3TZNA

Crystal structure of the yersinia pestis dihydropteroate synthase.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
243
Chain Sequence
SHMHLTARGLTLDLSRPQVMGILNNLDQALQHAQRMLSAGATLIDIGGELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transferase
molecule keywords 7,8-dihydropteroate synthase
total genus 85
structure length 243
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tznA00
4MWAD 3TYCA 4S3FA 4S3EA 4G9PA 4CCZA 1Q7ZA 4MWAE 4DAIA 1EYEA 1F6YA 3K13A 1TWSA 4PZVA 2YCKX 2Y0FA 4S23A 4DB7A 3H2EA 3H23A 2VEGA 4S39A 2VP8A 4DJEC 1TWZA 3BOLA 4DJEA 2Y5JA 4D8ZA 2E7FA 3TYEA 4HB7A 4NIRA 3NOYA 4DAFA 2YCJA 2OGYA 4MWAC 3MCNA 4DJDC 4DJFC 3TYDA 4DJFA 4MWAB 1AJ0A 4MWAA 3TZFA 1AJZA 3MCOA 3TYAA 4O0QA 2Y5SA 3V5OA 3H21A 4S3AA 3H2AA 1Q8JA 1TX2A 2BMBA 4S38A 4C1NA 3BOFA 1Q8AA 1TWWA 2YCIX 1AD4A 4DJED 4DJFD 1TX0A 1AJ2A 3H26A 1AD1A 3TZNA 2YCLA 2H9AB 2VEFA 1Q85A 4D9PA 3H2MA 2H9AA 2DZBA 2DZAA 4NHVA 4O1EA 4S3BA 3TYUA 4O1FA 1Q7MA 3H2NA 4NL1A 3H2FA 2YCLB 4S3CA 3TYZA 4S3DA 1Q7QA 3H2OA 3TR9A 3TYBA 3H22A 2DQWA 3MCMA 4D8AA 4NILA 4DJDA 4DJDD 5JQ9A 3H24A 4C1NB 3H2CA
chains in the Genus database with same CATH superfamily
2ZE0A 4S3EA 2NQLA 1Q4NX 3DKLA 1AVAA 2RH9A 4IIFA 4B5UA 3RCMA 3OZOA 1R38A 3HPXA 3VDAA 5PTDA 2VEGA 2Q3OA 1US2A 2X1IA 1RLDA 4MKSA 4O28A 2OLSA 5FJRA 3W3OA 3NO5A 1MDRA 2WLZA 1Q65A 3ICJA 3KS5A 4L6DA 3LZ3A 3M7SA 2OQLA 2A7NA 3DAQA 5SWUA 2X16A 3KWSA 3N6JA 5CZSA 3G1XA 3OYZA 3APGA 4REQB 3AHVA 1XYBA 4AFYA 3NM3A 4DWSB 2AGTA 4GCXA 1JDEA 2KZHA 2NSXA 3W6LA 5A6KA 4I8YA 3MCOA 3TC7A 4HMCA 3H21A 3VGEA 4EXBA 1WAUA 4M5PA 2XVKA 4F48A 3OLIA 2X1SA 1WKDA 3M9YA 2HNHA 1LBMA 3SRKA 4LUIA 2J79A 2B0MA 1JPMA 4KCUA 1C90A 4S3JA 1V51A 2UWFA 1H7RA 1GZJA 2PDUA 3RM8A 4JTQA 1XM3A 3NO3A 3N04A 4GQBA 3RLVA 5ENLA 4ZQPA 4LQ1A 4Z42C 5D9NA 1GOOA 3EWBX 1K6WA 5AC8A 4HKPA 3WDRA 4H01A 2RAGA 4UTWA 3S2NA 4L1WA 2FTPA 6TAAA 4J1OA 3HFYA 5M03A 2QCHA 2Z29A 3B9EA 4NJHA 1L6YA 3PPFA 1ZJAA 3P5YA 5I7GA 1H1YA 3AJ7A 3L0KA 3T0BA 3M5ZA 2PE4A 4NKCA 3NSMA 4DYKA 5FL0A 4S2BA 4IJBA 2X05A 3ARRA 1DE6A 2XFFA 1W9UA 2C1HA 4V33A 4M6QA 1UC5A 4QXIA 3TSDA 3NPVA 4TVDA 2YB1A 2W6RA 1GOMA 1WDRA 2OELA 1WKFA 3LGGA 3JR2A 4H3DA 4C65A 2XDFA 3VNKA 1RQBA 1CEOA 1ISXA 1BYCA 3QY6A 3BSGA 1R8LA 3DYPA 5IDZA 3W2NA 1EXBA 4PUMA 2C91A 3CAVA 3UCCA 5FESA 2Z1KA 1PHQA 2VC5A 3WBAA 1QOXA 4ES4A 3GXFA 1FH9A 5GVJA 5HQMA 3ITTA 2Q09A 1PTAA 1QNQA 3NOEA 5B7YA 4A3YA 1W1IE 4MZ8A 1VFMA 4PTNA 1YE4A 1DORA 3PAJA 1S2WA 2DSVA 1B9BA 5I6SA 4B15A 3FAWA 2NUWA 4O1CA 2ZOXA 1UR2A 1XFBA 3P82A 1UZ1A 1VPYA 4XKYA 3UY7A 2EPHA 2YZ5A 3CWNA 1ISWA 3W6MA 5JH2A 2CWNA 1QOQA 3GQYA 4O57A 3W0KA 4UMAA 3AZSA 1IQ8A 1JGIA 5FIPA 2EPMX 2YXGA 1IEWA 2I7GA 3FK4A 4POCA 3M0IA 2VHLA 1A0EA 4GUFA 3STFA 3G1DA 1XIJA 3CIXA 3LHWA 2VDHA 3GR7A 2JGQA 2ZRVA 2CLEA 1EF2A 3P67A 1K77A 4GABA 2WB5A 4DWDA 3QSRA 4LF2A 2WMJA 3S5ZA 1XPYA 5REQB 2Y5SA 4PYSA 4CN6A 3G0SA 3RRAA 4YHEA 1WZAA 3PM6A 3WJZA 3UCDA 5C9UA 3PTDA 4QJ3B 5A6BA 4YS1A 5D4YA 1FX6A 4CCDA 3VCCA 1M7JA 8RUCA 3IVSA 4Q7BA 1ONRA 2BWGA 3HPZA 2PC4A 4PTMA 3WJXA 1VCGA 1H49A 1DOSA 1H5YA 1WZKA 2VZSA 3LCLA 4YHGA 5K4XA 3G0XA 2NX3A 4W5UA 4PCNA 1KO0A 4ZB0A 4ZXLA 1GEQA 4OOZA 1PDYA 1UP0A 1HVXA 1XLEA 1OD8A 1FXPA 5EMLA 2CLPA 1BD0A 1YBQA 5HR6A 3QHNA 2OSXA 4ATDA 4OZOA 1O94A 4GYKA 2JKAA 3BLEA 4MVAA 4N4QA 3BW3A 2BASA 1UWRA 4PFMA 3BW2A 1W17A 4UFLA 1FOBA 3SGGA 2E09A 5GNZA 4Z2JA 1NWRA 4JTEA 3UGRA 2PB1A 3T4CA 3TYDA 4GBUA 1NDWA 2ZVRA 2ZYFA 4FI4A 1ZALA 1X7FA 4LF1A 1VHNA 3QV7A 3IIXA 3YPIA 1AFSA 3BOFA 1MW1A 3LA4A 1D2KA 4ZE5A 4AIEA 1P48A 3HURA 3IVTA 2ZUVA 1DJYA 3KRUA 4A3HA 1AMYA 1U1UA 4Y6GA 3MUY1 1QPQA 1EOMA 4Z1BA 1A80A 1SR0A 4S3BA 4XZ9A 1AQFA 3AIWA 1H61A 4JFSA 1JI1A 3GW3A 3W7PA 3W83A 4QJ4B 4E2DA 3FVDA 1VYPX 1BVZA 3RAOA 1KLZA 2ZKMX 3GDTA 6TIMA 1IIHA 4D71A 3A47A 5FOOA 4AU0A 4HCLA 2P3EA 1VKFA 4RDYA 4BWLA 1AW2A 4PSRA 2ADAA 4B91A 1TWDA 3OHIA 1GJWA 4GX8A 1OQFA 4NAFA 4S3KA 4HYRA 3V16A 5XIAA 1GOIA 1SW7A 2FVMA 4C1LA 3FV9A 1KM4A 3HN3A 3R10A 2X41A 4JQ4A 1PWLA 3RFAA 3EPMA 3SN1A 2BGSA 1ITUA 3P81A 5E6ZA 1M04A 3FDKA 2F84A 5DMYA 5CBJA 3M0KA 5D04C 2XVPA 3EDDA 4D1IA 3I7QA 2EJ1A 4K2SA 2BVWA 4L61A 4MB3A 2HTMA 2V81A 3DYOA 5EFDA 2B7NA 4BKNA 3SCOA 4Z2HA 1KWGA 4RUBA 4MYXA 1Q66A 1UB3A 4O14A 3N4EA 2PP3A 1PYMA 5E1QA 1PCWA 2GSHA 4WEVX 1MEIA 3MYOA 3TYUA 1D7KA 4AX6A 5C5YA 1WCGA 3EB2A 3QR3A 2JGYA 4J3XA 2CKSA 4HNNA 4RNHA 2BZNA 4ZGYA 2E40A 4B9YA 1HGWA 2ZX8A 3MCMA 5AYXA 3I10A 4KWOA 2GGGA 2EHHA 2YYTA 3T81A 4LS2A 4Z2LA 1GHSA 2YL5A 5F1VA 5HJLA 3T40A 1UZHA 4GACA 4O8AA 1JZ8A 1OF8A 2HBVA 3ITVA 1S5NA 5FF2A 3CC1A 4Y9NA 1R3RA 4NP7A 1VJIA 3NQDA 1W3LA 3MJYA 2BXZA 5TF0A 2DZPA 1QNPA 1T96A 4Q7NA 3WFAA 3B8VA 4QAWA 1XLFA 3WJWA 1P0EA 2WO5A 5REQA 3QOKA 3MSDA 3GFYA 3SQMA 3P60A 1H4PA 3P84A 1DHKA 1HJQA 3S5NA 4LCQA 5GQBA 2POTA 2DT1A 2FGZA 3LM3A 2HPIA 1JQXA 1V3KA 4XO7A 4W84A 1Q6GA 4W87A 5DO8A 4H7ZA 1N55A 2WPGA 1F8MA 3QQWA 4L1XA 4IPNB 3WQPA 4Z1AA 4B4FA 1H0GA 1B9ZA 3UD6A 5DN1A 5CG0A 4CD8A 3KVMA 4QDMA 1PV8A 4RNIA 2H90A 4C6QA 1O5RA 3MHUA 3INPA 4EAYA 5AHLA 2O0TA 3IV8A 1TJ2A 4PTXA 5IFTA 4FOKA 2FZMA 3OG2A 3W7GA 2VOMA 2DFAA 4PMZA 3SCRA 4JIEA 2G3JA 3CNYA 1B90A 3CV1A 3EWXA 1RALA 1G7VA 2NXGA 1J93A 4DNMA 1BEUA 1RA5A 4N9BA 1PX4A 2IKJA 3G1SA 4KWSA 4FOUA 4E4UA 2E6FA 3KTXA 1Q5MA 3RN6A 5FEZA 1W3HA 9RUBA 4QDWA 4PTWA 4QSHA 4Q4RA 3UJ2A 2A3BA 1JZ2A 1H3GA 3M64A 3MVIA 5FD0A 3C0JA 5BOFA 3MS8A 2X1RA 3M07A 3C0QA 1HQTA 2J27A 4WSJA 4TQTA 4D6FA 3UWVA 3QN3A 3FAXA 5AHFA 3R6IA 4B5VA 3M5YA 2XH2A 3MA8A 1XH0A 4HHPA 4A21A 5G1TA 1ZZMA 2ZZ5A 2AOSA 1MEHA 4RDWA 2EGZA 4PCSA 2RKXA 2G37A 1VR6A 3AHTA 3UJEA 1FDJA 2MNRA 1EJXC 3R0UA 2Z1BA 1VIWA 5T91A 1CB2A 1AA1B 4ZCWA 1JGMA 1VRDA 3DG6A 1GGOA 3S4TA 4DO6A 2I57A 3VTRA 1KQYA 3LGEA 1Z89A 3QEZA 2NW0A 4TTUA 5AVHA 1F3TA 1RCXB 3AYRA 1O95A 4JFWA 4HMEA 5BOOA 1UR9A 2Y89A 1IZJA 2QVHA 3A6OA 5AZ1A 4BCEA 5LNRA 1VFUA 2EG8A 5F4WA 4B5SA 3V4BA 3G0UA 5AHNA 3TTOA 4JQ1A 4GYPA 3ITLA 1W91A 3WUFA 4AVNA 5HMFA 4IGSA 1IGWA 4AMAA 3IANA 2PPGA 4A6GA 4Z2KA 3GH4A 2YLAA 4UWMA 4AEFA 1MUCA 3IAQA 3GHRA 4XG1A 1JPIA 1ZAJA 8XIAA 1E6NA 4AC7C 3V5FA 1S3TC 1WE5A 4K38A 3GG1A 4G1KA 3NQMA 3ZJ7A 5LGXA 3RU6A 1Z44A 2VO5A 1X7IA 3CIWA 1I1XA 3OLGA 3CWHA 1JQVA 1T5AA 1U5HA 3UWEA 1MNZA 1OFAA 3CQ0A 1Q6RA 2V9DA 2GJNA 3DEQA 4Q33A 2SFPA 5A69A 2Y4SA 4DI8A 4BI7A 1BLIA 2QJIA 4IF2A 4NXKA 3U2ZA 3AMGA 5FL1A 2TYSA 2O9OA 1AQ0A 1VCVA 5K2ZA 4JTRA 2YB4A 3MMTA 4HNTA 3HO8A 1E6RA 3MP4A 4NJKA 3N2TA 5C55A 5G4EA 5AC7A 3GS6A 4PA8A 1UBSA 1KC7A 2FMOA 4XISA 1UG6A 3C3NA 5C8BB 2ISSA 5A8GA 4IIHA 4H83A 3TYBA 2VUYA 5JIWA 5LA0A 1ADSA 4PRTA 4GLEA 2XH4A 4XTIA 4LAOA 1PIGA 3ZVHA 3AXMA 1CXEA 3VNDA 1B3ZA 1F6YA 4Y7EA 1PDZA 2PU1A 3E5BA 3GRIA 3BLIA 1G4TA 1FCQA 1KWKA 1OGSA 4DB7A 4FPSA 3O06A 2XJ7A 3UJSA 2B31A 3W7RA 1YKWA 3B03A 2I1OA 3V1HA 2D2OA 1SZEA 4LW7A 4JN7A 3VZZA 1FA2A 1UIOA 1R5YA 3KOWA 4RW5A 4HHLA 3SCWA 3KZSA 3FFSA 1TCMA 4S3AA 1VRXA 3KBVA 5A2CA 4A8RA 3OBEA 1KA9F 3W1NA 4NZ3A 2DZSA 1RVGA 3NWRA 3AMLA 5CPQA 2L5HA 4J9JA 3H4GA 1ZUAX 4UTMA 4DBDA 4B3LA 3GDRA 1JNDA 3E38A 1OK4A 3AI0A 2PCEA 1B3VA 4QTGA 5HWNA 4GIAA 3CHVA 4GC4A 4L9XA 1H60A 1QW7A 3RX4A 4MB5A 3EMZA 4C6KA 5C9WA 3VD3A 1FFRA 3TR9A 3VK5A 4AHPA 3NDZA 5EMMA 1FCVA 1E0UA 4ICMA 1NOFA 1TTQA 4U28A 4H7VA 2EG7A 2OQYA 5H8UA 3UVAA 3M0HA 3IVUA 1KXTA 3N2BA 4YTRA 1M01A 4XZBA 1SSDA 1XRTA 2VCBA 1UMYA 1F74A 3GLCA 3GUGA 3W27A 3APYA 3ZWSA 3KBMA 4I6VA 3FJLA 5KSWA 1KB3A 3QMSA 3VVGA 3PZUA 4HBKA 4Q4SA 4E3TA 3AYTA 3GNPA 4W86A 4GQRA 4DF0A 1RBAA 4UTWC 3SM0A 3MCNA 3I4EA 4JTFA 1J10A 4EX4A 2DQXA 4FLQA 4QEHA 3NG3A 2WHLA 1FWCC 4KETA 3BLFA 3OVQA 1NY1A 4AY8A 3V36A 5KZDA 3EMCA 3LPPA 4WGXA 3UNTA 1ZS2A 5E09A 4NAFB 3VGGA 4B16A 1BG9A 1XLIA 4C7FA 2PD5A 3JZUA 1QWKA 3GNRA 3C86A 3HPAA 4C6EA 3PC0A 4LXFA 1UQYA 1IZCA 5E9AA 3U6WA 1XINA 1CCWB 3WSUA 2R1NA 1WXJA 2E77A 3GY1A 5E70A 4CN4A 3NL3A 2VNCA 2FMNA 5FJJA 1TTPA 3L21A 4IOTA 4ZO8A 3K1DA 3W7KA 1HJSA 1KGXA 3AMDA 2BG5A 3M5VA 3M6YA 4GYFA 3W29A 4JNYA 2PDWA 4JTJA 3W38A 2BDQA 1XQLA 4UZUA 4CVUA 1W9VA 4HNUA 4JTCA 4FR6A 1Q2SA 1GKPA 2PDJA 3QY7A 4CUCA 4PUJA 1HTIA 2QUNA 3BXWA 2NQHA 4DUOA 3WH6A 4FNTA 3B4YA 1SO3A 4AH7A 1RH9A 1CGXA 3WDQA 4O13A 2VEMA 1TQJA 1T0OA 5CJ5A 4NJGA 1ME8A 4IISA 2E9LA 5I3KA 4LYQA 3UA3A 2DW6A 1XLDA 3G24A 2QKFA 4X3ZA 1RV8A 3W7NA 4J3SA 3QMRA 3AIEA 3TAOA 1ZY9A 2WHKA 1MW2A 4ROQA 4C1NA 3O07A 4ZO7A 3GB6A 4U31A 3APTA 3HA1A 1V3HA 1E0WA 2G0WA 4WDXA 4GGBA 2ZRZA 4CQBA 2WCAA 4UOJA 6XIMA 2HZGA 4LB3A 3O6CA 1TE1A 1GG0A 1UWSA 3PZTA 5G2HA 1NFBA 2QDHA 1EO7A 2TODA 1OIMA 1DKWA 4Q8TA 1RPXA 2NT1A 2WSQA 3AIRA 4LU0A 3C56A 4HNLA 3LNMA 2Z1XA 4UC5A 2WBGA 3UR7A 4LY8A 2EAWA 2HXUA 2VZTA 4AW7A 5I3GA 4G9PA 1FWJC 1W1B1 3W7DA 1GVOA 5JU6A 4G1NA 3EDJA 2X2GA 1H51A 5DBTA 4UIOA 3NZGA 3P0XA 1E6SM 3BDKA 4KCWA 4HYVA 4CNTA 3AXHA 2WJEA 2CW6A 4DO7A 3GZ3A 3SSJA 2ZTJA 4CNNA 1ZTVA 1IF2A 4GJ1A 4JHZA 1Y65A 1EJ7L 1W31A 4IUGA 1SM9A 1M65A 1B4EA 3R1ZA 2J62A 1UOKA 3QGVA 4O17A 5ABEA 2XFWA 2BTMA 2ZXDA 3HPFA 2AAAA 4HJFA 3CUFA 1Z7AA 3LSCA 4B3KA 3UXIA 5M2FX 1EA0A 3DXIA 4QNEA 1TPC1 1O5QA 5ECVA 4KF1A 3A4JA 2PMQA 1BXCA 4RJEA 1JPHA 2OR2A 3W9ZA 3NAVA 1I45A 4H2HA 3TWBA 3HQNA 4I7UA 4M6VA 4C6MA 3AS2A 5JIPA 4B5WA 2IS7A 1UD8A 4D6CA 1JYNA 1T99A 2PTDA 2WJDA 4HTBA 2QJHA 2WYSA 4I7WA 1P6BA 3OTRA 4GQ0A 3UZZA 5KZEA 4GJJA 4ADUA 2PODA 3S8HA 1ZFJA 4YL2A 4JQ2A 4HHMA 3O6AA 4ZENA 4F0KA 1TPDA 3TE9A 2KAUC 4MY9A 5DLCA 1IWPA 2ZRUA 4RLIA 1E3ZA 4KIRA 1XD1A 3P0WA 2VZVA 4N9EA 3DHUA 3BG9A 4ZOBA 5FJOA 4LVBA 1XLBA 3WD3A 3SIMA 3WLHA 4B5XA 4DZIA 4IFOA 4DJDC 2A7RA 1QAPA 1XXXA 1GW9A 4ZB2A 3W2KA 4H41A 3TYAA 4IPJA 5A94A 3BVJA 3TW9A 4HU0A 5I5RA 4GO8A 4LFYA 4ECLA 3VKBA 1QOPA 3TP4A 5CZJA 2NXHA 3A24A 4EPEC 4YTSA 3AMCA 4A4AA 2WPBA 3W24A 5E6YA 1A3HA 4G8TA 2W27A 3LRLA 3OVPA 2Q3RA 4UTLA 1JCNA 1N8IA 1NWUA 1KRBC 5BNKA 3BSMA 1TTIA 3NQ6A 2HJPA 7TAAA 1RP9A 4Q8OA 1DWAM 5A6BD 1TIMA 1FHLA 4BF5A 4XQ6A 4KGJA 1UW9A 2YKKA 4US6A 3WK1A 1OG0A 1JJKA 2PS2A 3NVDA 4O18A 1V93A 1JCLA 3G18A 2UY2A 2Z2AA 4RXFA 5FI8A 1FHUA 1AH0A 3S9IA 5I09A 3SFWA 3CBWA 4S39A 3UW6A 3EA2A 1GQJA 4GY7A 2WSRA 3TNBA 1P0KA 4G7EA 3UZWA 2R82A 4Y2WA 1CGVA 5DY2A 1EJTC 2XISA 4C6BA 3ZWTA 4YYFA 3OLEA 2CZVA 1PZ3A 1Q6QA 1DJXA 1CGWA 5A8NA 1DWJM 4US5D 4YCPA 1YPFA 4ILSA 1W32A 3R8RA 3VX1A 1W9DM 1GJUA 6PTDA 3VGBA 2OEKA 3L4ZA 2WXDM 4B90A 1WAWA 1R2TA 2PU0A 3ZVIA 1ZBCA 1XSJA 5LZLA 3P14A 5I3IA 1AD4A 4JKMA 3EDEA 1E5JA 2DUXA 2FH6A 3F4VA 3VD7A 3PUDA 1JXJA 4RZ4A 3S5OA 4GE8A 3ZJ8A 5HNTA 3GC2A 4WKAA 4PRRA 4S1FA 3DHDA 5ABFA 2QLYA 4NZJA 4R7OA 3N6QA 2QEZA 3WD1A 1VENA 4F0LA 5CC6A 3KUMA 2ONEA 1XRVA 5CXPA 4KT2A 4TMCA 1QNRA 3E0VA 5D2VA 1QI5A 5IHRA 3ENLA 3S47A 2BOGX 4ADSA 2BGQA 5EBAA 3KL0A 2XSXA 4R5EA 3RF9A 3P2VA 3S42A 4JCMA 1FKXA 1R46A 4H9VA 3KBWA 3THCA 4XZWA 3AWOA 7PTDA 2FVLA 1PKMA 3WDJA 3R7MA 4KRUA 1E43A 1TJPA 4HOXA 1T6MA 3NQFA 3TQVA 3AS3A 1ONEA 3ES7A 4JBRA 1XKJA 5M5DA 3WLTA 3LS9A 3U8GA 2ODOA 1BGAA 3PZIA 2YA0A 3CH0A 4PUEA 1HKKA 4BI6A 2IXUA 4V28A 2PWFA 3EKGA 3W1QA 4OGZA 1VAHA 4LUSA 3OZMA 2UY5A 1OB0A 2A3CA 4LY4A 2BMBA 3NL6A 4GIRA 5L9FA 2E1DA 4Z1DA 4XVDA 1ICPA 4BHYA 1DHPA 4YWIA 1OCBA 4LRSA 3CB8A 3C2YA 3ONCA 3B8WA 4I6KA 4JEJA 4DX3A 3PWAA 2PTZA 2Z6IA 2PDPA 2XN0A 4QE1A 4IIEA 5T9BG 5AHIA 1YMYA 2QZRA 4ROPA 2FGLA 1V8EA 1NEYA 2HXTA 2V0TA 2YYUA 4IT1A 3VUPA 5CAKA 1TA3A 1W9XA 1J5SA 2P76A 4DJFC 2EKCA 4LV9A 1FUYA 1XV8A 4DLMA 4LTSA 3CO4A 4CQ9A 2NV2A 3VDGA 4DZHA 2Y0FA 1HP5A 2J7HA 3BG5A 4D6DA 4GI8A 4P8WA 4FX6M 2YXOA 2QIIA 2O4QA 4L64A 1T41A 4RZ5A 4JTHA 4XUGA 4INFA 1JYWA 1XC6A 3B9NA 4RE2A 3U2CA 5LNUA 2O56A 1ITXA 1VZWA 3BSHA 3GNXA 4MAVA 3UU0A 4XSMA 4YCOA 1DQUA 3T08A 1Z41A 3SEPA 3A23A 4OFCA 2WZHA 4DXVA 1V02A 2CERA 4ERGA 1XLJA 2FTWA 2J9ZA 2XSBA 3M0MA 2O9TA 5FF3A 5HWJA 4GZJA 3IGXA 6REQB 3TJXA 4Q8WA 1S1RA 2GJLA 2OYMA 1G67A 3VFCA 4HOZA 5AY7A 5MKGA 1ML1A 1M68A 2Q01A 3SCQA 2YXXA 5HR7A 3B06A 1JCYA 4YXGA 3ARXA 4MKVA 1QPKA 4WKHA 1Y0EA 1C93A 4QIUA 3LXAA 3OZYA 5DXXA 4PEEA 3QLLA 1RHCA 2QV4A 1TJRA 3CL7A 2RDTA 5U4NA 4Q8QA 3TAKA 1TR1A 3KP0A 3ID7A 1BTMA 4PL2A 3MSGA 1AL7A 3LB0A 3GO2A 1UPMB 4WR3A 4A05A 1DJQA 1S38A 1UR4A 5DELA 3VCRA 3E2QA 1G6CA 4JPGA 4GISA 3KRBA 2QUUA 2YR1A 4ZQOA 4H8NA 1QATA 1A5UA 1QUMA 1OFEA 1UD5A 1I0DA 3LLDA 4W8AA 2Y5JA 2WMKA 3M0JA 5DF0A 1VF8A 1JYVA 5C71A 1LL4A 5EPDA 3XISA 2V5LA 3GVRA 3V0SA 4EPDC 2GDVA 4K3ZA 1LT8A 3XINA 3LRMA 1HJUA 3U57A 3MC5A 4R7JA 2CLKA 3GHTA 3H7RA 4JYEA 3ZVHB 1AJZA 1DWGM 2PFHA 4KFPA 1Q6FA 4IWWA 1MUMA 2CBIA 3FLUA 1MDLA 5C7VA 3GAKA 1E73M 4EXAA 3QZ6A 1XBVA 3TV8A 3GDBA 2XN2A 5CPTA 4ZEPA 4XIAA 3PJUA 3RNDA 3TNOA 3H53A 5EMJA 5D2XA 1UD6A 2YX0A 3F4NA 4PRWA 3ABRA 3KOFA 2WKLA 4TOQA 1EJRC 3L2IA 3AISA 2V5KA 5G4WA 2C79A 1H63A 3CZEA 1F9CA 3DH7A 2HPMA 4YLWA 1OC5A 4F2TA 4GIYA 2A6LA 1JI2A 2XIQA 2VENA 3RPDA 4C7GA 2O9RA 4H2CA 1OFDA 4CCZA 4EPKA 1TO3A 5TIMA 4I5XA 1I8JA 2R9RA 2ZZ7A 4UTTC 2DT2A 3GSMA 5FCZA 4H9MA 1PZ2A 2CFFA 1TPUA 4KMQA 4FK9A 1TWZA 4O53A 4LS0A 4I9AA 3ABQA 2VFEA 3WIJA 3C2RA 1R86A 4WLCA 5F2GA 2RJHA 4H7CA 1PJ9A 2PGFA 7CGTA 4PMNA 1WDDA 3E0FA 3N12A 4NNBA 4IFKA 1M41A 4AZCA 4AHOA 2E3ZA 1W56A 2WV8A 1SMDA 4FF7A 1AZ1A 2QJJA 3ZOAA 5H8MA 1XHGA 3KBJA 2PP1A 2W66A 1GPWA 2XIJA 2VEFA 3L5AA 3O3RA 1OC6A 3KP1A 3PB2A 1EP2A 2WBKA 4B2DA 2J75A 1PKLA 1V6YA 4DM1A 3W25A 1IEIA 1WUEA 2IPGA 4HPNA 1LZOA 1OYBA 1PHWA 3ECQA 4FOJA 1IEVA 4F2BA 4DJDD 2DSZA 3TA6A 3GC4A 1JNEA 3GH5A 2DZUA 2J4GA 1MQRA 3TJ4A 2GVYA 5HDRA 3WK3A 3MANA 4G7FA 4DWSA 4PMDA 3CUXA 4REQA 3AALA 4B92A 1L2UA 1S1PA 3QJAA 3C5QA 2GWNA 1KBJA 5DRCA 5DT7A 3EXSA 4WD0A 3THUA 4O50A 2D24A 1K6AA 3KDOA 3BAKA 5AYZA 3CQHA 5FF4A 1UWUA 2BNJA 1JF6A 4ZQCA 1Y7VA 1E3XA 2VWTA 3VIOA 5H6HA 3WK2A 1MZHA 1WDSA 3AU2A 1ADOA 2GL5A 2BHYA 3B4UA 3L65A 1P7TA 3IUIA 1JULA 5IM51 4UTJA 3POHA 5HJYA 2DZXA 4YNGA 3T8LA 3WEOA 2Q6ZA 4UTIA 1R30A 2A21A 3ATZA 2OSYA 4NZCA 1LRQA 5M1TA 1P43A 2A3EA 4LEQA 2BBFA 4O16A 1QNSA 1PTDA 4U4MA 3GWQA 1Z42A 5DBUA 3WQOA 2P3ZA 4KIEA 5DMLA 3VABA 4Q4QA 4DWSC 4N7QA 2W62A 2Y8VA 1ME9A 3H2FA 1LWHA 3CTTA 3OGVA 2QCCA 3CMGA 3HJEA 2ZUSA 4CKQA 1P6WA 2PDBA 4Q32A 5DCDA 3U48A 2OEJA 3UPBA 2IUZA 1ISYA 3PBYA 3ANVA 1RXOB 4L80A 4TXEA 4W7UA 1GUVA 3EA1A 1NIUA 1QK2A 3VIMA 3AYVA 1DXFA 3URQA 4GXWA 3IIVA 1K70A 4O4WA 2JFEX 1YQ2A 4MFDA 2I14A 4MAZA 2VVNA 3UVIA 4F9DA 1IWAA 4G56A 4K1GA 4G5DA 3CUHA 2QXWA 1J4EA 1UUMA 3EPOA 3ARWA 3FNDA 3NQEA 2WKGA 2ZTKA 4M80A 3QHMA 3MHGA 3ZO9A 1ICQA 4IX2A 3UP8A 2JALA 3DZ1A 5HJXA 1GVYA 2ZXBA 3WO8A 4AZHA 2QDGA 1LL6A 3TONA 3TW7A 3H2AA 1PE1A 3SZ8A 4QQ3A 1EP3A 3F03K 1SW0A 4PBFA 3IJ8A 3LNPA 2D3NA 4CNUA 3WBEA 3TX9A 3SRDA 3ITCA 3GYEA 1DIOA 1ZENA 3W01A 3O1NA 3TN3A 3FDGA 3P8IA 1E5NA 1SUXA 3IGHX 4LVDA 3U0HA 1HNYA 1JEZA 2WVTA 3H55A 3RILA 2O7QA 2PDIA 4ENLA 1RAKA 3H6OA 3PZNA 2XIMA 5I3FA 2DQWA 3BGAA 4WZHA 4F0SA 3W7IA 1SYTA 4NASA 1C9WA 2JF6A 1DWFM 2TPSA 4OBSA 4OWGA 1EYEA 1W3IA 1OGGA 2PTXA 1BHGA 4UFMA 3W74A 1XP3A 1R87A 1N82A 2REQB 4ZVJA 1OEPA 1VFSA 5LSMA 2EJAA 4GX9A 3W7OA 2OLHA 3VZXA 3M6DA 3B9AA 1O5XA 4Q8PA 4L9YA 3QW3A 1J8VA 4P7QA 4OQVA 4ZR8A 1S2TA 2ZIDA 3GIPA 3NQ7A 2ZZ2A 5I0DA 4XTDA 1FVPA 2QCFA 3PZOA 2FZ9A 4LVAA 4ZE4A 4PTVA 3RR1A 4M24A 3NXFA 4NL1A 2ACRA 1S5VA 4PN2A 4OV9A 1ITCA 2OG9A 1XC4A 1SMAA 3N3TA 3A13A 1A5CA 3N18A 4QJ1A 5AECA 2OOFA 3TMQA 3CXOA 4LYRA 3VNMA 1KW1A 3WY1A 2BB0A 2YL8A 4C6FA 2ANUA 3SN0A 1YDOA 2OODA 2E28A 1R6WA 3UR5A 1OABA 4AF0A 3H23A 4BS0A 3DENA 1XUZA 4GFIA 1E72M 1TV7A 3L12A 3ZZ1A 3W1LA 3N9SA 3IK4A 4E2BA 2G41A 2AGKA 4M0XA 4QCFA 1DE5A 3HU7A 5BXRA 2G4JA 1A5BA 6XIAA 3FGCB 3PZMA 2WCSA 2X40A 3BQ5A 3UG3A 2EPLX 1G94A 1WKEA 2D2JA 1G4SA 5EA9A 2R1KA 1J2BA 2GLKA 3SUSA 1DJIA 1FWSA 2AQWA 3PN8A 3I6EA 3SN4A 4HPHA 1DJZA 1P5BA 4UMCA 2DIEA 2ZA2A 2V38A 4AIBA 3LMZA 4YTUA 2QUMA 2Q8ZA 5F2LA 2J74A 2R1PA 1RJQA 3TZNA 1OZMA 1VP5A 2OX4A 2PDFA 4L9ZA 3NQCA 3AC0A 1X1OA 1JRCA 2DZAA 4PCPA 4F79A 4O1FA 4Q6JA 1NF7A 4LB4A 2Y1HA 4UQBA 1BTCA 1PL9A 4E2OA 1BYDA 2W4XA 1CLKA 5G1MA 1WNOA 1F61A 2WQPA 5T8GA 3NURA 1Z69A 1TSIA 1R9ZA 3MDWA 1X98A 5A2AA 2O92A 1AW5A 1B3YA 2ZVIA 5B80A 4AZCB 2C0HA 4MADA 3VILA 2QF7A 3LM7A 3QPYA 4DZAA 4MLRA 1T7LA 1A5AA 2PDYA 3N4FA 1TPB1 3USBA 1XYMA 2CBVA 2XN1A 4H9UA 4XD4A 1V0KA 1JL8A 2ZA1A 4UR9A 2QCDA 3ISIX 4KH2A 4AZ6A 3HGJA 2NQJA 4MWAC 1R3QA 4AB4A 3LG3A 1SFSA 2WZIA 1O7AA 3WMCA 1HKIA 1NOUA 3AIBA 3UWZA 3FXYA 1EKOA 2YJQA 1ZQ5A 4LAKA 4MDPA 1S2VA 1BWLA 1PO9A 3S1UA 3UZ5A 3GC5A 3T1GA 3O0FA 3DI0A 3M1ZA 1XYAA 1K9DA 4BZYA 1HVQA 1W6TA 1GJPA 1J2WA 3W1MA 2Y85A 3RITA 4JFVA 2Y2WA 5EMYA 3CAWA 2HVNA 3I7RA 5C0QA 2H9AB 3IJDA 4A8NA 1A5NC 1G0CA 1HJXA 3HZ3A 1E40A 4MJ4A 4O1EA 3BZGA 5LXXA 2E8YA 4N0RA 1TE6A 3FA4A 3NTYA 1BF2A 1S5WA 4JY9A 2WZEA 1GVEA 3L4YA 3T2OA 4RNFA 2VGIA 2FZBA 5C54A 3DUGA 1W1TA 2FYMA 2Z26A 4C1NB 1KGWA 3FHAA 1H0IA 3CK5A 5HUPA 3PSVA 1LRNA 1LCOA 3M47A 2VKZG 2UV8G 1EBGA 1OC7A 2PDKA 3RO6A 1PIFA 3BCFA 1UHVA 3IS4A 3CEPA 4LC8A 4BFAA 2DW7A 1VB9A 3MUZ1 2GZXA 3UR2A 2QCDB 2VGFA 2YSWA 1HFBA 3FA3A 3IIPA 4M7SA 2ATMA 2ZRXA 1CT5A 1ECEA 3AJXA 4O15A 4MM1A 1OX4B 2VD9A 1XJBA 3P93A 1OY0A 3PZ9A 4F66A 3W2LA 3FS2A 2DH3A 3JUGA 2A2IA 3T07A 3MI2A 1KM3A 2FHBA 5LHEA 2CZFA 3IJIA 3JZEA 3V5OA 2DT0A 1QPOA 4EANA 1NELA 4R85A 5BMWA 1C8XA 3LCWA 4KCVA 2OJPA 1ZRQA 1KBLA 3N9KA 4Y9PA 1PEZA 1SSGA 5D9PA 3KLLA 3UJFA 1WOBA 2VQUA 3TCEA 1ODUA 5C70A 2Z4GA 3RMEA 1EDTA 2I16A 2INFA 1GZGA 4E2VA 3W02A 2DSUA 5D32A 1V3LA 1A50A 5CZKA 3NQAA 1M7XA 1CIUA 4ERIA 4HU4A 1KCZA 1ZBWA 5M17A 3L68A 3EWUA 3LPOA 1SPQA 3VD5A 2P0OA 1UZ4A 3AU6A 4QEEA 4JTKA 3ALFA 4JTTA 1TRDA 3KS6A 3ZR4A 1ISVA 1DP0A 5C7HA 4V1YA 3TJLA 3L66A 4LUTB 4OTKA 1LOSA 2PF0A 1M03A 1FTXA 2G4FA 4CEXC 1CGTA 3KHDA 3T7VA 1XYZA 4M19A 1LQ0A 3VC5A 3UPWA 3GVGA 4ZQNA 1KFWA 1QVBA 4I3GA 3VFLA 3EDFA 3H12A 5CJMA 4KBXA 4I7VA 2A4AA 2DORA 4RZ6A 4MWAA 4W7VA 4AZIA 1JF5A 3XIMA 3WL1A 4UQCA 1B3XA 4JS3A 4LANA 1E6PA 3LENA 1P1MA 3C0LA 3BWWA 4DN1A 3RCNA 2OQHA 4QE4A 4W8LA 1MZRA 4AZ5A 1H41A 3CMFA 3VMNA 2ZXAA 1CB7B 3FN9A 1QNOA 3VDBA 3ES8A 2C19A 3TK7A 3WN6A 1S39A 1F3EA 2YCLA 4XSLA 4GXPA 2VDGA 4IL2A 4ZA0A 4Q7IA 1O1ZA 1SJAA 1E1FA 1KTBA 3RCYA 3W2UA 1LQ2A 1B3WA 4OBRA 1K8CA 2NUYA 5E5CA 3PTKA 1EDGA 3UT0A 4S3DA 2QULA 4RZBA 3G1AA 1LF1A 1K7FA 2BP1A 1ZCCA 3HJZA 3VIFA 1U1HA 2OLAA 3SB0A 4D72A 3TOPA 1X6LA 3KCJA 2ZX6A 3U7BA 1JCXA 4X63A 4PODA 3CASA 4DAIA 1EH9A 1EGZA 3H8AA 1V0MA 1HF6A 1EA9C 5C6MA 1OG6A 2ALDA 2QAPA 4UQEA 3SQLA 3OGRA 2DT3A 3V1PA 4A2RA 5A6SA 1IIGA 3E1F1 3WNLA 1KNWA 3HTWA 1XDLA 3L4XA 3L4WA 1IR1A 2VC9A 2HK0A 4Z0JA 4HJWA 4AD3A 1LLWA 2OT1A 2HS8A 3NPUA 1AUSL 2D22A 3OHMB 3O8AA 3SI9A 4H8UA 3WF1A 1E70M 5CBBA 1GG1A 4E38A 4O1DA 2FPTA 4XBKA 3EA3A 1QNVA 3UG4A 3BANA 2VURA 3LU2A 3FGCA 4ZQRA 4FLOA 1A47A 1Q6OA 2QGHA 1Q8AA 4NU7A 3E74A 1XL9A 3DGBA 4DO5A 2RHGA 4QLJA 3ZS4A 1I75A 3N25A 3DG7A 4LAUA 2E8ZA 4FLRA 2D2HA 4XD5A 4Y9OA 2UZ9A 2XH7A 3ANYA 3PR2A 4EOUA 1AH3A 1YBQB 3VAVA 1H62A 2Z2BA 1Y5VA 1D3HA 2YPIA 2E25A 3QW4B 1VFLA 2GGEA 3WQCA 4NZFA 5FSDC 3FVMA 4LCSA 3CGTA 5HMEA 1CW2A 4UQ9A 3ORWA 2ZX9A 3TN5A 4L4LA 2DPEA 1E0VA 2C3ZA 2P1FA 3K4WA 1RK6A 4P5UA 5FJUA 3WLJA 1UKOA 3TC3A 5BRPA 1UKPA 1A53A 5AFDA 1KTNA 2YW4A 3FCPA 2JQXA 3FX4A 1YTEA 2P50A 3ABOA 4GKLA 5HA7A 5MF5A 4UBPC 3T78A 5AHEA 3GTFA 5CGMA 3ZSSA 2X7VA 1XLHA 3EX2A 4XWUA 4BQ5A 3RRXA 4NUWA 1DXEA 2R8WA 1SZFA 2BODX 1Q6DA 3VGFA 4UQAA 5KTLA 4PMUA 4DBUA 4DZ5A 2X30A 2DZVA 2WC3A 1I2PA 3C4UA 1VLWA 3WELA 4ORIA 2QS8A 3MVTA 2QYGA 4GA8A 1IWBA 4O0QA 4Y90A 3CB3A 2WVUA 3EOUA 4IFRA 2FKPA 1TX2A 5FAGA 2RGLA 2FZ8A 2QNEA 3C8NA 3SRHA 3C2VA 2PEVA 3HM7A 3SADA 4HA3A 5FEXA 2WSKA 4A22A 3IJ6A 5IDIA 2PUZA 2WC4A 1L6SA 2GJPA 1OX5A 4O8RA 3EAUA 2ZA3A 4WXYA 5JBFA 4IQJA 1BSLA 2QDDA 1BKSA 3MKKA 3M41A 2OU4A 3P61A 2YCLB 4QBXA 4FIQA 5L6UA 4L4PA 5JBDA 3KVKA 2O55A 1XWYA 1IEXA 2WZTA 3TC6A 3ARZA 1K4GA 3PFMA 4B5TA 3A3WA 3P8JA 1KD0A 1V79A 4N4PA 3BCDA 4PZVA 1VPXA 1VYRA 1XPGA 1H2JA 1UH4A 5CGTA 4GUGA 4I5RA 4P7LA 3UXDA 3POCA 3GXIA 2VFHA 2Y62A 1YPIA 2CLMA 4PULA 2ALRA 2OZTA 2E7FA 3WBXA 4X2PA 4AD0A 5J04A 3GDKA 2ICSA 2PDGA 2VEPA 4DF1A 4JNMA 4U2ZA 2HE5A 2ZFAA 2NVAA 3ZJ6A 2DV0A 3AIUA 1BPLB 1LROA 5EYWA 1V08A 1I60A 3UZXA 5A8MA 4U3AA 2ZUMA 4GUJA 1R7OA 3UXAA 3B9OA 1UPPA 5LHFA 2X09A 2QJNA 1UD2A 1SFLA 1NF0A 4KEVA 3PZVA 2GVGA 4F8XA 1F6KA 5D09A 3F4WA 1AJ2A 2ESCA 3THAA 2XPKA 4GI6A 1WZLA 4OOUA 1Q85A 2BXVA 1ADDA 2WMIA 1AZ2A 1EC7A 6CGTA 2ZUTA 3K8MA 4WVXA 4WX2A 4UTHA 3PULA 3KDNA 3K5XA 1E6XM 4UCGA 3RX2A 3B8SA 3N2XA 3GG7A 5G2WA 3ZYZA 5ABHA 4AISA 2ZUUA 1YDNA 1TVPA 2JE8A 3LHYA 3AHYA 3AZRA 5BYWA 2RDWA 2WHJA 4UMBA 3ARSA 2ZCGA 1EZ2A 1XDMA 3RG6A 1VBRA 3LLFA 1N2VA 2HVOA 4DY1A 2BSLA 4KEUA 1FP8A 3ARPA 1CBGA 4M81A 2FQIA 4H9YA 1BQGA 4UNIA 3SRFA 3S2JA 2RFGA 2AMXA 4XBJA 3KTCA 4DJEA 2FB2A 5JXQA 4JOMA 1V3IA 1EOKA 3REQB 3ZXWA 1E6ZA 4BA0A 4AXKA 3BARA 4DXKA 1XH2A 1C92A 4XV0A 1VEPA 3LX9A 5BRQA 1DTNA 3WF2A 3VO0A 3VMOA 5IFPA 4BY3A 3RLGA 3T09A 3CQJA 5FF7A 5CSYA 5HMSA 5AC6A 1ODZA 3EX3A 4LUJA 5AHMA 1EO5A 2PWUA 3WLKX 3M16A 1Z3NA 3I4KA 1BWKA 3LHZA 4UR7A 5LNVA 1SO6A 5FKYA 3KOZA 3W07A 1LG2A 2Y70A 1TZZA 1WDQA 2FFIA 3DG3A 2HISA 3PUEA 1YXYA 1FWRA 1OT2A 2IKHA 1CXLA 4ACZB 2FPVA 2PDCA 1FWIC 2G3IA 5G5IA 3DFYA 3QQ0A 4O12A 3JS3A 3K30A 1VD6A 4CQDA 2E6YA 1ONXA 2BOEX 2WVSA 2CITA 3E0WA 5CPMA 5CC3A 1S46A 1VC4A 3WNNA 3UQNA 1RLCL 2JEQA 4W85A 5GJMA 3HG3A 3WEMA 3SJNA 1DIKA 2XGZA 1E4LA 1W1ZA 2XZ7A 1B1YA 2VC6A 1JDFA 2IPWA 3NPXA 3KL5A 2CYGA 4PFHA 3BK0A 4JHMA 1YYAA 1UR8A 4HK6A 3LQGA 4JDYA 3BMVA 2Q71A 3VINA 1POKA 1XI3A 3B97A 2CLLA 3W00A 1F76A 4BK9A 3H4WA 4HPXA 4WY0A 1YTKA 3CZGA 3IGSA 3URAA 5M3WA 3QTPA 3VNZA 1F4HA 1XKYA 5A6MA 1A4LA 5LA2A 3PB0A 2EPOA 1V7AA 1GONA 3TFCA 3GW0A 3D0CA 1UR3M 2J9YA 3WLRA 4PMOA 5HMDA 1MSSA 3BJFA 4AG0A 1GWJA 1XCXA 1J0YA 1HIZA 2AAMA 2DVUA 4AMCA 3EX1A 2ZXQA 1CX9A 1XIGA 3TR2A 5BMXA 3PFRA 1AL8A 4JDBA 1KM0A 1XX1A 4EK7A 3QV9A 4JIHA 3LXCA 4IICA 1GZ1A 1DJHA 3SAZA 1TPFA 4IMFA 1QU4A 3ATYA 5KMYA 1DTUA 2QW5A 5BWFA 3VD4A 4K1WA 4A3UA 2W92A 2ZUNA 2Z1WA 1EWDA 4NVTA 1HL2A 1KXHA 1IR2A 2YLLA 2G5WA 1DIEA 3M46A 4ZL1A 1ZAHA 3W7CA 1QJWA 2NLIA 1W37A 1EIXA 1D8CA 1MRAA 4MNMA 1EUAA 4LNYA 3VIJA 3TCSA 3MI3A 1FY6A 3CZJA 3E9AA 4KWWA 3M0VA 4X9SA 4GY0A 3WLOA 3O15A 1SFTA 4JICA 4XAYA 1GHRA 2FHFA 4JHOA 3MMWA 3G1RA 4AY1A 4Q6XA 1FWNA 1TG7A 2P5NA 2JF7A 3IEBA 3WQ5A 4IXHA 3Q65A 4WXZA 4L4MA 1FRBA 3WBWA 3W76A 3B0UX 3WDPP 5CEWA 2BFGA 4JZ5A 1JDAA 2E6AA 1EP1A 3DN5A 3SCNA 1PB0A 3PS7A 2ZBTA 2V69A 5JH1A 4DI9A 3GTHA 3A5FA 5A5WA 3RDKA 2VD8A 3TLQA 4NI8A 3IRSA 5LIYX 1OFQA 2YZRA 3VOCA 4GUHA 1BKHA 4RPQA 3BPWA 5CLWA 4JTDA 1XF0A 2ASHA 2VZUA 1TPWA 4W4QA 1XIHA 2FB3A 3R0DA 2V5BA 3TMLA 4LUSB 1QO5A 5FJPA 1LG1A 1BWVA 4MHBA 5HWMA 4A8LA 2QF8A 3LSBA 3WUGA 2P88A 5LIWX 3VYLA 2PGRA 3A3HA 4MUZA 5D02A 5CAHA 1RSCA 3MZ2A 3PUGA 3PUOA 3EB4A 3KX6A 1JRBA 1XISA 3ARTA 5D2WA 3N73A 1DYSA 4M3PA 1XQKA 3LHTA 2ZRWA 5DRIA 4HOWA 1WX0A 1LWIA 4H00A 4GPNA 5GNXA 3BG3A 2V3FA 3GIQA 3ITXA 3G22A 4WY0F 1EEPA 3VU2A 3IARA 2CNCA 4GHRA 4M51A 2J47A 3MWCA 1Z48A 1NP0A 3WLSA 1J6OA 3WMSA 3QM3A 1KFBA 3HGRA 2BHUA 1Z8AA 2YDRA 4U33A 3KAOA 3GTXA 1X1NA 3H4XA 2E0PA 1I0BA 2Z1VA 3MUCA 3WDIA 4RE0A 5D38A 4MYAA 2VR4A 3GVWA 4AIOA 1W5MA 1TCDA 3DI1A 3VGDA 1I2RA 1V6XA 4HK7A 4QNWA 2WJFA 4D8AA 3B04A 1B5TA 5LNSA 3WDHA 4XK2A 4RDZA 2CLFA 2E5BA 1JVNA 1VFFA 1H1ZA 2VX7A 5K4ZA 5DCBA 1B54A 1E9ZB 3KHJA 3K8LA 1FCUA 3VOGA 1EGMA 4QP0A 4ZOAA 3II1A 1XCFA 2OEMA 3LBMA 3ZJKA 1OT1A 3SIZA 4UTFA 4HVXA 4QG9A 3TFXA 1EGVA 1HJVA 3B8TA 5I23A 5JMUA 4UNKA 6ENLA 4LS1A 3WL0A 4C7DA 4K8GA 4O54A 1EX5A 5DQPA 4MY8A 4PBGA 4JX5A 3P3BA 1KLYA 1SZRA 4FNQA 4GH1A 1V3JA 1YDVA 2G3FA 4HNVA 4MNLA 4PMXA 5DMMA 1AW1A 4WQ6A 4ZSUA 1UMLA 3L5MA 3IUDA 3V0TA 2GDUA 1J11A 3TTEA 1TWWA 2CIPA 1IT8A 2DSKA 5KITA 4XZHA 1HO1A 2H3BA 3NGFA 2GUBA 4WIWA 5AZ0A 4D8LA 3E02A 4GQGA 4GBDA 1CWYA 1C91A 3AXIA 2ZZ3A 4ZODA 5AYBA 3W4RA 5D9MA 3HB9A 3V35A 1W1VA 2ZX5A 3TKFA 3MSYA 4OV4A 5TBOA 3CTLA 3V5CA 3SFKA 1TFVA 5MHBA 3OLDA 3CM4A 3PPGA 3AO0A 3OU8A 2J7FA 3GU9A 1J0ZA 1UKQA 3B0XA 3C2FA 1LTDA 1ZHAA 2P0IA 2W0UA 4DBSA 3M0XA 3RIKA 4TX9A 3FYYA 4D8ZA 4H19A 4K8EA 4EAMA 1XIEA 2VWSA 1SQ7A 1YLVA 2VDIA 1XRSA 2D73A 3FJ4A 1TV5A 3N14A 4O4VA 3TSMA 2VEIA 4RKAA 1O12A 2HNEA 2PWHA 4GJIA 2ZX7A 4JIIX 4ERAA 4PE8A 1UOZA 4JAWA 2D3LA 3QOMA 4FO4A 1L2QA 4GMEA 3AICA 1EWEA 2PLMA 9XIAA 1FCBA 2PRLA 4FNPA 3WQ8A 2GVLA 4F3HA 3GXMA 2NUXA 3WFZA 5D30A 4Q4PA 3BAWA 3O16A 2YDSA 3L4VA 1H7XA 5FEWA 3DFSA 3P62A 1W3TA 2CZ5A 4AWUA 1GQNA 4EPBC 1K9FA 2X0HA 3L2LA 3OOQA 4QS5A 1Q7QA 4DRSA 4CNOA 2PAJA 2UY4A 1OFOA 2I9EA 1LQAA 2WHMA 2LLEA 1Y5XA 3EWZA 3LTPA 4G6CA 2PURA 2EQDA 4UOZA 1UH3A 4O0KA 4N6EA 3MU7A 2DIJA 1BG4A 3SY1A 3DECA 4IZGA 1PCKA 2DSWA 1YPXA 3KBSA 5B7ZA 3NIYA 3GU2A 3E2SA 3NSXA 4AZ7A 1UKTA 1IYXA 1WZMA 3D3FA 5D8WA 1PKYA 4DUWA 1THFD 3HG2A 4MFEA 1C29A 1H7WA 2J66A 3K1GA 3F2BA 1TV3A 3HG5A 3VA8A 4C5ZA 1NOWA 2YBTA 3CUJA 5D2YA 1TPVA 4RDVA 3AWNA 2W61A 2VJXA 4J27A 1V0NA 3I6TA 4PBEA 2G95A 3L0NA 1TELA 3CS2A 4AVOA 1BAGA 1AG1O 3IJ9A 1RVKA 1MI3A 3A12A 2F2HA 4MPQA 4PH6A 3LCGA 5DXYA 4GVHA 3W1TA 1ZGDA 2BV9A 3EB3A 2ZUWA 1VH7A 3WK0A 1MRQA 4X2RA 3AS0A 1XSIA 3IJ7A 4J3WA 3EOLA 3EXRA 2XVNA 4AEEA 3ANUA 4IIDA 3PSWA 3N3MA 3UNDA 2AQOA 1HG3A 2NQ5A 3LV5A 5JQ9A 1K7XA 2B7PA 1CYGA 2XGIA 3PPHA 1BRLA 1HN1A 3LZ5A 2OYLA 2QDEA 2XIBA 1IE7C 2J24A 2YIHA 5E0CA 5HQEA 2UBPC 3Q4DA 4H4IA 2HV5A 1TV4A 3DU0A 3DGRA 1U33A 3R0KA 1QHOA 4PCFA 1ZJHA 3AXXA 3MPGA 1AODA 1TPH1 3U7VA 1WA3A 1OFRA 2HE8A 1IXOA 1PAMA 3AHXA 3VE7A 3UG8A 1GQIA 1WXZA 5BROA 2F7FA 4KW2A 3OVRA 2G50A 1Q45A 4X22A 4NAEB 1CXIA 1UUOA 1GEHA 3MMUA 2D1ZA 1HGYA 5F4XA 2G3MA 1V6UA 2P53A 3UWWA 1MO0A 3E96A 3BO9A 1BVWA 3KFTA 1W5PA 2WC7A 3W37A 1GQKA 4WUIA 2YCIX 3ZQ9A 3D47A 3WQEA 1UR0A 1XDJA 5HK4A 1O1HA 2X8RA 1KV5A 1OK6A 1FWHC 3VOFA 2V5DA 4NHVA 2EBNA 4HQVA 8CGTA 4XAZA 3SY5A 4S2CA 2FZNA 1XIFA 1TUXA 3L67A 1QT1A 1NVMA 1N7KA 3D46A 3LPFA 4NJJA 3USZA 4FSAA 1K1DA 3ZR5A 2AL1A 4OJYA 2YA1A 1IEQA 4YMZA 1A5SA 3PNZA 3UWQA 1Q63A 4JCLA 2A3LA 2J77A 4NSBA 2NV1A 1XD0A 3VNJA 3W1UA 3SUVA 3G77A 4KCTA 3C61A 1C9DA 3BLKA 3C8FA 2C13A 1X8FA 3KXQA 4IH3A 2R1MA 3SUUA 4GZIA 3V3WA 2VX6A 1HKVA 4V15A 4DJFA 3TZFA 3PWGA 4AAJA 4AY7A 2XG9A 2PBGA 2VR2A 4B4HA 3T44A 3N4AA 5DY3A 1FWFC 4JX6A 3HFTA 5D33A 1JDCA 2J25A 4IQEA 4XKMA 4UB9A 1W2VA 3PK7A 5TQLA 3FSTA 3Q94A 3L7RA 3B3DA 4NJIA 1K9EA 2NWRA 3KCOA 2NSOA 3W72A 1BQCA 1TVLA 3LHVA 1A5MC 1R2SA 1K7EA 4ADTA 3LYEA 2IPFA 3JVAA 4TVCA 3W88A 2J13A 2WJZA 4EVZA 1V5XA 3H2OA 1FWEC 4JL1A 2YL6A 5TNVA 3RXZA 1GTEA 4LBRA 3N6HA 1UA3A 3GNOA 1JZ3A 3TOYA 5CPSA 3O0KA 1TPEA 2PDXA 4IG2A 5KETA 1Q7ZA 4LYKA 3QV6A 2G97A 1C8YA 5H2ZA 3OB8A 3RGTA 2G8ZA 4JQ3A 2D0FA 5FAJA 1JUKA 1R2RA 4GH3A 3W7EA 3MP3A 4D6HA 3T4WA 4J2MA 2D0GA 4RL3A 3EX4A 2GJXB 3IWPA 4UR8A 3FYOA 3RPMA 3UA4A 3MUAA 4DUXA 5CZTA 4HK5A 3E5PA 4XBSA 2P8BA 3QY8A 5K9CA 2J8GA 3VIGA 1EIBA 4JXCA 3NZRA 3N34A 1BF6A 4JNZA 2XTKA 5A3HA 3L2MA 2NX9A 2CXGA 4I9JA 3M4HA 2CZEA 5IXEA 3ZLFA 3R58A 3GUWA 1JZ7A 3MW7A 1EC8A 5BZAA 4ICCX 2A6NA 2QCGA 4YJ5A 2PF8A 3BTNA 4WRHA 3TQ0A 3CV2A 3W22A 1B57A 3S1WA 5CJNA 2OZ8A 1K8ZA 2C0AA 1V6VA 1WYIA 2NT0A 3NDOA 2V68A 3F2CA 2OSWA 2E67A 1G69A 4J2PA 5BOEA 4CN1A 4DELA 3BAYA 3W7LA 1XIDA 3W6YA 2A79A 3WFLA 1VBGA 5HNUA 1BGGA 2XFRA 3QFWA 4C6IA 1W1A1 1YXCA 1AMKA 3ARYA 3PJXA 5GNYA 4DO4A 1LJYA 2CHNA 1H7PA 3BOLA 4XAPA 3ALGA 4CCCA 4H6RA 5IHSA 2QMKA 4K8HA 3RU8X 3ME3A 1O6IA 4G7EB 1E55A 2WM0A 1SFJA 1P4CA 1WUFA 4KRZA 1CXFA 1I1WA 3ARVA 4TV6A 3C3UA 3NZ1A 2VFFA 2VFDA 4IM4A 4HA1A 2YFNA 1ZL1A 3W7HA 1RY0A 1MYRA 1JYXA 5A8QA 3W87A 3GXTA 3R8HA 4IMDA 4F2UA 1MVYA 2YFOA 4DYJA 2VT0A 1VEMA 3EOSA 4XX6A 1XIMA 2FHCA 3M5XA 5BW6A 4JKKA 2GGJA 1KCLA 3H26A 1OZQA 1TMLA 3KOXA 5CKSA 3DHFA 1MFUA 2OT0A 3WNOA 3LUTA 1M9HA 2I5QA 3SQSA 1VBJA 3A21A 7REQA 3OQEA 3H2NA 4HD5A 3LTSA 2WMFA 4GO9A 4QRNA 1UWQA 2J78A 4US5A 1QCWA 1HXJA 2O9PA 5LKYA 3EZ4A 2V8ZA 1JUEA 1VLIA 3WD0A 1YXDA 2FGBA 3NJ3A 3M0ZA 1GNXA 4IMAA 4IGHA 2DUZA 2Z1SA 3CMJA 1S2AA 2W67A 2XFYA 2OCZA 4MZYA 3S9ZA 1FH8A 4HIBA 5J5DA 6A3HA 3WH7A 3GXPA 3GDMA 3E0IA 1RJPA 4MLJA 1ECQA 4H6KA 2OX1A 1V77A 3U4AA 3ABZA 2WAGA 3GDLA 4QFUA 2FJUB 3R79A 2YCJA 4WHBA 4WKFA 4LAMA 2XM1A 4GK8A 2HEJA 4IJRA 2WVVA 3VE9A 4L65A 4CLMA 2OZ3A 4K36A 4NZ5A 3U2EA 1DPMA 1MW0A 3BUVA 1GYLA 3MV11 2F9RA 3BL3A 3KLKA 4PR4A 3T0DA 2OPJA 3FW6A 2VM8A 4LC6A 9CGTA 4PMJA 2Y8UA 4F0RA 3CHFA 1KM1A 4WK9A 4GFSA 1W54A 3DBNA 4JTSA 1QASA 3DCPA 3PBWA 3WX7A 3LPGA 3LY0A 3SO7A 3PBMA 3VPLA 1R3SA 7XIMA 2Y63A 5E9XA 1CPUA 1GTHA 1WXYA 3Q67A 3OQ8A 4ZTYA 4P61A 4NILA 3AYSA 2F6UA 3MI6A 1UJQA 3GE7A 4XUYA 4AWTA 3ZM8A 3MV01 4N02A 8A3HA 4R7WA 1US0A 2BGNE 3CWOX 1BYAA 4XIMA 2VXNA 2J9XA 2QPXA 4WOZA 3S1XA 4BJHA 2WZMA 1HL8A 4Z0SA 4IXXA 4JN6A 3I7SA 2HDJA 3TA9A 5CZ0A 1PPIA 1JIBA 3CT2A 5D05A 1NFGA 2VTFA 1B0IA 4MY1A 4HMDA 1SJCA 4UNLA 1L9WA 1RCQA 4PUWA 3N15A 4QM1A 1BVNP 1PIIA 2QHAA 4EF8A 4HCHA 5AVNA 4BF9A 4P7NA 1XGEA 4S38A 1FWTA 2C18A 2DUAA 1ITQA 1CECA 3DFTA 3IK2A 1NSJA 4AYSA 3WH8A 4DJFD 2O7SA 1ENUA 2BY1A 1HP4A 4O0ZA 4KGLA 1I2OA 3MBDA 3QPEA 4L5ZA 2E1WA 1WP6A 4N6FA 4K39A 1M7PA 4ATWA 3LEPA 1TB3A 2J7CA 1TTJA 4LX4A 2NLYA 5HNRA 3RX3A 2IQDA 2XUCA 3QR1A 3NQVA 1UCWA 4FX8A 5A6TC 5KZ6A 3KZPA 2PRMA 2WK2A 2WANA 4RCXA 2CKRA 2PTWA 3GKFA 3F4CA 3SCSA 3WUEA 4ACYA 4AQLA 4TR9A 1AQMA 1GORA 2YCEA 3MO4A 2XINA 3VDCA 3K2GA 4C6LA 3NR0A 1M5WA 5K7JA 4MB1A 1E6QM 4D6GA 1QPNA 1ELSA 4HYWA 4M29A 4C6DA 4E8DA 1KXQA 3G1HA 1NAL1 4MWAB 2OYKA 3FIGA 1XRFA 2OMAA 4AHQA 3VOJA 4E4FA 2OO6A 2B4GA 8XIMA 2J8FA 4E5TA 3HMCA 5HPCA 5G1YA 1XBXA 4I9MA 3F5JA 1AK5A 2INZA 4IL0A 4GINA 2IXVA 1KR0A 1OWQA 3H7VA 1QHPA 4L6HA 1VGAA 1TZ7A 4HZ6A 4Q8VA 5DX7A 1S2UA 3WD2A 3EWYA 3CZKA 3CJPA 3DOPA 3W1PA 1W3JA 1J6PA 5I78A 3CUZA 4ZTXA 3V7PA 2C6QA 3GH7A 4XZNX 1JPDX 3QC0A 4GC3A 3N17A 4J3UA 4MSSA 3WF3A 3DFPA 4UZSA 3W75A 3NL5A 4ZB5A 4AXNA 3R89A 3VKKA 4V1XA 1EQPA 3A64A 1EUNA 4TMBA 3VM7A 5KEZA 1B4KA 3R13A 3VD9A 4FR1A 4H6EA 1CLXA 1ZPTA 2C14A 4FS9A 1VFTA 3UY8A 1HX0A 1ZCOA 3REQA 4JR5A 4P7RA 1SVDA 5JBEA 4NZ1A 3U5UA 2PZNA 1TQXA 5AYYA 4RV3A 7ENLA 1GYMA 4TO8A 3L5LA 2B81A 3M7WA 2FFCA 2BHZA 3C0SA 4K7VA 3FEQA 4M1BA 1GKQA 1G7UA 1PZ1A 3UYIA 3I3BA 1PXGA 4YWSA 1NH6A 3PBGA 1E0XA 5JVLA 3GD6A 3EEZA 3HMJG 1DQXA 1WOAA 1WDWA 3WQ6A 4FNUA 2YBVA 1CENA 2RUSA 3UGVA 1JCMP 2H8XA 2AL2A 4JTIA 1L6GA 1F2JA 4OIFA 1VEOA 3MMDA 9XIMA 1H1NA 3C2EA 4DIAA 4JQAA 3BLPX 3T0TA 1BRLB 5K9XA 3G3MA 3WLQA 3SR7A 1B2YA 1NJJA 2GUUA 4ACZA 2YDQA 3M0YA 1R47A 3CU2A 4DJDA 3QBUA 1A3WA 3R8GA 1Q3NA 2V2HA 2OGJA 5I3JA 2JKEA 1GVQA 3A4AA 3OIHA 2ISWA 4R9OA 2GYIA 5FEPA 2NQZA 2GSJA 4KRTA 4JTLA 4M6PA 4GYJA 1OD0A 3TSBA 3SBFA 5G4HC 3AUJA 4V27A 2GGHA 2D2GA 3NZQA 3TIMA 1M1BA 5ABTA 2Z0IA 3PTQA 4HSOA 1QI3A 2CCRA 3OG3A 2C16A 4O11A 2Z6JA 4LGXA 5A2BA 1KCXA 2POZA 1XGDA 4TIMA 3CEUA 5F1UA 3QPZA 2OB3A 3VC6A 3NEVA 3EKLA 3RK8A 3KEHA 1OF6A 1PS9A 5F7UA 3M0LA 4NRSA 2BLEA 1XLLA 3MY9A 1CZ1A 3NYDA 3UZYA 4D6JA 3B9DA 3FA5A 4WJXA 4HU3A 2GOKA 3AHZA 2NQ9A 3TTQA 3AS1A 4W8BA 5BU9A 3NQ2A 3EX6A 3H2MA 4M1RA 1H11A 4JFTA 3UESA 4HT3A 1XLKA 4H6QA 4RPPA 1R85A 1AQHA 1TREA 3RR4A 4CQAA 1N8FA 1WPCA 2QVNA 1YIXA 1W8SA 4ZQMA 3TU9A 3COTA 3OZPA 3TWAA 1E56A 5AC5A 2BY3A 3FXGA 4JTGA 1P0NA 1F4AA 3GR8A 4IIGA 4Q22A 1O68A 1EHNA 4K68A 5LIUX 4ZBCA 4A3RA 4LALA 3ZLGA 3LK6A 2TAAA 5I02A 4NX0A 2D69A 3LBCA 1TZ9A 5FA5A 1KTCA 1E4IA 3HQ1A 5D9OA 3W53A 1EQCA 1F8IA 5FACA 3EWWA 1HW6A 2PDMA 3OA3A 3PP7A 4ZOCA 1BYBA 2H3DA 1CGYA 1F05A 4IQLA 3R25A 1QFEA 4PL1A 3GIYA 3LCHA 1DIDA 1LUCA 2F61A 3N2MA 1WQ5A 4HP5A 3W71A 4IUOA 5LIKX 3IAPA 3CHCA 3WNKA 1KFCA 4JIQA 4E4PA 4AF0B 2PTYA 5HOSA 3F5LA 1JXKA 3PG9A 4LRTA 1YDYA 5A8OA 2Z24A 2PDNA 5BRBA 4W9TA 3TROA 3VNLA 4F9JA 1KKOA 3GX9A 2TMDA 3HBLA 2F6KA 4ORMA 4S3CA 4HMNA 4X9YA 3VOIA 3E12A 2A0NA 3WLNA 1XCWA 2WSPA 5HXMA 2WNWA 2JEPA 1VJZA 1S5TA 1LP6A 1J01A 4XO6A 4F40A 1D9EA 1GVSA 8TIMA 1S2CA 1W9PA 3WNMA 1D8WA 7REQB 3AQUA 3FKRA 2Z27A 1JG9A 3K13A 4CU8A 1K8XA 2B7QA 4RK8A 3W2JA 2V63A 3ZSTA 1J18A 3CHDA 4PEKA 1SO4A 4TVUA 3C2OA 4GKTA 1XYLA 4J5NA 4MUPA 5ECUA 1HJWA 5CLTA 4ZOEA 3S0CA 4GVGA 1SZGA 3FSUA 4R3UA 1TVNA 5I3HA 1ZB5A 2DJXA 1OIFA 1Z32X 2CLOA 4W5ZA 2V2CA 1A4MA 3I6RA 3T2PA 3UEQA 5CSRA 3VCNA 3DFNA 4Y8EA 2B7OA 1PTGA 2FLIA 3LMYA 2X42A 4UXDA 4QDPA 4UFJA 3EWDA 1KM6A 3F2DA 4MOZA 2PCQA 2WMGA 3AIQA 2W9MA 3KW3A 1XW8A 4CNPA 3C6CA 2QCLA 4P7OA 4IPLA 3U9IA 3ARUA 4TTGA 1Q6LA 2QJMA 4H9TA 5T26A 1MW3A 2R1LA 2J88A 3GYCA 3PNUA 1LL7A 1KQZA 3GVQA 2HMCA 4ZSTA 3OA5A 1RBOB 4QE5A 3WLPA 3W85A 4FLSA 1M53A 1TV2A 1EF3A 3B8UA 3S2LA 4PUUA 5IBXC 1QWGA 3ZIZA 2W5FA 4YVVA 2D23A 1QHZA 1CGUA 1QDSA 1SU5A 4F4RA 3UPMA 2G96A 2Y7EA 1T40A 3B0PA 2EF9A 3H70A 1OJXA 2V82A 4DJEC 2GQ3A 3RPTA 1JUBA 7A3HA 4Z08A 3TLLA 1UR1A 2GWGA 3OW1A 3VIKA 4KWVA 2QPSA 4CEUC 2WMHA 2DIKA 3G1FA 4W89A 5CSSA 4DHGA 5HBFA 3VZYA 2BOFX 3IRDA 5CC7A 1NDZA 1SR9A 1KFLA 1UWAA 2WW5A 4YU1A 3RMJA 3W84A 1J0KA 3K4AA 1UA7A 4W93A 1XS2A 2C71A 3AZTA 2HVMA 7TIMA 4ZFMA 5LA1A 2IMRA 1Q6EA 4FF5A 3PANA 2VRJA 1E1CA 3TH6A 1TV8A 4O10A 4QQUA 4C6OA 1Q7MA 3M44A 1P0DA 4LOCA 4HU8A 1CDGA 2BX7A 3CYJA 2GVEA 3D5HA 1US3A 2WWDA 1ALDA 2ZRYA 1MFVA 3UYCA 3IJLA 4HN4A 4L56A 4RR4A 3CO8A 2IPJA 3TYCA 1UWIA 1FP9A 1A49A 1M6JA 1YHTA 1PYFA 3JRKA 3W7QA 1JFHA 4L1GA 1XR2A 3WH5A 4GIEA 2GGIA 3EYPA 3PBUA 2GOUA 1W0MA 1OX4A 1W5NA 4NYUA 4O19A 3QHOA 5KINA 3WQWA 3QLDA 4HZ7A 1NTHA 4KEZA 5CG7A 1CI1A 3CQIA 2RDUA 2AKZA 2ZWYA 1RK5A 4ASTA 4M82A 1VIZA 1ZSXA 4NQ1A 4JFUA 1P7TB 3A9IA 4QLLA 1F3WA 2OOGA 4MB4A 4LV4A 5FJTA 1JAEA 3BC9A 3K4DA 3KCLA 1C7SA 5G2IA 1VS1A 4JN8A 4H8VA 4UTTA 3WKZA 5GPRA 1FWBC 4BF7A 1J0IA 3FEMA 1KBBA 4M6UA 3SURA 2BY2A 1L6FA 1EYWA 3RJXA 1FHDA 1WDPA 1RPKA 4YVXA 4YTTA 1NDYA 3QYSA 3ZLHA 4DYEA 5HPOA 4CD6A 1G5AA 1GVFA 2GVJA 4JY8A 3DERA 3EMQA 3ABXA 3NUKA 5BCAA 4DXXA 4FXSA 4LH8A 3ARQA 3GFXA 2QMJA 3S46A 2HWGA 1PBGA 2DDXA 1J0JA 2Z00A 3NFUA 4HCDA 1MQQA 1ONWA 2VQTA 5HANA 1OX6A 4O1BA 3E2RA 3G6LA 3P6LA 1VBHA 1LLOA 4MWAD 1XLMA 1Y5WA 2C1GA 2NWSA 3BLDA 3WLMA 3EOOA 3QTGA 1DWHM 4RNJA 4BEUA 1X38A 1KKRA 5XIMA 1FKWA 2GUYA 3AUOA 3VX0A 3S3GA 2QGYA 4CQ8A 2PDHA 4R53A 1NWSA 4AX7A 4DNHA 4WOQA 2XVGA 3EEGA 3M43A 2GPTA 4HSNA 3H7UA 3STPA 2A3HA 4IFKB 1A5LC 4UOQA 4NAEA 2YW3A 3L4TA 4JYDA 4DPPA 4X0NA 4YYCA 1CTNA 4KWUA 1HKWA 3CV7A 4ALDA 4YIWA 4UTKA 2NV9A 1J96A 1EZWA 2XIOA 2I56A 4AUBA 4D2JA 2PRHA 2YL9A 2CC0A 4E0CA 2PD9A 4X61A 4OBTA 2BVDA 3A3XA 3UWYA 3KOYA 3TTSA 2PLKA 2YA2A 1IHIA 2DVXA 1F6PA 2IQTA 1F07A 1K8YA 1R3YA 2VELA 1QTWA 4AWEA 3SCVA 1WBHA 3TVAA 2GQ8A 3QF0A 1ZNNA 1LT7A 1I9CB 4FXJA 3ITYA 1EHAA 4J7RA 3ELFA 1LWJA 1SZNA 2ZZ6A 4MF4A 4XZIA 3TN6A 1XLCA 1UYQA 2E5CA 3CH9A 3FJ6A 3AOFA 4DLFA 4RX0A 4YTQA 3LHUA 3BAXA 4FP1A 2WVVB 4FXRA 1RY8A 3MWAA 3WUBA 3QKEA 2INEA 2GSEA 2E9MA 2CXEA 3EDKA 2A5HA 4Q8MA 4QG8A 4DWSD 4UQDA 1XIIA 3BGGA 4WJ8A 2V5CA 3MZNA 3DKJA 5DT5A 3BZJA 4FB7A 3W26A 4OHQA 1S5MA 4WGHA 4CD4A 1GOKA 1D3GA 4C60A 3P80A 5TD4A 3LD5A 2ZE3A 4C1KA 4K6AA 3PZGA 3PZQA 5J8LA 3W23A 1N8WA 5BXTA 3Q37A 1IT0A 4G2DA 4R88A 1TWIA 5A6JA 1EFZA 3HOJA 2PWDA 3S6TA 1QK0A 3CL8A 2XVLA 2PDQA 4N2YA 1E71M 1IXPA 3PHAA 3U4FA 3BE7A 4W7WA 3BAJA 3R11A 2ABBA 3UJRA 2GQ9A 3ZT7A 1I2NA 3QSTA 5F2MA 3PWIA 2EO7A 3RYSA 2WNZA 3QV8A 4FX7A 2FVKA 3B0VC 1GCYA 1J5TA 3ZMRA 4MNKA 1EC9A 3QXBA 4Q3MA 2V6AA 2NZLA 3HV8A 3DYMA 4N9CA 4IMEA 1SJBA 2ZWZA 4QJ5B 1T8XA 1ISZA 3RLUA 1X39A 3O6DA 1OFPA 1RP8A 4C6JA 2XZ9A 4FA3A 4M8UA 1OVDA 3OYXA 2TSYA 1BSIA 3NYZA 1WO2A 2F6XA 3I65A 1RQEA 4I5UA 2VCAA 3SCTA 4HNCA 2QIWA 1X8CA 4EF9A 5CPNA 3KL3A 2A1YA 2Y61A 3S1GA 4HGXA 3VMPA 3GTNA 5H8PA 3BMXA 1O60A 4CD7A 1JAKA 2CBUA 3Q58A 3LCFA 5CBIA 2WSYA 6REQA 2R14A 2CEQA 5H1WA 5E0KA 3CUIA 1MXDA 1YW1A 4NIRA 3LGDA 2XM2A 3W7MA 1ME7A 1FWDC 4DF2A 3BGJA 1DEDA 1I4NA 1WV2A 3WQFA 3RLHA 1LRTA 1LM1A 3N2CA 2IQ0A 3D3AA 3DDMA 3PJWA 1D7FA 1BXNA 4AWSA 2FZDA 3VGHA 3PBVA 4PSPA 2DY3A 5C9ZA 2X2YA 2AMGA 4U5KA 2CETA 1AD1A 3UETA 1MMFA 2E5DA 4GD0A 4GZEA 4LEFA 2EXOA 2XYLA 2VGGA 3SUTA 4XD3A 4GI4A 1XBYA 3AMKA 4JL2A 4FNRA 4IQDA 3TYZA 4TX6A 2Y8KA 1YX1A 4FNSA 4MKNA 4BI5A 1KBKA 2GK1B 3H24A 3VOHA 2V30A 2VZOA 2CLHA 4S3FA 3VKDA 1V3MA 3JW7A 3B40A 4ZFCA 4LSBA 3GG8A 2WWCA 1L6WA 2Z28A 4UTUA 2V3EA 3VXGA 1QBAA 5AC4A 4EP8C 4JYFA 4GOAA 3E0LA 4AD2A 2GFTA 1OSEA 3ERPA 2OVLA 5CGQA 5IRPA 2YGYA 1GOXA 2Z25A 1M3UA 1XG4A 3NDYA 5CCZA 4V2XA 5F2IA 1KR1A 3GK0A 5T9CE 4ZZ9A 3STGA 3GHUA 4CVWA 1KBIA 3E2VA 1QI0A 3GVVA 4PUNA 2ACQA 4Y9AA 2HROA 1JPKA 1YEYA 3IIOA 3CQKA 5CQ1A 3UR8A 5BWAA 3EKZA 2XH0A 3LRKA 1GVIA 3W73A 2VFGA 5BXSA 2J7GA 3KBNA 4KFNA 4PGLA 2WM1A 3WH9A 3R94A 4Y96A 4L6OA 2MUCA 4NI3A 2Y7GA 4P2VA 4B2DD 3SDOA 1MUWA 4HA0A 3CUGA 4DVOA 4ZO6A 1F5ZA 3W82A 1H7NA 4RW3A 1PSCA 1RR2A 1NARA 1HL9A 1UASA 1M7OA 4CU6A 2R94A 3NO1A 2OXNA 3CIVA 5AN7A 4OT7A 1L8NA 1Q4WA 3HGOA 3CL6A 1HO4A 4GNVA 2PC8A 1POJA 1YE6A 4NNCA 1UD4A 4MG4A 5HINA 4OE7A 4DPQA 5HUOA 3G1YA 3DC8A 1E9YB 2UY3A 4R9XA 3TXZA 4OU1A 3FOKA 4ML4A 3LCIA 5A6LA 3CPUA 3URNA 2J6VA 5AB3A 3TQPA 1PWMA 2EPKX 2GK1A 3G1VA 2ABAA 4Z1YA 4PMYA 3TTYA 4AZGA 4I8DA 4FALA 1C8VA 1HZYA 4UCFA 1UP2A 3KVLA 3DBPA 3R43A 3DC0A 1KFKA 2OKTA 2W63A 2WQDA 2VRQA 1I2QA 3OPSA 4MJ2A 3WMBA 3U5YA 3CZ8A 4FZIA 3O6YX 4H9ZA 3CPGA 4IP7A 1W2PA 4AD1A 4XD6A 3T9PA 1WBJA 2J6XA 2GJRA 1BFNA 2HRWA 3G8RA 3TUUA 1W9BM 4C6CA 1W3NA 3T0CA 5HAOA 1TJ0A 5EBUA 1S3HA 3H2EA 3K46A 4GY1A 2VP8A 1I6NA 3LTYA 1REQA 3T6CA 2NVDA 5D8ZA 3BH4A 2EG6A 4A35A 1UD3A 1XBZA 2XWDA 1K03A 4Q4OA 3P7YA 2RDXA 2J7EA 3OGSA 3WMLA 5I77A 2V67A 3CAKA 3WJYA 4FMVA 4J3VA 5I03A 3PJTA 1V03A 3O9NA 3QGKC 4FHAA 4CD5A 4YPJA 3N11A 1QXLA 3GTIA 2A3AA 2QUVA 3WEZA 1FBAA 2I17A 4C6NA 1F7BA 2ZDSA 3V18A 1EB3A 3LN3A 4GZ7A 1ZJBA 2FPYA 4EXQA 3SGZA 3QR0A 2VFIA 2VMFA 4LUTA 1XICA 1FQ0A 2CLIA 2OKOA 3CV6A 3BV7A 2DP3A 3RM4A 1R3TA 4M56A 1RBLA 2ZZ1A 4ONVA 3OP2A 1XLAA 4WJEA 1QRQA 3FHQA 1K4HA 4H9XA 4WCJA 4MDOA 1DWIM 1Z9AA 5DCEA 3I3EA 4B3ZA 5HULA 4GRSA 2ISVA 4U10A 4DEFA 3F7JA 1GW1A 3PF3A 4BQ3A 2JKPA 4P8UA 1OINA 1E1EA 1R7AA 3W1AA 2PI6A 2CBJA 2V5JA 1X97A 3W1RA 1BXBA 1KFEA 2F8QA 4NF7A 3OEXA 1YNQA 2I5GA 1GYNA 4UFHA 3IIZA 2DJLA 3VNIA 1LDCA 4K7YA 1PUDA 1UJPA 1LORA 1RJRA 3GU1A 4LUYA 4BR1A 4LT9A 1XH1A 3AXKA 2OWXA 1GKRA 3O63A 1UQZA 4HB7A 2BS9A 3VKAA 4U5IA 4UFIA 2JBMA 4D6IA 2OWCA 4XAGA 3TEVA 2HQAA 1LUCB 4KESA 3NEHA 4W88A 1QW9A 3T2QA 3TJIA 3GFZA 1A0DA 3AROA 1X6UA 3KTSA 2Y88A 1F3XA 3Q2DA 3V0UA 3SCUA 5EY5A 3WNPA 2J7DA 3OO2A 1VHCA 3OBAA 5CC5A 1TX0A 5A95A 3KM8A 2DU2A 2W3ZA 3MQTA 1TMQA 4ZO9A 4JX4A 1DQWA 4A8IA 1K3UA 5DANA 3WF0A 1KXVA 3W70A 5IBXA 2WNNA 4IPPA 5HNNA 2QQ6A 1H50A 2W91A 2GDQA 3MUXA 1SO5A 3O2LA 1V6TA 4LCRA 5FSEC 3FJNA 2PSNA 3PPCA 3EBVA 5I79A 2PP0A 5EL1A 3V75A 5I3DA 2PWVA 1VYSX 1MWOA 5I24A 4P8VA 1NFPA 2CZDA 4FIRA 4JD4A 1YADA 1Z6KA 1E51A 4TUFA 2TRSA 2OTDA 4H1ZA 4NT0A 3GXNA 3UG5A 1RD5A 2VOTA 1C3FA 1VFOA 1X6NA 2YDAA 3VIHA 2HS6A 3CZLA 4OVXA 2HCVA 1VJSA 1NU5A 3SY8A 3IPWA 4KKXA 5EKYA 4BEQA 3S9YA 1AJ0A 3T05A 4GGHA 2JIWA 3HV9A 3WD4A 1JFXA 1LOLA 3QVQA 2ZDRA 5HQLA 2Q8XA 4Q4MA 4J3ZA 3BMWA 3G2GA 4KS0A 3HPSA 4NXSA 2E6DA 1G4EA 1GVRA 2GJXA 1OM0A 1TR9A 2ACUA 3OIXA 3Q45A 5EU9A 4GUIA 3BQ6A 3SSZA 3NQBA 1TRIA 1E0TA 1U5VA 3N13A 4AZBA 1D3CA 3P74A 4M7TA 3W28A 3ONBA 4J40A 4FEZA 2VL4A 3R12A 3CLMA 1KRMA 3OBKA 3IJQA 3W1XA 5GJPA 1O4UA 4WSHA 4HTYA 1IV8A 4NYYA 4E8CA 3VKCA 1G01A 1ICSA 3UERA 2BVTA 2Y7DA 4UFKA 3L23A 3L9CA 4E8GA 2QR6A 2Q8LA 3VUSA 1TWSA 3SW6A 4WDTA 1U83A 3OJGA 1K02A 3DFOA 1MEWA 3QZAA 3G3DA 2C7FA 3J7HA 2OWWA 1OYAA 3LLXA 3TYEA 2OZ0A 3W7JA 4DAFA 2QT3A 1QO2A 3VIIA 4IMGA 2FDSA 5RUBA 4NY2A 2YOCA 1FH7A 4I9TA 3HF3A 3W81A 3GNDA 1U1JA 3F4DA 5BXPA 4UUIA 3MDUA 2ZC1A 1NQKA 5A6AA 4IGNA 3EGJA 3VDHA 4JTUA 3NPWA 1A3XA 2EEXA 1W1PA 1J79A 3QZEA 5KZMA 1E4NA 2X1UA 2P10A 1QI4A 1FDYA 1ZP3A 1ZBVA 5GJNA 1U5JA 4R33A 3LQLA 1E1CB 1JZ5A 3UXKA 1OFBA 2F2KA 2RJGA 1GOQA 2QPUA 5AYIA 3L4UA 2Y6ZA 3H22A 1FWWA 2QJGA 3A9BA 1CLVA 2D0HA 1A5KC 4IHCA 1B3OA 1YTDA 3VKJA 2VVSA 3QC3A 3B8IA 3PTMA 3WJSA 3F1QA 4Q8NA 3R4IA 4GVFA 4Z17A 1UROA 2J7BA 4H04A 3UBPC 1LYXA 4LAZA 1Q2RA 1QMLA 3OODA 1OCNA 4NG3A 3IV3A 1V7YA 4KFOA 1UKSA 4Y8FA 1J9YA 1J12A 4NNAA 4GQQA 2WKJA 2VEKA 1PX3A 3K8KA 2Z2UA 2VX4A 3FYPA 1OCJA 4LJ3A 1QW8A 5A8PA 1NM9A 1E15A 4XB3A 2BY0A 3N19B 3HG4A 1KV8A 2Y7FA 1EDQA 3NL2A 5LIXX 4GYPC 3I3DA 3LXBA 4AEOA 4P8XA 1R9YA 5HATA 3SUWA 1JCTA 3E6EA 2REQA 1H09A 3BURA 3BV4A 4F0MA 2FTYA 4PUDA 1K9TA 2C15A 1UZDA 3KE0A 1EEXA 2OFJA 3NNTA 2ACSA 3VIPA 2QCEA 1REQB 1V4YA 4QCEA 4HPJA 5FJIA 1KRAC 3U3HA 5U7SA 2PLJA 2EPNA 3UWUA 4JIPA 1DBTA 4H8HA 2GQAA 4A29A 2EKGA 3VI2A 3GBDA 4L7ZA 2NVCA 4HNOA 1ESWA 3IACA 4QG6A 3S2MA 4JTAA 3HQOA 3ABSA 1XYFA 4NRRA 3UXLA 2PLCA 1DJGA 1OYCA 5J5RA 1GT8A 1O5KA 1ZBKA 3VM5A 1DJNA 4AC1X 2DGAA 3MKVA 4EIVA 2YBUA 5AOUA 1FFQA 2IKGA 4AD4A 2RGMA 2XGBA 1OHLA 3G6MA 2JIEA 4PMRA 3MKCA 4QITA 2I9UA 4LBSA 2KX9A 5DMNA 4LNCA 2OGYA 4MNJA 1PX8A 3MT1A 1H7OA 5FF0A 3NZPA 1B31A 4CU7A 4J4KA 3TN4A 3FY1A 1E9LA 2IW0A 1XG3A 7ODCA 3S5SA 1IT7A 2ON3A 1PZ0A 3C52A 3NQ8A 1EBHA 5AKQA 1EL3A 2R6OA 1RCOB 1KRCC 3GXDA 4D1JA 2VI0A 1LBLA 3RO8A 1GPFA 1XIBA 4HZ8A 1G1YA 3G5EA 2QV5A 1ZJIA 3T55A 3W86A 3S6OA 5EGRA 2ATSA 2QAFA 4NX5A 4Q8UA 3GKAA 3EOEA 3PG8A 4MIMA 3S6DA 3BW4A 2E68A 3T0AA 1XGZA 3KRZA 1R0MA 1C7TA 4RV8A 4K37A 4OKDA 5EMKA 4R27A 1JDDA 1QR7A 1NQ6A 1B30A 1UC4A 4WF7A 1FDZA 1VCFA 3N29A 4RXGA 3OVGA 2VX5A 4LPCA 1EX1A 2DEPA 3JU2A 3LOTA 4DBEA 2PDLA 2HSAA 3ZT6A 1EJVC 1W5QA 4HA4A 3NSNA 1IXNA 4CGTA 4IIBA