A 1ZLPA 4DF1A 3G6MA 1K4GA 4J3ZA 2FQIA 1UROA 4RXGA 4HPNA 5HANA 2FVKA 4MNKA 1UBPC 3TYUA 2ISWA 4NY2A 3BG9A 2H3BA 1GEQA 5JMUA 2C14A 1P7TA 4IP5A 2WNWA 1CLVA 1DORA 1E71M 5D2VA 3T1GA 4QFUA 5JQ9A 4UZUA 4NNBA 1PEZA 3EX2A 5G5IA 3IIXA 3W7IA 1YPFA 4GH3A 4QR6A 2YL6A 3MJMA 3ZR5A 3BMVA 4X60A 3SGGA 2WHJA 3UXAA 1WDWA 2V68A 2WPGA 3WQFA 4ZQPA 4GQBA 1XIBA 4LH8A 2INFA 3BSGA 3IANA 3U2EA 2GGJA 1AZ2A 3I6EA 3CZGA 4XG1A 1BF6A 1I0BA 4PB3A 3IIPA 1FXQA 1K7XA 1TV8A 4G1NA 6XIAA 3CAWA 1DVJA 4JGDA 3DFNA 1XFBA 3ABOA 4YJ5A 2ZZ2A 1EC7A 3L0KA 4QCEA 1CGVA 4DYJA 3NWRA 4NZ3A 3BOXA 2EKCA 3RFAA 3EB3A 1E1CA 3QZAA 3PBUA 2PLCA 2ZTKA 3MSRA 4XZMX 4W86A 3DFHA 1YW1A 2V0TA 1D2KA 3KRSA 4PMQA 4I8YA 5TIMA 1WXYA 5GNZA 3UG8A 2GOKA 1UWTA 3M64A 1TUXA 2V67A 3DAQA 2EKGA 1FHUA 1A4MA 2XGIA 4UXDA 4D8LA 3RLGA 2XIQA 3VUSA 1FWSA 2FZ8A 3KRZA 3O2LA 4JPGA 1ZBVA 3EOOA 2VD9A 1CW2A 2RAGA 3MKKA 4XBKA 5BMXA 1G01A 2PURA 3B8TA 3CJPA 3QR1A 4XAGA 1GOWA 4NNAA 1GHSA 1R8LA 3T8QA 3HFYA 4J3SA 2G41A 2J6XA 2GFTA 2OJPA 2XH0A 4GX8A 1PDZA 3ZO9A 4TVUA 3B0VC 2YL5A 3U7BA 1P0NA 1BVNP 3WMCA 2WNNA 1LRQA 2GWNA 3TKFA 1DWGM 3KX6A 4LYKA 3LU2A 2PPGA 3O63A 1L8NA 4FXJA 4OV9A 1GVFA 1I9CB 4N0RA 3ZR6A 4GCAA 3BAWA 5G1YA 2Y5SA 1B2YA 4PE8A 3M0ZA 1B9BA 3OLEA 4I8DA 1XLDA 1M41A 5JVLA 1R0MA 3SRKA 4LYRA 2QVNA 1R2RA 1XGEA 2QGHA 1XLJA 3MV11 4NRRA 1GEHA 5HULA 2PWFA 3L4WA 2A7NA 1F6PA 4DZHA 1LUCB 2BXZA 3MY9A 3E6EA 3ATZA 4IIDA 3B8SA 4S3JA 4RE0A 1KCZA 1MFVA 4CQAA 1L6SA 1RD6A 3KZSA 5LSMA 4A2RA 2YBTA 5HNNA 2VC7A 4HSOA 1V79A 5JXQA 2GDUA 1ZHAA 3PBVA 5XIAA 2E3ZA 4KCWA 5BW6A 1S5TA 4LVBA 5DN1A 4NQ1A 2FKPA 1B3OA 4L5ZA 2VX5A 3MWCA 3M0KA 2YIHA 4KWUA 4O1BA 2GPTA 1MI3A 1KFKA 3W84A 4IH3A 2E6DA 2A4AA 1EGMA 1GQJA 3B9AA 4FEZA 4FS9A 2AKZA 1MW3A 1C93A 3FX4A 3ITGA 1K7FA 1PIFA 2PDYA 3UNDA 2GWGA 1IF2A 3P84A 3HFTA 3W2UA 4W87A 3N4EA 4ZQNA 1W1IE 8CGTA 3XIMA 2XHYA 2X2GA 3C3UA 5I3HA 3UZJA 3W38A 1XISA 3FKRA 4URIA 5MKGA 2P5NA 2JKEA 1Q8AA 3E12A 3VMPA 5BOOA 4PH6A 3W7NA 1RQEA 2VEMA 1VRDA 4HU3A 4XBJA 1EP3A 4XZLX 1OFOA 1N2VA 1PTGA 3QH2A 1YQ2A 3M9YA 3ARUA 3HM7A 3QQWA 3IJ6A 4JNYA 4LCSA 4M19A 4I9MA 3OOQA 2V6AA 3KOXA 4PMDA 1KM6A 1GOKA 3QSTA 1F5ZA 1CEOA 2G97A 3W75A 2QCFA 1DE5A 4A8IA 5C54A 3QKZA 2GVGA 3PBWA 2J24A 1HKIA 5FIPA 5HJXA 1C91A 1LLWA 3S1GA 1MEHA 3UZZA 3SY8A 2V5KA 3T7VA 3T0BA 1AD1A 5G4HC 2XVPA 3O7UA 3S2JA 4US5D 3IV8A 1F3WA 2OEJA 2KX9A 2ZKMX 4UTUA 4F0MA 3AIWA 1QNOA 1AQFA 3OHIA 4UUIA 3T78A 3UJSA 2F38A 4MSSA 1B3ZA 3CMFA 4Y90A 3IGUA 3QV9A 1EJXC 5A8PA 4U2ZA 1QI3A 2PP1A 4ZR8A 3OIXA 4QP0A 1V3KA 2WSKA 4H8HA 2E5DA 2Y2WA 5FSDC 3STFA 3MVTA 3UW6A 5CSUA 1MXSA 5CSSA 4CD7A 1W9BM 3QV8A 5ABEA 4C65A 2I5GA 3PK7A 4CQCA 1TX0A 4IUOA 3W1LA 3B8WA 4O12A 3SCNA 2ZUVA 3WDPP 2FFIA 3MUY1 4LRTA 3V5FA 4S3CA 5K9XA 5A6MA 5BCAA 3VNDA 2VKZG 3SUVA 4GZEA 4UC5A 3VGGA 1HKWA 3THCA 3W1RA 1UP0A 3CLWA 3NZPA 1L8PA 1EHNA 2ZXDA 3DESA 1FH9A 2Z0IA 1VHCA 3KWXA 2RH9A 3BUVA 3L2LA 2RJHA 3MZNA 2DZBA 1OM0A 4XUGA 5HPCA 1TWWA 1TB3A 3BICA 4LS2A 3NCOA 3E2RA 3U7VA 3LSBA 5D2XA 1K77A 1UKTA 4DYKA 4LX4A 3BG5A 4D2JA 2BSLA 3FA5A 1X8FA 4UQCA 1EHAA 2A6LA 3A4JA 1ME8A 5HNUA 3KRUA 4PMJA 5AC8A 4IMGA 5DFAA 2QMKA 1OY0A 4K7VA 2FZBA 5HWMA 2YOCA 3W1XA 3TYBA 1GKPA 3MWAA 1RBLA 4LW7A 1OCNA 4K1GA 1ZUAX 3GS6A 4XAFA 4FB7A 4AD4A 1KFEA 4H4IA 4IGSA 2VI0A 4JNZA 3UETA 3EEGA 4CCZA 3DIPA 4X2RA 2V38A 3PSVA 3ZXWA 3SEPA 5KZEA 3URNA 4QLLA 2OSXA 3W2NA 1R7AA 3UD6A 3CUFA 2XSAA 3KL5A 4Y9AA 5BYWA 1E15A 1GZJA 3G1XA 1R7OA 2D2OA 1W91A 2IS7A 2C79A 1H60A 1KRAC 4NYYA 3B9NA 3C2YA 2XN1A 2P0OA 2JK2A 1MQRA 2DVTA 3LXAA 4NKCA 3VOFA 3CQJA 4XUYA 3A5FA 3HG4A 1PL9A 3B04A 1HT6A 4E5TA 2G4FA 1E0VA 4HA3A 1YXYA 3KOZA 3B8IA 3VDAA 3WQ8A 2CLFA 1DJHA 4J27A 1EL3A 4C7FA 2G3MA 3W7HA 1M3UA 3GXDA 1JZ5A 2FGZA 1A5BA 2J66A 3VCCA 5DRIA 2FZDA 3NQBA 1FQ0A 3AQUA 4DWSA 4MJ4A 4NAFB 3RLUA 1LQ0A 3NPUA 3P74A 2A6NA 4AUBA 4R7JA 1BD0A 1REQB 3DYPA 5LA1A 2Z2UA 2OFJA 3UR7A 5I06A 4A05A 1OQFA 3NM1A 1C90A 5LA2A 1I0DA 2BDQA 1T0OA 4JHMA 3L9CA 1VIWA 3A3XA 4V2XA 3WQWA 2PC4A 3HMCA 1JCYA 3C4UA 4NL1A 3W86A 1UW9A 3E9AA 4FP1A 1AQHA 2D24A 2W0UA 1UZ4A 2J7FA 3USZA 3NR0A 2WMIA 2CWXA 1J0JA 3NSNA 3VZYA 4UMAA 5CPSA 3B9OA 4H9VA 3BPWA 3TAKA 2CBJA 3HV9A 4GFSA 3SZ8A 1RBAA 1UZDA 2QCDA 2OZ0A 4GFIA 3CZLA 3LHYA 5DCDA 4XIAA 3IIOA 2C3ZA 2EBNA 3H12A 1POKA 3VTRA 3EX1A 3NXFA 1UOKA 2QJHA 3GRIA 4HYRA 4ZE5A 3W26A 2AKMA 4RNJA 1PX8A 3MS8A 2QIWA 5M03A 4DYEA 4H2CA 1TRDA 1E0UA 1QATA 5T8GA 3KXQA 4BEQA 4IIFA 1B90A 3HJZA 1WAWA 1XDLA 1VCFA 3ZWSA 3GH7A 2INEA 4IQEA 4WEVX 2R24A 4S3DA 1H2JA 3ZS4A 3OHMB 2PP0A 4JIEA 3EDDA 1K70A 4ONVA 1XBYA 3HPXA 1CLKA 3WEOA 2Q02A 3VDGA 2CEQA 3S5SA 2IQ0A 1R3TA 4HNTA 2AL1A 2A3BA 1PJ9A 4A21A 2P1FA 3OGSA 3PB0A 4CQ9A 3NDOA 4DQWA 4QS6A 2NQ5A 1SFTA 3GVGA 5HMSA 3EOSA 4ZCWA 1H1ZA 1QPQA 4R34A 3K13A 1JGMA 2ZZ4A 3MI3A 3I3EA 3R2GA 2TODA 1ITUA 4CCEA 2PTWA 4MZ1A 2E5BA 3ITCA 2XSBA 4KF1A 1JYVA 1HG3A 2JKPA 1WA3A 3C2OA 2F7FA 3FLUA 2HCVA 4CD8A 1FUYA 1JZ2A 1GONA 3CQIA 3ARZA 1SW0A 3LYEA 4B90A 2VFDA 3QC0A 1CECA 3GAKA 2Z4GA 4L9YA 2ZA2A 3MCMA 3D6NA 4UMCA 3QTPA 3VD9A 2Y7GA 1US3A 4NXKA 3SN1A 1AD4A 2YA2A 4TTUA 1W3TA 1FHVA 2Y61A 1EX1A 4PRTA 3Q37A 2EG8A 2B7QA 2R82A 5HXMA 3BLPX 1RLCL 5FEXA 1CXHA 3L12A 1C8QA 1PDYA 3MC5A 2H8XA 3MP3A 4IPLA 4HU0A 2Z1WA 4HMEA 1EEPA 3TC3A 2CXEA 1E55A 2O9RA 2FTYA 1RCQA 5JIPA 2VD8A 5SWUA 3GK0A 3LNMA 4M24A 4N9CA 2VWTA 1YXCA 2GQ8A 4I90A 2G3JA 3W88A 1GZ1A 1R9XA 3LXCA 1V02E 3GDRA 1XLBA 4PCTA 3E0FA 2OQYA 1Y5VA 2H9AB 2OEMA 3C0SA 1S39A 2EEXA 2I56A 1J0IA 3GC2A 3A12A 3W27A 4PTDA 4WQ6A 4PUKA 4JOMA 5AYYA 1SPQA 4INFA 3G1RA 3AMKA 4Y9NA 3CPRA 3BANA 3L5LA 3K4DA 4L56A 3LBCA 3SQSA 4MB5A 3DHFA 1SGJA 4AZCB 1V51A 2BVDA 4UFMA 5FJJA 1AL8A 3ZJ6A 3ITOA 3SURA 2QULA 2VCBA 3MCOA 3S4TA 4RW3A 3LMZA 3OYZA 3ALFA 4S3AA 3IJ9A 1TUFA 2VTFA 1SO6A 4D6FA 1UD8A 4OUEA 3V16A 1JI1A 2IQTA 2CXGA 4K8HA 3RR1A 4M6VA 2VJXA 4ILSA 2Z26A 3RPDA 4YCOA 2R8WA 2R9RA 4NJKA 6REQA 2SFPA 5IBXC 3RGTA 2JEQA 5DQPA 1FWNA 3ZT5A 1ALDA 1W3LA 2QDEA 2O9TA 1IEQA 2CLLA 2W62A 3BARA 3TUUA 4F2UA 4OZOA 4PA8A 3S5OA 3QV7A 3N6HA 1TV7A 4RUBA 1W5PA 1GVIA 2XU2A 4GGBA 1QNVA 4CN6A 4PB5A 4XBSA 3R89A 3C0LA 3EYPA 1KRBC 2EO7A 1HJUA 1JCLA 1RD5A 1SFJA 2G3IA 3SO7A 2ZX9A 1K03A 2V5CA 5PTDA 4O15A 4JKLA 5DT7A 4OBRA 2Y1HA 2ZUSA 1X98A 1UUQA 5HMEA 3FV9A 4QBXA 1AVAA 5XINA 3K46A 4AYGA 3O06A 2DW6A 4L6DA 2YLLA 4HPGA 1F6KA 2C19A 1DWJM 2CFFA 4XSLA 5A1AA 2DDXA 3FCPA 1VPQA 2PDFA 4OQVA 2E7FA 3SCTA 3G0SA 1WXJA 2QPUA 1O7AA 1O5RA 2XN2A 1LM1A 1ITXA 5FCZA 4M29A 5G4EA 1AQ0A 4FHAA 3LB0A 1JPKA 3A9BA 3CIXA 1XG3A 2DSUA 3STGA 1FWAC 2PDNA 3AYSA 2WM0A 3DFYA 2RGLA 1TFVA 1MDRA 2QJNA 2QJJA 5CZ0A 4HNCA 2YKKA 1QHOA 3FSUA 4HNNA 3QLDA 4PSRA 4KCVA 4PBFA 2Y8VA 3MUCA 3NQ8A 5CSRA 2YB1A 1C8VA 1OADA 2NX3A 3WUBA 4HNOA 1R6WA 3WBAA 1IZKA 2EGZA 1E70M 1LOQA 4JTRA 3W9ZA 3UERA 4HZ7A 1U22A 4MJMA 3MSDA 1W8GA 5C2GA 5F2IA 4X61A 3WNMA 2WYSA 3C0JA 3WELA 5I3IA 4AX6A 3BAXA 1J2WA 3LPOA 1WPCA 3QN3A 3VNJA 4QG9A 4E4FA 1YE4A 4E3VA 4GWEA 1DHPA 1BF2A 3LS9A 4R85A 4PB4A 2JQXA 1XR2A 1OD0A 1XG4A 3MT1A 3KVJA 4JKKA 1BKHA 1W3IA 1GW1A 1KCKA 4M56A 3H54A 5C9XA 3HQOA 1SW7A 1JEZA 1GVSA 4NU7A 4ZXOA 4AHQA 3QHMA 3VFCA 4IPNB 2F6XA 4M1BA 3SCVA 2CBUA 1GUVA 1XLFA 3WQOA 3AMDA 3FN9A 4NJHA 2DH3A 4NAEA 2RUSA 1UC4A 4E3TA 3HQPA 2BV9A 3MO4A 3T2QA 5FSEC 4ACZB 1QJWA 1EPVA 3WQPA 3TEVA 3PAOA 3G1FA 1I8JA 3UWQA 1RP9A 4OJYA 3DI1A 3QFWA 1YMYA 2NV1A 4PRWA 1XH0A 3L65A 2FB3A 3HPZA 4LANA 3SM0A 2D69A 4AHPA 2GJPA 3E02A 2QLYA 3EPOA 2GQ9A 3PY2A 4A3QA 3GVRA 2FPVA 1BPLB 3BE7A 3FYOA 3GHTA 2VO5A 5AKQA 3E0IA 5HR7A 3PWGA 3W7JA 3I10A 5JBFA 1XSIA 5G1MA 4NVTA 3MZ2A 4MWAD 3O6CA 5D8ZA 4DZIA 2BVWA 3G2GA 1K9EA 4BJHA 3GDTA 3BDKA 1CNVA 1KXTA 3G1HA 4IIEA 3VM7A 2WWDA 1XYCA 4YS1A 3GSMA 1TREA 3BV7A 3B0YA 4UQBA 3T0CA 4FNQA 2P8CA 3WLOA 1KFBA 4DJFC 3S0CA 1CGWA 3CO8A 4WSHA 1EIXA 3NG3A 2QPXA 1RK5A 3VIOA 2V8ZA 4H9TA 4JX5A 2EPMX 5ECUA 5CPMA 1W17A 1OFPA 3PJXA 4O0KA 4BR1A 2ZYFA 1XQKA 4P5UA 3I3BA 4DI9A 2XIBA 5ECVA 1GJPA 3IJ7A 3KS6A 1ODUA 3PPGA 1J0ZA 3A3HA 4ZL1A 1HX0A 3GU9A 4EWJA 1BWKA 5AY7A 4BF7A 4Z1AA 1VCGA 4H6KA 3P2VA 1XYLA 2GJLA 3G6LA 4PEEA 1V03A 3I3DA 3GBEA 4RJEA 2OG9A 2E1DA 1V3MA 3W4RA 4QSHA 4MJ2A 3LPGA 4UTHA 2VR2A 4XZWA 4HCDA 5AHLA 1TIWA 2ZVIA 4DVOA 1JUEA 1JG9A 3QRHA 4HCHA 4HHMA 1EYEA 4RCXA 1LP6A 2E28A 5CBJA 3FY1A 3WQ6A 4I9AA 2DIJA 3NZRA 4AD5A 2OEKA 2D2JA 1P7TB 1KKRA 3CV6A 2H3DA 2EF9A 3AU6A 3B8UA 1TTQA 2XSXA 4AY7A 2D3NA 2E9MA 3DYOA 3WBXA 5EYWA 4LVDA 1U33A 3QSRA 2G8ZA 3LLXA 6ENLA 3W2LA 1BFNA 1OG0A 1UWSA 3TN6A 3TNOA 5CZSA 4N02A 5LNSA 3AUJA 4FXFA 1EOKA 2PAJA 3QGAC 3VIPA 4LCQA 4P61A 1FWDC 4A3RA 1LOSA 5D33A 1UH4A 3GU1A 4O28A 3CUXA 4XTDA 1DHKA 4MUPA 4MAZA 3L4YA 1Q7QA 3EKLA 4LNYA 1KWKA 2A0NA 4WR3A 3PNUA 1H49A 3FEMA 2RDTA 2X1UA 1E1CB 3S9ZA 2DIEA 3UJ2A 4G7EA 1Y8BA 1Z9AA 5CLWA 3WCZA 3T0TA 2YCEA 4UTTA 1UR8A 2NXGA 3KVMA 4O8RA 4RDYA 3L68A 3GW3A 4TV5A 1K9TA 1OF6A 2NQZA 3AXHA 4IP7A 3BAIA 3KLLA 3LQLA 2OOGA 1Q4NX 1KB3A 1GOXA 4DUVA 2OKOA 3AIEA 2YFNA 3S3GA 3AZSA 1FCUA 4F9DA 3AZRA 2J7HA 4ASTA 1UD4A 3SRHA 3LHVA 1KR1A 2WC7A 4Y6GA 3DBPA 4LUSA 1FOBA 1BXNA 4GVHA 1M9HA 4XZNX 2CBIA 2J7BA 1FDYA 1VPYA 4L6HA 3P0WA 1FCBA 1HFBA 2ZA3A 4DY1A 2DVXA 2VC9A 1NEYA 4PL1A 3CWOX 2E6AA 3KOFA 3W74A 3ELFA 2ZRUA 1DEDA 1FCVA 4N9DA 3ISIX 4Q8WA 1GZGA 2V3GA 1TPEA 4NX0A 5T9BG 5EBAA 3KW3A 3QC3A 5HJLA 5AYZA 1J01A 3T2OA 2YDQA 5CC5A 3TTEA 4Y8EA 4LS0A 1I60A 2HVNA 4ZTXA 1TJ1A 4WJEA 4WSJA 5DMYA 4J3UA 1GNXA 3DFTA 1OX5A 1ISWA 3VE9A 1QASA 1BAGA 1HUVA 2XTKA 2VURA 3QM3A 4H04A 4GG9A 1DJWA 1I2RA 1LQ2A 2DT1A 2XIMA 2UY5A 1FVPA 1OX4A 1R3QA 3LCGA 2CHNA 2J25A 4ORMA 4U3CA 1M03A 3W82A 5IHSA 5FJIA 3VINA 1KM5A 1EDGA 3QVQA 3LCIA 1XS2A 1V6UA 4C6DA 3I65A 4W9TA 1R86A 4R3UA 3U2OA 3OP2A 3STPA 5HINA 4WY0F 4E38A 4DBUA 1FH8A 4H8NA 4M6UA 4O50A 4J9JA 1C92A 2WJFA 4MHBA 2BVTA 1SJDA 2XH2A 3O0FA 1GOOA 2QDHA 4PFMA 2X1RA 5FEZA 2BGSA 4PN2A 3R4IA 3EWYA 1E4NA 5AN7A 2A3CA 3E3HA 3UESA 5MF5A 3W1QA 1CDGA 1QW8A 3BZJA 3W7DA 4Y9PA 3M6YA 1Z7AA 2V3FA 2ZUWA 4QEEA 2OT1A 1EF3A 3WLNA 5CBIA 3ANUA 3CHCA 1PPIA 2E77A 3GVWA 5H1WA 3TC7A 4KFPA 3REQB 1SJBA 3KL3A 3U8GA 1WDRA 1UJQA 1UR2A 4GXMA 1EA0A 5HNTA 5MKGB 1G0CA 1SO3A 2IKJA 3GIQA 2ALDA 4Y96A 2YZRA 1M04A 3KBWA 3VIJA 4JX6A 3N4AA 1S3TC 4AD1A 2Y0FA 1XYBA 5D02A 4JQ3A 3WLPA 3TK7A 3UG4A 1XIDA 3QQ1A 1TR9A 3RN6A 2Y7FA 1W5NA 2X1IA 1X6NA 4OGZA 1W1TA 4JXCA 4PZVA 2J47A 4C6IA 1UR3M 1XYZA 1NWUA 3E0WA 5I3JA 3OODA 5FJUA 5B80A 3H4XA 5CCZA 2X09A 4GISA 3PZUA 1YNPA 1U1UA 9XIAA 4AW7A 1WOAA 3RMEA 1SQ7A 3GB6A 4RZBA 1M1BA 2WWCA 3OVPA 1PCKA 2GK1A 3MUIA 3F5JA 1VYSX 4Q4OA 4K2SA 4FI4A 1JDEA 3FKKA 4IPIA 1I2QA 1UQZA 4UTLA 3ARRA 2G95A 3N2TA 2Y62A 2CLEA 2E25A 3N12A 4C1NA 5I7GA 2TRSA 4OV4A 3M0HA 2VC5A 1LRTA 2WO5A 3ARVA 4GI4A 1WZAA 1V8EA 3M5ZA 4D1JA 5BXTA 4JCLA 4W84A 5CGQA 4O18A 3LI1A 2ACQA 3E5BA 1P6BA 4LVGA 4LWWA 1NWSA 3PANA 2O4QA 3E2SA 1T6MA 2XIJA 3CT2A 4FOUA 1F61A 1H7WA 2PLKA 5K7JA 4F9JA 5HMDA 1TO3A 2C18A 1PZ2A 3ARTA 2PWDA 5TAOA 1AH0A 4GVFA 4UTKA 3SCOA 1O5KA 1KFCA 4DWDA 2QUTA 3VX0A 2Z6JA 4XKYB 1CXIA 4BWLC 2DORA 4LC8A 3BAYA 3UY8A 2DZUA 4KBXA 1K6AA 2OELA 1V6WA 3OZYA 3S2LA 1Q8JA 1JDFA 3N25A 4HGXA 4NXSA 2G4JA 2Z1SA 2CERA 1C3FA 1KNWA 3PZVA 1UMLA 2QXWA 4IQLA 3USBA 1R3RA 1I6NA 4CCCA 3NURA 3QEZA 3IACA 3P81A 3F2DA 4S3BA 1NDWA 1TZ7A 4NIRA 3IUIA 2WHMA 3MA8A 3Q67A 3OTRA 2Z28A 1HO1A 3BLEA 3F2CA 3WD2A 3RM8A 4AVNA 1XQLA 1MW0A 3TW6A 2E6FA 1E4IA 3CHEA 3S46A 1ONEA 1BG9A 1IZCA 3NVTA 4X9SA 1W1YA 3FA4A 4UTWA 2J62A 2QCMA 2V5DA 4TV6A 4JTHA 2WNQA 3M0IA 4UTIA 2D0HA 4GI9A 4RKAA 3CH9A 5F4XA 3VNYA 3KBMA 5CBBA 2W92A 1MNSA 4UR8A 4O0QA 4W93A 4C6BA 3SY1A 1RUSA 2QCNA 3L5MA 3SCWA 4UNLA 3VKAA 3APGA 2R1NA 3MCNA 2ATMA 4N4PA 1IZJA 5I2UA 2FLIA 2BMBA 3DC8A 2WMGA 3VXGA 4WXYA 1BWLA 3PHAA 3D46A 3CEUA 5I02A 1KRCC 4A3YA 2ZICA 1H1YA 3AUOA 4Z42C 2V82A 4Q8QA 3U0HA 4ROPA 3MI2A 1XUZA 2ISFA 1XINA 3R1ZA 5ABTA 8RUCA 3CYVA 3DG7A 3S6DA 4GE8A 3EMQA 4ZTYA 4NZCA 3GG0A 1JR1A 3KUMA 2D0FA 1K8XA 3E96A 4N2YA 1WBHA 2FZMA 3T55A 3F5KA 1YXDA 2WQDA 3HPFA 1K02A 4DWSB 2NT0A 1SJAA 4Z2LA 1SO4A 1A5AA 1I1XA 4QG8A 4W7VA 1ELSA 2O9OA 1Q6CA 4HNVA 1KBBA 1YDVA 3GNOA 2WLZA 3HMJG 3U2ZA 2NUXA 1OK6A 5U7SA 3TA6A 4JTIA 1UQYA 1ZJBA 4QSFA 1QI5A 5E9XA 2ZZ6A 3TCEA 1S2UA 1UB3A 3KWSA 3FFSA 3VD7A 1O1ZA 3RX2A 1FTXA 1ITQA 3W7MA 1E3ZA 4LSBA 3VZZA 3V3WA 1MNZA 2WMIB 3IRDA 3GUGA 1VD6A 1DE6A 4CD4A 3JU2A 3FSTA 3DHUA 3CO4A 5TQLA 1QMLA 4E2BA 3R43A 1MEIA 3S5YA 3KVLA 3M0MA 2CHRA 2QCDB 1K8YA 4BQ3A 3QMSA 1KFWA 3RAOA 3FVMA 3CAQA 3P82A 5I3KA 2VQTA 1UH2A 1J10A 2XH4A 1UASA 3D47A 2V2HA 1IGWA 3TDFA 3H8AA 3LXBA 3WH6A 3EDJA 4H83A 2BS9A 4RZ4A 2VUNA 5GNYA 3S47A 3RCNA 2CETA 2A7RA 4IPPA 5IFPA 1PIIA 1TVLA 3UJRA 2PD9A 3IK2A 4FX8A 3IGSA 4WCJA 4LQ1A 2VRQA 4OWGA 4AEEA 3KHDA 1GVYA 4GMEA 5A6TC 1CXEA 1QNSA 2GGHA 3AYVA 4U33A 3FA3A 3VC5A 1JD9A 3ME3A 4DBDA 2J6VA 1SSDA 3VGFA 3NQDA 2HXTA 1HQTA 4CNTA 1A3XA 1W1A1 4X0VA 3N11A 4J3TA 3W1NA 3TR2A 1JPDX 2PCQA 2QCHA 1YLVA 1A3HA 1IEIA 3WL0A 1D8WA 3DBNA 3W28A 3HIJA 1VENA 1B31A 4GUGA 5DO8A 4FNTA 3DZ1A 4KGLA 4MF4A 4WZHA 1S1RA 1XFCA 3C56A 4UFJA 3LN3A 2YA0A 4BI6A 3VVGA 4GYPA 1IT7A 1US0A 4GUJA 2ADAA 2XVLA 4KFOA 5AZ0A 4V1YA 3TWBA 3H24A 5BWFA 2JALA 3CAVA 2ALRA 3AS0A 3TAOA 1R87A 4P7QA 5BRBA 3OPSA 1PWLA 3TIMA 1BVZA 1AQMA 4IG2B 1ECEA 4NNCA 3QF0A 1JPMA 3N3TA 3N19B 3WO8A 1H7PA 3M16A 1KRMA 4MPKA 3T6CA 1OF8A 2Z1BA 3LEPA 3ALGA 4LVAA 2ESCA 5E0CA 1KGWA 2CITA 7TIMA 4B3KA 5K9DA 3KDOA 3UG3A 1ISXA 3H4GA 5FEWA 5TD4A 3DU0A 4BQ5A 4JTUA 4JQAA 4QJ1A 4XAPA 4O13A 1QNQA 1EZ2A 1G9HA 2ZWZA 3CHDA 4J28A 4YPJA 2NXHA 1CXKA 1EH9A 3KBJA 3N15A 2VZOA 1PKMA 3N3MA 4OOUA 2DZTA 3MANA 3S9IA 4DPQA 2HWGA 4J1OA 1J9YA 2Q3OA 3K30A 4DRSA 2O4MA 1XP3A 2OLHA 3HG5A 1B1YA 3BOLA 2VENA 3NPXA 5J8LA 1O4UA 3MVIA 4Z1DA 2QQ6A 4FXSA 1A50A 1Z32X 2W79A 5C9WA 3CUIA 5A94A 2HZGA 3MI6A 1RJRA 2VEGA 2JIEA 1MRAA 3G3MA 2PRHA 3E38A 3L7RA 4U5KA 2PUZA 4O8AA 3SI9A 4E4PA 2P88A 2Q71A 3GM8A 4ZB2A 2ON3A 3T07A 1QRQA 1TJRA 4LEFA 4AH7A 3E2QA 5CPQA 1VBGA 5LNVA 2YGYA 1XCXA 3B3DA 1OCJA 4V27A 3M0YA 4H2HA 4Q4SA 3WKZA 1WP6A 2BNJA 3PPHA 4GIYA 1W6TA 2B31A 3P80A 4MYAA 3CBWA 2FIQA 1TWSA 5H2ZA 1OGGA 1XGDA 7PTDA 5CC3A 2X0SA 4GCXA 2BB0A 3BSMA 3C86A 3CIVA 3OU8A 3HTWA 3QW3A 4PL2A 1KM4A 2VGBA 1DWIM 6REQB 3POHA 4BI7A 3THAA 1J12A 4NRSA 1VLIA 1KM2A 2W27A 3H6OA 1RA5A 1VJZA 2IKHA 1VF8A 3ZVIA 5CGTA 3NQFA 4GYJA 4ZGYA 2XFYA 3AISA 2D20A 3BLDA 3Q94A 1ZSXA 3M5YA 1MUWA 1R46A 1PIGA 1B3YA 2DT0A 4E8CA 3H7UA 5A3HA 5D4YA 3F2BA 2PDKA 3W25A 3F4WA 1EJRC 1KM1A 2ABBA 1WCGA 4R88A 1PYMA 1NFPA 2PLMA 4J5NA 2OU4A 1NELA 2VZVA 2ZFAA 4N7QA 2OSWA 4MNMA 1YIXA 3IWPA 3MMDA 5F1VA 4JTTA 1W31A 4P8UA 4EF9A 2A2IA 1DJGA 4JTLA 3VIMA 5AYIA 4ERAA 2IW0A 2WJZA 4B5NA 1H50A 4ALDA 1H0GA 5EFFA 3WJWA 4RPPA 4EXBA 1JQVA 4FX7A 3W72A 1NFBA 3B4YA 1AUSL 1WDDA 3IVUA 4YMZA 2G5WA 4QLJA 1LT7A 2IXUA 4GHRA 3SECA 2XM1A 2Z1KA 1IWAA 3VGHA 1HL2A 5CEWA 1E0WA 3AWOA 2HEJA 3JR2A 4PUWA 3OA3A 4ML9A 3HOJA 2Z2AA 2QGYA 4W7UA 3PZIA 1MXDA 5GVJA 4C6KA 7ENLA 4I9TA 1CB2A 3SJ3A 5LIXX 1W9XA 1DJQA 1FDZA 4LAMA 1GG1A 2A5HA 3WN6A 4E2VA 1XV8A 1TWDA 3QY6A 2PDXA 4UQ9A 3NNTA 4FX6M 3WFAA 2DEPA 1A0CA 1IIHA 2PLJA 2YCIX 1UC5A 3IJ8A 2X7VA 1SZFA 4KFNA 1UR9A 4PBEA 1BSIA 4E0CA 4HPHA 3WF2A 4B2DA 5D38A 1GOMA 3W29A 2PGWA 2X05A 3DKJA 2QJGA 3F4NA 1GCYA 2V9DA 1E1EA 2BZNA 1V7YA 1GVEA 3O07A 1MUCA 4NF7A 2WCAA 1H1NA 5DMNA 2P53A 4M81A 1L2QA 3VE7A 4ZOCA 2BHZA 2RDUA 4GD0A 3R58A 3GYEA 2PGEA 4WSKA 1SR0A 3L5AA 4N6FA 1F3XA 5K4ZA 3GXFA 5DY3A 2GJXB 1HL8A 1CTNA 3D3FA 3KTSA 4IFKA 4FAMA 3LMYA 5CAHA 3HG3A 4IIBA 1IYXA 3H55A 2RDWA 1JXJA 4H7CA 2VDIA 1A49A 3QR0A 4MB3A 3A4WA 2Y7DA 4DPPA 2WK2A 3S2MA 4GBDA 1Z42A 2V81A 4MB4A 2DZWA 2PWVA 5A6JA 1WOBA 3T2PA 4YYCA 1T41A 4RK8A 3PFRA 4AG0A 5I07A 1SVDA 4NILA 3OLDA 4LCRA 1JDDA 1XD1A 5MHBA 2TAAA 2XM2A 4ZFCA 2V5BA 1KO0A 3F03K 3E0VA 3RLVA 2AGTA 4KQNA 1BYAA 2QYGA 4W5ZA 3W6YA 3CZ8A 5I24A 4WY0B 5DBUA 3NL3A 5FF2A 1QPNA 1WUFA 1SR9A 1E1FA 1WZLA 1Z89A 1TWZA 2NVCA 4OBSA 4LALA 2FMNA 5KITA 3SN4A 1KGUA 1PX3A 3GTXA 2ZUMA 2PTDA 4TVDA 4BI5A 3VOIA 5T91A 4CNUA 3NL2A 4H3DA 3GDKA 1C8YA 3TOPA 2F8QA 1VS1A 4IMFA 2I9EA 3QFEA 3NZQA 3OB8A 1EWEA 1ECQA 4WIWA 4REQA 1DWAM 1GW9A 3G1YA 3DFOA 3YPIA 4KEVA 3ENLA 4JFWA 3RR4A 1P1XA 3C52A 1OB0A 2FB2A 4MY9A 1F05A 1XDJA 4MWAA 2A3HA 2HNEA 4RNHA 3N9KA 3NA8A 3CU2A 3IIVA 4X22A 4JN6A 4ZOBA 4FNRA 3LZ5A 4Z0SA 4HNLA 5CC7A 1WB0A 4JHZA 4N9BA 4BHYA 2FMOA 2X8RA 3NQCA 4OKDA 5E70A 5E0KA 3GHSA 4NI3A 4J2PA 4ATDA 2ACRA 1F4HA 4I7WA 4C91A 2PE4A 3KHJA 1ZBKA 4RX0A 1K8CA 2Y70A 2VWSA 3KCOA 2GJRA 4H19A 4TR9A 4EPBC 1FWRA 2Y89A 3O6YX 3FHAA 3SQLA 4H6RA 1SZGA 4JL1A 4LAKA 1NTHA 2LLEA 4AMAA 3KE0A 1TTIA 4GOAA 1I45A 4MKSA 4GLEA 3M0XA 3FAXA 4LF1A 5B7ZA 4TX8A 2VR5A 3W87A 3GIPA 1TCMA 1YKWA 1OJXA 3AIBA 1ZBCA 3NOEA 3K4WA 4KERA 3AIQA 3SSJA 1VP5A 4A8NA 1UD2A 3I6TA 1E3XA 4DO5A 1FXPA 4DBEA 1BYCA 1NSJA 1DBTA 3VU2A 4UTMA 4HNUA 1K8ZA 4MKNA 1Z41A 1EUNA 3F7JA 5AC6A 4DJFD 1F8MA 5FL0A 3WDIA 1GG0A 1XICA 5LIUX 3LK6A 4HZ8A 1IEWA 4WGXA 4H7ZA 4Y9MA 1QXLA 3ONCA 3TE9A 2YDSA 3BURA 3UXLA 1RY0A 1Y5XA 3CZEA 2NWSA 3UYIA 1JZ4A 3L21A 3QPYA 1QPOA 1ISVA 4Q6JA 5CQ1A 5A8MA 3S1XA 4DLMA 1ICQA 2ODOA 1TIMA 3DHPA 4FNUA 4F79A 2GQAA 1SMAA 2HE5A 3NUKA 3FDKA 4AZ5A 5BU6A 1QAPA 3I4EA 2PBOA 5CG7A 2OTDA 2WKLA 4Q8OA 4ZXLA 2L5HA 5A8NA 1F74A 4X0NA 2YR1A 2XGBA 3QOMA 2EHHA 4M3PA 4MDOA 1E9ZB 1D7KA 2OXNA 3DH7A 2POZA 7TAAA 2QDGA 4IICA 2F6UA 1ZU8A 3ABRA 1M5WA 4O1DA 3RIKA 3A5VA 3EMZA 1RV8A 3CAKA 2VL4A 1XKJA 2C71A 3N9RA 2EXOA 1M65A 1PHQA 1NF7A 1UHVA 3O6DA 1QO2A 1QUMA 4I9JA 2OYKA 3SFKA 1KV5A 4ZO7A 4C6QA 1U2YA 2YFOA 3II1A 4HPXA 2OO6A 1OCBA 4G9PA 1KM3A 1LTDA 1ENUA 4LUSB 4IJRA 4PTWA 1DIKA 1XF0A 1GYMA 3TVAA 6TAAA 3ORWA 4ENLA 4DEFA 3L4VA 5FKYA 4FK9A 2B4GA 3NM3A 3GFYA 4O1EA 3TH6A 4LS1A 3VFLA 3EBVA 4YN5A 2HPIA 4JEQA 3IUDA 3GDLA 2YW4A 4MVAA 4DJDC 5CGMA 2V63A 3VIIA 3KRBA 1AODA 3TTQA 5A2AA 4PULA 3W1TA 3KCJA 2PFHA 2Y8UA 1EGVA 3I7RA 2WVUA 4IMCA 3AJ7A 4Q8VA 1J8VA 4UIOA 1NP0A 1KLYA 4H01A 3DX5A 3TMQA 3LHUA 2A7PA 4Q6XA 4YL2A 3XISA 1OX4B 5CJMA 1E6XM 3FYPA 2QUNA 3A4XA 4I7VA 1LG1A 2NXIA 4GI8A 3WLJA 4FF7A 2VEPA 4QTGA 1AK5A 4M51A 1OCQA 2ZXQA 1UP2A 1JJKA 4HTYA 1CGXA 1ZCOA 3O3RA 3H2FA 1L0PA 3TJLA 4NX5A 3O8AA 1F4AA 1EDTA 3GNNA 6PTDA 1XYMA 2POTA 2ZBTA 3N4FA 2H90A 1RALA 1NOUA 1E56A 2G37A 1UYQA 2VELA 4NZ5A 4WKFA 2YDAA 3AXIA 3V4BA 1F3TA 1TTPA 2Z29A 4LNCA 3AZTA 3BLOA 3AC0A 1VIZA 2PDGA 3V18A 1XHGA 1OFBA 2ZC1A 3TJIA 3E74A 4U28A 4D8AA 1VRXA 3WMLA 4R53A 4GBUA 4HMDA 4MM1A 1JF6A 1UKPA 4LBUA 3VILA 4DUXA 2GGGA 3UG5A 2V30A 2PDPA 3VNIA 2VFFA 3TYCA 2UWFA 3OG2A 3TC6A 2Q09A 3BLIA 2J75A 2HVOA 4O54A 4DXVA 5A2CA 3LOTA 3P7YA 4MAVA 3NQMA 1HJQA 2IQDA 4MZYA 1KM0A 3QY8A 5CKSA 3A23A 3AHZA 3M44A 3I7QA 3G24A 5KZMA 5H6HA 2ZUNA 1UUOA 1VB9A 5LKYA 4IOTA 4JFUA 4LOCA 1J0YA 1TR1A 4AIUA 2I5IA 1PB0A 2ONEA 3V5CA 3GH5A 4HKPA 2IMRA 1V3IA 3ZZ1A 4MKVA 1R5YA 3VD3A 5C70A 4JTJA 4XAYA 2BP1A 4GUHA 1C7TA 1S5NA 3SJNA 5FESA 4MNJA 4L9ZA 4IMEA 3EMCA 5HR6A 4RPQA 1Q6EA 4Q4QA 3S2CA 1CI1A 2GK1B 3UF9A 5KINA 3WNPA 2Y5EA 1G1YA 1Y7VA 4JIPA 1YEYA 1LLZA 3GTNA 5H8MA 3LD5A 4MY8A 3LUTA 4JQ4A 3W22A 4L80A 3RCYA 3SUUA 2QMJA 4DELA 2E5CA 4GVIA 4C1NB 2ZUTA 3S1WA 2YBVA 1XGZA 2I57A 4Q4RA 4WVXA 1V3HA 1BKSA 4XO6A 3HBLA 5D2YA 2FVLA 1MWOA 1KBKA 4TX9A 1A5SA 3UWWA 3QBUA 1DJNA 3KBNA 4LUYA 4HYVA 1B30A 1EP2A 2CZFA 4K6AA 1QW9A 5I3FA 3IVTA 3PUDA 3MMUA 3T0DA 1L9WA 3GBDA 3A3WA 4RNIA 1J79A 1TA3A 4DZAA 3VOJA 3UPMA 4UZSA 1NDYA 4EXQA 4KW2A 4DJEA 4G6CA 1HGWA 3PJUA 1AZ1A 2DT3A 2ZRVA 3PB2A 3QQ0A 5AYXA 7REQB 4CN4A 1H11A 3QTGA 4WXZA 1RA0A 1ONXA 3BLFA 2WMHA 4L61A 1D3HA 3T40A 3RILA 4DHGA 4UTWC 2C91A 2W4XA 4R33A 1H0IA 4PFHA 3NQVA 3EGJA 1J0HA 4YTUA 1AFSA 5HUPA 2FHBA 1E6NA 4NZFA 2XINA 4KEZA 3LHTA 1J96A 5KSWA 1JI2A 1TCDA 1BG4A 4U4MA 1LWJA 1NVMA 1BWVA 4H1ZA 3EA1A 4KRUA 1TV3A 3TYAA 2VFIA 3BL3A 1NIUA 4HK6A 3O0KA 1CX9A 2NVAA 2XWDA 4B92A 3LNPA 5C0QA 3TYDA 3RO8A 1OIFA 2QR6A 3EXRA 3WUEA 4A4AA 1DQWA 1RK6A 1SFSA 4LUJA 2OZTA 3B0PA 1OC6A 3DG3A 2HV5A 4QDMA 3W2MA 1EJTC 1NOWA 2CLHA 5D32A 3UJFA 5CZKA 4E4UA 4PTMA 5M1TA 2VRJA 4K37A 4AD2A 3R8RA 2E40A 4LEQA 3LRLA 4QCFA 2VFEA 1HTIA 5REQA 3NPWA 1PZ1A 1A5CA 1KQYA 1FWFC 3TN3A 2BX7A 3ANVA 1S5VA 1XLLA 4Q7NA 5LGZA 3THQA 3GYCA 1FA2A 4F0RA 3L23A 5EGRA 1M7PA 5HNRA 4I6KA 3WDJA 4KWWA 1VKFA 4GI6A 4IIHA 3ZT7A 2GJNA 4PMNA 3LTYA 4YVVA 2DUAA 3HGSA 2I16A 2PDIA 5IDZA 3EEZA 3WLHA 4PUMA 5FD0A 2EPHA 4NJGA 3U6WA 3TCSA 2O0TA 3KS5A 2V5LA 4HJFA 4QNEA 4FR1A 5LNWA 3IAQA 1TZ9A 1ZTVA 5CG0A 1VFLA 2XVGA 5HQMA 1E73M 3REQA 2CLIA 2OQHA 1C7SA 3SCQA 3QZ6A 1W1PA 4NYUA 1ISZA 4OE7A 3UR8A 3ZOAA 4L64A 2X41A 1R3WA 4IFOA 2AMXA 2NX9A 4WOZA 1JRCA 1VGAA 2GL5A 3KBSA 4HSHA 3RRXA 3UZXA 4O1CA 1VYRA 3OYXA 3W6LA 4DN1A 3P14A 1CENA 1A53A 3AMGA 7A3HA 1VBUA 3NEHA 2QCGA 5K3VA 3KDNA 4ZENA 1TJPA 4J40A 3GDMA 2ZZ3A 1VEMA 1OYAA 3L66A 3CHFA 1BLIA 1XCFA 2W61A 5FJOA 2OT0A 1H41A 3EDKA 3EX3A 3SIZA 3CUZA 4UQEA 4GZ7A 1A0EA 3M7WA 2CZEA 2VT0A 1J4EA 2MUCA 3CZKA 1N55A 1ZGDA 4Z2GA 3S1VA 1DPMA 4H00A 2DVUA 3NZGA 3P62A 4C5ZA 4RR4A 2XFFA 3VIGA 1POJA 2NQ9A 3ITVA 3IV3A 3TSBA 1EFZA 2XIIA 1XSJA 4B5UA 4QJ5B 2EG6A 1HF6A 1GVOA 2OWXA 5J5RA 1HJWA 3PJWA 4M6PA 5EL1A 1NH6A 2QCEA 5AVNA 4O1AA 2YB4A 3RNDA 1L6FA 1XX1A 3C3NA 2B81A 2J7EA 5DBTA 4W89A 1YPIA 4YTSA 2GSEA 1ADOA 4HZMA 2WZTA 5FAGA 3P60A 2ZX6A 1F3EA 3MHGA 4JS3A 2UY4A 3D3AA 2QPSA 1JZ3A 5HBFA 2NQLA 1U5JA 4GY0A 2JFEX 3L2IA 5IOBA 4GYPC 3EB2A 4XKYA 3SDOA 4RLIA 4FLSA 2JEPA 1R9YA 2XZ7A 2VVNA 1HJVA 3DHDA 3FGCA 3T42A 3BLLA 2ZIDA 3EWXA 1HGYA 3F4VA 4GA8A 1JGIA 4OU1A 1ONWA 4UR7A 3VKDA 3R25A 4DF0A 1NU5A 3TYEA 4P7LA 2HRWA 1W3NA 4BKNA 4PUEA 4XX6A 3EWBX 4PUUA 1IXQA 3OJGA 4GKTA 3WLIA 1CBGA 4UTJA 3SUWA 3UPWA 2J88A 4DBWA 4FZIA 1BSLA 4D6HA 2PDHA 4OT7A 2BG5A 3CUJA 2GDQA 1A5NC 3QYSA 3UT0A 2GYIA 1DXFA 3UZ5A 1VHNA 4ES4A 1VFOA 2JGYA 5LIKX 5C9ZA 4ZA0A 2VHLA 1V6VA 1UKQA 5EMLA 3OG3A 2Y6ZA 3W81A 2YPIA 3GNPA 3K8LA 3GHUA 4S23A 2CPUA 4QAIA 2VGIA 1UCWA 3GXIA 1SJCA 3HU7A 4HMNA 2B7OA 1JFHA 1MQPA 1F7BA 1TYGA 5JU6A 4Q7BA 2P10A 3WYZA 4R9XA 3W7EA 3R12A 4B4FA 3UEQA 3RX4A 4C7GA 1GJWA 2E68A 4UOQA 1UP3A 1RR2A 4UCFA 4BS0A 2B0MA 3RK8A 4IUGA 2WSQA 2B7NA 3Q58A 5KMYA 2Z6IA 3BTNA 3BWWA 1QNPA 2Z1XA 4FIRA 4RZ6A 3MTWA 4O10A 5CLTA 2BOFX 3A4AA 3HA1A 3ITLA 1KXHA 4JQ1A 4PCPA 4PUJA 5BOFA 3Q65A 4K8GA 2ISVA 2NUYA 4G5DA 4WDWA 3GVVA 3P0XA 2VDHA 5A95A 5IRPA 1X6LA 3B4UA 2QCCA 3EDEA 2DQWA 1X97A 1Q6OA 1IXPA 1DWFM 1B57A 5EFDA 5AB3A 3VPLA 3GAYA 3GTIA 4RNFA 3DG6A 3MSYA 4W8AA 1EP1A 3PBMA 4GY7A 3RX3A 5I03A 3WIJA 2E8ZA 2X1TA 3K8KA 4KEMA 3MQTA 3PWIA 2PB1A 3ANYA 4AF0A 1X38A 2DQXA 4DXKA 2PDCA 3BK0A 1C9DA 3GKFA 2WB5A 2WNZA 1UJPA 2INZA 4JBRA 2FVMA 4OIFA 1XBZA 4JR5A 6XIMA 5ABFA 1QWGA 4AC7C 2WHLA 2GLKA 2PD5A 1QW7A 4NJJA 1SM9A 1XLCA 1VJIA 2ZUUA 3W2JA 1DP0A 3NOYA 3BXWA 2HK0A 1XH1A 5E1QA 2DFAA 3N2OA 4XVDA 2A3AA 3S6OA 3WDHA 3QLLA 4MYXA 1R3VA 4GZJA 3PZ9A 5I00A 1PKYA 5I23A 3VM5A 2ZZ5A 4Y8FA 2PRLA 4IQJA 3T81A 2CU0A 5HK4A 3M6DA 4TXEA 3TW9A 2NLIA 3LM7A 2ANUA 5A6SA 4O11A 4XZBA 4FIQA 4MJZA 1WKYA 2OKTA 3TN5A 8A3HA 4GX9A 4JTSA 3FNDA 4BCEA 1X6UA 2BXYA 2W3ZA 4GIRA 1BXCA 1VBRA 3WD4A 3DI0A 4F3HA 1O66A 4DUOA 4QE5A 1I4NA 2WMFA 2VX6A 3AXKA 3MDUA 2VUYA 4LBRA 1FP9A 1X7IA 2NV9A 3BCJA 1XXXA 1VEPA 3LX9A 2HTMA 2PDJA 5IDIA 4LV4A 3PZOA 2I17A 1L6GA 3TN4A 1D8CA 2Q8XA 4CU6A 1VH7A 2J9XA 2RJGA 1BQCA 1XDMA 5FAJA 3SUTA 2CNCA 1GVQA 5I0DA 4K68A 3UXKA 1EIBA 3R8GA 4GZIA 1FWWA 5HQLA 1OD8A 5ABHA 5I3GA 3W23A 1JNDA 5C7HA 3AIVA 4AWTA 5CXPA 3PBYA 2J9YA 1N82A 4AIOA 2IPFA 2NQHA 1L2UA 5F2GA 4JEJA 5F4SA 1MDLA 3VIFA 3PTKA 4ZO9A 2V2DA 2DSZA 4IG2A 5FEPA 1FWBC 1VJSA 5DXXA 4HMCA 3ZM8A 3L4XA 4UBPC 2OZ8A 1FWTA 1OBAA 1Q6FA 2XJ7A 2Q01A 3QZEA 4V15A 3STCA 2WANA 5D03A 4JX4A 3ZJKA 5BZAA 4NZ4A 1RXOB 4Z2HA 4B9YA 1P1MA 1E0XA 4IFKB 4U5IA 4L1GA 3WQCA 4EE9A 1JYWA 4L6OA 5GNXA 3CB3A 1JUKA 1ZAHA 2PZNA 1Q7MA 1Q85A 5EY5A 1OHLA 3CT7A 5T26A 1V4YA 4QLKA 1W3HA 1K9FA 3N34A 3W7RA 4U10A 2AQWA 1LBMA 4QAWA 2WZIA 4MLJA 1V93A 1ZBWA 3EOEA 2GUUA 5I5RA 4BFAA 1YBQA 1YRRA 2JF7A 1S1PA 3NSXA 4E2DA 3ZJ7A 4UFLA 1IEXA 1UIOA 3W0KA 3EOUA 5L6UA 1KC7A 4EPDC 3ZR4A 4U2YA 4H9YA 2PBGA 4LB3A 4OTKA 3W70A 2F2KA 3P8JA 1H5YA 4JIQA 4C6MA 4OVXA 5BU9A 4PSPA 1A47A 3GFXA 1EF2A 1J0KA 2ZX5A 1TJ2A 1BTMA 1TV5A 3NQAA 2C8NA 5I6SA 1DIDA 2X7WA 4GUIA 3N17A 3SCPA 1B0IA 1K1DA 2QV5A 1QCWA 3QOKA 3NL6A 3LG3A 3VOHA 3UZWA 3SGZA 4HHLA 3WF3A 3RJYA 4GQGA 2QIIA 1M68A 3WQ4A 4UQDA 4PMVA 2D23A 5CPNA 3R79A 4REQB 4GY1A 5A2BA 2PTYA 4B3ZA 4ICMA 5FACA 4QIUA 2YCKX 1DQUA 3WENA 3S6TA 3ZLFA 4I3GA 2R1LA 2PU0A 1PX4A 4LAZA 3TLQA 3DFPA 1MZRA 3H22A 3PUGA 5M17A 3BAKA 2NX1A 2JGQA 4MWAB 2NVDA 3T44A 1TWIA 2V3DA 5C6MA 1THFD 4HOXA 3W6MA 3ERPA 1AW5A 1TZZA 3PTMA 1PZ3A 4YTQA 2OVLA 3W1UA 1XI3A 3LENA 2RKXA 2PGFA 3KOYA 5LIWX 1S46A 3N2CA 1HIZA 3W1AA 1EO5A 2VNCA 4AY8A 2EJAA 3VNLA 3M43A 1W3KA 3D0CA 3P3BA 1G6CA 4XWUA 7ODCA 5G4WA 5EPDA 4EAMA 1SYTA 4B5WA 2X16A 3WFLA 2GVLA 5DLCA 3CQHA 1XRVA 1YDYA 1JYXA 3CMGA 3NQ6A 3R5EA 4AB4A 4Y9OA 5I09A 1HNYA 4B5XA 4FOKA 1OG6A 4JICA 2PODA 1XCWA 1EJSC 4DO6A 1XPYA 3H21A 1QFEA 1AA1B 4MZ8A 1NWTA 3GNRA 4YTTA 1TE6A 3D5HA 3LQGA 1PBGA 1P0EA 2WAGA 7CGTA 3QW4B 1W32A 5A6BD 1FKWA 4EK7A 3LRMA 3V5OA 3KM8A 4GNVA 4LXFA 1A0DA 4K36A 3WLRA 1LLOA 4N42A 1FWIC 4HQVA 3WH7A 1EJUC 1GQIA 4GXPA 1WZMA 3LERA 2A3LA 1IXOA 1HVQA 2NZLA 4OBTA 3BSHA 2FPYA 4L4PA 5DXYA 4POCA 1PV8A 4XD3A 1KWGA 3WLKX 4J3WA 2E8YA 4LT9A 1U5VA 2OX4A 3VC6A 3DC0A 5F2MA 3SQMA 4Z17A 3ZVHB 5LNUA 1F8IA 1HXJA 1PKNA 5A5WA 4AU0A 3EWWA 3WH9A 3W73A 4TO8A 5AHFA 2BHYA 3PZTA 2AGKA 2YYTA 4MLRA 3SY5A 3S83A 1A5UA 2CLKA 1X1NA 2BY1A 1WDSA 1RBOB 1FWHC 1NWRA 3AO0A 2VZUA 1QI0A 2GJXA 2FTPA 3TX9A 6TIMA 3C2FA 5AECA 1AH3A 2FGLA 3L0GA 5F1UA 1EQPA 4ZSTA 4AD3A 4HBKA 4ADSA 5GJNA 1BTCA 3TR9A 3QXBA 3PPFA 4HD5A 2XISA 1MVYA 1S3HA 1XLIA 4QEHA 4DO4A 1TPH1 1EWDA 1WE5A 2A21A 4PODA 3GX9A 3TTSA 4A8LA 4B9ZA 1CT5A 5FA5A 4O57A 5HMFA 3LV5A 3IEBA 3TMLA 8XIMA 2ZXBA 2ZWYA 4AEOA 3CL8A 2QVHA 4JYEA 4QRNA 3GTFA 1SZRA 4W5UA 3GIYA 1N7KA 2JBMA 2ZE3A 5CH9A 1L6YA 1GVRA 4K39A 4HOZA 2X30A 1EQCA 2AAMA 4L4LA 1R2SA 4TUFA 4WY0A 1YNYA 3G22A 1JDAA 1QOXA 3VKJA 4P8WA 1OZQA 4IWWA 5EMMA 4BZYA 4Q8TA 4RDWA 4JKMA 1G7VA 3L2MA 4YVXA 1OC7A 3NYDA 5GJPA 1NDZA 2ZOXA 3MW7A 4QQUA 3E49A 3ITXA 2VXNA 2WZHA 3UZYA 1FDJA 4AZIA 2PF8A 2F9RA 4TQTA 2ZCGA 4AEFA 2BOEX 4KH2A 3CQ0A 4W4QA 4KCTA 4KRTA 3G8RA 4GO9A 1XW8A 3THUA 1UOZA 3HQ1A 3RYSA 1EC8A 1VC4A 3HGJA 1X8CA 4IF2A 2QZRA 1BQGA 4CU7A 2HROA 2C1GA 1VFHA 1S2VA 5KETA 1SSGA 3OBKA 2OZ3A 4IP4A 3LCWA 2YYUA 4EPEC 1JNEA 3W01A 3IGXA 3TJ4A 4C6FA 4MB1A 3LCXA 3W24A 3C2VA 5G2HA 3CEPA 5LHFA 2WC3A 3R13A 3CK5A 3V0TA 5BROA 3HGRA 4ZQCA 3EA2A 3UPBA 1EPXA 2OPJA 3NO1A 3NDZA 1Z69A 2CESA 5AHMA 1AW1A 2DH2A 1KFJA 1XIFA 3SRDA 5DANA 4FNPA 1LL7A 3DCPA 3TONA 2I9UA 4O4VA 4D9PA 3BGGA 4DJDD 1UWRA 1TVNA 1GT8A 3FW6A 3VDBA 3J7HA 2GVYA 1SU5A 1SO5A 3TFCA 3Q2DA 2VRKA 2OYLA 1JQXA 2DZPA 3VOCA 2TSYA 1W2PA 1H51A 3WLSA 2AQVA 2VX7A 3BH4A 2DUZA 4PCNA 3TZFA 3BCDA 3FOKA 4D71A 3GXMA 2D2GA 1O12A 2WZMA 3SAZA 1I75A 4H8VA 4MY1A 1TE1A 3TNBA 2DGAA 2DZVA 2WQPA 2PC8A 3TQ0A 1FP8A 3B97A 4K7YA 4AAJA 3M07A 3UVIA 3P8IA 4J3VA 2YZ5A 1B54A 3CIWA 2EQDA 4IQDA 1DJYA 2CCRA 1OT1A 2WJEA 4ZVJA 3M46A 4UCGA 4DNMA 2KAUC 2ZX8A 1DWHM 1LROA 1ZP3A 5BRQA 1VFUA 3IUHA 5AOUA 4RDVA 3CLMA 4E2OA 5C8BB 4BK9A 3LPPA 1JUBA 4DJEC 3K8MA 1OYBA 4LY4A 1KV8A 1KA9F 1S2AA 1OINA 4J4KA 2G3NA 2Z1VA 1UR4A 3AIUA 3T0AA 1YPXA 1O5QA 4O4WA 1DTUA 3PS7A 1EGZA 4QDWA 2XVNA 1JF5A 3IVSA 3SADA 2C0AA 4HA1A 3MYOA 2VX4A 4R27A 1DKWA 3M5XA 5HWNA 3APTA 1TA3B 3GFZA 5EMUA 3WD0A 1TPWA 1MEWA 4Q22A 4JTGA 1Y65A 2J77A 3W1MA 3LZ3A 3QMRA 1Q2SA 3WBEA 3MUAA 3LGGA 1CB7B 3DDMA 1M7JA 4N4QA 4PC8A 1A80A 1WYIA 4JFVA 2BXVA 3WD3A 3URAA 1M6JA 4JHOA 5DT5A 4O14A 4V1XA 5D9OA 1KBLA 3ABSA 3BC9A 1UD6A 5ABGA 5DEZA 1MMFA 3NXLA 1S2CA 2BGNE 4B16A 1S2TA 3T09A 4BQ2A 3NJ3A 4AIBA 2FDMA 5LZLA 3OIHA 1L6WA 3PFMA 3LHWA 3SRFA 3KCLA 2WJDA 3WJSA 5H8UA 1NQKA 1T5AA 4P7OA 2O7QA 4QX4A 4HA0A 2FYMA 3LCFA 2WVVA 3V0UA 3GWQA 1CGTA 5C9RA 1IEVA 1DIEA 3V75A 2RDXA 4L4OA 4RXFA 2J8GA 2ICSA 1VFFA 1VQTA 3UCQA 1VCVA 4D6GA 3A47A 2X0YA 1BEUA 5LYRA 3IAPA 1BGGA 4YU1A 3WY1A 3PZGA 3H23A 4E8GA 1RZMA 3ONBA 1IT8A 3WF1A 1N8WA 2VCCA 4MFEA 3ZLHA 3G3DA 2QW5A 2XUCA 5REQB 2CZ5A 1JD7A 3CHVA 3MPGA 4F0LA 3MBDA 3HB9A 1K7EA 3PF3A 4B5SA 3WJZA 4L7ZA 3EX6A 3Q45A 2J7GA 1E0TA 2PEVA 1AL7A 1XIIA 4Q4PA 4ZSUA 5IXEA 3NFUA 4PCFA 3AHVA 1ZAIA 1PUDA 1FWCC 3ABXA 1Q7ZA 2EPLX 3WUGA 1T96A 4PMUA 2DU2A 4D72A 4GPNA 4JIHA 2A85A 3W53A 4YNGA 1LRNA 3WQEA 1U1HA 4PRRA 1FX6A 3VIHA 1B4KA 4HN8A 1LF1A 1JVNA 1HJXA 2J8FA 2QF8A 2O55A 3PAJA 3LV6A 2WHKA 2Z00A 5EMJA 5EKYA 1Q6QA 3ZLGA 4QJ4B 3FIGA 2C7FA 1US2A 1K3UA 2E67A 2P50A 4EKJA 1RH9A 1CWYA 3WK1A 4BWLA 1GOIA 2WSYA 3WMBA 4WHBA 3LHZA 4S1FA 3N14A 2Y63A 4AZ7A 1VR6A 5BMWA 3SCRA 1XC4A 1QOPA 1JFXA 2FJKA 2ACSA 4XZIA 4JAWA 3BCFA 2HPMA 3PZMA 3NGFA 3N18A 1RCXB 1ZFJA 2O92A 2YSWA 3R11A 5HA7A 3QJAA 1ONRA 2WC4A 1E6QM 2J27A 1G4EA 1XRSA 1E4MM 4C7DA 2CYGA 4HK7A 2FDSA 1Z8AA 1XIHA 1XM3A 3R6IA 4XV0A 4B15A 1ZJHA 2OCZA 2DSWA 3UWUA 1XC6A 1VFMA 1UWQA 1JCXA 1J93A 2C6QA 3JW7A 2QUVA 1D9EA 3BQ6A 2B7PA 1QK2A 5G2WA 3H26A 2W9MA 5HWJA 2D22A 2WVSA 3GY1A 2OO0A 3TTOA 3GZ3A 4GIEA 4FLOA 4CNPA 1R85A 3I4KA 1X7FA 3GC5A 1GTHA 4US5A 1I2PA 4JTAA 3W07A 1BVWA 1WDQA 1FFRA 3O05A 2XGZA 4GIAA 2F2HA 5C55A 2GVEA 1V3JA 2AAAA 2OWWA 1RQHA 1OEPA 1QU4A 1OVDA 2F84A 2EPNA 3WBWA 5I77A 4CU8A 4NSBA 4AZHA 3QR3A 3NTYA 3GHRA 2P3ZA 4QDPA 7REQA 3PN8A 1NJJA 5CPOA 3VZXA 4LAUA 4KCUA 1RJQA 2WZEA 3CYJA 3LBMA 3KP1A 3KAOA 4Q33A 5H91A 3FHQA 2XDFA 4LYPA 1NARA 3G1VA 3FGCB 4A3HA 2XFWA 2EPKX 1PO9A 5CPTA 3AHXA 3P5ZA 2G96A 3TSDA 2PWUA 1AJZA 4QITA 3ABZA 1TPDA 3U3HA 4XZ9A 3WNNA 2REQA 2AMGA 1QOQA 4PTVA 3DECA 4XKMA 4ML4A 4QM1A 2AL2A 1TRIA 3TV8A 3EWZA 2J7DA 3LTSA 2QCLA 3FXGA 2GQ3A 2WCSA 4GINA 4AY1A 3EKZA 4AXKA 1JIBA 3AICA 1E51A 4WDTA 2YDRA 5FJTA 1FWJC 4CGTA 1TSIA 3WNOA 4D6EA 2HBVA 3N29A 1UWUA 1MFUA 1O60A 3OVGA 1MQQA 2WM1A 5A6AA 3N6JA 1W9PA 2CKRA 2JF6A 2UV8G 1ICPA 4MDPA 4HYWA 2Z27A 9XIMA 2BFGA 3VYLA 4LGXA 2IPWA 2BGQA 2FZNA 1GQLA 3MKVA 3TJXA 1A4LA 1H5VA 1FY6A 3ID7A 4HHPA 3OLIA 5LXEA 3E5PA 2D0GA 3E1F1 1D7FA 4PUDA 3GW0A 2VM8A 4DWSC 4MUZA 1WNOA 4ZQMA 3WF0A 5BXSA 2WKJA 4FR6A 3TFXA 2W66A 4ERIA 1PE1A 2FHCA 2WW5A 5F4WA 3GNXA 3OVQA 1K9DA 3PVFA 1FHLA 3C61A 2FZ9A 4XD6A 5IHRA 4C6CA 1ZL1A 3H2MA 3U5YA 3B05A 1W9DM 1W9VA 1W37A 1G67A 3PNZA 4B3LA 4GJIA 4KIRA 5BNKA 4EXAA 4IT1A 4ZEPA 3AHYA 3MV01 2E0PA 3VD4A 4CKQA 3TROA 3WK3A 1YYAA 3QKEA 2X40A 5C2CA 1E40A 3WDRA 1W5OA 3MP4A 3TW7A 1UMYA 3WQVA 4JDYA 4U31A 3MBFA 4D6DA 4S2CA 5I3DA 5BWAA 1GORA 1OIMA 3TSMA 2J4GA