3TZNA

Crystal structure of the yersinia pestis dihydropteroate synthase.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
243
Chain Sequence
SHMHLTARGLTLDLSRPQVMGILNNLDQALQHAQRMLSAGATLIDIGGELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
molecule keywords 7,8-dihydropteroate synthase
molecule tags Transferase
source organism Yersinia pestis
total genus 85
structure length 243
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tznA00
4MWAB 3BOLA 4NHVA 4O1EA 3TZFA 4S3CA 4MWAE 3TR9A 4G9PA 1AD4A 1Q7ZA 2YCKX 2H9AA 3TYAA 3H2OA 1TWZA 3TYCA 1TWWA 4DJDA 3TZNA 3H21A 2Y5JA 3MCNA 2VEFA 4DJED 3TYEA 1Q85A 2DZBA 1AJZA 4NIRA 2DZAA 4S3DA 3NOYA 4O0QA 4NILA 4DJDD 1AJ0A 1TX2A 1F6YA 2YCIX 2H9AB 3K13A 5JQ9A 4DJFC 3H2EA 3H2CA 1Q7MA 1Q8AA 4D8ZA 2YCLA 2BMBA 3TYZA 4MWAC 2YCLB 3MCOA 1Q7QA 2OGYA 2DQWA 4PZVA 2VP8A 1AJ2A 4NL1A 3H24A 3TYBA 1TX0A 2E7FA 3H2MA 3H2FA 3TYDA 4C1NA 1EYEA 2Y0FA 3BOFA 4D8AA 4DAIA 4DJFA 3H26A 4S3AA 3H2NA 3H23A 4D9PA 3MCMA 4MWAA 3TYUA 4DJEC 4DAFA 3H2AA 1AD1A 4DB7A 2YCJA 4S39A 4S3BA 4DJFD 1Q8JA 4S38A 1TWSA 3V5OA 4DJDC 4S23A 2Y5SA 4S3FA 4C1NB 4O1FA 4MWAD 4HB7A 4DJEA 4S3EA 2VEGA 3H22A 4CCZA
chains in the Genus database with same CATH superfamily
1SZRA 3EGJA 2ZVRA 2DIJA 3F7JA 3DI1A 3W76A 3T2OA 4J4KA 3BAJA 5BU6A 4EXQA 3AIRA 4DJED 3RR1A 3L9CA 5FOOA 2UY3A 1E40A 1PYFA 1MMFA 2W62A 4JTDA 5E9XA 3NA8A 1DIKA 1XICA 1X96A 3QC0A 1MNZA 1QNVA 3TW7A 4DJDD 1B9BA 2X1RA 2GSJA 3RLGA 3ZSSA 4LPCA 1GZGA 3EWCA 3I6TA 1ADDA 2FGBA 3MTWA 4HQVA 1RXOB 2C8NA 1LLOA 2QJGA 3ZT6A 3QY8A 2QGYA 3GG7A 1XIEA 3CUIA 1G4TA 1S5VA 3L2LA 1XW8A 1W0MA 4M6PA 2QCGA 4BR1A 3MUY1 3VNMA 3NCOA 2HZGA 1H11A 4XO7A 4RPPA 1DJIA 4KIRA 1GNXA 1EL3A 2YJQA 4GE8A 5CC6A 4NRSA 1JAKA 3HO8A 1BWVA 3EWYA 4RZ6A 3VYLA 2WNZA 2PD5A 2QPUA 5DMYA 2PDMA 1W5OA 3BAXA 1XBVA 4FNPA 1QWGA 1SPQA 3PG9A 1YE4A 4WY0B 3VIHA 4HNCA 3CASA 3OBEA 1MWOA 3LI1A 5C8BB 5E70A 2Q8ZA 2JIEA 1J6PA 4R85A 4H2HA 5A8QA 3P74A 4BQ2A 4FAMA 3NXFA 4CD5A 1QPRA 1GTHA 3TAKA 3O16A 4PUMA 3ENLA 3W7DA 3WD4A 1Y5WA 3JZEA 4F0KA 3G77A 2IQDA 4NZJA 4XAYA 1HX0A 4JCLA 1J0KA 1JYWA 3FFSA 3T2QA 4AD4A 2YCLB 2ZDSA 1UD6A 2OGYA 4UNKA 1OYCA 2YYUA 4WD0A 1XIMA 4D72A 1N8IA 1NF7A 3DEQA 2WNQA 1IIGA 2CBIA 1AD1A 1V51A 3W7LA 2JK2A 5I3HA 5IDIA 1RD5A 2OPJA 1ZRQA 3RMJA 5A6KA 4AH7A 2EJAA 2OELA 3N1AA 3MSDA 4PUDA 3FVMA 4ALDA 1R30A 4HMDA 1FWAC 1C29A 3GC4A 3I10A 2H8XA 3EOSA 1BYDA 2DVTA 1JR1A 3B9DA 3KVKA 1UR1A 1ICPA 2ATSA 1B9ZA 1MYRA 1XH1A 5JBEA 1O7AA 5DY3A 3NQMA 1XXXA 3QC3A 3VO0A 4JTAA 4FLQA 1E6NA 1P0DA 3P3BA 1E51A 2BWGA 5EBAA 2IXUA 1L2UA 1A3XA 3PUDA 1XQKA 1Z3NA 3W83A 2PU1A 4MY9A 1KRCC 4ADSA 3BARA 1V7YA 3LSCA 2V3DA 3URBA 5LXEA 1IGWA 2E28A 3M07A 3W4RA 2BGNE 1SW7A 2HWGA 4V28A 5CSSA 5TAOA 3T0CA 3K1DA 1MNSA 3SY5A 1ITQA 1P5BA 3ABSA 1EBGA 4MZYA 5F2GA 2O7QA 3G22A 1LOSA 5BMWA 2SFPA 3BZGA 3GY1A 1JNDA 2WJDA 3ARSA 3EMZA 3EPNA 1H49A 3IAQA 5CH9A 3RM4A 4PN2A 1FWIC 5TD4A 4UCFA 1EC7A 2QYGA 2CZFA 1YTEA 5T9BG 3TSBA 3B8UA 3LV5A 2XJ7A 1QT1A 4AVFA 2V63A 1WXYA 1WP6A 1FTXA 3SCVA 1NDWA 3CT7A 3ZO9A 1QOXA 2F7FA 4ZFMA 4Z0SA 2Y61A 1XF0A 4JTSA 4LCQA 2J77A 3LM3A 2ICSA 3NL6A 3TROA 4CN1A 5F2MA 2V5CA 3KBVA 4IX2A 2VI0A 1B3VA 3W7MA 3PZOA 5BOEA 3SZ8A 1PWLA 2X41A 1B2YA 1MW1A 2A7NA 5LIUX 5JIWA 4I6KA 1JI1A 2JKEA 4ADUA 4E3VA 3P8IA 2ZUUA 2CZVA 3SRHA 3AXHA 3H55A 3OA5A 1WKEA 3FX4A 3KCJA 1TJ2A 3V35A 3B40A 2OYLA 4HPXA 4MUPA 1A4LA 3OIXA 2TRSA 2GZXA 4PCPA 1PZ0A 3O0KA 5A6MA 4LB3A 3GTFA 2PDLA 3U2CA 3WLMA 4DX3A 3SCOA 4PCNA 4ZQRA 3WDHA 1PHWA 5CZSA 1NY1A 3MDWA 2XSBA 2C15A 4QQUA 4LYQA 3COTA 4UFJA 3DXIA 2FGZA 3H24A 1OVDA 4KEVA 3M47A 4ATLA 3OO2A 4UTIA 5FF7A 4JTQA 1GWJA 3LNMA 2CBVA 4R5EA 3L2IA 2WC4A 3A47A 3PPGA 1CLVA 3CAQA 1TPWA 3FNDA 3GFYA 4L4OA 4JIIX 1OY0A 5HR7A 2OSXA 4GVHA 3HGRA 4RNFA 5FJTA 5HQMA 2ASHA 3BLFA 2ISFA 4L1XA 2PWFA 3WENA 4EWND 1G9HA 3GIQA 4HZ8A 5FF3A 1H4PA 4H4IA 4XZNX 2ZWYA 1PCWA 2Q8LA 1IXNA 2VKZG 4I6VA 1O12A 3STFA 2XN0A 4YTRA 3RLUA 4C6JA 3PN8A 4MADA 2HE5A 1H09A 1TSIA 2VEFA 1ZL1A 4UMCA 3G6MA 1Q6CA 1CXKA 5T8GA 1VJZA 3QV9A 1XS2A 2OTDA 1ICQA 3LMYA 3PPHA 1CCWB 2ZA2A 3MHFA 3PZTA 2DU2A 2CU0A 2Q6ZA 3G1HA 3GX9A 2XSAA 1BTMA 3B8VA 4IGHA 3WJSA 3VMNA 2GWGA 1VFTA 3RR4A 4QQ3A 3MUCA 1VYSX 4TVCA 3LV6A 3LOTA 4KFOA 3OVGA 3PPFA 4IPIA 3M5VA 4N4QA 3T9PA 5HUPA 2IKJA 1WBHA 4ZB2A 1XYBA 2WYSA 2ALDA 3P6LA 2PMQA 1DE5A 1DXFA 3CV1A 3PZMA 2VX4A 1W1A1 2CIPA 2W66A 1L9WA 4FO4A 2E6AA 4AFYA 4X2RA 3EOEA 4V1YA 3T42A 4H7ZA 4MJMA 4DYKA 3GH7A 1OCQA 4KWWA 3TJLA 3NL3A 3LCFA 4IICA 3WBAA 1EBHA 1YNYA 1JGMA 4LALA 1OG6A 1VZWA 1HF6A 1ZSXA 2X1TA 4A2RA 4MJ2A 1M3UA 2X0SA 2YYTA 3B9AA 4PA8A 3E3HA 3AYSA 2VUNA 2WLZA 3G1FA 4TVUA 3LXAA 2QUVA 2ZZ2A 2A5HA 4PL1A 2ZX5A 2UWFA 1RBOB 1EJWC 1PV8A 3O2LA 3NYDA 2NQ5A 4NG3A 3WQEA 1L6YA 4OFCA 1NWUA 3CXOA 1HL2A 4E8DA 1W9BM 1EWEA 4B5NA 3MPGA 3V3WA 2EPMX 4O57A 3GDMA 1YXYA 1Z42A 1Q2SA 4UXDA 4QDMA 3G2GA 2YXXA 3MI3A 1GT8A 3N3MA 3IJ8A 2P76A 4E4UA 3OYZA 1RPXA 3EOLA 1OGSA 4QM1A 1KGUA 1S5TA 3LG3A 3SCPA 3PAJA 1NVMA 3W7NA 4LGXA 2CLPA 2H8ZA 4PBFA 1TWIA 2MNRA 1LQAA 4AZIA 3I3DA 1D7KA 1W3IA 2W0UA 3W1LA 3VM5A 4KGJA 3W3OA 1M5WA 5KZEA 3BMXA 3G0SA 3II1A 3PNZA 5DCBA 1LG2A 4MAZA 2ZICA 4LBRA 3C56A 2EPOA 5C2CA 4PTWA 1P7TB 2BS9A 3E38A 3WD2A 3G1DA 1E55A 1G4EA 3TK7A 3WDRA 1VPQA 3BH4A 1XLCA 4ICMA 3CIWA 3I7QA 4PTMA 4JIPA 3NZRA 3GLCA 4LEFA 1X97A 4WGXA 3TN5A 3VOHA 4OZOA 1VP5A 2HE8A 2ON3A 1R3SA 1CGUA 3OBKA 3IGUA 1K03A 4DY1A 3S2LA 4ADTA 3BMVA 1DJGA 3MA8A 1Q2RA 5CGMA 2CERA 2GVLA 2Z2UA 1IT8A 4LAUA 4XWUA 4HNOA 1B3OA 2TAAA 4UUIA 1PCKA 3M16A 4JZ5A 6TIMA 3NVDA 3QKEA 3VZZA 4DUWA 3PANA 1XLKA 1C90A 2E9MA 3AICA 3GM8A 2BDQA 2PZ0A 1VJIA 3VE7A 3CUJA 4C6DA 3A9BA 2XH7A 4IJBA 3GH4A 4RCXA 4LSBA 4CVWA 2Y5EA 4O15A 3SSJA 3W2JA 4HNLA 1GYMA 4PMUA 3STGA 3MBDA 3U5YA 4AZGA 1OK4A 2XZ9A 1S2VA 2PU0A 4W86A 3DFNA 5AHIA 5D2VA 3WZ0E 4HPJA 4XVDA 1CI1A 3PVFA 1WB0A 3A9IA 3R89A 3WN6A 3LA4A 1I6NA 1HKMA 3VZYA 4I8DA 3ARUA 2RDXA 3UCCA 3S1WA 4UQEA 5DRIA 2G8ZA 2QAFA 1TREA 3OZPA 2J7BA 4GPNA 4GBUA 3N4EA 4GUIA 3GTNA 3OP2A 1G1YA 2P10A 1UOKA 4IPNB 1UR9A 3QGAC 1R3WA 4XAZA 4NU7A 2QCEA 3RX4A 1EP1A 5FSEC 3PULA 4OWGA 3HM7A 1HP4A 2GJXA 3KBSA 2GL5A 1TWZA 3QY6A 5C9WA 4Q8UA 2RKXA 1QHZA 2Y5JA 3G0UA 1ZCOA 3VD3A 3Q94A 1KB3A 3SGZA 2PLJA 3HFYA 4QAIA 1T8QA 2I9UA 3P84A 1TTJA 3GYCA 4L4MA 2BGSA 1PIIA 5IXEA 4YCOA 5EFFA 5CPNA 3KBJA 3TFXA 1VCFA 3TMQA 2FB2A 3DFPA 1TZ7A 4Q4PA 4NUWA 3RYSA 1V3KA 3NURA 5I5RA 6REQA 4DWDA 4DWSA 2GFTA 3BW2A 7REQB 4K8HA 3C0JA 3LZ3A 5A1AA 4WX2A 2WM0A 1FY6A 2Y2WA 5HMEA 1OCNA 4JY9A 1W5QA 1DXEA 3RIKA 1D3GA 2JF7A 3A4AA 1DWAM 4CN4A 3T0BA 3L5MA 4QE4A 4TXEA 3WJWA 1XI3A 3IVUA 3KL3A 1ZAJA 3A4WA 4KERA 2YFOA 1FWTA 1UC4A 1VRXA 3WF3A 1JZ4A 2XDFA 2ZDRA 5HJYA 3N2OA 3PUEA 1BSIA 2Y5SA 2W61A 1Q6DA 1XISA 1O1HA 3JR2A 2Z25A 1G4PA 2XG9A 1XDLA 2R14A 4EF9A 4MAVA 3L12A 1E5NA 2HS8A 5HWNA 3DOPA 4LV4A 4NJHA 5I79A 1JZ5A 3GXDA 2J7CA 1PX3A 2ACUA 1OGBA 1GVQA 1V6VA 3E2VA 3LDVA 3PG8A 1FCBA 2W91A 1DQUA 2VR5A 4IL2A 3VX1A 1BXNA 2NQ9A 1CLKA 4W8BA 2Z6IA 1VGAA 4G7EB 4A3RA 5IRPA 4DQWA 1AFSA 4GK8A 3EX4A 5HA7A 3FK4A 1E4MM 1AL8A 3WK1A 1LBMA 3CS2A 3NQBA 4JAWA 1A4MA 3NUKA 2X42A 1YBQA 1KBKA 3NAVA 3WIJA 4LAMA 3ITOA 1WNOA 3UJRA 2XWDA 1XSKA 2DZUA 1JCXA 3HB9A 1QW7A 3TYDA 3I7RA 3BOFA 3IIVA 3R6IA 5G2WA 4C5ZA 3BVJA 1VFLA 1X7FA 3UY7A 4UMBA 3QW4B 4XG1A 1TVNA 1XPYA 1BWKA 1H5VA 2Z2AA 3DBPA 4NAFA 3GR7A 4OJYA 4R7OA 5CAHA 2Z1KA 1A53A 2C13A 3I3BA 2IXVA 2WSYA 1T7LA 5D32A 2GUBA 1OGGA 4C60A 2ZRYA 4ORMA 1L6SA 3V5OA 2FHCA 4GXPA 4FLOA 4OGZA 3EDJA 3S2CA 4AD5A 2C0AA 1XYAA 4B3ZA 1TJ0A 5D2XA 5T9CE 1T8XA 3ARPA 3YPIA 4GYPA 3TYAA 1XUZA 1ZUAX 1GONA 1GQKA 3EX1A 3OIHA 1UKOA 1Q5MA 1TMLA 3K4WA 4NNBA 1CXHA 1PKMA 1QWKA 3V75A 4EOUA 1BQGA 3AWOA 1GORA 3EWUA 3ITCA 1HJUA 2OYMA 1A3HA 3ITGA 1GZJA 1P0BA 1U83A 4BK9A 4KFNA 1WDSA 3M7WA 2QZRA 2PI6A 3LTSA 4LVBA 4DLFA 3ELFA 3H2EA 1HGYA 1P43A 1V3MA 2Z1XA 1BHGA 3LCGA 2QVHA 3T1GA 1VFMA 4HNVA 1J10A 5E09A 3IIOA 1RVGA 3P14A 3MP3A 3GC2A 8CGTA 4Y8EA 1KM1A 3D3AA 1F3EA 3OZOA 1IT7A 2NUYA 3SSZA 5IHSA 3WH7A 1OFAA 4GNKB 1ONEA 1FCUA 2IQTA 4GWEA 2D2HA 1N8WA 1FHUA 3GNPA 4MIMA 1R9YA 4JIEA 3OW1A 1LZOA 4AYGA 4D6HA 3RLVA 3ZLFA 3EMQA 5DX7A 1TWDA 4ZOBA 3UG4A 2V30A 3WLIA 1RBLA 3FW6A 3KOYA 4DJFD 1X6LA 4RW3A 3G1SA 1VD6A 2V68A 4FOUA 2PDCA 3RUBL 3SI9A 3UG8A 5EFDA 3UZ5A 1IXQA 4U5KA 4PRTA 1JUBA 4KPLA 3CH9A 3FJLA 3LB0A 4Q4SA 2VDHA 1IQ8A 4JTUA 3CL8A 4JHOA 4H19A 1E0TA 1K7FA 1BRLA 1MXGA 2WNNA 3U8GA 4M6QA 3W7PA 1I1XA 4MLRA 1NEYA 2ZUWA 1GQLA 3SUWA 4DWSC 4YYFA 1XD0A 1KC7A 1WPCA 5LSMA 3NPUA 3AMGA 1VFUA 1XLHA 3BLLA 1ISZA 3ABQA 4X3ZA 1JPHA 5CXPA 2VEIA 4QX4A 5FIPA 4X9YA 1JUEA 4IFKB 4LBUA 2FTWA 3GDRA 5A6JA 2YR1A 7TAAA 3DN5A 3I3EA 5CJMA 2QJIA 3OGRA 4CNTA 1KWKA 4LNCA 4NL1A 3C0QA 2D0HA 2YL9A 1DP0A 3UWVA 2ZUNA 4OBRA 2BOGX 5M3WA 2OB3A 3IACA 3A3XA 4R9OA 2HCVA 3GBEA 4V33A 1YHTA 4D6EA 1GVFA 1SZEA 5A2AA 2DSVA 4S1FA 3QQ1A 1OABA 1Q8JA 1REQA 4CD8A 1X8FA 2A21A 2Y7FA 5LHEA 2WMIB 4AMCA 4W5UA 1POJA 3WMCA 2F6KA 1BEUA 3S6DA 1UZDA 3QY7A 3DFTA 4B92A 1KGWA 3Q2DA 4CNUA 2QT3A 3U2ZA 1TWWA 1CWYA 4AZBA 3REQB 1FUYA 1L8NA 4Y96A 3VOFA 3PJXA 4EIVA 3O6DA 1F5ZA 5H91A 4LC6A 4L9YA 1R3VA 4QIUA 4C1KA 1OFDA 4PUEA 2ACQA 2VRQA 1OF6A 2BVYA 3T8QA 1QMLA 1DIOA 4GUJA 2OSWA 3W1MA 4ZR8A 4AWEA 4MFDA 3ANUA 5JBFA 3MBFA 4LS1A 2RDWA 3PJUA 1XFCA 5EMLA 4DYEA 2J9ZA 3CPGA 3RG6A 3CUGA 2YB4A 4IMAA 2TPSA 2EG6A 1EGZA 1CPUA 2VC6A 5ABHA 3RM8A 3SFWA 3UPBA 5AC6A 2ZC8A 3EYPA 1CW2A 3K4AA 4QJ5B 1XL9A 3OPSA 5FF2A 1JZ3A 2D0GA 2ZXQA 4GYPC 4MDOA 2X16A 3N2CA 3R0KA 1J5SA 3PZVA 4IFRA 2OWXA 4Y9AA 3P0XA 1HVXA 3OLIA 4HTYA 1J4EA 1GPFA 4XZBA 4IP7A 3SAZA 4Y2WA 6TAAA 3W27A 1LL4A 3M9YA 1Q63A 3IAPA 4N7QA 2JEQA 2Z0IA 2Y7DA 2X7VA 5EL1A 1A5KC 4E0CA 2VGBA 4HKPA 2BP1A 4LCRA 4M8UA 2W9MA 3EXRA 4IXHA 3H6OA 1DHKA 4I7WA 4IIHA 4MMWA 4PCSA 1XKJA 3GSMA 4JBRA 2VOTA 1Q6EA 1O4UA 1RK6A 4G2DA 1JD9A 2WW5A 1V02E 4IHCA 2QJHA 3CEPA 3K13A 5AZ0A 3GG0A 1O94A 2F8QA 2AOSA 1XH2A 2OGJA 3AUJA 1YDNA 3VCRA 2OZ8A 1E73M 2PCEA 3O0FA 2ACRA 3VD4A 3GUGA 4ACZA 1M7PA 2IS7A 3JU2A 2Y62A 4C65A 4X63A 1I2PA 1KR0A 1YTKA 5LIXX 4D9PA 2DPEA 3VA8A 3ABRA 3PJWA 5AC8A 4REQB 4IX0A 3E02A 3GO2A 3KLLA 3KOFA 3AU6A 2ZZ4A 4RUBA 1TIWA 3HURA 1W1ZA 1LG1A 4TIMA 3RFAA 4KMQA 2CHOA 3B8WA 4DM2A 2XGBA 4GC4A 3R58A 1LCOA 4G9PA 5D9NA 1RK5A 2WKGA 2J62A 2VR2A 2REQB 1W3NA 3UESA 4B3KA 1XJBA 3V1PA 4U5IA 4B3LA 3L5AA 3B4YA 1QI3A 2E40A 3RX2A 3ICJA 1E4NA 2ZZ5A 4D6JA 2EBNA 3NYZA 3A4XA 4JQ4A 4DXVA 2C71A 1FX6A 3EWBX 3G3MA 4L9XA 1K6WA 5J04A 1UKQA 4D8ZA 5MKGA 1PPIA 3SO7A 4F9JA 4GZJA 2Q09A 5EMKA 2R8WA 2CZDA 4HHPA 3PZGA 4R27A 3OTRA 3D3FA 3OYXA 1LP6A 4D8AA 2GSEA 2Y1HA 2V2HA 1WOBA 5HK4A 3ZR4A 4EPDC 4Q8OA 3HG2A 1UJPA 4JNMA 4XVEA 4JR5A 1XLLA 1EGMA 1T40A 5ABFB 4JIRA 4NNAA 3TAOA 4ZQMA 3GVRA 4NAEB 5HDRA 4LWWA 1TCDA 4A8NA 2DSWA 2QUTA 1IV8A 4P7RA 5AECA 3WYZA 3V16A 1BKSA 4JTLA 3WLTA 5CPQA 1TRDA 1EKOA 4E4FA 3LQLA 2ZUVA 1P6WA 4O17A 1CXFA 4Q4OA 3LLFA 4XTIA 2WM1A 2EHHA 3TW9A 4LS2A 4AAJA 4X61A 3CO4A 3NPXA 1W3TA 4OQVA 3L0NA 1UHVA 1HL9A 4P2VA 2HPIA 4JTKA 2PF8A 1UA7A 1UPPA 3HQOA 1XM3A 4PTDA 1Q8AA 3DDMA 3R79A 1G94A 3VGDA 1AQ0A 1DJWA 1H0IA 2DQWA 3GVQA 3GAKA 3NZ1A 4IG2A 2VJXA 1ZBCA 2D2JA 4AIUA 3C86A 5DQPA 4FLSA 3HPFA 4O16A 1PDYA 3B97A 1FDJA 3D5HA 2YLAA 4MG4A 3WY1A 5I00A 2VWSA 1PTDA 2GQ9A 1OFOA 4L56A 4UCGA 4H9XA 3TU9A 3FYPA 4K39A 2PDJA 3QR1A 1LLWA 1VB9A 2NZLA 1OFBA 3KZPA 3A3HA 1RA5A 1NOUA 2NQZA 4UOQA 3W1XA 4PTNA 1BG9A 4B5SA 4GVFA 3VKAA 4ERGA 1Z69A 3CB8A 4B5TA 3MHUA 1M41A 3TZNA 3I6RA 5F4WA 1VLWA 1R86A 4IGSA 4PRWA 3FGCA 4HYRA 2FHBA 5CGQA 3CZ8A 3GVGA 1V3LA 2C1HA 2OWWA 1SZGA 3BJSA 3L4UA 4UFHA 3HJZA 3V5CA 1ENUA 3NG3A 2B7OA 1OC7A 4NXSA 3O6YX 4KWOA 1F74A 2NWRA 1CYGA 2ZIDA 4L6OA 4GY0A 3MVTA 1PUDA 3T05A 2HNHA 1RALA 1E1EA 1CTNA 1QFEA 2EG7A 1SSGA 1XBZA 3TSMA 1H7XA 1E6XM 3C61A 4LQ1A 4RNJA 1SU5A 4IWWA 3O6CA 3AZRA 1YPXA 3W74A 3U2OA 1Z6KA 4MWAA 4AMAA 1FWHC 1KRBC 5AC4A 1AW2A 4H3DA 4JL1A 3WLQA 3HGOA 2AQVA 4OBTA 3VU2A 3LXBA 2QQ6A 4IH3A 2E9BA 3KOXA 4GJIA 4UTTA 4AZ6A 3BUVA 1X1NA 1KRAC 4Q8PA 3EWXA 1N2VA 3I65A 1UQYA 2NQJA 1UWAA 2D1ZA 1V7AA 1ECQA 2PP3A 3IEBA 5KZ6A 3FN9A 3KW3A 1W1IE 1N82A 1I1WA 4BCEA 2PRMA 2XM1A 1GUVA 3UEQA 3VCCA 5I3DA 4F40A 3KTXA 3C8NA 1ZALA 3UXDA 4LAZA 1GOIA 3CLWA 2J7HA 5I78A 3ZVHB 1C92A 3NOYA 4XZMX 4WLCA 4AD0A 4ATWA 2QGHA 1ME8A 1QR7A 3RCYA 3AFBA 3IARA 3VZXA 2VC5A 4RL3A 4OUIA 4AXNA 1M6JA 3NWRA 5BXSA 5JQ9A 4ZBCA 2KX9A 4FOKA 1OX4A 5CZJA 4FF7A 3ISIX 4M81A 1ODZA 1E0VA 4LAKA 2GJRA 3GXNA 3AS0A 3B03A 1H1YA 3WFAA 2YB1A 1H0GA 1C8QA 4WXYA 3LXCA 2PGRA 4MM1A 5AHFA 1TE1A 5TNVA 4GUHA 3SW6A 3T78A 1XIFA 2I5IA 1WUEA 1PAMA 2ZVIA 2XU2A 2V5BA 3NNTA 4PMZA 2OKOA 4TV6A 3MW7A 5LIKX 2R1LA 2E09A 4C6LA 5HNUA 4UQAA 3BW3A 4LUTA 2DW6A 5CGTA 4CCCA 1NDVA 4GOAA 1AA1B 2CWNA 1KGXA 1O66A 1LRTA 2VEGA 1MUWA 3GBDA 4US5A 3VIFA 3FV9A 4H6RA 1GOMA 3SJNA 4AB4A 3AYRA 1RQEA 1KM3A 2BY0A 1EIBA 1OYAA 2DP3A 1VIZA 3TJIA 5D09A 1TZ9A 3UJEA 1R7AA 1S2CA 1Z89A 2G97A 1ZTVA 3AMDA 1R47A 1MEIA 2VGFA 4J9JA 2D22A 1OJXA 2ZZ3A 3QVQA 4AQLA 4BFAA 1EGVA 2DSKA 4FI4A 2O4MA 2PTDA 1T6MA 4YHGA 1H2JA 4K36A 1JEZA 2YX0A 4MGGA 3PUGA 1A5AA 1OCBA 1JF6A 3I4EA 4QG6A 3EDDA 1MQPA 1NFBA 3OZMA 7XIMA 1KM5A 3DI0A 3M0JA 5G1TA 3G24A 3M0YA 2CHRA 4M24A 4PUJA 2C1GA 2GOUA 3W2UA 1CGWA 4I5RA 1PTAA 1S1PA 4C6QA 4F66A 3TN6A 1IWBA 5C6MA 2I1OA 1DXIA 1V6WA 5IDZA 1FWBC 4QNEA 5FA5A 2V5DA 1RUSA 4S3BA 4WSKA 5CCZA 5A8PA 1H1ZA 1XV8A 1VBUA 2PEVA 1TO3A 5DN1A 3H7RA 2C14A 3EPMA 3TQVA 4DN1A 4ZO6A 2XISA 1FWNA 1TVPA 1HKKA 4M6UA 2PP0A 4I8YA 3HIJA 1I75A 3ORWA 3WQ8A 2YKKA 3W26A 2OT1A 3VX0A 1Y7VA 3T09A 3CH0A 1HP5A 3V1HA 3D46A 4DI9A 5LNWA 5CZKA 3QRHA 3W7QA 1HNYA 1XLMA 1YX1A 4A22A 1W5PA 4IF2A 4DEFA 1FQ0A 4GLEA 3TLQA 5HQEA 3HPAA 2A85A 3T40A 4F2UA 2DT0A 3A12A 1PKNA 2GWNA 2BXVA 1TPFA 3BAYA 1I0BA 2HNEA 4MF4A 4MWAC 4QBXA 3N34A 4DYJA 5REQA 3GXTA 4Q33A 3S5YA 3CWOX 1R3TA 4UTTC 2R1MA 1QCWA 3KBWA 4LJ3A 3LENA 2E67A 4PCTA 3OJGA 3UW6A 3UZJA 1Z44A 1W6TA 3PSWA 3BGGA 3KDNA 4JQ2A 1V6UA 1RD6A 3SCSA 4J40A 1NP0A 5DT7A 3WLNA 5K2ZA 9XIMA 4M19A 3B8SA 1K3UA 4JQ3A 2PUZA 2FLIA 1J18A 3AHVA 4L80A 4HNUA 3L65A 3LTPA 2ATMA 1Q6GA 2FQIA 3E0FA 3ZJKA 2NQLA 3I7SA 2I7GA 4QE1A 2VO5A 2V3EA 1J11A 5AYIA 3HV9A 4X0NA 4QTGA 5E93A 3GHSA 4TTUA 3DKLA 2PODA 3ZT5A 5A6TC 2VDIA 4RE4A 1VLIA 3VDCA 4S3DA 2VZUA 4ERAA 2DT1A 4ZEPA 3O05A 3LGGA 1UUMA 3KBMA 3MSGA 3IRSA 1QPKA 1MO0A 1AW5A 1VRDA 5HMDA 2GVYA 1XLBA 4D71A 3L23A 4K1GA 3MV01 4YWIA 1E72M 1AODA 3GZ3A 2R91A 7CGTA 4RJEA 1V6TA 5D33A 4G56A 3SJ3A 1KBJA 2PDYA 5DO8A 3LLDA 1ZENA 2Z27A 2YXGA 2ZZ7A 2ZUSA 4HD5A 2WV8A 3WJXA 1TYGA 1V8EA 3FEQA 3AYVA 3TSDA 3BCDA 3DBNA 1UWIA 2A6NA 4KH2A 5I24A 4V27A 2YA2A 1CECA 4GFIA 4P8XA 4YPJA 2X09A 5A8MA 1EDTA 1K8ZA 3RXZA 2OKTA 3S6TA 2W3ZA 4QLKA 4JTIA 1RP9A 4MPQA 4HK6A 1JDFA 3CL6A 3GIYA 4B9ZA 1FCQA 3M43A 4E6MA 3BAWA 3EMCA 1D8WA 3TEVA 3AIUA 1L6WA 1SGJA 3AIVA 3B0VC 1M9HA 1TJ1A 4CD4A 3LNPA 1TR1A 2G3FA 2BX7A 3TH6A 4M1BA 2IPWA 1ONXA 4NSBA 1UP0A 5FAJA 4ATDA 2Z26A 5M2FX 3AI0A 1EO7A 4CU8A 3RU8X 3WH8A 2J27A 5CPTA 4XQ6A 1FFQA 3PTMA 4PMQA 4QFUA 5GJPA 5G4HC 2XVNA 4KRZA 2XH4A 1V0LA 3MYOA 5L9FA 1NSJA 3LGDA 3CU2A 1IR2A 1XLGA 3NM1A 5C2GA 2ZZ6A 3TWAA 4RPQA 3GHRA 3KCLA 5KINA 3OOQA 2ZUTA 3V0SA 5A2CA 1VEPA 5I23A 2NV9A 3LZ5A 2PURA 4ZXOA 2BG5A 4J35A 2G50A 2V81A 4Q7BA 2HMCA 7PTDA 1QNPA 4GZEA 5GNXA 4IGNA 1DJNA 1HVQA 3BO9A 5C9XA 3WQVA 4GQBA 1QI0A 1TPB1 3T2PA 4XAFA 1NOFA 4J5NA 3KTSA 3M0LA 2DSUA 5E9AA 4MWAE 5DMMA 4FIQA 1EC8A 4FP1A 3VUPA 3IK2A 4ASTA 1M7XA 3NL5A 5AHMA 4HK5A 4L5ZA 3AHZA 1F3TA 1RPKA 2JIWA 4JFSA 2CESA 4N9BA 4JTCA 3P2VA 4CD7A 4GY1A 1UIOA 1I2OA 2G0WA 2NUXA 3SM0A 1B4EA 5GJNA 3E2SA 3AWNA 3ZWTA 2J7EA 3A5FA 1PWMA 1O68A 4GNJA 4GIAA 4N9CA 2ZKMX 3N17A 1UUQA 1QPOA 3R12A 4XISA 1PKYA 3ZJ6A 2NVAA 1Q65A 1MXSA 2UY5A 1X8CA 2ODOA 3LSBA 4UWMA 4DO5A 2B4GA 4PTXA 4UFMA 4HTBA 1MFUA 1OZMA 1XIIA 3ECQA 2PWUA 1ECEA 5ECUA 1UROA 5H2ZA 1EJVC 6REQB 3CV2A 1JPIA 2CYGA 4NJKA 1VBHA 3N6JA 5DBUA 2WJEA 4TX9A 3W88A 1OT1A 1US3A 3P60A 3UWEA 1HXJA 2X2YA 4WZHA 4AWUA 3GNOA 3G5EA 1WDPA 3DCPA 1T0OA 2IPGA 2X1UA 3BJFA 3DFYA 3K30A 3AHYA 4P8UA 5M03A 3WBEA 5D37A 1WAWA 2HJPA 5BRBA 4LTSA 1GPWA 2CFFA 3BW4A 1FHLA 4QE5A 4NI8A 3ZR5A 2DORA 4Q3MA 4HT3A 2W27A 4JYEA 2VEMA 2BVDA 1TV7A 2EEXA 3URAA 4IQLA 3ZIZA 1KXQA 3OU8A 3FHAA 4XBKA 4YTUA 4J3SA 4M7SA 2V69A 4IMDA 5CPMA 2GGJA 3GNDA 1UYQA 2A1YA 2VELA 2BFGA 3E0LA 4J1OA 4EX4A 3BV4A 2XFYA 3FXGA 4QGCA 3WQWA 3SRKA 2I17A 1RCQA 2EPHA 2GK1B 4XD5A 3M64A 1EF3A 1QI5A 5JIPA 2EO7A 2RGLA 4ZOAA 1MDLA 3NQEA 1K8CA 3SFKA 1C93A 3UG3A 1TB3A 4XIAA 3LBCA 5EMUA 2OLAA 2NLYA 3QZ6A 2C19A 4IP5A 1UR3M 3WQCA 4JDYA 3FSUA 1F8MA 3ZZ1A 3RRAA 1UOZA 2V5KA 3QV7A 1OB0A 3LHTA 2ZXBA 2WVVA 1E5JA 3LERA 4DHGA 2INZA 2F6UA 3TN3A 1IXPA 3GD6A 5HJLA 1X6NA 1YNQA 2DEPA 3INPA 5C9ZA 3N6QA 1MEHA 2RDTA 3JS3A 1DIEA 3ANYA 5I6SA 1BFNA 5HPOA 1UBPC 2YCKX 1R6WA 4QS5A 3QMSA 4W87A 2JGYA 4JIQA 5DMNA 4JYDA 5A8NA 4XKYB 3PP7A 4FIRA 1JZ2A 3VC6A 4C6FA 1S5MA 1PX4A 1D2KA 3XIMA 1P0NA 5C9UA 2QKFA 3BSMA 5IM51 1U1HA 3P93A 4FHAA 3LS9A 4W5ZA 5AYYA 5DBTA 4HSOA 3O1NA 4M0XA 2J7FA 4JXCA 2Z1BA 4L64A 4NASA 4HYWA 4M3PA 2XPKA 4MPKA 4ZODA 5G4EA 1GOOA 2XIMA 1M1BA 3N73A 2NVCA 2XSXA 4ZE5A 3MC5A 1W3KA 2FMOA 3S3GA 3LPGA 1TA3A 5KETA 4JQAA 2ZRWA 5FD0A 3GXMA 3WQPA 4WEVX 1I2RA 3UU0A 3CZEA 1A5BA 4F48A 2WHJA 1E6RA 1V0NA 1W2PA 1XSJA 4Y9NA 4JD4A 2PP1A 1G7UA 3LN3A 1G7VA 5D02A 4HPNA 2BZNA 2CWXA 5EMJA 2PWDA 3ZS4A 4EXAA 1TTIA 2R24A 3FKRA 4KCTA 3W70A 4H6QA 3A5VA 4JTTA 3D0CA 2C91A 3C0SA 2FFCA 3VNIA 2ZYFA 4FXJA 4PRRA 4QG8A 1PEZA 1F7BA 2JE8A 1UR4A 5E0CA 3MCNA 4QXIA 2PS2A 4AVNA 3FSTA 3O07A 1F8IA 3MWAA 1KXTA 1TIMA 2CXEA 3W71A 5D2WA 4UQDA 4BF9A 2ABBA 3CAVA 2J24A 3BL3A 1AH4A 1UD8A 3AXIA 4KQNA 2A3LA 4XBJA 3VNKA 4HP5A 1MVYA 3TQ0A 4YS1A 3NPWA 1BRLB 3WMSA 2WANA 5DELA 4IMGA 4ZVJA 2YCLA 1NDZA 3FKKA 1P1XA 2DT2A 3AXXA 3IIPA 1EZ2A 3ARYA 2J6VA 1H7RA 4CQ9A 1ZHAA 3MP5A 3CZJA 3GE7A 3W24A 1XIJA 3AU2A 1A49A 1Q6QA 1VYRA 4H9ZA 2DQXA 3E74A 4PEEA 4OE7A 4RLIA 1PL9A 4WSHA 4MB4A 2PTYA 2WZTA 5BROA 2PE4A 1EEXA 4OKDA 3W37A 2WKJA 4XZLX 4XAGA 3L4TA 4RNIA 5KTLA 2QJMA 3LM7A 1AZ2A 2OR2A 5LYRA 4UFKA 4IUGA 2VRJA 1YYAA 3PZIA 1ISWA 2J6XA 1TQXA 3NFUA 3TC3A 3STPA 3ATZA 5A6LA 5LIWX 3U6WA 2GUYA 3W29A 2YSWA 4MB5A 3UY8A 1REQB 5CSYA 1F3XA 4PBGA 2XM2A 1V5XA 3AMKA 2YBUA 3W28A 3E49A 1XCWA 1F6PA 1EHAA 2YDQA 5AYBA 5I77A 3UBPC 1EJ7L 2FJUB 2D3NA 4OECA 1HKJA 2ZADA 3AQUA 5HBFA 3NO3A 4MJ4A 4F2TA 4OTKA 3W1NA 2OEMA 3F4VA 1RP8A 5FACA 4LUJA 3VVGA 1LUCB 1BGGA 3HMJG 1KLYA 3R0DA 1TKKA 2J8GA 4KRUA 4LANA 3WSUA 5I03A 3QEZA 4LVAA 3F2DA 4RV3A 4D8LA 3NXLA 3RLHA 2VVNA 1GOQA 3IJDA 3FIGA 3LHZA 2VP8A 2ZE3A 3WELA 4I90A 3UP8A 3SCTA 3UNTA 1W54A 3SCRA 4C1LA 1BGAA 3GB6A 3CEUA 3S8HA 1QVBA 1FH9A 1MQQA 5GNYA 4GH3A 2D2GA 2IKHA 2WMHA 1IEQA 3SCNA 3UG5A 5BYWA 3N18A 2F9RA 1W2VA 4JFWA 4UOZA 4EF8A 4GA8A 4WOQA 1JGIA 2NX9A 4FX7A 4BJHA 2DSZA 3WH6A 3I4KA 1WBJA 3VOIA 1OZQA 1QNOA 1FWRA 1P48A 4AHOA 3SQSA 5C9RA 1HIZA 4YHEA 4FF5A 4FNQA 4FX8A 4B4HA 1TMQA 3MU7A 4P8VA 4F8XA 2FVKA 3EZ4A 3W7IA 3EX3A 4GD0A 4YVXA 1GW1A 2ACSA 5CJNA 4UTKA 1AMKA 3FLUA 2QCNA 1EPXA 1EH9A 3FYOA 3IIXA 2VZTA 3S83A 2O9RA 4F0MA 4GQ0A 3MT1A 1LROA 1LOLA 3RNDA 4IMFA 1F6KA 3L0KA 3WG6A 2P88A 3E2QA 3ARRA 2Z1WA 3FJNA 4JIHA 3W01A 1JYXA 2Z00A 1J01A 2IKGA 3M6YA 2CKRA 3W07A 2VYOA 4DZAA 2ZRZA 3LCLA 1CGTA 1ZAHA 2NSOA 1JRBA 1V3JA 4E4PA 1Q4NX 2XVKA 3T4WA 4KF1A 2A3AA 4MNMA 4LY8A 3B06A 1BVNP 1UH2A 2WZMA 4LC8A 2VOMA 1L2QA 1UD3A 4TTGA 1PS9A 1PB0A 4YIWA 4CCZA 4NZ5A 3AIBA 2CLIA 1GKPA 5ABTA 3OGVA 5CC7A 3K46A 3TR9A 4PMVA 2OVLA 3WK0A 3LHYA 1ITXA 3VOGA 4B5WA 1JDCA 1DWJM 3TC7A 3WDIA 4ZQOA 2OOFA 3BQ5A 3FAXA 4W8LA 3VD7A 4J2MA 1LTDA 1DJXA 1FDZA 2P3ZA 1RQHA 4KWVA 1QW8A 5I09A 1Y65A 1JIBA 3W7RA 2R94A 3BG5A 3BLEA 2E9LA 1ZGDA 2WSQA 2Z7KA 4DZ5A 4TO8A 1PDZA 4LYPA 4WHBA 1F73A 5J5RA 4IPLA 1K77A 1ZNNA 2EAWA 1FWFC 1XYFA 3EAUA 3RO6A 3GIPA 3DERA 2PF0A 3L4WA 3UYIA 4L6HA 3C4UA 4DBSA 1JD7A 2HVNA 5A6SA 1OIFA 4GI8A 4EACA 1ZJBA 4JEQA 1OFPA 2AL2A 2FZNA 5JH1A 3QTPA 3C52A 5MKGB 4FPSA 1A5MC 2ISSA 3DHFA 4G1NA 1BYAA 3GVWA 5D2TA 5FL0A 1WKDA 1I60A 5DT5A 3HOJA 4CU7A 1XD1A 4S23A 1A5SA 3DIPA 5CBJA 4J27A 3VPLA 1PIGA 4YJ5A 3VE9A 3SGGA 4Q8TA 3F5LA 4NJGA 1JPKA 3W84A 2WWDA 2DUZA 4S3CA 4IPJA 2QV5A 3KE0A 4MUZA 4E38A 4D1JA 4FEZA 4I3GA 4S3JA 1AQMA 3FYYA 3HN3A 2P8CA 3L21A 8TIMA 4MOZA 5HULA 4GABA 2QCDB 2NT1A 3OLGA 4UZUA 2TYSA 4IIEA 5DF0A 4JOMA 3C0LA 4NZCA 2ZOXA 2J88A 2QR6A 4ML9A 4QCEA 5CSRA 4US6A 9CGTA 4EPBC 3BLKA 2WPGA 2Q3OA 3NZPA 5C71A 1E1CB 1W1TA 1Q13A 3AAMA 4RE2A 3KL5A 4XZWA 2G41A 2DJXA 1UMYA 3R0UA 1M7JA 3QOMA 3GKAA 4TUFA 4K1WA 1AJ2A 4CCDA 1W3LA 2UY2A 3SQMA 2PGEA 1P7TA 4XX6A 3UWZA 1XX1A 4QP0A 2EPLX 4HBKA 4XUGA 1O95A 3GQYA 1QOPA 3DESA 1PYMA 4E2DA 3CUXA 3WLSA 4H9MA 1NWSA 3U2EA 3WUBA 2BY1A 4RDYA 3VC5A 2JEPA 3K1GA 1ISVA 3CO8A 4I9JA 5CLTA 2JGQA 4O1FA 2NXIA 1XIBA 4S3EA 2DH3A 3NSMA 3R4IA 4YVVA 3H70A 4GIRA 1DKWA 5FJRA 1ONWA 8A3HA 3H54A 2QVNA 4O19A 3W25A 1FHDA 2XGIA 1KCKA 4I9MA 5CEWA 3K5XA 3WUEA 4PH6A 4XKMA 1TCMA 3S9ZA 3WKZA 3N25A 3CTTA 1LOQA 3NO1A 3KRBA 3WD1A 1IWAA 3LMZA 3VXGA 4K38A 4AW7A 3U0HA 3IJ9A 1PZ1A 1UASA 1UZ4A 3ITXA 4O50A 4GHRA 3WO8A 4GBDA 3BOXA 4LXFA 3BLDA 3MP4A 4XUYA 3IJ6A 3HQPA 5ABEA 3AS2A 4O1BA 4E5TA 4ZL1A 2CKSA 4PZVA 1KTBA 1OINA 2EF9A 2QV4A 3G8RA 1CENA 1FRBA 3WNMA 3AMLA 3H2NA 3LI0A 8XIMA 5IFTA 3UXAA 4E8GA 4L61A 3V4BA 4UNLA 4W89A 3LCHA 1GVYA 1C9DA 4XZHA 3C6CA 4D6DA 1IEXA 4JN7A 3H12A 2VR4A 3TTYA 1OM0A 4K8GA 4F0LA 3KHJA 3EOOA 4IMCA 4MWAD 3PHAA 4AZHA 3P5YA 3NJ3A 1FWSA 4N02A 1HL8A 1PJ9A 1ICSA 4JFUA 4MWAB 5GPRA 1ME7A 4DUXA 3AHTA 2HXTA 4UB9A 2O7SA 1S1RA 4DF0A 3IGXA 4YN5A 3G1VA 4QJ3B 1I9CB 4GQQA 1Y8BA 3MYPA 3NR0A 3WDJA 1TV4A 3TC6A 1AQFA 3N2MA 3KRZA 2VT0A 1ZZMA 4KW2A 3LBOA 4KGLA 1R8LA 4FR1A 4W93A 1NQ6A 2I5GA 3UCQA 4YL2A 4TX6A 4RZBA 1WZMA 2ZRUA 2NSXA 4AYSA 1BVWA 1NWTA 2CHNA 1JULA 2XH0A 3PWIA 2PWVA 1D3CA 3VDAA 7REQA 5J5DA 4HU0A 2G3JA 3CK5A 4KCVA 3O63A 2BTMA 3QZEA 1CDGA 1OHLA 3QYSA 4DO7A 6XIAA 1FWEC 2P53A 3MZ2A 4BI6A 2EJ1A 1HKWA 4DUVA 4IPPA 1OX4B 3THAA 3BV7A 2WBKA 3AROA 4ORIA 4O1CA 1HO4A 2VRKA 3U9IA 4MLJA 1XG3A 4CUCA 1N8FA 1KLZA 1O5RA 5EB8A 2XHYA 2RDUA 3PAOA 4EK7A 4FNUA 3WK3A 1KFJA 4CNPA 4POCA 1ZP3A 5CPSA 3W1AA 4M7TA 2AGKA 3SADA 2R1PA 1EA0A 1J0ZA 3L4XA 4CCEA 4RNHA 1J93A 4H6KA 1JF5A 2PLMA 4LOCA 1FWJC 4W9TA 5A8OA 1H7WA 3FA4A 2NX3A 2V6AA 3ALGA 2FMNA 1X98A 4H8NA 3KWSA 1Z48A 1K7EA 4WSJA 3ZWSA 8XIAA 4US5D 1VBRA 3PUOA 2YBTA 2XIOA 4W7VA 2J13A 2WO5A 2J7GA 4KKXA 2GGEA 5E0KA 4GCXA 4WRHA 3WEZA 1VAHA 2J47A 3TFCA 1LJYA 1TX2A 4H6EA 1OADA 1DE6A 4HU4A 1L0PA 4LT9A 2PLCA 3QLLA 4GRSA 4HYVA 2F6XA 1Q7QA 4IT1A 4MVAA 3L2MA 2F2HA 4TOQA 3MJMA 3ZJ7A 3RILA 4H9VA 5D30A 1EYEA 4JDBA 5BOOA 4W88A 3EXSA 1QASA 3GTHA 1UR0A 1EA9C 1EJXC 3LCIA 3C3NA 1QK2A 2UBPC 1QPQA 4JNYA 4IQJA 3VILA 5EMMA 2DVXA 1EF2A 4IOTA 4R33A 4C6CA 3AXMA 4PSRA 1TMHA 4RZ5A 1LWHA 4NVTA 3TV8A 4AIEA 4QAWA 1B3WA 3QH2A 3VKDA 4W8AA 4GACA 5CSUA 1NH6A 2PA6A 1SZFA 1TQJA 4QEEA 1JJKA 1EO5A 4PMXA 3PJTA 1J0YA 4WKAA 1SSDA 1VEMA 3IJIA 1E9IA 3NQFA 5GJMA 1AK5A 3IWPA 4GGHA 2PDNA 2PBOA 1VH7A 4Z0JA 2J79A 3KAOA 3WDQA 1UWSA 2BBFA 2YDSA 2DT3A 3AIQA 2D24A 3N29A 2JQXA 1W1B1 1MRQA 4LUSB 4D6FA 4MKNA 3LPOA 1F6YA 4HNTA 3VINA 4CU6A 1XC6A 3ZLHA 2GVJA 2HVOA 4ZB5A 4EXBA 2X1SA 2ZBTA 4M56A 3MMDA 3MWCA 3M0MA 1B1YA 1HW6A 3WEOA 2Z2BA 4O13A 1MFVA 3MCMA 3FCPA 1DJYA 2R9RA 2Z6JA 1P6CA 3IPWA 4U33A 2YA1A 3W82A 3E0WA 2VZOA 3WCZA 3IRDA 1R0MA 2Q3RA 2E3ZA 3RGTA 4Y9PA 4HN8A 4FZIA 3WLPA 2WXDM 1BLIA 3CGTA 3PZNA 2WVSA 3UJSA 4YTTA 3OHMB 3SCUA 2CCRA 1P4CA 5GVJA 1Z32X 3KTCA 1E9YB 3R8GA 2INFA 3BQ6A 1QUMA 4M51A 2HEJA 2Y70A 3L7RA 2WSKA 5H8MA 2X2GA 3QR0A 3S1VA 1NOWA 1VQTA 2DZTA 4HPGA 3FDGA 2B7PA 4YYCA 5LNSA 4JL2A 3AS1A 1FOBA 3CUZA 1FBAA 4UFIA 2WNWA 1E6SM 2ESCA 3WUFA 3CYJA 2QCFA 1KO0A 3ATYA 3W53A 1HKIA 5BXRA 6XIMA 4W84A 1IR1A 4FA3A 1K9EA 2VCCA 4EANA 3MI2A 1UUOA 2CLHA 4JFTA 3HA1A 1YEYA 2FIQA 2RFGA 2HDJA 3QBUA 3HPSA 3IVSA 4J3UA 4TU1A 1LT7A 1VPYA 2A6LA 1GQNA 2A0NA 3WK2A 4DBWA 1A0DA 3N2BA 3H2FA 4WIWA 4JNZA 1V3IA 5F2IA 4AWTA 3APTA 4UQCA 2E6YA 4EE9A 3LHWA 4DB7A 4LW7A 2BHYA 4GJ1A 4U2YA 3S1XA 2CXGA 1V3HA 2GDUA 1SZNA 2EG8A 2WMFA 3M1ZA 3TONA 4H9TA 1FH8A 1XFBA 4ZCWA 3N2XA 2VCAA 4AZ5A 1CX9A 3S6OA 3W6YA 3QFWA 3F03K 3MVIA 4C7GA 2PGFA 3VIGA 4X2PA 3Q67A 3B0UX 3VK5A 1GVIA 2Q02A 1QDSA 3MSRA 3WJYA 4PC8A 1F4AA 1TPC1 4E2BA 1E6ZA 4EWJA 3VNJA 3BGJA 3TTEA 4CNOA 2GDQA 5PTDA 1EX5A 4F0SA 3GUWA 1I2NA 1GOKA 3KWXA 5FCZA 2FZ9A 2A2IA 5F1UA 3VABA 4F0HA 2H3DA 4XAPA 2YCEA 4ZGYA 3EXTA 3ZM8A 3QM3A 5AY7A 2ZE0A 4JKKA 2BXZA 3OA3A 2V38A 2UZ9A 3L66A 2OX4A 2PBGA 3LYEA 3WQ4A 4LH8A 1G67A 3KEHA 4OBSA 4JX6A 2ZRVA 1BF2A 3ARQA 2A3CA 2VZSA 4PFHA 2W6RA 1DWFM 3PB2A 1LL6A 1YDVA 3TTOA 1J12A 3ALFA 4DNMA 3QPEA 3F4WA 5I0DA 1I8JA 4LX4A 2PSNA 3M0ZA 3TKFA 2YCJA 1ZY9A 5BXTA 1SFLA 4Z2JA 1HT6A 3VGEA 2QCCA 3QPYA 3DFSA 3ZSTA 2BLEA 2ISDA 4K7VA 2AMXA 1EYWA 4AF0B 2IPJA 2POZA 3P5ZA 2XIQA 1EDQA 1GQJA 4L4LA 2JKPA 1W1VA 3GYEA 4HA4A 4J3TA 4R88A 4OOUA 1EDGA 4FNRA 3UQNA 3EDFA 5HOSA 1XKYA 1FVPA 5E6YA 1B3XA 4WJ8A 1BVZA 3CMJA 1L8PA 2PDIA 5I07A 4MJZA 1UH3A 5HR6A 4PUWA 4V2XA 3W7CA 3E2RA 3ARVA 3A3WA 1R2SA 4O0KA 4EAYA 3TVAA 1FWGC 3GDBA 3PM6A 4GYJA 2QULA 2VM8A 3B0XA 5K3VA 1NJJA 4MDPA 3QR3A 4UIOA 4PB4A 1M7OA 4HSHA 2WKLA 1S3TC 1SW0A 4FMVA 1SUXA 3QXBA 4IQEA 1AVAA 1E0XA 3TYBA 4QDPA 4C7FA 4QDWA 3S5OA 1EP3A 1KTCA 2J25A 3W1PA 1R3YA 4HVXA 3GG1A 5J8LA 2VX6A 3T4CA 5FJJA 1U1UA 3B8IA 3QQ0A 2NLIA 1O5KA 1RCOB 3AJXA 3TYUA 1W8GA 1KM2A 1UKSA 4UC5A 2PDFA 1RBAA 4N2YA 2YZ5A 2E8YA 4QSFA 2VEPA 1NTHA 3MHGA 2HRWA 2FHFA 2XFFA 4GMEA 2RJHA 1WXJA 5CG0A 3IUHA 1YXCA 4AEFA 2GYIA 3T08A 1K02A 1ZBVA 3SUUA 3LRKA 3CTLA 2VXNA 1XYMA 2HSAA 3Q58A 2H6RA 3HU7A 4Z2IA 3TZFA 4CNSA 5U4NA 3GDKA 3NZQA 3NIYA 2H9AA 4LYKA 1K4GA 3DKJA 1XBYA 4JTFA 4ONVA 3LCWA 5A69A 3M0HA 3B9EA 4DNHA 1VHCA 4PYSA 3C2RA 1EOKA 3RAOA 4NX0A 3MUXA 2E5CA 5F7UA 1K8XA 2VENA 3WL0A 3PBGA 1OD0A 4D6IA 2BHZA 5C5YA 3H2CA 1GVRA 4RDWA 4Y6GA 3EOUA 3VUSA 4IJCA 4GFSA 3GW0A 4BQ3A 4OIFA 3CWHA 3RU6A 3GG8A 2QDEA 3FVDA 1B54A 4ILSA 3N9SA 4NYUA 1POKA 4K37A 4CNNA 1XP3A 1M03A 3C5QA 4YTSA 4R7JA 3S1UA 4MB3A 3WNOA 4E8CA 5LGXA 3GR4A 3W7GA 4XZ9A 4IQDA 1H7NA 3BWWA 3PTKA 3VIIA 2GSHA 1KBIA 1WDQA 4GXWA 5G1MA 1UZHA 5ABFA 3ZVIA 4S39A 3DYOA 3GDTA 4CQAA 1XINA 4NAEA 5L6UA 4JTEA 3BANA 2FZBA 1D7FA 3A4JA 4N0RA 1BG4A 4X22A 1XIGA 2WJZA 4UR9A 3DZ1A 3RHGA 4I9AA 4WDXA 2R6OA 1UKPA 3MDUA 1LRNA 4U4MA 3M6DA 4DELA 6A3HA 2ZA3A 4LU0A 4GIEA 1R87A 3SIZA 2VZVA 2BSLA 4YCPA 2Z24A 3LLXA 3SDOA 1DTUA 4O8AA 3PWAA 3XINA 1XRFA 2P0IA 1X1ZA 2FB3A 4F2BA 3TJXA 4ZTYA 3BG9A 1KNWA 5AC5A 1OC5A 2PCQA 1P0KA 2XYLA 3QJAA 4K68A 3HF3A 1J5TA 4ES4A 1RY0A 1BXCA 2ZXDA 4JQ1A 5T26A 3PR2A 4Z1YA 1QU4A 4UFLA 1C8VA 5H6HA 2QJJA 3PC0A 4UQBA 4JX4A 3TA9A 1JZ6A 4OT7A 1ALDA 1IEIA 1J79A 4C6BA 3FEMA 4XV0A 4Z2HA 5CQ1A 3K8KA 1DHPA 1G4SA 4MKSA 3R43A 4Q32A 4C5YA 1DWHM 1P1MA 4LYRA 5E1QA 3BK0A 1GEQA 2PZNA 3MMTA 3UR5A 3UPMA 3UWQA 4L1GA 4MYXA 1MZHA 3AO0A 3UXLA 4UTLA 3DU0A 3DH7A 2OJPA 4U28A 1TA3B 7TIMA 1E56A 3GRIA 1IEWA 3GH5A 1R3QA 3WD0A 3M0KA 4QHRA 3FXYA 2PDPA 3TDFA 3W6MA 1UP3A 5D8WA 5G5IA 4GO8A 1B5TA 1KCXA 2QJNA 3GXPA 3O3RA 4GCAA 1ZBKA 5E5CA 4GI4A 2FH8A 3UETA 4TMCA 3B9NA 2QLYA 2V0TA 4Q4KA 1FP8A 5EMYA 5FEXA 3H8AA 1KWGA 3EA3A 3W00A 5A8GA 1NQKA 1AJZA 4A21A 2DZAA 4BI7A 1XLFA 4B5UA 4OV4A 1WDWA 4HJWA 4BZYA 1O6IA 1XRSA 4AZCA 4XZIA 4RKAA 3MI6A 4U2ZA 2JBMA 2FZDA 3ANVA 2FPYA 5A6BA 4ZTXA 2A3BA 2G5WA 3RMEA 3WLJA 2QDDA 3ARWA 3TWBA 3U4AA 1XLIA 4A3UA 4H7CA 1JNEA 4HHLA 2PTWA 1KFLA 5AVNA 4ZQNA 1W31A 4B2DA 2FZMA 4QROA 3DYMA 1S46A 3W87A 2XVGA 1H41A 2D23A 3EDKA 3NDOA 3I6EA 3AISA 4GKTA 1VR6A 4WUIA 1XIHA 3M41A 3NGJA 3TQPA 3BSGA 3VIJA 1YADA 1QW9A 3VFLA 2V9DA 2QUUA 2J9YA 4Q7IA 3CIXA 1YTDA 1DTNA 1HTIA 2G3NA 3WBXA 3T07A 2GJNA 1K9DA 1JFXA 1Q45A 4CEUC 2FGLA 3LPPA 4DRSA 4QCFA 1G0CA 3L0GA 1M53A 4ACYA 1OIMA 1FP9A 1FKWA 2P50A 3WNNA 3ZVHA 3WLKX 1GKQA 3UCDA 2W67A 3W72A 1XBXA 5G2HA 1OYBA 2QMKA 5A2BA 6ENLA 2ONEA 1WDRA 3UA3A 2V67A 1U30A 3BG3A 3EWDA 4TMBA 3CV7A 4M29A 2E6FA 4LY4A 1ZFJA 4MZ1A 1SVDA 1SO4A 1Q6FA 1JXJA 5I3JA 1TV8A 1XGEA 4DBDA 1UD4A 4F3HA 1V03A 3CUFA 2NXGA 2CW6A 1GQIA 3WQGA 3TXVA 1AG1O 3SCQA 2PDWA 4J28A 3OEXA 3S5SA 1AH3A 1HZYA 1YIXA 3T7VA 4MTVA 3OB8A 1ONRA 4PUKA 2HV5A 1TTQA 3VNLA 3CM4A 2F38A 3W1UA 1BXBA 4HZ6A 3RO8A 3CHCA 1DJQA 5EPDA 3EWZA 2WCSA 3WNKA 1B3YA 2XTKA 2HPMA 2GDVA 1M01A 1RLDA 1JZ8A 5AZ1A 1IIHA 4MNLA 3HQNA 2GQ3A 2HROA 3BCJA 2GQ8A 3GR8A 5BNKA 3HPXA 1S2TA 3R2GA 1RHCA 4OV9A 3U7VA 3RCMA 2AQOA 3M7SA 1JL8A 2J8FA 3EEGA 1S2AA 2FPVA 3CB3A 4B90A 3C2VA 3TUUA 2CEQA 3B4UA 4KT2A 1ZS2A 2WVTA 1V08A 2XFRA 4Q4QA 1TRIA 3W38A 4AIBA 3ONCA 3NEVA 1KCLA 1OQFA 5JUVA 2JFEX 1UC5A 4XD4A 2D0FA 1DJHA 1EX1A 3PBMA 3N11A 1EUAA 1THFD 3K4DA 1I2QA 1AL7A 2B0MA 4L9ZA 5FL1A 4C1NA 1PX8A 3TOYA 4Q6XA 3H26A 3W0KA 1VS1A 4PB5A 2YBVA 4U10A 2I9EA 3G1YA 3IS4A 4ENLA 1E3ZA 3CQKA 3T55A 3VDBA 4IIGA 4FB7A 2C6QA 1KR1A 1B30A 3W1QA 4GVIA 2OSYA 5T91A 3WDPP 3V18A 5DFAA 4ROPA 5LNVA 3UVAA 3DAQA 4I7VA 2POTA 2GJPA 2O9OA 1IHIA 1TUFA 2FTYA 5JBDA 4RE0A 1H5YA 3UJFA 3LGEA 1TPEA 2WZIA 5I7GA 3TYCA 3QYQA 3R8HA 4LBSA 3BZJA 5EA9A 5AN7A 3TYEA 1FWDC 3F4NA 4WKFA 2VQUA 1UD5A 2QUMA 1R38A 4N6EA 1UBSA 3MSYA 1BTCA 2I16A 1KFEA 3LPFA 4FS9A 4K2SA 1V4YA 4BHYA 5FEWA 1GTEA 2PDHA 2X0YA 1QHOA 3D6NA 3UZZA 2V2DA 2ZX9A 1MI3A 1UR8A 1BYBA 4ERIA 4PR4A 1NARA 5XINA 3BLIA 4A3HA 4LB4A 2YGYA 3C2OA 5I06A 1LQ2A 1KFBA 1LLZA 4A3QA 3L67A 4XIMA 4H04A 1DWGM 1LDCA 1O5QA 3BJTA 1WQ5A 5HMSA 1OFRA 4M5PA 1HUVA 1FXQA 3R10A 5K4ZA 5HINA 3EA1A 3AYTA 4DUOA 2J75A 2C3ZA 2RAGA 2EPNA 1KBLA 3O6AA 4C6EA 3QHOA 5K9CA 2FVLA 4E3TA 5M5DA 1EOMA 2Y85A 4EAMA 4PFMA 1TUXA 2E4TA 3DG7A 3VAVA 4A6GA 3T0AA 2EKCA 3HPZA 3P0WA 4AWSA 1SJAA 3WMLA 2AL2B 3BOLA 3FA3A 3RPMA 2Z1VA 4V15A 2A7PA 4AHQA 1BWLA 2BOFX 2C7FA 1XRTA 2GPTA 1X6UA 2NVDA 2FPTA 4J7RA 3WUGA 1VJSA 5C7VA 3A13A 4L4PA 5LZLA 4R9XA 1OD8A 4M82A 4EKJA 3E5PA 2QS8A 3PBUA 4CVUA 3DHPA 1VC4A 1OX6A 1N55A 1MQRA 5HNNA 1FXPA 3TR2A 1J0IA 5DMLA 3CUHA 3IK4A 2C16A 4IIBA 2PTZA 5H8UA 4LEQA 2A4AA 2ALRA 4UTMA 1WX0A 4M6VA 3LCXA 4RW5A 3O7UA 3NQ8A 3QHNA 3L68A 5DLCA 4FR6A 1JDEA 4PODA 4TR9A 1SQ7A 2O56A 1EUNA 4EPEC 1IZJA 4AC1X 1SFTA 5F4SA 2V3FA 3PTDA 3LHUA 2CITA 3WQ6A 1JCJA 3NZGA 4GI6A 3SY1A 3BTNA 2HQAA 5A6AA 1X39A 1NF0A 3UYCA 1KXHA 3KP1A 4O54A 4ML4A 4S3AA 3N6HA 2PRHA 5H8PA 3NSXA 1TJPA 2VX7A 3E1F1 4QJ1A 1NFPA 4GYKA 3B9OA 1IXOA 4P7OA 3QSRA 4P7LA 1YDOA 3UR7A 4XO6A 2IKIA 3GZAA 2FFIA 5I02A 5D9OA 1SJCA 4ZQPA 2PTXA 5FJIA 4BEQA 1ISYA 4CGTA 3WLRA 3GFXA 1J96A 7ODCA 1HN1A 2VD9A 1E15A 1VHNA 3T44A 4NZ3A 1DEDA 1IEVA 3U57A 5F2LA 4MHBA 4R7WA 2VNCA 1CNVA 2V5JA 4CQCA 4L6DA 4FXSA 4URIA 5FJUA 1DQWA 3W73A 1R2TA 2BY2A 3MZNA 1NDYA 3LBMA 1YNPA 2DIEA 2P5NA 5C0QA 5B7YA 1V79A 3A6OA 2Y8VA 5DANA 1KXVA 1GK8A 2WHKA 1JDDA 5A5WA 3S1GA 3DECA 1BYCA 3MUZ1 3G18A 3OVPA 3H4WA 3QZAA 4HA0A 1WZAA 2ADAA 1YPFA 1H62A 4J2PA 4QLJA 1CBGA 3L5LA 1NWRA 4PBEA 4NZ4A 2Z7GA 3C2YA 1IF2A 2BV9A 1SMDA 5E0FA 1GKRA 1J2BA 3NDZA 3OZYA 4KFPA 3RM9A 3NDYA 2OU4A 3IANA 3KDOA 1NIUA 3WF2A 1HQTA 4GUFA 1A50A 4I7UA 2E68A 2DVUA 3DC8A 3F4CA 3W2MA 2CBUA 3N3TA 3S2NA 3APYA 2I5QA 3V0UA 1TV2A 3T81A 2G3MA 3BPWA 2I57A 4W7WA 1ZCCA 1YPIA 2PDBA 4EP8C 1J8VA 1W9VA 4IISA 3H53A 3MO7A 4IJRA 1OSEA 2VFDA 2OFJA 4LVDA 3TTSA 9RUBA 1RR2A 4A29A 1ML1A 2VGIA 3IUIA 2XVLA 2DZVA 3KZSA 2PFHA 2CLMA 2OMAA 4AC7C 1E4LA 5D9PA 4KIEA 5F4XA 3VMPA 3OODA 3TMLA 3E96A 3CAWA 3W9ZA 2PC4A 1Q7ZA 1PZ3A 3KS5A 3HMCA 3VKKA 1Z7AA 1TV3A 3FA5A 3S5NA 3F4DA 3W2LA 2E25A 1ZQ5A 2OXNA 4NIRA 4BA0A 4XD6A 1VF8A 1ZJHA 3HFTA 1US0A 1V02A 4HHHA 1CB7B 2VC7A 3URQA 3B8DA 3NM3A 4H9YA 1CEOA 5M1TA 1O5XA 4JN6A 1XLDA 1RQBA 1SR0A 4K6AA 3EBVA 5G4WA 1CGYA 3NQDA 1GCYA 4KESA 4NY2A 2G4FA 3OLDA 2IQ0A 5KSWA 1ZAIA 3B0PA 2X1IA 2WZEA 1R2RA 1PHQA 2RJGA 3WH5A 1RA0A 3STEA 1FKXA 1TV5A 3LRLA 3WH9A 2PGWA 1IGSA 1YDYA 3Q65A 4N4PA 3VIKA 2C79A 3UD6A 3HBLA 1EB3A 3W7OA 1E0UA 4QITA 4JX5A 5HWMA 1KFWA 3W85A 3C3UA 4UTWA 4JTHA 3Q45A 1SM9A 1H60A 2HS6A 3SECA 2E1WA 2ZWZA 3NQCA 5I2UA 3MV11 3BICA 1J0JA 5BU9A 4JKLA 2NQHA 3FHQA 3T6CA 5DXYA 1F07A 3A64A 4WQ6A 2R82A 2W5FA 4KEUA 3H2OA 1JCMP 5H1WA 2GGGA 3WQOA 2CZ5A 2ZXAA 4O12A 3M46A 1MXDA 5I3FA 1Q85A 2RGMA 4C6PA 4DPPA 1VBGA 4PULA 1D8CA 1NU5A 1PVNA 1WKFA 3AUOA 1K70A 4UNIA 5BMXA 2DUXA 5DY2A 1U5JA 4PMYA 2WWCA 5F1VA 4PMJA 4HN4A 1V93A 3WF0A 3IVTA 2V3GA 3KVLA 4O11A 3W1RA 3WFZA 1X38A 1C3FA 1UWQA 3LD5A 2GK1A 4ZSUA 4ZXLA 4HMNA 2XFWA 2YOCA 3ONBA 4DZHA 1KQZA 3AOFA 5FESA 1ISXA 3M5ZA 3G0XA 4C6NA 4WXZA 4V1XA 2PDGA 1JCYA 1SYTA 4XSMA 3VOCA 5HXMA 5KZMA 3RF9A 4TV5A 3S46A 3PNUA 3UR2A 2YLLA 4JS3A 4ZO8A 3ME3A 3THCA 1R3RA 2BVTA 3H22A 4GXMA 4NJJA 3VDHA 3O06A 4BF7A 4H01A 1EPVA 2CLKA 3U3HA 2H3BA 4XKYA 1EXBA 3HTWA 1ESWA 4CQDA 5DEZA 4UQ9A 3QKZA 2YW4A 5DXXA 1CXEA 3VKJA 1XLEA 1RY8A 4ZE4A 3K2GA 3F5KA 3UNDA 4GH1A 3WL1A 4L65A 4ZOCA 2ISVA 1S2UA 1H7OA 3SQLA 3FY1A 1H7PA 1JFHA 1NAL1 4HJFA 1EZWA 1EC9A 5CAKA 4HCDA 1K8YA 3EEZA 3LEPA 1Q7MA 1GEHA 3QQWA 4YVPA 1QK0A 2VMFA 3PK7A 3PZQA 3CZLA 1EHNA 1UMLA 4MZ8A 4O53A 4LAOA 2IUZA 3ITTA 3OQEA 3IJQA 1DVJA 1ZB5A 5A3HA 2XUCA 2Z28A 4WVXA 4GJJA 2QPSA 3DHUA 5BZAA 4LF1A 4WOZA 3USBA 3ITVA 3HV8A 4HU8A 4G5DA 1UWUA 1HO1A 4Z2KA 5LHFA 3BXWA 5RUBA 1S3HA 1AH0A 3DFQA 1XRVA 1FH7A 4Z2LA 5FJPA 5LGZA 2J8TA 3QF0A 3D47A 2ABAA 2BVWA 4JEJA 1UIPA 3W7HA 4IZGA 9XIAA 3VKBA 4K8EA 4Z42C 5I3KA 5JXQA 2R1KA 3MJYA 1F05A 2KZHA 3QV8A 4U3AA 5DCDA 4IP4A 1UW9A 5KITA 4AY7A 1XCFA 2Y7GA 1FFRA 2RH9A 1PIFA 3P61A 4F79A 4ROQA 3NTYA 2B7QA 2RUSA 2AMGA 3THUA 3TXZA 4RDVA 3HJEA 3RRXA 1ITCA 3ARXA 4Y90A 1PE1A 3RK8A 4UTWC 3TLLA 3XISA 4ZENA 2LLEA 3QW3A 1KKOA 1GHSA 3H7VA 1XYZA 4IFOA 1MW0A 4P7QA 2FH6A 2W4XA 1GYNA 4IXXA 5D05A 3SURA 1ME9A 1QATA 2OYKA 3VIOA 3P80A 1N7KA 3V5FA 2VFGA 3HQ1A 2E5BA 4KS0A 1IE7C 3JZUA 4PEKA 2ZCGA 3VNZA 4PMOA 4JCMA 1W1PA 1XGDA 1YQ2A 2WSPA 3EKGA 4NNCA 4AXKA 4O1DA 4LCSA 4DVOA 3DX5A 4QISA 3S47A 5M17A 2BHUA 3CHVA 3QMTA 3WQDA 5TQLA 4ICCX 3T8LA 3KRSA 4S2BA 1GZ1A 5CJ5A 1NELA 1DV7A 4HPHA 1SFJA 4J3ZA 4RK8A 3USZA 1S39A 1AD4A 2GJXB 2NUWA 1SJBA 4C90A 1BKHA 5KMYA 1MEWA 2QCLA 4CEXC 1EJUC 5AVHA 3VOJA 1F4HA 3N9KA 3B0YA 5E6ZA 5I3GA 4NILA 2ZA1A 4W4QA 2YW3A 2DIKA 2QHAA 2NXHA 4QJ4B 1LUCA 2IPFA 1W56A 5AHEA 1VFHA 3S2JA 4DWSD 3QLDA 2G37A 4PUUA 3CIVA 3RN6A 4DWSB 1B0IA 3JRKA 1A3WA 2OODA 4Q8VA 2WQPA 4NF7A 2A3HA 4NQ1A 3V36A 3WMBA 4RXFA 1TPUA 4XSLA 5BXPA 1AZ1A 4KBXA 1C8XA 1TJRA 2W79A 3PS7A 1OBAA 4AY8A 3NO5A 3UERA 3E0VA 4F0RA 3H2AA 4HHMA 1WDDA 4RXGA 5FAGA 4BY3A 3QFEA 3OQ8A 4C6IA 4DBEA 1OWQA 1LWJA 4P8WA 4N9DA 3R8RA 3ZT7A 4JY8A 4JTGA 3QV6A 4GVGA 1W37A 3DFOA 1AMYA 1J9YA 4K3ZA 4FK9A 3W22A 4GKLA 1DWIM 3IGSA 2P1FA 3ZYZA 1WYIA 2BB0A 5I3IA 2ZTJA 3UZWA 3UWUA 2GLKA 3F1QA 5EU9A 3VFCA 4Y7EA 3N19B 5CG7A 1R7OA 4Z17A 2Y63A 3GNXA 1RVKA 4PMRA 1ZPTA 2GQAA 1Z41A 2DZBA 2Z1SA 3WFLA 1Z8AA 2NV1A 1Y5XA 2J7DA 4H41A 4GZIA 4DF1A 1CB2A 3GNNA 3ZQ9A 1AQHA 4Y8FA 2PPGA 1JCTA 3C8FA 2YIHA 5CC5A 4RR4A 5TIMA 5K7JA 2XH2A 3KX6A 4HSNA 1UKTA 4PUNA 4DO6A 1QRQA 3KOZA 1XCXA 2Y7EA 1GGOA 3R7MA 1Q6OA 5EKYA 3BLPX 3CNYA 1EFZA 3TYZA 4YNGA 2CC0A 1YBQB 4HIBA 1PSCA 4AVOA 2VQTA 1EJTC 3DYPA 2OLHA 3PSVA 2P0OA 1KQYA 1EXPA 5HWJA 3OG3A 4P5UA 5EGRA 1A47A 3UJ2A 3E12A 3GC5A 5ENLA 3V0TA 2TMDA 4ZO9A 3PWGA 2A7RA 4KCUA 4AISA 1L6FA 1T99A 2NV2A 2JF6A 3R94A 3POHA 1E4IA 1CZ1A 1HJQA 3UA4A 3LUTA 4NAFB 5AC7A 3MMWA 3SBFA 3KCOA 2CLOA 2J9XA 3HGJA 3THDA 4INFA 3BSHA 3E0IA 3QGVA 4D6GA 3BDKA 4E2OA 4MB1A 4DJEA 2P8BA 3CLMA 1TE6A 2QDGA 2QIIA 3NVTA 4O4WA 4R53A 1VFSA 3NGFA 3PBYA 1S5WA 3UF9A 1JYNA 4BS0A 4DJDA 2QCHA 1UJQA 1A5OC 2UY4A 1WOAA 3STCA 3AJ7A 2VWTA 1F61A 1HFBA 1US2A 4YWSA 4XB3A 3WNLA 3GU2A 4I9TA 1S2WA 2IMRA 3WF4A 1BPLB 3VNDA 4HA1A 4B15A 3P67A 5EBUA 1QAPA 2Z4GA 2OX1A 4IUOA 3QMRA 5C70A 2PB1A 2VVSA 4DIAA 2YCIX 4HK7A 2H9AB 5IBXA 4ZSTA 3RDKA 3EB3A 3ITYA 1HGWA 5LA1A 5LIYX 2OZ0A 1SR9A 4Z1DA 3W6LA 4I5UA 1IZCA 4QG9A 5CKSA 3EB4A 3PTQA 5LNUA 1XIDA 4U31A 2HXUA 2WMKA 4LS0A 3IUDA 1K6AA 4E2VA 3OBAA 3KFTA 4BEUA 1ITUA 1W9XA 4AX6A 4QEHA 4HCLA 4WDWA 1JG9A 3VKCA 4WY0A 4UTUA 5IFPA 1QPNA 4O8RA 4MFEA 4AD1A 3GNRA 3S2MA 4A8LA 3TW6A 3BLOA 2PWHA 3BMWA 1SO6A 1W9DM 4U3CA 1MSSA 1FDYA 3ES8A 3KHDA 5C2XA 1YE6A 3PBWA 4D2JA 1U5HA 4G8TA 5C55A 3GWQA 1F76A 4B9YA 3R11A 4RZ4A 5CBBA 3M0IA 2X7WA 4F4RA 3WLOA 1DBTA 4LUYA 1SMAA 4QR6A 3BE7A 4G1KA 4MYAA 1JXKA 1VBJA 1U33A 3WD3A 2OZ3A 1DL3A 2BGQA 4ZO7A 2WCGA 1GVEA 4F9DA 2QCDA 2XN2A 1XLAA 5CZ0A 1BF6A 1G5AA 2VC9A 3ABOA 2ZFAA 1TVLA 3CQJA 4H9UA 4HGXA 3IJ7A 1V0KA 3SR7A 1B57A 2PRLA 4A8RA 3R13A 1IWPA 3QGKC 3BAIA 3UT0A 1VCGA 4B16A 5CPLA 2ZUMA 5AHNA 3DUGA 1E1CA 3L4VA 4M80A 1IZKA 4X9SA 4QNWA 1E6QM 1OFQA 1E1FA 3TJ4A 1UQZA 2DY3A 3W02A 4UR8A 2OLSA 3BGAA 2EGZA 3WF1A 2WK2A 3TOPA 3POCA 3W2NA 3EX2A 2XWEA 4JKMA 2WBGA 3E6EA 4UTFA 4GQRA 4L1WA 1G6CA 1XC4A 1RJRA 1VFOA 3DG3A 1WUFA 2PDQA 2F84A 1FWCC 2XZ7A 3DG6A 3B3DA 2OWCA 3GXFA 3F2BA 4WDUA 4WR3A 4YLWA 4AY1A 3SUTA 1W1YA 3S9IA 3N12A 4M1RA 4K7YA 2WCAA 2GVEA 1TELA 3SRDA 3MKCA 4GG9A 2WQDA 3WJZA 5CZTA 3Q37A 5JH2A 2ANUA 4W7UA 1XSIA 5DRCA 3IV3A 3VGFA 3E9AA 4AEOA 4AX7A 3A21A 3WQFA 2QW5A 5D9MA 2O55A 3RITA 1PBGA 2ZX8A 1B3ZA 1UR2A 3TN4A 1W32A 4Y9MA 4S3GA 4ICNA 2AQWA 5TF0A 2F61A 3WBYA 5DCEA 1FCVA 2BMBA 3BC9A 2V2CA 2Y24A 2XIBA 1Q3NA 3R5EA 4PGLA 4JHZA 3A23A 3BAKA 1Q4WA 3JUGA 3KRUA 3N04A 2NT0A 5U7SA 4IL0A 1QTWA 3H2MA 4LNYA 1TTPA 4YU1A 4BQ4A 2Y0FA 4DAIA 3IGHX 3W2KA 5A6BD 4AZCB 1JYVA 4O28A 4DJEC 3GS6A 4IIFA 2DZPA 2ZTKA 4KRTA 3TQKA 1MW2A 4S38A 2FKPA 4B2DD 4DJDC 3MUIA 2HBXA 1UWRA 4HB7A 3W75A 1MRAA 3UVIA 4UTJA 2E0PA 2MUCA 2QDHA 1ADSA 1RH9A 3DC0A 1XDJA 3S9YA 4JFVA 1U2YA 4BQ5A 4HZ7A 4H00A 1KKRA 1SO3A 2V5LA 1JCNA 5IBXC 1QNQA 2YPIA 1KW1A 3IJLA 4ZOEA 6PTDA 1TR9A 1JPDX 1PTGA 2DW7A 2O9PA 5FKYA 5IHRA 2YL8A 3OLEA 1JQXA 1GHRA 4WF7A 1GJPA 2XINA 3NSNA 1RCXB 1OCJA 4PB3A 3N2TA 1RSCA 4B91A 2DV0A 5HMFA 1WV2A 3WLHA 5BRPA 2WSRA 4UZSA 2WB5A 3OGSA 3MCOA 4GZ7A 4IM4A 3LY0A 1HJWA 1C91A 5JVLA 5AKQA 4LV9A 1VFFA 4PL2A 4UTHA 4H83A 4ACZB 4H8HA 3TCEA 4KETA 5IOBA 1ZJAA 2EXOA 5MHBA 1E3XA 2DH2A 1W17A 3VDGA 3CZKA 4GI9A 2V8ZA 2OO0A 5GQBA 1BAGA 2BXYA 3WX7A 3NQVA 1GG0A 3NL2A 3CHEA 3AXKA 2EPKX 2DZXA 3UXKA 5CLWA 4DLMA 1T96A 1IYXA 3N13A 5FF0A 3AHXA 4BI5A 1RAKA 5AOUA 1KBBA 2VURA 3W7KA 1UG6A 4UR7A 5LXXA 3GK0A 2J4GA 3K8LA 3ARTA 4UOJA 3P7YA 1XUUA 3W81A 2Y8KA 2AL1A 3PPCA 1GVOA 1WCGA 4NZFA 3EX6A 4H8UA 1W9UA 5FI8A 3QPZA 3M0VA 5AHLA 4O0ZA 2PDKA 1TZZA 3B05A 4GO9A 1OK6A 1T41A 2X8RA 5D2YA 3VTRA 4MNKA 3ARZA 1A5UA 1DJZA 3W1TA 1OX5A 1KM0A 4LVFA 2QAPA 5ABGA 2ZRXA 4MY8A 3EPOA 1QBAA 1EIXA 1DQXA 2BASA 3CC1A 2QPXA 2PDXA 3P82A 2FVMA 5FEZA 4Q7NA 1QBBA 4EVZA 2YFNA 2X05A 3MUAA 1QXLA 4DZIA 2CBJA 2PWEA 7ENLA 4GQGA 3CPUA 4JN8A 1CLXA 4O18A 3U7BA 4S3FA 5HJXA 1AUSL 4C1NB 2VFIA 3UXIA 1LT8A 2OCZA 2QCMA 4D6CA 3K8MA 4O1EA 4A8IA 4RV8A 1EWDA 1XH0A 3GHUA 4C6OA 1UPMB 4HMCA 2J78A 3ZXWA 3SB0A 2HK0A 2VFFA 4OVXA 3BCFA 2L5HA 3KVJA 4N6FA 2XVPA 1TFVA 4O0QA 3QHMA 3TIMA 4LUSA 2PDUA 2WOQA 3C2EA 3Q4DA 3NQ6A 3VIPA 3W7EA 2Q01A 2OQHA 3CQIA 1ZJIA 3TTQA 4GYFA 2QF8A 1XG4A 4GISA 2NW0A 4C91A 4RDZA 3KLKA 3TA6A 1ZLPA 3M4HA 3LX9A 1HJXA 2OQLA 2WZHA 3UGRA 4HOXA 1SJDA 1RJQA 4A2SA 4OOZA 4B5XA 3RJYA 5AFDA 5HNTA 4IG2B 2Q71A 1TX0A 4H2CA 1E43A 4KCWA 3A22A 3VGGA 3PF3A 5B7ZA 1E9ZB 2YXOA 3WNPA 3GFZA 2G4JA 1ADOA 3CAKA 1PZ2A 2VHLA 4NP7A 4WCJA 3RX3A 4P61A 1RJPA 5D4YA 4D1IA 1ZP4A 5HPCA 5HANA 1ZU8A 1UD2A 3RPTA 5D8ZA 2Y89A 3LTYA 2VFEA 3SEPA 3PB0A 3O15A 2OOGA 3N15A 4NJIA 4H1ZA 1BSLA 3THQA 3P62A 5KEZA 3WBWA 1XWYA 5JMUA 3UWWA 2IW0A 2W63A 4C6MA 4Z1AA 2DGAA 4IIDA 2GOKA 4TVDA 1XQLA 1R9ZA 4A4AA 4LVGA 5K4XA 3NQAA 2C18A 1XPGA 3CHFA 3FGCB 3U5UA 1WXZA 3VI2A 3MO4A 4GGBA 4NT0A 4CQBA 1AJ0A 1F3WA 2OEJA 3ABXA 2JALA 2D73A 3KOWA 4ZA0A 4RX0A 4CKQA 5BWFA 1B90A 1WKYA 3AZTA 3G1XA 3M5XA 2ZC1A 1PO9A 3J7HA 2YL6A 1CGVA 1JI2A 4X60A 1K7XA 1CT5A 1E70M 2CNCA 1VENA 1LM1A 2WLYA 1K9TA 3NQ2A 1QNRA 2WJFA 1QJWA 2WC7A 3MMUA 4ZZ9A 3TNOA 2R1NA 2VCBA 2YL5A 2FYMA 4Q4RA 3TE9A 4OU1A 1QO2A 4PMDA 3T0DA 4NRRA 3H4GA 4FOJA 2OQYA 4DPQA 4H8VA 1MZRA 4A05A 1QHPA 1XLJA 3ZOAA 3CL7A 2H90A 2C1IA 1OT2A 5CPOA 1YW1A 2C0HA 1GW9A 1D9EA 4DXKA 1GJWA 3GHTA 3GKFA 3G8EA 3GU1A 2Q8XA 2A3EA 3O8AA 4JPGA 1KM6A 3U48A 3HGSA 5GNZA 4XD3A 5LA2A 3GVVA 3QSTA 3VIMA 2D3LA 4PSPA 1IT0A 3OVQA 4HOWA 5SWUA 2PD9A 4OHQA 5AYZA 1HG3A 4Q4MA 1BQCA 5HQLA 3QTGA 3JVAA 2AAMA 3GDLA 3KVMA 4AIOA 5LKYA 4J3XA 4MY1A 1O60A 3NEHA 1MUMA 2O0TA 4KWSA 3EA2A 2I14A 1GG1A 2DFAA 5HNRA 1P6BA 1KV8A 4YTQA 2PWGA 1XYLA 3VM7A 1MUCA 4MKVA 4W85A 2PAJA 3M0XA 4R34A 1O1ZA 3ITLA 4LUTB 1WZLA 4AF0A 1LORA 3VD5A 1JZ7A 1CGXA 4G7EA 4JTRA 3TX9A 1AW1A 1HKVA 4DBUA 1ZBWA 6ALDA 4XBSA 3PFRA 1KRMA 1ELSA 1KA9F 2HBVA 2FDMA 3AIWA 3W7JA 4PCFA 1Q6LA 2DUAA 1KM4A 3PZUA 1YKWA 4JICA 1TPVA 2BOEX 4Q8NA 3ERPA 3E5BA 2G3IA 2Y88A 1VPXA 2HISA 1C8YA 5D04C 3CT2A 3G3DA 2W92A 1YMYA 3L4ZA 4HA3A 3KL0A 4QRNA 3CJPA 1YRRA 2J74A 1W9PA 4DI8A 3CMFA 4GC3A 1VKFA 4Q6JA 1G69A 2OEKA 1H1NA 3UFYA 3MQTA 3CWNA 2VX5A 4KEZA 4WGHA 1TG7A 1LBLA 5AB3A 3KS6A 1TPH1 2WAGA 3FDKA 3C2FA 4Q22A 1A0EA 4CN6A 1DYSA 4MNJA 1NP2A 1UA3A 5FSDC 1KD0A 1Q66A 3RCNA 4DAFA 1W5NA 5C54A 1J0HA 1LL7A 1QNSA 3UR8A 2ZZ1A 3ID7A 1RV8A 2VL4A 2XN1A 4KWUA 3TCSA 1SO5A 3SN4A 3SRFA 4J3VA 2EQDA 1G01A 2Y6ZA