3TZNA

Crystal structure of the yersinia pestis dihydropteroate synthase.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
243
Chain Sequence
SHMHLTARGLTLDLSRPQVMGILNNLDQALQHAQRMLSAGATLIDIGGELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transferase
molecule keywords 7,8-dihydropteroate synthase
total genus 85
structure length 243
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tznA00
2Y5SA 3TYEA 4C1NB 4D9PA 3H23A 3V5OA 4S3FA 4CCZA 2YCIX 1TWZA 4DJDA 1Q7MA 4MWAA 3H2EA 3K13A 3TZFA 4D8AA 2Y5JA 2OGYA 4DJEC 4C1NA 4DJDC 3MCNA 2YCJA 4D8ZA 2VEFA 4S3AA 3H24A 4NIRA 2VP8A 3H21A 3H2AA 4NILA 2DQWA 4O1EA 4DB7A 3H26A 4S39A 2DZBA 4S3BA 4DJEA 4PZVA 4O1FA 4HB7A 3TYZA 4S3CA 4DAIA 3H2MA 5JQ9A 1TX2A 4MWAC 4MWAB 1TX0A 3TYCA 1Q85A 4S38A 2E7FA 3BOLA 1TWSA 3TYDA 4MWAE 2Y0FA 4S3EA 4DJFA 4DJFD 3MCMA 4DAFA 4NHVA 3TR9A 4S3DA 1Q7ZA 3TZNA 2BMBA 3MCOA 4DJED 1Q8JA 4NL1A 3H2OA 1Q8AA 1AD1A 3H2NA 3H2FA 4O0QA 1F6YA 1AJ0A 1AJ2A 2YCKX 3BOFA 3H22A 4S23A 1TWWA 3TYBA 1AJZA 4G9PA 1Q7QA 2YCLA 3TYUA 1AD4A 3NOYA 2H9AB 2YCLB 1EYEA 2DZAA 2H9AA 4MWAD 3H2CA 4DJFC 4DJDD 3TYAA 2VEGA
chains in the Genus database with same CATH superfamily
1T41A 2POTA 2KX9A 4DX3A 4AZIA 1V02A 1VFTA 2OYLA 1NF0A 4JL2A 4JNMA 1M3UA 3RR1A 2UBPC 4ZEPA 4X60A 3QGKC 4LCQA 3OBAA 2QEZA 1WUFA 1ZU8A 4QNWA 1OEPA 3LX9A 1AL8A 3H4GA 1FWIC 3FGCA 3GQYA 3CPRA 2ZVRA 2ZUUA 4I9AA 4PMOA 3GFYA 1EDGA 5E93A 4QEEA 3AIQA 3FVMA 3R0UA 1V3KA 2F61A 2AGTA 4S3CA 1EBGA 2ZWZA 1VPXA 2BOGX 2PP1A 1TX0A 2V3FA 2XIIA 3NWRA 3VNMA 4D1JA 1YADA 1XYLA 1DHPA 1QT1A 1X8CA 3M1ZA 1VB9A 2GK1B 3RYSA 1BTCA 3CUJA 3MMTA 3KL3A 5G4HC 1TPFA 5K4ZA 3C0JA 1MZRA 4W7WA 6REQA 3HPXA 1LBLA 2PC4A 4KFNA 3MJMA 3PSWA 3LRLA 4NF7A 5I3IA 3CB3A 3VOHA 2PDLA 1N82A 5FA5A 4INFA 4XVEA 5REQA 4MJZA 2AAMA 3C2EA 3SQMA 3JRKA 4K68A 1E6QM 2RDWA 1X6NA 3MSGA 2NQJA 3CT2A 4O1CA 1FCQA 4MWAD 1SO3A 1BEUA 3ATZA 3GXIA 3BO9A 2Q6ZA 3GS6A 1E1CA 4IIBA 3BURA 4KGJA 2HNHA 4TUFA 3WMBA 5DT7A 4H6KA 5XIMA 2RH9A 2D1ZA 3KHDA 3L4UA 4JKMA 4GVHA 2BY3A 3DI1A 5C0QA 1TA3A 2IKJA 1AZ2A 1AODA 2Q8ZA 3GAKA 2OJPA 2BGQA 4XZHA 3KP0A 3FLUA 3GE7A 4NAEA 3MHFA 1QHZA 1QI3A 2P5NA 2TRSA 1V0LA 3LBCA 4WY0F 3QV7A 1G01A 2VGBA 1FWDC 2CYGA 2F38A 4Y7EA 1TPWA 4QXIA 3ARYA 1PKYA 3LLXA 1ZAHA 3B4UA 1Q45A 1M7PA 2VRQA 2Y63A 2PLKA 1S2CA 5F2GA 3P67A 4WHBA 1A5AA 4EKJA 3THAA 1NWTA 2PBGA 2QUUA 1EGZA 3TFXA 3B8WA 4CQ8A 5A69A 2VURA 4AW7A 4FF5A 3Q58A 3N13A 1XD0A 1SO6A 1GOWA 3F4WA 4HCHA 1OFQA 1BXBA 5G2HA 5E1QA 1FCVA 3GG1A 5DMMA 2CKRA 5KZ6A 5FSDC 4YS1A 3KTXA 3T05A 4FIQA 2A0NA 3QTGA 2C13A 1JULA 1O5QA 5IHSA 3B0XA 3NDYA 2VEIA 1OT1A 3KLLA 3UY8A 1KCZA 2RDUA 1DE6A 3SCWA 1GVOA 4C6IA 3QF0A 3T4WA 5A6MA 2J62A 3KBSA 1E1EA 5EBUA 1LL6A 3W1TA 5H8PA 4PMRA 4UZSA 4IQDA 2QUMA 5BROA 4B2DA 3W7NA 1XLIA 3SRHA 5XIAA 2DQWA 4GIRA 1QI5A 5GPRA 3U7BA 4PRTA 3HGJA 4UR7A 1KBIA 4ZSUA 2VHLA 1HW6A 1MW1A 4H9XA 1JYNA 1IWBA 3XISA 4B91A 3MP5A 4LC8A 2OWXA 3VAVA 1NFPA 4CN1A 5IXEA 2DSWA 4IZGA 1DOSA 3NQ2A 2F9RA 5F1VA 1GQKA 3PUOA 3T2PA 4EAMA 2FGZA 1G67A 4BJHA 3QLLA 4L6HA 4TQTA 4YVPA 3W1QA 2OOFA 2VEPA 1Q6FA 4FP1A 2WV8A 2TMDA 3L12A 4QISA 1V79A 3AC0A 4YVVA 4KEZA 1TWDA 3SJ3A 1W5NA 3BLDA 5C7VA 3ZJ7A 1QASA 3D5HA 4LCSA 3VNYA 4PUKA 1AVAA 1ZHAA 2GJNA 3XINA 1LQ0A 3KE0A 5C9ZA 2QIIA 7PTDA 2J79A 1DTUA 1XS2A 2WB5A 4MG4A 3GNRA 3C2RA 2XFRA 4LPCA 1LT8A 3WLIA 2YL9A 1JPDX 3W2UA 3ECQA 3R89A 2WLZA 3CO4A 4O18A 4RR4A 5EYWA 3VMOA 4JTKA 1KM5A 4DJEA 5BXTA 3ZMRA 4JTTA 1XLKA 2HRWA 3TMQA 1QNOA 2ZUNA 3NQGA 1HP4A 3NL3A 2GVJA 3W82A 1R2RA 3VNJA 2DY3A 5IFPA 4IM4A 2V5CA 3VNZA 2JIWA 4UOQA 4AEEA 4M7TA 1ITQA 2GVLA 2WSQA 2D3NA 5D9PA 2YXOA 4OBTA 1P0EA 4HNOA 3PY2A 4PUWA 3WQ8A 3QMRA 1KXTA 3UJRA 3M0XA 2J6VA 4AIBA 4GQQA 4Q8VA 5AC7A 5LIUX 4WY0B 3D3AA 3BC9A 4A29A 3S47A 1PE1A 3P6LA 3GRIA 3GDLA 4HNVA 3A4XA 4UWMA 2FFCA 3DHUA 2OO0A 2BGSA 3NEHA 3TJLA 1DJZA 3CV6A 4DJFC 1BYCA 2VEGA 4A22A 5M5DA 1XD1A 3WNLA 2JEPA 2NZLA 4K3ZA 2E9MA 3NTYA 2A85A 1L6WA 2VZTA 1J96A 5TQLA 4CEXC 2Z29A 5TNVA 3N3MA 3AXIA 1UD5A 2ZICA 3HJEA 3WO8A 4JTUA 4EPEC 4RZ5A 2GVGA 1D8CA 4JTDA 1BWLA 5C2XA 1H41A 1TSIA 4JNZA 4MTVA 5A6JA 1TX2A 3P0WA 3ARPA 2GWNA 1GOMA 2ZXBA 3ZVHB 1TWSA 3UZYA 2PUZA 3NA8A 4H9VA 3GG0A 1OFPA 2XISA 2E8ZA 3LSBA 4WJEA 1ONXA 1KGWA 2JBMA 5DBUA 3OP2A 4RL3A 4XO7A 4KT2A 1FWJC 3E49A 1R9XA 1F74A 2JKPA 4Q8TA 2IKGA 2P0IA 3SFWA 2FPVA 3W38A 2B7OA 5TBOA 2PGEA 2OOGA 2BOEX 3RLGA 3LNMA 3CL7A 3PZQA 1KXHA 1OD0A 1IT8A 1U1HA 3UZ5A 4B3ZA 3TCEA 5LYRA 2VGGA 3C61A 2PDXA 4U2ZA 1ESWA 5K7JA 1UUQA 3DKJA 4AFYA 1GCYA 3HMCA 1XRVA 3R2GA 1HJSA 4ZZ9A 3CHDA 5CZJA 2VX4A 2ZRWA 3NQVA 4PBGA 1TPEA 1ZJAA 1JZ7A 4J28A 2FDSA 4CQBA 3EX3A 1FWFC 1S5VA 4U2YA 5H2ZA 3QV6A 3TUUA 2PDNA 2AKMA 4FS9A 4PE8A 1CGXA 3RHGA 1ADSA 1OWQA 4WY0A 4H6EA 1KFLA 4XBSA 3GH5A 2V67A 2Z28A 3GXDA 3TKFA 1XG4A 2Y1HA 4EAYA 4DBSA 2DPEA 5I03A 2J13A 3CJPA 3A22A 4JTGA 2EPHA 2J8TA 4G8TA 1ZPTA 1P0DA 1GQNA 1ZQ5A 1F7BA 2QPXA 3AYVA 5EMJA 1R3VA 3EKZA 3E3HA 1OFRA 2D2GA 3ZJKA 3IRDA 2PDPA 3LCIA 3PUGA 1Z41A 4J1OA 4M1RA 1YXYA 4FOKA 2ICSA 1G5AA 5XINA 3LMZA 1JCTA 4BQ4A 1H7PA 2VRJA 1VAHA 2ZA3A 3ITLA 2NXHA 1V77A 2NLYA 1B57A 3XIMA 1S3HA 1J01A 5DMYA 3MMDA 4TOQA 3GXPA 3OQEA 1L2QA 2A1YA 1VPYA 4IPLA 3C8NA 1QW8A 1FA2A 3UA4A 1R38A 2PE4A 2FIQA 1TCDA 2VR2A 4MAZA 4O1EA 2CZVA 3GHRA 1MRQA 4JQ2A 4IP7A 4UXDA 2QGHA 3GTHA 3E2RA 5E9XA 1WA3A 3N4EA 3AIRA 3VGBA 3GNPA 2GQAA 3AROA 4S3KA 3WH9A 2PTXA 1XISA 4P7RA 4N9BA 2DZPA 4DJED 2CLPA 3LDVA 4I5RA 3W7JA 3M07A 3N14A 3W88A 4OQVA 3G3DA 5EMLA 1ZALA 1OVDA 2VRKA 4MY9A 4DF1A 5AC4A 3A4WA 2D23A 3BANA 3STEA 5G2WA 1G7UA 4V1XA 5JIPA 2QULA 1HVXA 3N9KA 3APGA 3ES7A 2Y8VA 5JVLA 3I4KA 1VH7A 3K8KA 1MFVA 3MDUA 4NT0A 2O7SA 1OGBA 1EIBA 1W9PA 1HKIA 4GLEA 3UCCA 2P53A 3KBJA 4E8CA 3EMZA 3FAXA 5KETA 1M53A 1TO3A 2FHFA 2OU4A 3H2EA 2EHHA 1JYWA 3UWQA 1B3WA 4AEOA 4K8EA 3WUGA 1S2AA 1K9EA 3UWEA 1E9YB 5FSEC 4GJ1A 3TA6A 1FFRA 3V36A 2C0HA 3TC3A 1PUDA 2PZ0A 2C1GA 4M0XA 3KFTA 4LBSA 2J25A 2Z1XA 3RG6A 4K8GA 4WSJA 3E74A 1DIOA 4KWUA 1H1YA 4GKTA 3GVVA 3KWXA 1Y5XA 3TR2A 4QLKA 4Z17A 2W62A 1KFEA 4PYSA 1BD0A 3GO2A 2CHOA 3O06A 1QW7A 1EP1A 4EF8A 3DERA 3CL6A 1FDYA 3M0VA 1O5XA 4QP0A 1F5ZA 3U2CA 3L2MA 1JXJA 4DYKA 5A6AA 1TKKA 5FF0A 1EP2A 2RUSA 3A64A 3KOXA 1AA1B 2P8BA 4N02A 3LGDA 3VI2A 3WIJA 2TAAA 3T55A 4DJDD 4K7YA 5CPMA 3GTFA 2EKCA 1E6XM 1JRCA 2PDJA 1LWJA 4U31A 4C1KA 1FWBC 5E0FA 2OEKA 2NQHA 3WLMA 2J7DA 2PODA 4UTUA 3S83A 3PG8A 3FJLA 2GJXB 2X1TA 3W83A 4IQLA 2VVNA 3HV8A 4AHOA 4GC3A 4CD5A 1RUSA 3CAKA 1YTKA 1RP8A 4YHGA 3WJYA 1SJBA 2BASA 4BWLC 1FY6A 5HINA 4L1XA 4V28A 3OPSA 2WCAA 1F07A 3R11A 4L5ZA 4PEEA 4K37A 1EOKA 4B4FA 1DYSA 4AVNA 1GT8A 5ECVA 1EA9C 4V15A 3PBYA 3T9PA 3UP8A 4IX2A 1BGGA 1IEVA 3UZWA 5A6SA 2YIHA 3NVTA 2E6DA 3PBWA 2PTWA 4LF1A 3DYPA 3NXLA 4IQEA 1XV8A 1S5WA 3NSMA 1Q6DA 4UQCA 4LSBA 4XBJA 1PZ3A 4CQAA 3ABQA 4HZ8A 4REQA 1V3MA 3BUVA 1OFAA 1OYAA 2XIQA 4WDXA 2DZXA 3LXBA 2YLAA 1JUBA 4IPPA 2EPOA 3GY1A 3PWGA 4NSBA 3W3OA 1PEZA 3KEHA 1E72M 1OX6A 1HUVA 3ZR6A 4AD3A 4HN4A 5CGQA 3IRSA 3VDGA 3S6TA 1UA3A 3CUZA 3NGJA 2DT0A 2DZSA 2WVUA 2IW0A 3WLRA 4FMVA 4J4KA 1EJ7L 3MANA 3FK4A 4HBKA 3RCMA 2WZIA 4OU1A 1M1BA 3B03A 3LQLA 3CYJA 4XAGA 4CU6A 4OGZA 1UJQA 1MEHA 3P81A 4AAJA 3B8VA 2YL6A 3WLJA 2FH8A 4CUCA 2OTDA 1KV5A 4FR1A 4K7VA 1FCUA 1VGAA 3LI1A 5HQLA 2O4MA 1IEWA 3WD4A 2XH4A 1SZNA 2H3DA 3R0DA 1OX4B 3WBWA 1HL8A 2GQ3A 3CZ8A 4YCPA 5LIWX 1ZL1A 3TK7A 1I45A 2REQA 2ZADA 4M6PA 1EIXA 1M01A 1R5YA 1XIBA 3WMLA 1P48A 1VENA 3SBFA 1Z42A 2WO5A 2NQ5A 2BXVA 3CUHA 5DY2A 7REQB 2ZRVA 3LY0A 1CPUA 2E67A 3F4CA 1LG1A 2VZOA 3KCJA 1SJDA 5HATA 4IPNB 2QDDA 1MQQA 1UZ1A 5K3VA 1UWAA 5I2UA 3WLHA 4NYUA 1CX9A 2F6KA 3AO0A 1X7IA 3I6TA 2WMFA 3ARVA 1VRDA 4UCGA 3IV8A 5A6BA 5E70A 1XGEA 4ATDA 1KC7A 2XN1A 1O12A 4IMEA 1UP0A 1PXGA 2PWUA 2PBOA 4OECA 2Q09A 2XVKA 4GWEA 3G1DA 3URBA 5GJPA 1WDDA 1IXNA 3WLTA 4I3GA 5IFTA 3C8FA 1TJRA 3HZ3A 1ZP4A 1O1ZA 1IR1A 2IKHA 3L5LA 4AF0A 5JH1A 4N7QA 4PUNA 1PDYA 2V5LA 5A8PA 5AN7A 4IGMA 5CSYA 2ON3A 3GNOA 1RY0A 4DNHA 1XINA 1I60A 3G1AA 2DEPA 3PAOA 2OVLA 1VCGA 3QKEA 3EKLA 4Q4PA 4XQ6A 4GJJA 1A5NC 3RX3A 1JYVA 1WPCA 2YJQA 5CQ1A 1UPPA 3H7VA 3CQHA 3UU0A 1JZ2A 1HIZA 4RDWA 3CQIA 1HJXA 2HVNA 1K70A 1LL7A 3L0GA 2Y7GA 7A3HA 1F4AA 4G6CA 2VFGA 2XH0A 1CT5A 4LV4A 3NQMA 1WKYA 1MXDA 1ZJIA 3CC1A 2OB3A 2A3LA 4LAUA 3W75A 1ALDA 5AHEA 4PMUA 2E5DA 1OCBA 3TV8A 3PTQA 4X61A 1FDZA 3RGTA 2OXNA 3M16A 3KS5A 3CV2A 4X63A 4XZWA 1KLYA 2QGYA 3PC0A 3U0HA 2J75A 5J04A 3O8AA 3GXMA 4IICA 1YMYA 1R9ZA 2ZFAA 3NM1A 3UY7A 1E9LA 2VQTA 1ME9A 4AX6A 2VFHA 3CQKA 2XFWA 3G1YA 1EJWC 1XRSA 1K8CA 5T9CE 1DQUA 2R1PA 1XRFA 2H90A 4HHPA 4L6DA 4C1NB 1QW9A 2A3BA 1EPXA 2A3AA 1XLAA 4UTHA 4ADTA 3QV8A 1QOQA 4BF5A 1N55A 3NVDA 3Q67A 4EPKA 3MPGA 3VX1A 4PCPA 3F2DA 4XD3A 3L4XA 5HJLA 1XRTA 3PULA 2Y8KA 3POCA 4UFLA 4F40A 1MVYA 1P7TA 1UROA 2ZXQA 3TH6A 2R82A 1N8WA 5K9XA 3ZLHA 1SVDA 3SUSA 1KM2A 3RLHA 4QE5A 3DBNA 3EA1A 5E0KA 3CV7A 4JD4A 3UW6A 1TPDA 2VC6A 4GNVA 4DUWA 2A6LA 2PD5A 5HWMA 1QXLA 1KTNA 3VK5A 4O0ZA 5IRPA 3QSRA 1LF1A 3FY1A 1VBJA 4S3DA 5D2WA 3NZ1A 5L9FA 1OFBA 3LGEA 3LEPA 2WQDA 1YYAA 3STCA 4CD6A 2EJAA 2FGBA 1BRLA 1K4HA 3C52A 3ICJA 1J0KA 4A05A 4AVOA 2NSXA 3NFUA 3BQ6A 4GGBA 1HJVA 1EXBA 3UGRA 4AXNA 1BVZA 3DG3A 3AJXA 2VZVA 4K39A 3WLPA 2XN0A 1GOQA 1QNSA 1JAEA 3WDRA 4AU0A 2AL2B 3V18A 4L64A 4H8NA 3WJSA 4ZGYA 3W22A 2HS8A 2FTWA 4NZFA 2YGYA 3RU8X 3WJXA 4YTSA 2WNNA 3GU9A 1X1ZA 1ONRA 1TMQA 1VEOA 1Q65A 3U6WA 1EOMA 3LLDA 1BF6A 1UOKA 4XAYA 2GOUA 3CBWA 1W1A1 1QMLA 1E4IA 1JNEA 2OLHA 1NELA 1TRDA 3PZMA 4U5IA 4LUTA 2X0YA 4HHLA 2YA2A 4GO8A 4XKYA 5I7GA 5D30A 1K7EA 1JRBA 3N34A 5GJNA 3GFZA 4UQAA 2ESCA 3RR4A 1LT7A 3BL3A 3BLOA 3TYCA 1EA0A 5EPDA 1GTHA 1YX1A 3WQGA 5FL1A 5IBXC 5A6LA 1XBVA 1OF6A 3AALA 3VO0A 4WRHA 4UFJA 2BMBA 2EG6A 4HP5A 4R5EA 3VUSA 1B3XA 5JUVA 4H8UA 5I24A 1DVJA 1N7KA 3BLIA 4NJGA 4CU8A 3MC5A 1VJSA 2WPBA 4ACZA 3WBYA 4OHQA 2V63A 1YXDA 1B30A 2CCRA 3ELFA 3WBAA 5KMYA 4O52A 4RPPA 4PTDA 1KWKA 1FWEC 3O6YX 5BZAA 3BJSA 5I0DA 2H8XA 1VRXA 1E0UA 4B5VA 2ZRYA 1QJWA 2VZUA 3R4IA 5TIMA 4IGHA 3FS2A 4F2BA 1NP2A 4ZXOA 5I6SA 3IIVA 1A5OC 3L9CA 3JU2A 1VFSA 1XIJA 3DEQA 4KETA 4E4FA 2HE8A 5BRPA 3LD5A 5J5RA 1BLIA 4XZBA 4BKNA 1NAL1 3O63A 3NQCA 3O3RA 2G4FA 1TTQA 2YLLA 4JKLA 1XLGA 1XR2A 4NJJA 3A13A 2X1IA 1TELA 4JFUA 2CESA 4E2DA 1YPFA 2HZGA 3UNTA 3RXZA 3R8RA 2QJIA 5AFDA 2C1IA 1A0CA 3TEVA 2YB1A 2POZA 1Q4NX 4YVXA 1YEYA 4UQEA 1DJGA 1V02E 4KERA 2JIEA 4IG2A 2W3ZA 1XXXA 2OFJA 2Y89A 1BKHA 5D9OA 1EO7A 3K46A 4GA8A 4LY4A 3TYBA 3V5FA 5D9MA 4PUMA 2ZZ7A 5DN1A 2FPTA 5LA2A 3NM3A 2V5BA 4JIPA 2OELA 3IARA 1LORA 2CBUA 2GGIA 2X0HA 2PLCA 3MUCA 4QROA 4KCWA 4JGDA 4WJXA 5LA0A 3C0SA 5EMUA 2B7PA 1WDRA 1CLKA 1OGGA 1BAGA 5F1UA 3IAQA 3P84A 1BWKA 3WJZA 2NVDA 1XG3A 2CWXA 2REQB 4CNPA 4KPLA 2Y6ZA 1WP6A 1S2UA 3C2FA 5AYBA 2YBVA 3KS6A 2DFAA 4LW7A 2OLAA 3NPWA 3C86A 1TZ7A 4JPGA 3IGHX 3SRFA 3M64A 3SFKA 3VKAA 4DXXA 3VIIA 1HKJA 3MBDA 4PSRA 4N42A 4JQ1A 5FJIA 4YLWA 1ZLPA 1MO0A 4FX7A 4PGLA 4AY8A 3BLEA 2YW4A 2ZUSA 4HNLA 2ACSA 4FLSA 5GNXA 4QJ5B 5AVHA 1ADOA 5FJTA 4AWEA 1OBAA 3NO5A 4QCEA 4L65A 3VE7A 3WEOA 1ZCCA 2QDEA 1XLDA 3UYCA 3TONA 5CBBA 2ZZ4A 3SUVA 1G69A 3TYAA 2D0GA 7TAAA 1XYCA 1GWJA 4GG9A 3EX6A 3CGTA 3PTKA 3EA2A 1XIFA 3WSUA 1HO4A 3OZOA 4I7VA 3O6DA 4YL2A 2JKEA 2VVSA 1ZBCA 3SDOA 3EDDA 5I23A 2YYTA 2BBFA 4HA3A 1I2OA 2X2GA 3ARZA 3TZFA 2WCGA 4DELA 4B5UA 3AZTA 4K36A 4NNCA 4TX9A 3POHA 1JI2A 3PPGA 2Z0IA 4M19A 2VO5A 3RK8A 3VD3A 2GK1A 1HKKA 2DDXA 3TTYA 1BFNA 1RK5A 3FIGA 3OQ8A 2W0UA 1V08A 2G3NA 1ODUA 3ARRA 3NURA 1OADA 4ORMA 1UD8A 1IZKA 3VIPA 1GORA 3HBLA 1IEIA 3G6MA 3TP4A 4IISA 3GH7A 2A7RA 3TLLA 1FFQA 1PTGA 1YQ2A 1UR1A 2GVEA 3OB8A 4UTIA 3MZNA 2VJXA 1XX1A 4UTJA 3V16A 4I8YA 4B90A 4L1GA 1W5QA 2G96A 3SQLA 2VD9A 4HKPA 1C92A 2QDGA 4CD4A 4UR9A 1FCBA 2VDIA 1PYFA 3WQWA 2NT1A 2FMNA 4XBKA 4DXKA 3N9RA 2ZE3A 2TODA 1RA0A 1XLEA 5E6YA 5FAJA 2H8ZA 1W5MA 1GHSA 2JE8A 4RK8A 2PDKA 2IXVA 5DRCA 1PZ2A 3RM9A 2WVVB 1PHWA 2CKSA 4H9MA 3MI6A 1OGSA 3BSMA 2PI6A 2PLJA 1WDQA 4Y8EA 1UW9A 4S39A 1YW1A 3VD5A 3EDKA 3G1XA 3BAIA 2RDTA 1A5BA 1ZAJA 3QZ6A 4JY9A 5ABEA 4KCVA 3UR7A 2OZ0A 4IWWA 5JH2A 4MKNA 1LM1A 2BODX 3LCWA 2O0TA 5CJMA 3VILA 1JCLA 5T8GA 1R3QA 2ZXAA 3M5VA 3CEPA 3GIQA 4K1GA 4BR1A 1EKOA 3MUAA 4A21A 3VYLA 5A6KA 4ALDA 1LOLA 2VDHA 4DZ5A 1CLXA 5A8MA 1DIEA 3ARUA 3R0KA 2J7EA 3N04A 3VKBA 5HWJA 4LS1A 4H6RA 1EWDA 2D2JA 4RLIA 2GQ9A 4OBSA 4ML9A 4FA3A 4GYPC 1YBQA 2RJHA 3TC6A 5AVNA 4JFSA 1CWYA 4LAKA 4A3UA 4ADSA 4EP8C 5C54A 4LAMA 4PTMA 1OFOA 1P1MA 2WZEA 3KOYA 1OFEA 3C0QA 3M5ZA 3OGSA 1VP5A 1H0GA 2PTYA 3SN0A 1CXHA 3HQPA 4QGCA 1GYNA 5MKGB 4P7OA 4ENLA 1NOUA 4ZQOA 4QRNA 2ZTJA 2DZWA 4JHMA 1LTDA 3NYDA 2GGHA 2VZSA 2F84A 3FA3A 2JALA 1XSJA 4FNSA 5I3GA 1G4TA 4NXSA 4O8RA 4MWAE 4MSSA 3BCDA 1FOBA 1WDSA 3GBDA 1B3VA 3SQSA 1I1WA 1QOXA 1DWIM 1FWTA 1ISYA 1DWJM 4FK9A 1UOZA 4XWUA 4D72A 3AISA 3UWZA 3T0DA 3WH5A 2BVDA 5CSRA 2W4XA 3GB6A 3SSJA 2PGWA 5FEZA 4V27A 5CLTA 1OCJA 1XP3A 5DANA 1A5KC 4FNRA 2CXGA 4D6JA 1B54A 2PDUA 3AYSA 4PB5A 1BHGA 4HD5A 1XYBA 1RSCA 1CGTA 3ORWA 3BG3A 4CNTA 4R7JA 4AWSA 2IUZA 1ISZA 1QDSA 1QFEA 3LPPA 2ZZ3A 3OJGA 2IQDA 3DCPA 1Q6QA 3P5ZA 3QZEA 1D9EA 4LVDA 4UTWA 3EWBX 5HAOA 1W31A 4FI4A 5HOSA 1EYWA 1REQA 4UFKA 4I6VA 1UQZA 4DBWA 1VJIA 1SM9A 2XWEA 4R9OA 1KFKA 1G9HA 3JUGA 5KSWA 3M0MA 2RJGA 3CAVA 4J3ZA 1FVPA 3C4UA 3UG5A 1EHAA 2QIWA 2CWNA 2VR4A 3FNDA 4C6LA 3WQOA 1XLLA 5D04C 4M82A 3OLIA 4WVXA 4IP4A 4IGNA 1OF8A 4F0MA 3G0XA 4FB7A 3N6HA 4ES4A 2D2OA 3QJAA 4LUSB 2L5HA 2R8WA 3MVIA 1LCOA 3B9NA 5DO8A 4NHVA 3VOFA 2GLKA 3UWVA 1EXPA 4HMEA 6XIMA 1AQ0A 3ITXA 2HVMA 4HU0A 4I5XA 3W26A 4CKQA 3H6OA 4PMYA 3WF1A 1PJ9A 2HNEA 3EGJA 3S1XA 5B7YA 5BYWA 3VX0A 2CLEA 3CU2A 3W87A 1TTIA 2F2KA 4RZ4A 4LANA 5GNYA 4JDYA 3W7OA 4LVFA 1C90A 3GR4A 3MKVA 3V4BA 4ERIA 1UD3A 4JAWA 3T1GA 2OGJA 3U8GA 4H1ZA 4C5ZA 2C91A 1XWYA 4HHMA 3L5AA 4XIAA 2HPIA 3VXGA 4JHOA 2XYLA 3GVGA 4AZBA 4XAPA 3GAYA 3GC5A 4WXYA 1EJXC 4JIQA 5CAKA 4WDWA 1C29A 3A9IA 4JEQA 1E6RA 3LV6A 3R25A 4G1NA 4WXZA 3GWQA 3M5YA 4IPJA 3MSRA 2IPFA 4P8UA 2XVNA 3M9YA 2PWVA 2G3FA 4CU7A 3BJTA 4LQ1A 1GGOA 4KWOA 4NZJA 1J0ZA 1UBSA 1RQEA 4CCDA 1F3XA 2BHZA 1YHTA 4A4AA 4MWAC 3G22A 3OU8A 1NDWA 2OZTA 1JFXA 1OC5A 1VFHA 3KUMA 1XH1A 5I3FA 2WHMA 2CLKA 4LOCA 1CW2A 1W9BM 4FNUA 2HSAA 2V5DA 1NWUA 3ZVIA 3CK5A 4KRTA 3T07A 4MM1A 5CPLA 1Q8AA 4IIHA 2ZX9A 3LXCA 1JDFA 1SJCA 4Q4SA 3WNKA 2QQ6A 5F4SA 3E5PA 4AZGA 2G5WA 4AD2A 3QHMA 1WXZA 3NZPA 1MNZA 1V8EA 3UERA 3HF3A 3FKKA 3GR8A 3UCQA 1RQHA 4R88A 3RN6A 1WKFA 4EXBA 2C18A 2XWDA 1W54A 2R94A 3HU7A 3DN5A 2PP3A 1PTAA 1JPIA 1GVYA 1ZSXA 2VFDA 1TPVA 3AJ7A 1AMKA 2DW6A 4B3KA 1X6LA 1H7OA 1RV8A 1SGJA 3WK3A 3LBOA 3WQDA 3DH7A 3HG4A 2OR2A 4PCFA 4UMBA 5PTDA 8XIAA 1JIBA 3W7HA 5A2CA 4AHQA 1HKWA 4JCMA 3W6YA 3W86A 4A3HA 2YW3A 3SSZA 2EG8A 4RW5A 4KKXA 3S1VA 1TFVA 1PDZA 1S39A 2QJMA 5SWUA 1IEXA 4QQUA 4FOJA 4QM1A 4GISA 4ASTA 1JF6A 1S5NA 1VIZA 3N25A 2DT1A 2VELA 4N0RA 4WEVX 4ZO7A 3T2OA 4EE9A 3G2GA 4ZQRA 4QDMA 4FHAA 4G1KA 1O5KA 3FKRA 3B97A 3SECA 1V7AA 5BXRA 1J5SA 1G4EA 4CCCA 1V6VA 1ONEA 3WF4A 1J9YA 5D4YA 4QSFA 3LRMA 4LC6A 3U2ZA 4WKFA 5BNKA 3IK2A 1U33A 1C8YA 3W4RA 1X1OA 5FJRA 3KOWA 1LQ2A 3K4AA 3W1NA 2WJFA 3M0KA 3R5EA 4WGHA 1IXQA 2PTDA 1LRNA 3REQA 1UR0A 4HPHA 3WZ0E 3C2YA 5AYZA 4JFTA 3UG3A 2Q8LA 4YWIA 2Z26A 4FLOA 1YTEA 2J4GA 4UOZA 1H62A 1NQ6A 4W9TA 9RUBA 1QPNA 2J27A 1EB3A 2BG5A 5CC5A 3HTWA 4H01A 5KEZA 1XKYA 3N9SA 1UKOA 3AIVA 5F2LA 5LIYX 5KITA 1S2VA 3W6MA 1PCWA 3S6DA 4KEMA 4B5TA 5HXMA 2ATSA 1K8XA 1XI3A 4NG3A 3PBUA 3IVSA 1X98A 2OSWA 3HQ1A 3R10A 4HZ7A 2GUUA 3H4WA 4GIYA 3BGAA 1UZ4A 3UNDA 1NU5A 4HVXA 3VGDA 3O7UA 2FZ9A 3G6LA 4FOUA 1UG6A 2PF0A 3WEMA 1I0DA 2EPMX 5DELA 3PK7A 4QE1A 2PCQA 4UTMA 2OLSA 4MB5A 4A8IA 4AWTA 4Q8PA 1BVNP 4REQB 5CC7A 1LOSA 4RW3A 2E1DA 2PA6A 1PAMA 3W28A 1WXJA 3SADA 1YLVA 2WVTA 3PBGA 1CXFA 2W61A 3ZT6A 2KAUC 3SB0A 5CPNA 4WDTA 3N3TA 1SR0A 3A24A 2GGEA 3QM3A 1KRCC 4OIFA 4E8GA 1ZCOA 1EBHA 5D2XA 4PODA 1Q3NA 4YU1A 1K77A 3W7KA 2G97A 3H7RA 2QF7A 2DVUA 4UTKA 2GL5A 4R33A 1XIEA 2HMCA 3SUUA 4LVBA 3GVRA 2PFHA 5K9DA 4TVCA 1JGIA 3LHWA 3UXLA 3GXNA 4BWLA 3CIWA 3VNKA 1IXOA 4PMDA 1OC6A 1GVRA 5DRIA 1QNVA 2C15A 7ENLA 5AZ1A 2VX6A 2O9RA 6A3HA 4C6CA 3SZ8A 4A35A 3RM4A 2VFEA 2PDYA 4Q4QA 3U48A 1L8PA 3IJ9A 1OG0A 4NX5A 1FH9A 4HCLA 2OYMA 3STGA 5A8QA 3U3HA 4CNOA 2QZRA 3WNPA 3VU2A 1VIWA 3PM6A 5DQPA 3AOFA 2OQLA 3M6YA 2P76A 3ZYZA 3S1UA 3E2QA 3CQJA 4JTLA 3AS1A 2OKTA 1QCWA 3V7PA 1VYSX 3E2VA 4EXAA 1Q7ZA 2YSWA 4LY8A 4US5D 3P93A 1TRIA 1UMLA 4H8VA 1KKOA 3VM7A 2BVTA 3Q94A 2FHBA 1F6YA 3PTMA 3N6JA 3V5CA 3O0KA 1PZ0A 4UTFA 1Q63A 2NX9A 4IG2B 4ADUA 4PBFA 2GOKA 3GHTA 1K9DA 3EOEA 1RHCA 1A50A 3L4WA 3VIMA 1WOBA 1RALA 2OMAA 5CKSA 2EEXA 2IKIA 4NX0A 5E9AA 4YPJA 1GUVA 1XYFA 3V0TA 3W7DA 1VYPX 4FXRA 2YPIA 4O4WA 3TE9A 1RK6A 4ZR8A 2MUCA 3EPMA 1EEPA 1TPC1 3VIHA 4F2UA 3W74A 2DSVA 2HQAA 2X40A 4KBXA 2J78A 1SPQA 3R12A 4LFYA 3WX7A 3GFXA 3JZEA 3GSMA 2HBXA 3IIPA 3C3NA 4UMAA 3NSNA 4LAZA 4PZVA 2DGAA 3QOKA 1G4SA 3WQEA 1GOKA 1WNOA 4JNYA 5E6ZA 1A53A 1W0MA 4YHEA 2J7BA 3GC2A 3IJLA 2TYSA 3SRKA 3W2MA 2GFTA 5AHIA 1QHOA 4L1WA 1HZYA 3P82A 1W3TA 1ZRQA 1YRRA 3GXTA 1S1PA 1ZBWA 4LNYA 2E4TA 3VFLA 1EJTC 5BMXA 2PSNA 3DG7A 3DECA 1FBAA 4MLJA 4CD7A 3BTNA 4ICCX 1UWQA 2DORA 3NQ6A 1R9YA 1PHQA 4XB3A 4UR8A 1KD0A 1KCLA 4Q22A 4TXEA 4H8HA 3A23A 3RUBL 1GZJA 4GVFA 4B4HA 2A3CA 3LS9A 2VXNA 5D37A 1D3CA 4N6EA 4C5YA 1HXJA 2HK0A 3IGSA 3MMUA 4PTVA 4GUJA 2V2HA 1BPLB 1KGXA 1Y8BA 2R1NA 5M17A 1VS1A 4TMBA 5C9XA 4LNCA 4WOZA 1FHUA 4D6DA 2UWFA 1J0JA 3KCOA 1D3GA 1O95A 3LZ5A 4MADA 4MUPA 3BLPX 1C8VA 1WV2A 3NDZA 4NIRA 2Y4SA 3ARWA 3RF9A 3MBFA 2BXYA 3EKGA 1UPMB 1XF0A 1NDZA 2ACRA 2J7GA 1V6WA 2G0WA 3NGFA 1JQXA 4K2SA 2BY1A 1JFHA 3S2CA 1CXEA 3DFHA 1XPYA 1GK8A 4HJFA 4YYCA 3HMJG 4WSHA 1XLMA 5LNUA 1F3TA 3FW6A 2ISFA 2VEKA 1MW3A 1Y65A 4QHRA 3N4FA 4RNJA 4Y6GA 3PUEA 3CIXA 3ID7A 3L4TA 4DLMA 3QPYA 4GUGA 4I90A 1YPIA 3OZYA 5BXPA 2RGLA 1B3YA 1TIMA 3V35A 3U2OA 3EWXA 8CGTA 4XZIA 2WAGA 4LUIA 4AZCA 3EA3A 3VE9A 2E77A 3BICA 1UH2A 3H2FA 4WJ8A 4JEJA 3MJYA 2YDQA 1TZZA 4LUSA 3BAKA 4XTIA 1TWIA 3WD0A 4LAOA 3BAJA 3GK0A 5F7UA 3MHGA 3S5SA 3LHTA 4Q3MA 3BZJA 5CGMA 4DF2A 2ONEA 3CWNA 4IX0A 2W6RA 1Q6OA 4EPBC 1BQCA 4PMVA 5EMMA 1S5MA 4D6EA 1JI1A 5C5YA 3A12A 1JXKA 1XLHA 1AW2A 5AHLA 1UA7A 3H70A 2FVLA 1Q4WA 2X7WA 2P88A 2INFA 3DC8A 2NX1A 1TREA 1Q5MA 2XJ7A 2WWDA 2QPUA 1QI0A 3TN4A 2OSYA 4BEUA 3BWWA 4DNMA 3WF0A 3L66A 4AIEA 3VNLA 4I8DA 2I57A 4MNLA 4YNGA 4B3LA 4I5UA 4ERAA 4ICMA 3AIWA 1LROA 3GZ3A 1T7LA 1T40A 2IQ0A 1L0PA 3SY1A 5I00A 3GTNA 5G1YA 3SR7A 4OE7A 2WJDA 3OLEA 3QSTA 4BEQA 1F05A 1I1XA 5BWFA 2BWGA 3EYPA 2BXZA 3UA3A 1IHIA 4GVGA 2C79A 4GGHA 1EQPA 3FEQA 3IUDA 1J4EA 3PR2A 3GNNA 4XUYA 3MS8A 3LK6A 2X41A 4R9XA 4WSKA 2ZQ0A 4FNPA 3O0FA 2X8RA 3LCFA 1WQ5A 3GU2A 3VA8A 1JZ8A 1A4LA 4PTWA 2E9LA 4PFHA 4ILSA 3CZLA 1BRLB 1HNYA 3DFNA 3MHUA 2Y5SA 3D46A 3VABA 1G0CA 4CVWA 2O56A 4PEKA 4MY1A 3VOIA 1PIIA 4GBUA 2CITA 2W63A 4WKAA 3PUDA 1W9XA 4PMQA 5D2YA 3VCCA 4WLCA 2W66A 4C60A 4OFCA 9CGTA 2WK2A 1XIIA 3NO1A 4GI4A 2AL2A 2H3BA 3KZPA 3W85A 4HK7A 3WG6A 3F1QA 5LA1A 4GPNA 3CAWA 1M6JA 2W91A 4L9ZA 4DN1A 2EAWA 3TMLA 4GI6A 4GXWA 2B4GA 3R58A 4PB4A 5C2CA 3CAQA 2DVTA 1E0VA 1I8JA 1NF7A 1W3LA 4KS0A 2NV1A 3OYZA 1QVBA 5HMFA 2I14A 2AOSA 3COTA 3KRSA 4LWWA 3AYTA 3G5EA 1V3JA 5I07A 3DUGA 1V0NA 3L68A 4AG0A 2CLOA 2ZC1A 3SAZA 3L4ZA 3G1VA 3JS3A 1A49A 3WLSA 3EWZA 3VKDA 5CBIA 1FHLA 4R7OA 3TXVA 1F73A 2QNEA 3WDQA 1IGWA 5D8WA 2VOTA 4H9YA 3MW7A 4G9PA 5D33A 1LG2A 2B81A 2ZUTA 5D05A 2PTZA 3DI0A 1XHGA 2Z25A 1GJPA 2J24A 3AIUA 4EOUA 4W87A 5JBEA 4S3JA 4HA0A 3UZZA 4JTSA 1HTIA 3AXHA 1DBTA 1C7SA 4NZ1A 2XSAA 1VR6A 1GHRA 4BS0A 3HPAA 4FIRA 1OM0A 1M7OA 4H04A 3UG8A 4ZQPA 4EWJA 1RQBA 5D02A 4IFKB 1IYXA 3WEZA 3GUGA 1TV2A 3BMVA 3DENA 3OGRA 1GZ1A 1XUUA 2VTFA 3QHNA 3CASA 3V75A 2XVLA 4QCFA 2E25A 1HO1A 1GOOA 2INZA 4DYJA 1JZ4A 3VC5A 4QJ4B 2G8ZA 2HDJA 2ACUA 1WE5A 1YTDA 5LNSA 4Z2LA 4FLQA 3LZ3A 1W1PA 1EGVA 2J6XA 2GDQA 1PS9A 3AMDA 4H4IA 2OX1A 4PCTA 5HR6A 3AXKA 1VCFA 1HGYA 4KWSA 1YE6A 1VBGA 3UR8A 2XIMA 4ZB0A 4FAMA 5C7HA 3E0VA 3WLKX 4HSHA 4HYWA 4YJ5A 2Y7EA 1R3RA 3L5MA 4GJIA 4J3UA 1XSIA 2NXGA 3MWCA 4BQ3A 2VGIA 2BSLA 3IWPA 3DFTA 4HSNA 1CIUA 1ZZMA 3VM5A 1FX6A 3HOJA 3E0WA 1VHCA 2VWSA 5DCBA 1BXNA 1J0IA 1JEZA 3MA8A 1UWIA 3OVRA 3TU9A 2FGLA 1F8IA 1XC6A 3MI2A 4ZA0A 4MIMA 2V3DA 4UUIA 1CNVA 2EO7A 3R8GA 4CN4A 4J3SA 2BS9A 2W79A 3S42A 3SCPA 5JXQA 2NUWA 1GJUA 2O55A 3MP3A 1CEOA 1U2YA 4IMCA 1I2QA 2FQIA 1VQTA 4Z0SA 1SZFA 2QT3A 2WYSA 5HULA 1XLBA 1ODZA 4UQDA 5H1WA 4K8HA 1NARA 3VOJA 3A5FA 3CHVA 2QCLA 3J7HA 3OLDA 1KRAC 4W93A 2GJPA 1TYGA 4WUIA 4D1IA 1DL3A 1PX4A 3S1GA 3TZNA 3WQFA 3OZMA 1AH0A 2FVMA 4OV4A 4YN5A 3KP1A 2OEJA 5BU9A 2FFIA 4DRSA 4QAWA 2E0PA 3PN8A 1KRMA 4NQ1A 5C6MA 1R46A 1V3LA 1KM0A 2DJXA 2XZ9A 1AD4A 3ITYA 1R87A 4J2MA 4E38A 3G77A 4J40A 2VGFA 2A79A 3GIYA 3S2MA 1SZGA 3CUXA 3TOPA 4W84A 4GE8A 1VBRA 3ZZ1A 5EMKA 5CBJA 4D6HA 3S2JA 3C2OA 3MUIA 3TJIA 3AS2A 3RDKA 3PPCA 3PVFA 1JDAA 2FZDA 3MCNA 3EPOA 1MFUA 1IT0A 3O6CA 3T78A 4ZTYA 3LG3A 1FQ0A 1QK2A 2A6NA 3SCNA 3NQ7A 1WBJA 3QH2A 1NWSA 3GX9A 3LHUA 3MMWA 2HCVA 3U9IA 3ZS4A 1GOIA 1TV7A 2WBKA 4NASA 1YDOA 3I65A 3DHDA 4LGXA 3CQ0A 4UFIA 1W5PA 1ZBKA 1C93A 2WANA 1SMAA 2FZ8A 3LCGA 4L7ZA 4E2BA 4IMGA 3VZXA 3NO3A 2XM1A 2PF8A 5A8NA 4GK8A 3N15A 1TR1A 1U83A 3OIHA 4HNTA 3C6CA 3FSTA 2QCEA 3LB0A 4DI8A 1AJ0A 1CLVA 5AC8A 5BWAA 3FOKA 3U5UA 3WH6A 3O16A 2HISA 4MOZA 4FF7A 3KX6A 5U4NA 3WQ6A 4XSMA 3TTOA 3G1SA 2V68A 4DUOA 3KRZA 4B5NA 3PZNA 2WMHA 3M0LA 2VCCA 4E0CA 4E4UA 2OT0A 2XFYA 1JCJA 3TWBA 3ALFA 1PKMA 2PRHA 3K30A 1EX1A 5F2MA 3RO6A 3VDBA 3T42A 4ZQMA 5HQMA 2H6RA 1K3UA 2A5HA 1U1UA 1UUOA 1DXIA 5E09A 1TVPA 4GNKB 3LBMA 1Z8AA 2C16A 1DJIA 2NLIA 3QY7A 3LN3A 2GPTA 1W1IE 2J7CA 2WPGA 2XH2A 4MPQA 1NFBA 3IS4A 1OY0A 2ALDA 2VD8A 2XUCA 2Z6IA 3W2LA 1AW5A 1J8VA 4O10A 1YXCA 3N73A 1LLWA 4M24A 3L7RA 4F8XA 1PIFA 4LUYA 4AD0A 3WLNA 3W37A 1UC4A 3G8EA 3GC4A 3UJSA 4UTWC 5HNNA 2GSHA 4JTIA 2VCAA 1ICPA 4HJWA 5EY5A 2OWWA 3T0AA 1IZCA 3EX2A 3ITCA 1OCQA 4RKAA 1SQ7A 2FHCA 3NQDA 3OVPA 3LV5A 4KEUA 1IV8A 2V0TA 3WFLA 2J9XA 4RXFA 1AJ2A 4QG9A 5LXXA 1B9BA 3DOPA 4C6KA 2YKKA 4LYQA 2BV9A 4Y9AA 3OYXA 1VEPA 1C9DA 2FPYA 5AZ0A 4AZCB 3FHAA 3OG3A 1SW0A 1PTDA 1Z44A 3AIEA 1LLZA 1J0YA 1T8XA 2GJXA 1ZB5A 1GKRA 1QU4A 3GDRA 4V2XA 3RAOA 3VIGA 2ZYFA 5MHBA 4FEZA 1TVNA 2AMGA 2CFFA 2GGJA 2YCIX 1A3HA 3TW9A 4P5UA 2O9TA 2XGBA 1BG9A 3W81A 1TG7A 3SCOA 3USBA 4LTSA 2W9MA 2PWHA 3LERA 1FWGC 1MWOA 1BYDA 3EOOA 3UWUA 4CN6A 1E4NA 1QBBA 2E1WA 1OIMA 1TVLA 3SCRA 4Q8OA 4ZO8A 3SCVA 2GJRA 1YDVA 4R53A 4DWSC 3NZRA 3IJQA 4L4PA 3DGBA 4PMNA 1WKDA 4GUIA 1O1HA 4EVZA 4A2RA 2E9BA 4NXKA 4JIHA 4IFKA 3GVWA 4DAFA 4WZHA 1J5TA 1S1RA 1VFLA 2IPJA 2V5KA 3WNMA 3E0LA 4UQ9A 2XTKA 3F2BA 3EAUA 3LCLA 3A3WA 1EDTA 5A5WA 3PWIA 3IPWA 4Y8FA 2WZHA 5M03A 1HKVA 3I7SA 4MJ2A 1VPQA 3QN3A 1R85A 3F5JA 1F3EA 3BCFA 3PP7A 4XKMA 4XD6A 3N2XA 3PNZA 3IEBA 4DBUA 4JTAA 3FXYA 4GZIA 1C91A 5CH9A 3S46A 4X0NA 3UXDA 3MY9A 5IOBA 2ACQA 3NPXA 3ITVA 3P7YA 2IQTA 4K6AA 1YNYA 2YCJA 2A21A 3CUIA 3SCSA 1H7WA 3GDKA 3WQ4A 2ISVA 4GZEA 4S3BA 1KM6A 4LJ3A 3ZR4A 1A5SA 1TV8A 1SSDA 3RJYA 2NWRA 1NDVA 2QR6A 5ECUA 2V30A 1RJPA 3VCRA 3KLKA 4GUFA 4ZXLA 4XG1A 1QPRA 1E6ZA 3GR7A 2UY3A 4US6A 1RH9A 3PJTA 3EZ4A 1XCFA 4HOWA 3FJNA 4E3VA 3WBXA 1VZWA 4MKSA 3KWSA 2AKZA 2XU2A 3M0JA 4J7RA 4EX4A 3F03K 4N9EA 4B92A 1TQXA 1V4YA 2DT3A 3FVDA 5HDRA 3AXXA 1RBAA 3EX1A 4LRTA 1W9UA 3T8LA 2X05A 4F4RA 4PUEA 2G50A 1CCWB 2CBJA 4FXJA 4JYDA 3I7QA 1AK5A 1IXPA 2JKAA 4KEVA 3CYVA 2DZVA 3IVUA 4R85A 1LWHA 1POJA 2HTMA 3TQVA 3VZZA 3ZXWA 3L2LA 3EWCA 1ZBVA 7XIMA 2QUNA 2EG7A 1AQFA 2Z1VA 5AB3A 4IMFA 4AISA 2XG9A 1GKPA 4IXHA 3PJWA 1D3HA 4OVXA 3ITOA 3PBVA 4AY7A 8RUCA 1OK4A 1KLZA 3OHIA 4GO9A 3W7RA 3WENA 4KIRA 4PUJA 2QDHA 4IIGA 4KRZA 3IJDA 4FALA 2YXGA 1A4MA 3LHVA 4FX6M 4M6QA 3R7MA 4W86A 5A94A 2UY5A 3TXZA 4QAIA 1GQLA 3SUTA 4IOTA 4I9JA 1UD6A 1Z9AA 4M56A 4DJFD 6PTDA 2F8QA 4P7LA 9XIMA 3DFYA 2YZ5A 4GACA 2B31A 5FJPA 4BQ2A 3EWDA 3AXMA 5FF4A 3A47A 1MEIA 4NP7A 4O1BA 2C71A 3B8IA 1V6TA 3GNXA 1Q6CA 4LU0A 3AU6A 1LUCB 3BVJA 4PCNA 3A21A 4JIRA 4WF7A 3RPTA 3LGGA 1YDYA 2DZAA 1QAPA 3PPFA 1U5JA 4QS5A 4DPQA 1PV8A 3T2QA 4IJRA 3T4CA 2VX5A 3WL0A 3IGUA 3A5VA 3B0VC 3H23A 2PC8A 3AQUA 3URQA 4MJ4A 2A2IA 2AQVA 4GI8A 1ISVA 2I16A 2ZUMA 2WZMA 1O6IA 1ICSA 3LTPA 3HQNA 4AZ5A 3ZO9A 3QYQA 4FO4A 1D7KA 4CNSA 4IL2A 3N2MA 2CC0A 3P60A 4O54A 4R34A 1RVKA 1F9CA 2PCEA 3T0TA 4GZ7A 3QY8A 3FYOA 2I9EA 1YDNA 5LSMA 4IMAA 3KVMA 5CXPA 2JK2A 2XPKA 3QW4B 3H55A 1XICA 3B9OA 4F48A 2ZOXA 3MZ2A 4QDWA 3AZSA 2DUXA 3D3FA 4RNIA 2WVSA 1W3HA 2AL1A 1L6YA 2R6OA 2GJLA 2J66A 4O0QA 3WH7A 2VCBA 5AC6A 1WX0A 3OVQA 3ZT5A 5D03A 8TIMA 5F4WA 1TMHA 1K02A 4HYVA 1JCMP 2WSYA 4ZMGA 1AL7A 4C6BA 1RD6A 3KVLA 3H2CA 2VKZG 1VD6A 4MYAA 5EMYA 2D0HA 2J9ZA 1HN1A 3GHSA 3R13A 1IIHA 1UCWA 2QVHA 3TLQA 2VL4A 3STPA 3H4XA 3K8MA 1H1ZA 1VBHA 1CXIA 3PZUA 2QYGA 4X2RA 3MKCA 5CC6A 3BE7A 2PPGA 1LRTA 3R79A 3W1AA 2QPSA 1TJ1A 3HG3A 3MU7A 5H91A 1MUWA 2CETA 3AMLA 4FX8A 1CENA 3W1XA 4RDYA 1FP9A 5D2TA 5FF3A 4DWSA 1WB0A 1XDMA 4H2CA 1HL2A 3MUY1 2XSXA 3M0HA 1FTXA 2ZZ6A 4PFMA 3TNOA 1RZMA 3BJFA 3D6NA 1MQPA 4RPQA 4L9XA 4NNBA 4Z1DA 3EDJA 1YIXA 4G56A 4DUXA 3IIZA 1V0KA 5CC3A 3OZPA 2UY4A 3RFAA 2OO6A 4AB4A 2Y61A 4YCOA 4PULA 3QZAA 2OODA 4M80A 4IIEA 3TFCA 2QJNA 2A7NA 1RR2A 4GY7A 1W8GA 3ALGA 4XX6A 3SURA 3RLVA 2Z24A 4CNNA 4Q8WA 3T40A 4CCEA 2EF9A 2BY2A 3OEXA 4DWDA 1O7AA 3RILA 3UYIA 3LU2A 3AS0A 3S4TA 3KTCA 1EL3A 1C8XA 3AHZA 2Q3RA 5DMNA 2HVOA 3DFSA 3FA4A 5A95A 3WD2A 1E9IA 3BGGA 3FFSA 4DLFA 2J8GA 3PG9A 3WDIA 4YMZA 2VFIA 3DYOA 1MW2A 4GCXA 3W27A 3S5NA 2PDMA 3BARA 5HBFA 4MZ1A 5K2ZA 4DIAA 3FV9A 3T09A 2ZXDA 4HN8A 3SUWA 2XGIA 4HK6A 4UNKA 4W89A 2CU0A 4NZCA 4AVFA 1V93A 3WD3A 3HGOA 3ZJ6A 1UWTA 2WCSA 3WN6A 5BRBA 3N2CA 2C6QA 4LBUA 3GXFA 4NVTA 4I9MA 4TR9A 1F4HA 3N2BA 4JTRA 4OJYA 1ONWA 2NV2A 5HK4A 3FAWA 3WL1A 1A5MC 4RNFA 3URAA 3BG9A 2ZA1A 3MDWA 2ADAA 2QW5A 4H83A 1NOWA 1XL9A 1F3WA 2P3ZA 4WOQA 1P0NA 3K1GA 2J7FA 1UR3M 2ATMA 4F9DA 4ZODA 1ITCA 5CSUA 1TV3A 2D73A 4V33A 3CH9A 4ZB2A 2G41A 1KBBA 1DWGM 3DKLA 1PL9A 2QUVA 3Q65A 5FJJA 3AHTA 2O4QA 3OO2A 4EWND 1QPKA 3S2NA 1NH6A 5C9UA 1E5NA 2D3LA 3LPOA 3N17A 4LEFA 1FWHC 1JZ5A 1US2A 4HMNA 4MVAA 4F79A 3VDCA 4ROPA 3CTTA 3QR1A 4ZO6A 3QYSA 4X3ZA 4ZTXA 4MMWA 3UESA 3QLDA 3GVQA 3EB3A 2NQLA 4P8WA 3H12A 3DESA 1XBXA 1OYBA 2XZ7A 3UJFA 3E5BA 1W91A 2ZRZA 3P14A 1NJJA 1R30A 4DY1A 3NZQA 3V0SA 4H41A 1WKEA 3MSYA 3W7CA 2Y5EA 4PMZA 5EFDA 3VMNA 3RX4A 2V6AA 4B15A 3FN9A 4HB7A 3RPDA 4W4QA 3UJEA 5BCAA 5CPSA 1EFZA 4HGXA 1W9VA 4IPIA 2RDXA 2JQXA 3EWUA 1LBMA 4GIEA 4HOXA 4H7CA 4AZHA 2FJUB 3LHZA 4M29A 1TCMA 3TCSA 4OWGA 3GH4A 5C8BB 4URIA 1TV5A 4G7EB 4M51A 2BLEA 3H54A 3ZR5A 1M41A 5FD0A 2WM0A 1Q2RA 1K7XA 1E4MM 4U10A 4CD8A 4O14A 4EXQA 1D7FA 3MVTA 4FZIA 1WAUA 1JVNA 4MHBA 2VT0A 3FYPA 3W73A 1EEXA 4LEQA 2PWFA 4JL1A 4AX7A 2WMIB 3WF2A 2C3ZA 5D32A 2EPNA 1JCYA 2TPSA 1Q66A 4JTQA 5DY3A 4JHZA 3W7GA 3N29A 3U4FA 3MSDA 4YTUA 3I6EA 5D9NA 3ZWTA 2BNJA 3ANUA 1C7TA 5JU6A 1MYRA 4PMXA 4OOUA 3CL8A 1LRQA 3FYYA 1WDWA 1KRBC 3VOGA 3UG4A 2CPUA 4OUEA 3PB0A 3N11A 1ZS2A 3IVTA 3HGSA 3EPNA 4GKLA 4D8LA 1EF2A 4GQGA 1Z3NA 2PP0A 5H6HA 4XVDA 3QR3A 4D6GA 1W56A 4IH3A 4WR3A 1UQYA 5FEPA 1L2UA 2X1SA 4AD1A 1PB0A 1TTJA 1BSIA 4BF9A 1Y0EA 1ECQA 3VDAA 1XJBA 1G7VA 3TTSA 1H7RA 3U5YA 3W7IA 2E7FA 3UFYA 2A3EA 3GDBA 3B0UX 1DWAM 5G4EA 1X7FA 2E68A 4J9JA 2NUXA 1TJ0A 1XYMA 4LB3A 1VJZA 4AYSA 1E51A 1EGMA 1GQIA 5C2GA 3B4YA 1IZJA 3CZKA 4P7NA 2DIJA 1TPH1 4NJHA 5ENLA 1FWWA 3WUEA 4WDUA 5A6TC 2ZVIA 2JF6A 3V1PA 2E3ZA 2WNQA 2X30A 4KFOA 1A80A 1KB3A 1Q7QA 4KCUA 3REQB 1DIDA 3BAWA 4LBRA 4HQVA 4XZMX 4DI9A 2Y8UA 1F6PA 3A4AA 1NVMA 2EJ1A 3B3DA 3AHXA 4POCA 1PZ1A 2OEMA 4ECLA 3TYEA 2QJGA 3FEMA 4FR6A 1KR0A 5DF0A 2WC3A 2XSBA 3BLFA 3KXQA 3MYPA 1KQZA 3L0KA 3NL5A 4B9ZA 2ZZ5A 1R0MA 2G3IA 2OSXA 1K9TA 4AMAA 2V9DA 4Z0JA 3U57A 4UIOA 2WHKA 1QTWA 3S6OA 2WXDM 2VC9A 3WQVA 4UFHA 2ZRXA 1HFBA 3UR2A 3UD6A 2OQHA 1KFBA 3EOSA 3K2GA 3SO7A 4A8LA 3ERPA 4TTUA 2NVAA 1AW1A 4AY1A 4M3PA 3CWOX 4E4PA 4ZFCA 1HKMA 1KQYA 3QVQA 1JD9A 4BI6A 1HP5A 4L4MA 2XM2A 3VNDA 4XAZA 1LQAA 4JTJA 2QV4A 3OODA 4FNTA 1KM3A 4L4LA 4HA4A 3BH4A 1E4LA 3ONCA 1KKRA 1KWGA 3KHJA 1SFLA 2VM8A 2YCKX 4W5UA 2VWTA 3K4WA 1M03A 1X6UA 4A3YA 1ZUAX 5GQBA 2KZHA 2DIKA 4JN7A 3HN3A 3NOYA 4D71A 4HYRA 2H9AB 3OTRA 1U5HA 3AMCA 4Q6XA 1JPKA 1J0HA 5IDIA 4U3CA 4GC4A 2PAJA 3LQGA 5LHEA 1V6XA 4R7WA 1E6PA 4N9CA 5M3WA 2OKOA 1SUXA 5D38A 4U28A 1R7OA 4YTQA 4S3FA 3VFCA 1V03A 3KVKA 4IXXA 3TTEA 8A3HA 2ZC8A 4C1LA 1TMLA 3KZSA 3F7JA 1WUEA 2FH6A 4J35A 3VZYA 3DGRA 2WC4A 4HZ6A 4DJEC 4Q7NA 1A5UA 4M7SA 4D8ZA 1DWFM 1H7XA 2QKFA 4FLRA 3OG2A 4Q4MA 4JTEA 4GQ0A 4HU3A 4NJKA 3M0IA 1GPFA 1RAKA 2QCFA 5BOFA 4O1FA 3PZIA 1US3A 4Q8UA 5FF7A 5A6BD 1V5XA 1JDEA 3WF3A 4JQAA 2OWCA 4H7VA 1KFCA 1HJQA 4PCSA 3SIZA 3K1DA 5LXEA 1B3ZA 4H19A 4KFPA 1TJ2A 3A3HA 3RU6A 3PZ9A 1H5YA 4C6JA 1YNQA 1Z89A 3PPHA 1LDCA 2DH3A 3ABOA 4LYRA 1OABA 3LPGA 4G7EA 4EANA 3W02A 1S46A 1P5BA 5DBTA 3A9BA 3EXRA 3W76A 1HJWA 1PKLA 3S3GA 5HA7A 2NSOA 4F2TA 4IJBA 3W70A 1R3SA 3A4JA 1BKSA 1RA5A 3NSXA 3K4DA 4GNJA 4O28A 3CTLA 2A4AA 2V3EA 2VC7A 4ACYA 1SW3A 1DQWA 6ENLA 4QR6A 4XTDA 3SW6A 3HJZA 5J5DA 2JGYA 2ISDA 3W84A 2EGZA 3L4VA 1Q6RA 1JUKA 4ZO9A 3TX9A 3LCHA 2G3MA 2E6FA 2ZZ2A 4NILA 1OHLA 1C8QA 1M9HA 2WMKA 3UT0A 1BXCA 3HQOA 2C7FA 2DVXA 1XDLA 4PA8A 4UNIA 3OA3A 4S38A 5M2FX 5DCEA 3C2VA 3THUA 2AGKA 4ZOBA 4US5A 2WNZA 1KCXA 3LHYA 1Z48A 1GOXA 2OYKA 1EUAA 3BAXA 3HFTA 4DQWA 4ZE5A 3VKJA 1SSGA 3W7LA 1YBQB 1XBZA 4QFUA 2ZTKA 4Y9NA 2CERA 4UFMA 1JF5A 4GD0A 3PJXA 4LVAA 1RBLA 4JIIX 1JQVA 1ICQA 1WO2A 1YE4A 1QI2A 2GSJA 3TWAA 3GUWA 3MV01 2JGQA 1TQJA 2G4JA 1TZ9A 3S2LA 4JIEA 4MNJA 1IGSA 3WLLA 4GY0A 5I3HA 1LUCA 1R2SA 3NNTA 3ZM8A 3VUPA 1EJUC 1ISXA 4F66A 2V69A 2UZ9A 1E0WA 4CVUA 2CNCA 5HNTA 2BHYA 4GINA 4FSAA 3EOLA 3TN5A 1W1ZA 1MDLA 1H5VA 4LYKA 3G1HA 1WBHA 3DXIA 5J8LA 1B9ZA 1UP2A 1W37A 3NQBA 3R8HA 1RCXB 4DB7A 3OHMB 4JTCA 3SY8A 2XHYA 1EDQA 3WY1A 1LBFA 3E9AA 4ZQCA 4O16A 2R24A 4C90A 1P43A 2OPJA 4DBDA 1LWIA 3RRAA 3PWAA 4JX5A 3G24A 2QCHA 1I75A 2Q71A 4B5SA 3ZOAA 2WSPA 2DQXA 1IIGA 1W1VA 1NIUA 1T8QA 4J3TA 4D6CA 2OT1A 5FJUA 1J2BA 2VFFA 2CLFA 4LF2A 1Q8JA 2X16A 3VGEA 4MAVA 4NI8A 3KOZA 1KCKA 4NKCA 2DT2A 1KFJA 3HFYA 3PZOA 3L23A 5HMDA 1XIGA 2R1MA 4LV9A 1WDPA 3W71A 4Z2JA 3NYZA 3OIXA 1HF6A 2QMKA 4C6FA 2XIJA 4JYFA 1H4PA 3GLCA 1UD4A 1ZNNA 3IK4A 1E1CB 4P8VA 3PZTA 3TIMA 1W5OA 1DJWA 4C6NA 3MO4A 2EPLX 2Z1SA 3E2SA 2HK1A 4TV6A 1M7JA 2BGNE 2Z2UA 3CWHA 2C8NA 3PBMA 3NL2A 1IT7A 4N4QA 5FEWA 1EJSC 1X39A 5I79A 5CEWA 3BK0A 5FEXA 3N2TA 3ZIZA 3Q4DA 3TQ0A 3AIBA 4DXVA 4AH7A 4IF2A 2CXEA 3E96A 4ML4A 2DUAA 3M4HA 3O2LA 3RMEA 4XISA 1KO0A 1RD5A 1KBLA 4F9JA 2ABAA 1B3OA 3TJXA 5LZLA 5EBAA 1OIFA 2BB0A 5AHFA 3NCOA 4JFWA 1W3IA 1H09A 4W8BA 4XO6A 4QDPA 2WHLA 4KW2A 3S5ZA 1DJQA 2YDAA 3MCMA 1M5WA 4MJMA 4OOZA 4DM2A 1XUZA 5T9BG 1FHDA 4O0KA 1A5LC 3LRKA 3PZGA 2PDQA 4NL1A 3VPLA 5I78A 1K1DA 3H53A 1UH3A 1IWPA 1JCNA 3KCLA 5CGTA 3Q45A 3UXAA 1N8FA 5EL1A 5CG0A 2HBVA 1GYMA 3HURA 4DZAA 1UR8A 3ZVHA 1SFSA 1WCGA 1AH3A 3W7PA 3SCUA 3DFPA 1DORA 1JDCA 3IUHA 6TAAA 5LGXA 3KOFA 5KTLA 3M0YA 4Q32A 3V5OA 1CDGA 3B05A 4G7FA 3MI3A 3W7EA 2ANUA 3M47A 1Q6GA 2RAGA 2WOQA 1T96A 2OQYA 4JKKA 2PU0A 2WLYA 3G3MA 3BOXA 1TUFA 1BVWA 3P5YA 4YYFA 4DO4A 4KQNA 4GYKA 5AKQA 1R3TA 3WJWA 2YDRA 1E70M 3O07A 1K4GA 1SYTA 3S9IA 1BSLA 3ZSTA 3QHOA 1CXKA 3S9ZA 2VQUA 1UMYA 3KRBA 1EJVC 2Y0FA 1XGZA 1QATA 5GJMA 3PB2A 3INPA 3CMGA 3OBEA 5BXSA 1FH8A 1A0EA 4NI3A 4TTGA 2PEVA 1XW8A 1OINA 3QQWA 1AH4A 2R91A 3F5LA 1KV8A 1A0DA 1XCXA 4LCRA 3E1F1 1R47A 3UETA 3BOFA 1C3FA 3EMCA 1HVQA 4UMCA 5CPTA 3KM8A 3LPFA 1ITUA 3E0FA 3NEVA 4ZOEA 4HT3A 2YCLB 2J74A 1ZP3A 1XLCA 3G0SA 3ZFHA 4K38A 4XD4A 3NQFA 2ZBTA 1XIMA 2P3EA 1GONA 1IR2A 5HNUA 5F4XA 1SFJA 3WNOA 3CMJA 4QLJA 1Q2SA 3QBUA 1F6KA 3WUBA 4JZ5A 2W27A 1OK6A 3HPZA 2BZNA 3IIXA 3AHVA 2A3HA 2PU1A 3PF3A 4QQ3A 4MFEA 4C7GA 1JPHA 3TAOA 1VYRA 4P7QA 2DZBA 3QFEA 1K7FA 3GDTA 2D0FA 5EA9A 2WKLA 1ENUA 4JS3A 3CH0A 2G95A 2YDSA 1SZRA 1RP9A 1JAKA 1DIKA 1POKA 3BSGA 3QV9A 3L0NA 4XD5A 1MUMA 4M81A 2R14A 1XYZA 3OW1A 4GVIA 1EF3A 1XKJA 4QSHA 2ZX6A 3VTRA 4NRSA 5H8UA 4Q7IA 2VC5A 5CG7A 1OJXA 4O57A 5EFFA 4PC8A 5LNWA 3IIOA 4AWUA 3BV7A 1CGUA 2YA0A 2DW7A 1VLWA 5BOOA 5MF5A 3CPGA 1XSKA 4AXKA 4AC7C 3TYUA 4EF9A 4GUHA 1LJYA 3RJXA 1OCNA 1EYEA 2ZWYA 5I09A 5AOUA 3B9EA 3DIPA 4I7UA 5LGZA 2X1RA 1UWUA 4GABA 4GX9A 2PZNA 1PCKA 5E5CA 1IEQA 1GVFA 2HV5A 1N8IA 4ZB5A 4E6MA 3AMKA 5AYIA 4AD4A 4Z2IA 4Z1BA 4BQ5A 1HGWA 4HTYA 1I2RA 5HUPA 4Z2GA 4C1NA 5CAHA 1GVQA 4TO8A 4S2CA 2CBVA 1G94A 3M46A 4PR4A 3CHCA 1Y7VA 4J27A 3H21A 3QTPA 3MWAA 4BK9A 3IJ7A 4H9ZA 4IFRA 3TYZA 3SM0A 3EWYA 3WELA 2LLEA 1IWAA 5LNRA 3I3DA 2GDVA 1FP8A 3BCJA 4A3RA 4DZIA 2QVNA 1T6MA 1VFOA 4Z42C 1H3GA 2Q8XA 3RNDA 3VMPA 2MANA 3EEGA 3U7VA 3RMJA 2AQOA 3KW3A 3RIKA 2Z1WA 3FX4A 1H60A 3CT7A 4HPXA 3EDFA 5I3DA 1UWSA 3PTDA 3CUFA 1FDJA 3CV1A 1R6WA 3IAPA 3Q37A 4B5XA 4S23A 3HO8A 2Y88A 1QPOA 3GG7A 3THCA 4WD0A 1UIPA 2AMXA 4KGLA 4PL2A 3CHFA 4S1FA 4H3DA 5A3HA 3TQPA 3AU2A 2WJEA 4W7VA 5KZDA 3CLMA 3PFRA 3APYA 3G8RA 3HPFA 4HU8A 1LYXA 4QTGA 4DO7A 2YB4A 3V3WA 3GG8A 3P74A 2WSRA 3E12A 1V3IA 1AFSA 4IGSA 3IGXA 3OA5A 1FH7A 3W23A 2X2YA 1AQMA 2EXOA 1QPQA 4GX8A 5HR7A 4MPKA 4RE3A 4C6MA 1PYMA 2GVYA 2CBIA 3LM7A 3S5OA 3QKZA 3VD9A 3LI0A 1YKWA 4PUUA 3LUTA 5HJYA 3F4VA 1DJXA 3QY6A 3W72A 3A6OA 5JQ9A 1BTMA 4AYGA 1R3WA 4JX6A 5G2IA 4FXSA 1RCQA 3CO8A 1I6NA 1Y5VA 2F6XA 1W1B1 3WMSA 5EB8A 3TR9A 1S38A 3QGVA 4OBRA 1A3XA 1GG0A 2XIBA 2DSUA 2BVYA 4HIBA 3WMCA 1M65A 1QR7A 4HPJA 2PDWA 5AYYA 2B7NA 3QEZA 1JL8A 5FI8A 1LOQA 1X8FA 5BRQA 1BGAA 4ZFMA 1R7AA 2QUTA 2WSKA 4JTFA 2CLLA 1AJZA 4JBRA 2NX3A 1SO5A 6XIAA 3M0ZA 3WFAA 4ZOCA 1XBYA 2O9PA 1EC7A 1XH2A 5HUOA 5CZ0A 2ISSA 3AWOA 2CZDA 1DP0A 2QF8A 1HG3A 4HK5A 1Q13A 4F0RA 2X0SA 5FF2A 3NAVA 4Q7BA 1KFWA 4DJDA 3IACA 2ZE0A 5FACA 4YIWA 3WDHA 4KCTA 3OGVA 3N1AA 4AD5A 2Z1BA 3HV9A 3DYMA 5IM51 4QBXA 3KBMA 1DHKA 4MDPA 3M41A 2VP8A 3TW7A 4XAFA 1BYAA 3EWWA 2YXXA 3I3EA 5TAOA 2Q01A 1XQLA 1V7YA 2GDUA 1W17A 5LHFA 3VGGA 1PIGA 4Z1YA 4KWWA 2I5IA 3DU0A 2HROA 3TW6A 3WFZA 2WQPA 3BW2A 1X97A 4HNNA 3TDFA 3V0UA 1K6AA 2YBTA 1W9DM 1IF2A 1WZKA 1RY8A 1WZAA 5ABTA 1FRBA 1FKXA 3C0LA 3G18A 1F76A 3MUZ1 1GVSA 2WMJA 3EBVA 1I4NA 2E40A 2CW6A 3CB8A 1KBKA 3ATYA 2WC7A 1GW1A 1MDRA 4O13A 5HANA 3S8HA 4HOZA 1RBOB 4Q4KA 2NUYA 4HCDA 3UF9A 2RKXA 1TE1A 3SN1A 3SEPA 4LH8A 2YFOA 1UR9A 3VKCA 1TIWA 2MNRA 1OB0A 1EZ2A 3RPMA 2PURA 2PLMA 4BFAA 4D8AA 6ALDA 5FL0A 1U1JA 4S3AA 2D22A 3L4YA 4DM1A 1HX0A 3H2AA 4GYPA 2PS2A 1UASA 1E43A 3A3XA 3FSUA 3UJ2A 1QWKA 2AAAA 1FWAC 1K8ZA 2RHGA 3B8SA 1VHNA 3IANA 2WHJA 4HA1A 4TMCA 2XGZA 3W7QA 3FDKA 3AUOA 2QHAA 2NT0A 4QJ3B 4GQBA 4QG6A 1UWRA 1KM4A 4MYXA 3BMWA 4KMQA 1FKWA 2GZXA 2PDFA 3BQ5A 3DX5A 3N19B 5JBFA 1MXGA 4C6EA 1MI3A 4K1WA 3D0CA 1DJNA 1Z69A 3PSVA 3D47A 2QJJA 4TIMA 4UBPC 3L2IA 4RV8A 3WH8A 3UZJA 4J3XA 2CLMA 3O05A 2WNWA 4ZENA 1UP3A 3PZVA 4R27A 1YNPA 1TB3A 1J6PA 3T6CA 2ALRA 4DPPA 5FCZA 5C9WA 3UQNA 5CJNA 3ANVA 4P2VA 5RUBA 1IE7C 1F8MA 1R8LA 3RRXA 4ROQA 2BY0A 4H9UA 1RJQA 3VKKA 1XH0A 3W2NA 1MW0A 3ITTA 4DO5A 1KBJA 2ZCGA 4UTTA 5C70A 2Y5JA 4O1DA 3H8AA 3WUFA 1FXQA 1ZENA 3FJ4A 4JXCA 3KL5A 5T26A 3UVIA 4PUDA 5GNZA 1QRQA 3TJ4A 3EXTA 5LNVA 4E2VA 5CZSA 1Y5WA 4MB3A 5G5IA 1GTEA 2C1HA 3DC0A 4KWVA 1NFGA 3QPZA 1H11A 3O1NA 1DJYA 1KNWA 2XINA 1KGUA 3PNUA 4GIAA 1ML1A 1UB3A 1JNDA 1V6YA 5K9CA 4J5NA 1V51A 2DIEA 2I17A 4RZ6A 2ZX8A 3DAQA 2J47A 2QMJA 3LLFA 4RCXA 5DXYA 4N2YA 2ZX5A 4GHRA 3BG5A 4UB9A 3NG3A 4X22A 3ME3A 1VEMA 5A8GA 3UWWA 3VNIA 6TIMA 3CZEA 1G1YA 2BTMA 1R2TA 3GZAA 2H9AA 3TTQA 4E3TA 1E9ZB 3CLWA 1HT6A 4AIUA 1KM1A 3PFMA 2VI0A 3K8LA 2PDHA 3CZGA 2EQDA 1WOAA 1GVEA 1CBGA 2E6YA 1VC4A 1PX8A 5TF0A 3UZXA 2ZRUA 1K8YA 3MB9A 3B8UA 4BI7A 2D24A 2VUYA 4Y96A 4BZYA 1EPVA 4TVUA 3IV3A 3P80A 4FPSA 3W1RA 2BFGA 4V1YA 3C3UA 5AHNA 3VIOA 2V8ZA 4NUWA 3MT1A 4Z1CA 3B06A 4XZ9A 4GBDA 3EX4A 1OG6A 4C6OA 1OX5A 1CZ1A 4JCLA 4ATWA 1PBGA 1W6TA 2OX4A 3NPUA 4M5PA 4JICA 4MF4A 4EACA 4NJIA 3T0BA 2CIPA 4DJFA 1MQRA 4GY1A 3RCNA 1U30A 4PRRA 4JR5A 2YFNA 1EWEA 1ME7A 3FA5A 4GZJA 2YYUA 4QG8A 4Y90A 2PDBA 1FXPA 1WZLA 3H2NA 3G1RA 4LVGA 2DH2A 4X0VA 1Q6EA 4F0LA 3QOMA 2Z27A 4O8AA 3NR0A 3FHQA 3HG2A 1MZHA 1TPUA 3GTXA 5BW6A 1ADDA 4AF0B 4ZE4A 3ABSA 1K9FA 1UKPA 3MUXA 4GCAA 3LM3A 4MZ8A 3T8QA 1CTNA 4NNAA 4U5KA 4JFVA 1RCOB 3H7UA 1DV7A 3CXOA 1JYXA 2WZTA 4LXFA 2V3GA 1ZAIA 4QNEA 3U2EA 1AZ1A 1V3HA 2QV5A 2DP3A 2EPKX 3BV4A 5HPOA 2JF7A 4N9DA 4L9YA 4Q33A 3MP4A 4EPDC 2OGYA 3SCQA 4IFOA 2DZUA 4HMCA 2X42A 1SMDA 4L56A 3JVAA 3O9NA 4ICNA 1JZ6A 1R3YA 2QLYA 1RJRA 1P6BA 2PWEA 3GNDA 3BMXA 2FB3A 2Y62A 1VFMA 1TUXA 1W1TA 4L61A 1S2WA 5FAGA 2WVVA 1S3TC 3LTYA 1PO9A 3MKKA 5MKGA 5I02A 1QOPA 1UIOA 2P1FA 2YL5A 4YWSA 5DMLA 4PTXA 5D2VA 1I9CB 2EKGA 2FKPA 3NQ8A 3OLGA 2QAPA 3PJUA 4F0KA 2GWGA 5KZEA 3TROA 1WYIA 3NQAA 1M68A 1JR1A 2TSYA 1MEWA 3AICA 4RE4A 1NEYA 1ZTVA 1SO4A 4MKVA 2HEJA 2E6AA 3W0KA 2CEQA 3LSCA 1P6CA 2FZNA 4JTHA 4C91A 3WKZA 1BG4A 1XFBA 2Z7GA 4BCEA 2GSEA 3DG6A 4GXPA 1Z32X 2YA1A 4LS0A 2YR1A 3T08A 1A47A 4ZQNA 1GJWA 2PGFA 3NPVA 4WKHA 2OZ3A 3S0CA 3GIPA 3UPWA 2HWGA 2VNCA 5CPQA 6CGTA 4QITA 2WM1A 4D6FA 3KTSA 1DKWA 3W2KA 4JN6A 3BZGA 1FWRA 5G4WA 1MUCA 4YTRA 2YZRA 3IJ6A 2WBGA 3G1FA 4ZVJA 4U33A 4DEFA 2ASHA 4S3GA 5LKYA 4DWSD 3GU1A 1H50A 3RLUA 1NSJA 2V82A 2BP1A 4IT1A 2XIOA 2UY2A 3VD7A 2ABBA 3AI0A 3AUJA 4EK7A 4AMCA 3AMGA 4H00A 1NOFA 3W1MA 1XFCA 1NDYA 4OZOA 5E0CA 1MSSA 3WDPP 2B7QA 2BOFX 3EEZA 3CIVA 3BPWA 1CGYA 1EO5A 4O19A 3TOYA 3L21A 2WWCA 4QX4A 2P0OA 4GYFA 4B2DD 4AEFA 2R1LA 1XGDA 2RFGA 3BGJA 1UH4A 3W25A 5I06A 2BX7A 1GEHA 2C0AA 4AC1X 4UC5A 4Q6JA 4WX2A 3ZQ9A 3W1PA 1C9WA 1QUMA 1SR9A 3FDGA 3B9DA 4XSLA 4UCFA 1GPWA 5C55A 1E15A 1XCWA 4IHCA 2NV9A 1CXLA 1OQFA 1CGVA 1X38A 1XLFA 1J11A 4C7DA 4HSOA 3I7RA 5C9RA 4CGTA 2V38A 4HNCA 4I9TA 3TC7A 1J12A 3DFOA 2DJLA 4HU4A 3PHAA 5TD4A 5FESA 4DO6A 1ZJHA 1OZQA 3M6DA 3H26A 7CGTA 2Y70A 4HPGA 1M7XA 1JGMA 1EUNA 3SGUA 3KDOA 4OKDA 1E56A 2E8YA 1SJAA 2Z6JA 1JJKA 1Q6LA 4IIDA 2C19A 3N2OA 5ABFA 1EC8A 1E55A 3BOLA 1RLCL 3YPIA 3EB2A 1EHNA 4E8DA 1WAWA 2WKGA 8XIMA 1I0BA 4Y9OA 1P4CA 1JDDA 1X1NA 3CPUA 3WQPA 3SI9A 5I3JA 3LTSA 4AZ6A 3H2OA 3SGGA 1MXSA 4H9TA 4ATLA 3LMYA 3NXFA 3ZSSA 4H6QA 4M6UA 4RV3A 4MB1A 1TJPA 4CEUC 2XVPA 4IQJA 3NZGA 2JEQA 1GKQA 4Q4RA 5HPCA 1WZMA 5ABHA 3I6RA 1KA9F 3GYCA 4CNUA 3Q2DA 3AWNA 3BW4A 5EGRA 3C56A 2Z00A 2Z4GA 1VFUA 3OBKA 2ZUVA 3S9YA 3HGRA 1J93A 3CHEA 3N4AA 3QC3A 2J9YA 4I6KA 3NUKA 4OV9A 4AQLA 2R1KA 3M43A 1B31A 1Q7MA 1HJUA 1P6WA 5A8OA 3ES8A 1YPXA 3P62A 5T91A 4MNKA 1H1NA 1H63A 3W1LA 3NOEA 4GMEA 4A8NA 4WIWA 1UR4A 1V6UA 3TQKA 3F5KA 3AAMA 4O1AA 4PSPA 4Y2WA 5CJ5A 2VR5A 3I68A 2WW5A 1PWMA 1R86A 3EB4A 2FYMA 3UXIA 5CCZA 1XC4A 4Y9MA 4PH6A 2GGGA 3HB9A 3N12A 4MGGA 5HNRA 3H2MA 4CQDA 3ABRA 4NZ5A 3M5XA 1GVIA 2IPGA 4DBEA 2ZZ1A 3APTA 1UKTA 3B0YA 3F4DA 3RITA 2FLIA 2NVCA 3F2CA 1WXYA 2PD9A 1LZOA 2PWDA 1PVNA 2Z2BA 1E0TA 4Q8NA 4HMDA 1EH9A 3VIJA 3WYZA 4GOAA 4RE0A 4S2BA 2G37A 3WCZA 1QWGA 4XIMA 3LCXA 5IHRA 1L8NA 4ZL1A 1EJRC 4GYJA 5DT5A 2ZKMX 3WQCA 1UKQA 3NIYA 2D20A 3HPSA 4W8AA 3FXGA 4O50A 3E6EA 1QHPA 3MCOA 2I1OA 3G0UA 1L6GA 3KBWA 4ZBCA 3LXAA 3II1A 3ARQA 1MMFA 4XZLX 3P8IA 2EBNA 3QMTA 3T81A 2I7GA 1US0A 1RVGA 1THFD 4CCZA 1SZEA 1TWZA 3LA4A 2PRLA 2ZDRA 1W3KA 4LYPA 3W00A 2DU2A 1QNQA 5AECA 2XH7A 2PB1A 1Z7AA 3WNNA 4ZSTA 2CLHA 5IDZA 2V2CA 2VEFA 1ME8A 2J7HA 4TVDA 4DZHA 2Q02A 1P7TB 2IS7A 2I5QA 3QGAC 1EC9A 3UVAA 1FHVA 2JFEX 2UV8G 5A2AA 1NTHA 1EZWA 4GI9A 4J3VA 5FKYA 1DQXA 1VKFA 2X1UA 2BDQA 4HPNA 3R1ZA 1E6NA 2CZFA 4QIUA 4C6DA 1ZGDA 1VF8A 2I5GA 5I5RA 2WKJA 2FTPA 1N2VA 2PWGA 4I7WA 3NL6A 2E09A 1PKNA 1G6CA 1AD1A 4NZ3A 3P8JA 5CZTA 1ZY9A 1KTBA 3USZA 1W32A 1DEDA 3SGZA 4HHHA 3HG5A 2PDCA 3RCYA 4KH2A 2IPWA 2FTYA 4UOJA 3N18A 2FDMA 2E5CA 1CB2A 4JQ4A 5JBDA 3R6IA 1QNRA 3TN3A 3B8TA 2I9UA 1XLJA 5A2BA 3UWYA 4O17A 1PWLA 2YX0A 3F4NA 3CS2A 1X96A 4UNLA 2R9RA 2YCEA 3M44A 3P61A 3O6AA 1ECEA 1B1YA 3E0IA 1LLOA 4Z1AA 2QAFA 4Z2HA 4GFIA 3CMFA 4CQCA 1J10A 1T5AA 4LB4A 1O60A 2C14A 1ZFJA 4PN2A 3AS3A 4MLRA 1RPKA 2V5JA 4L6OA 2FB2A 1QO2A 3W29A 1UYQA 4PL1A 4LALA 4DJDC 1V0MA 1MRAA 4O4VA 4E5TA 2HS6A 1CI1A 3W1UA 3GBEA 2Z2AA 4GRSA 2IMRA 5HWNA 4W8LA 5BMWA 1E3XA 3B8DA 3W2JA 3PAJA 2Z7KA 4WGXA 2DSZA 1B2YA 2Y7FA 1TE6A 4DVOA 4NRRA 3TYDA 4GH1A 1KXVA 1GEQA 5M1TA 3SCTA 3MO7A 3KRUA 3S5YA 4TX6A 2PMQA 1E71M 3T44A 1CYGA 2F7FA 3L67A 4BF7A 2ZIDA 1UD2A 3KVJA 4O12A 3BSHA 3URNA 2FJKA 3LOTA 1TWWA 2F2HA 2NWSA 3GKAA 4Q4OA 4RJEA 3TVAA 3VGHA 1UUMA 4BI5A 1BQGA 2E28A 5BU6A 4DHGA 1K6WA 4NAFA 4HZMA 1O66A 1U22A 3DBPA 1NP0A 5G1MA 2PDIA 1DJHA 3THDA 2G3JA 1ITXA 4XK2A 3JR2A 4QE4A 2A7PA 3BDKA 5I3KA 4PTNA 1DPMA 2Q3OA 5IBXA 1OZMA 4MB4A 1UC5A 4QEHA 3QFWA 5C71A 1E5JA 4AIOA 2FZBA 4KIEA 2WMGA 4MUZA 1XQKA 1E6SM 1PPIA 4EIVA 4YXGA 3ARSA 4C65A 3QC0A 4KESA 2IXUA 3UPMA 4H7ZA 3L65A 1W2VA 4J2PA 2XN2A 2XDFA 2YBUA 1B5TA 3EMQA 3PS7A 4N6FA 4YTTA 3BAYA 4AZ7A 1L6FA 4GH3A 3GDMA 3S1WA 2DSKA 4NAEB 4L4OA 4Z08A 4W88A 3KBVA 3KAOA 1RPXA 2CHRA 4XV0A 4O15A 2W67A 2P10A 1TPB1 5HMEA 4KF1A 4RUBA 4IL0A 5CLWA 3HA1A 2WJZA 4X9SA 2O92A 3NQEA