3TZVC

Crystal structure of an inkt tcr in complex with cd1d-lysophosphatidylcholine
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
270
structure length
263
Chain Sequence
FPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSQDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGQASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLQGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAAGLSCRVKHSSLEGQDIVLYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysophospholipid presentation by CD1d and recognition by a human Natural Killer T-cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Invariant Natural Killer T Cell Receptor chain A
total genus 61
structure length 263
sequence length 270
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tzvC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tzvC01
4U6YB 1FL5A 4IRSA 4OTXL 1X5JA 2ZKHL 4Q0XL 4ZUUA 1N8ZA 3RPKA 4FS0A 32C2B 2WUBL 1CK0L 1FNEA 5HYEA 4R6UA 1XF4B 4WY7L 4HH9A 4I3RH 1MLCA 1VKXB 3RVUC 2HT3D 4ZUTA 4KY1L 1G9NL 3DETD 4LVOC 5TDNB 2QV2A 1S7SA 1VFBB 3VG9C 3LPGA 2Y4SA 3NIDF 1WAAF 4LOUC 1T4KA 3O6FB 1DBJH 5IEKB 4PBWD 5FKPB 4LLQB 3WFBH 1KLGA 1MSPA 1L0XA 2A0LC 4IDJH 5ADOH 5KVEH 1S7UB 4NN6C 3IJYB 2DDQL 3ULVL 4CNIB 1AJ7H 1T20B 4YC2C 2AJUL 2CK2A 3L7EB 5DRWB 4RMUA 1WTLA 2M26A 1NEZA 4OKDA 1MPAH 5I8KH 4GKSA 1PKQA 4JM2D 5GJSL 5DXWA 3DX6A 3QQ9D 4PYGA 4F15B 3ARGC 4OZFH 4EDXA 1I8LC 4WW2A 2I26N 3U48A 5CJ5A 3PL6A 3DVNA 4CVXB 4M7LH 4FQPA 1HHHA 1PSKH 3ROLA 2AJYH 1YMMA 4JFDD 2HTKC 2IJ0C 2NY6B 4AG4L 3BOVA 1FFNB 1E6OH 3QDAA 4HWEL 5EIIA 3F62A 4UOW1 4YEEA 1CZ8L 3H2WA 4K8RD 4WEBH 5KAQF 5DO2C 3PGDA 2XYCA 1LDPL 2RFXA 1M05A 3CUPB 3TT1L 1IM3B 3FT2B 1I1CA 5KN5A 4UB0L 2EDTA 3Q48A 3BD3A 4PREB 5GJTH 5AZ2L 5GS0D 2D7OA 4XGZB 1HINH 5DUBB 4BFGA 1MWAB 5FYLD 3MLRH 4U6HB 1INDH 5KVDH 1U8MB 2CLVA 5F3BA 4X7TA 3TBWB 2UZIL 1RI8A 2BVOB 5I1DA 5TDPA 4B41A 1SEBA 3EJZD 1G6RA 3RUGA 3S34H 3WFCH 2DMKA 4GUPA 3E1F1 3AFLA 3CH1B 4QT5B 4MX7B 3VXUB 2FBOJ 2R29L 4JPKL 3FFCA 5DT1L 3JVGC 1DDHA 3MNZB 1NBZA 2XN9D 1D5XA 4RGMB 2W9DL 2D4FA 3OAYK 1U6AL 5I1AA 5GIRA 4HF5H 3MRPA 1YEKH 3OV6A 2QJDA 4HEME 5F9OH 4TOYH 4KZEH 3WFZA 4EQ3A 3EYSL 3VXPB 1AGBA 3D87B 3DURA 4QYOA 5DMGD 2Y25A 5D1ZA 4K3DH 2EYTA 1T7WA 3MFGB 3MUY1 4CN1A 1GAFL 1FC2D 4YHLH 1B88A 3O41B 4HDIA 3BSZL 5D7IF 2LU4A 5DD6A 5E8PB 1HHIA 2FX8H 4E5XA 1M1SA 4GXUN 3MUHL 5JLZA 3BEVB 4S2SB 2KKQA 3DROA 1SQ2N 4H5SA 5D70H 3SQBA 4QNPE 2VJXA 5IF0A 1VHPA 2AV7B 4ZSOB 4Z6AT 2CUIA 6CGTA 4X4MA 3BPCA 1S7WA 2B2XH 5JHDE 2ICES 5B8CC 4GT7A 1OLLA 2HJKB 4YBQC 2DQJL 5AG8A 1UB6A 4GLRI 3LV3B 4X98A 4KDVA 3IJSA 4P2OC 3GGWB 4WY7H 4ODSH 3UBXB 3D39D 5CJQL 3WJJC 3CXDL 5ALBL 5EBMA 4LNVA 4Q9QL 1FCGA 2DLEA 4OUOA 3UTTE 3RWDB 4KVNH 4NO0A 4ZXBC 1BIHA 4R8WL 1RJZB 5CZKA 1ULVA 3DBXB 4OKVA 5HDLA 5IFAL 3BRFA 2H3NA 5FO8B 3FCTA 4O2EA 4XX1G 4HG4J 5EZIL 1NCUA 4R4ND 4MVBC 2OLDA 3QIUA 4Y2OA 4BYHA 5E08L 2X1XR 4D0CA 2I07A 1A6PA 1UH4A 2DYPA 5E4IA 4YFLI 4HLZG 4JAMB 1DVFB 2L7JA 1MJ7L 1EXUB 3DX9A 3FTGA 3KPRB 1ED3B 5B21A 2OL3L 4N5EC 2GJ6B 1FFQA 2DTSA 1RZKC 5E2WH 1CICC 3MLXL 3FB5B 3BDBA 5E0QA 1BBDL 1HDMA 3NZHH 4GS7B 5KSBB 3UPRB 1CDJA 3GSNB 4HFWA 4XX1E 1OM3H 3QDGB 5LXGL 4P3DA 4G6FB 3QFJB 5FUCC 1MH5B 3H7LA 4JO3H 3T2NL 2VLJD 1T21A 1ZGLP 5FOBA 1CU4L 1NCAL 3DJ9A 3O8XC 4OM0L 4NDMB 2HJLB 2IH1B 5CGMA 2ZNWA 1NCDL 3QXTA 5F6HI 2PW1A 3IAQA 3DRTA 1PBYA 2X10A 3I6GB 3MA7B 3P9MA 3QNYB 3QG7H 2E9JA 4PV8B 1ITBB 2ZPKL 3EOTH 3FOLA 3OKDB 5BVPL 1QSFA 2GUOA 1GC1C 4G8FB 4M5YH 2XQYG 4NGHH 5FV1L 2AK4A 5C6TH 3UP1A 5EUOB 3VWKA 5E8OA 4Q97A 5BXFA 3G08A 3OJ2C 4NNYB 4UQ2A 3P0VL 3BZDA 1D6EA 1I8LA 3LRSA 4P46A 4WW2C 5E1AA 2Z8WC 3QUXD 3IDMB 3ESUF 4DJMA 4PJFB 3NCCB 1EAPB 3BH8B 4CAGA 4BK4A 5DMIH 3JWOL 3SCMB 3MV7E 4X8XA 5EZJA 4KJWD 1UWGL 3SDDA 4F7TB 3VG9B 5DEFA 5HY9B 1WBYA 3BW9A 4TUJA 1S5IH 4OLVL 4LHQB 4Q2ZB 5ITBH 4JFEE 2CK0L 1R3IH 4HUUA 3OJMB 3EFDH 4OTXH 2GHWB 1G0DA 1FNLA 3OKOA 5L9DL 1A7OH 4ELKA 4HK0A 4NN6B 3S97C 5E9DE 1MQKH 2VN4A 2ZCLH 5D6DC 5E6ZA 4POZC 1R3LB 3VH8G 5DA4A 2BJML 4S11A 3FO9B 5EU6A 4L4VB 1WBXB 1TZGL 1U92B 2MCPH 3G6JF 4YHKL 3RVVD 1Q94A 2IMMA 3QJFA 4ONHA 5D71H 4JG1H 4TNWK 5HVHB 5KANG 1KTDB 4G8EA 4OF8A 1XIWD 3WFEH 2MQ3A 4P2RD 4YDKL 5MEPA 2MKLC 1RUAL 4HGMA 4OLWL 3FQUA 4X83A 2CRIA 3GRWA 5INCA 1CFVL 3GSRA 1U6AH 2V5TA 4LSUH 5DR5L 1T04B 1HILB 2YBRA 1BJ1H 2DAVA 2CO6B 3OJDA 2HJFB 4JY5H 4LAJH 3DGGB 1LE9A 1U93A 4N8VA 5GS0L 2VLME 4LL9A 5D2NE 3ULSB 3OWEA 3U1SH 3OKYA 4IMKC 3NACH 1FN4A 4ALAL 3M45A 3V8CA 5EORL 5HHME 5KSBF 2H9GA 5JO5A 1YN6B 1MFEH 2F8VA 5F7WC 3HZMA 2EH8L 1NDMB 1N59A 2B4CC 2X89D 1OTTC 5IFJA 4X6DE 3WUWA 4Z95L 5D72H 1XF3B 1DSFL 4LSQL 3EGSA 4NRYB 4K9EH 4QWWC 1K4CA 4XZUB 5T1KD 5DYOB 1PJ9A 3VFVB 3VD5A 1KG0B 4BFIA 4L4VD 4N9GA 3TC9A 1F6AA 1KIPB 2VABB 5HVFB 5GS0C 4YDIL 3K2UH 5C0ND 3UAJD 2IAND 3BVNA 4M02A 4NSKA 4S0TD 4LPCA 1YECH 4LRIC 1EEZB 1IGJA 1JTTA 4JN2B 4NP4L 1S9WA 4JZJC 4JM4L 5FCSH 5CEZD 3DXAA 1DE4A 1S7TB 4JFPA 5KJRL 4PRIE 2YPLE 4N0UB 3HE7D 1D5MB 1I9JH 1RFDL 4HIXL 3HMXA 3BP6B 1CS6A 1K9TA 3WYRA 4IRJC 3K8LA 1IGYB 1I1AC 1JN6B 1YC7A 4GAJL 5EO1B 1FFRA 2I9LB 3TVMA 1KLUA 3ZKSD 4YBLB 4NO3B 1JHTB 2DJSA 5F89B 1W0WB 2K9UA 3AMLA 5LGJA 2I27N 3PHSA 4JN1L 4TRPH 5ICYB 3MOBL 2SEBB 4OCRL 1Q9WA 4Z7WB 4HKZA 1T5WB 3T0ED 3MBEA 4PGBA 4AY0A 1S9KC 2BFVL 4G43A 1KTLA 2IC2A 2QQKH 2VB5A 1RVFL 1MCBA 1MIEL 3ARDA 2Y5TA 4U0RC 4KKBC 4KDWA 3NVQA 4LHUA 2BNUB 5F93C 4BZ2L 1CFNA 3M1BA 1BFVH 2ZUXA 1PZ5A 3EYOA 4N5EA 1INQB 3UJIH 3JZ7A 1YPZB 4LAQL 2KZWA 3L5HA 4G6JH 1JPTL 4ZG1A 5KVMC 4G6ML 3PL6C 3MRBA 4UZGA 2UZYB 2APTA 4F9LC 1XGQB 4CJ1A 5FO7A 1LK2B 1R5IA 4GG8B 1T83A 3GMQB 5B38A 2WWMD 1FORL 4L29B 5TJWK 1G7QA 3K74B 3PWPD 5LVEA 4M1GL 1IAKA 4LSQH 3PNWB 1DQJA 1KT2A 5D2NC 3TFKD 4Y5YC 4XP9H 4KK8C 4Y4KC 4S1SH 3TIDA 2W60B 4MNHA 4ODWB 5HDBF 4Z7NE 2FWOA 5AD0B 5HSFA 3CDFA 1Y0LA 3PGDB 3QULB 3QPXL 2Q8BH 1ZHLB 3LQMA 4K55A 5GGUB 4EUPA 1BZ9A 1NAKL 1WFOA 3AMKA 5JXEC 4PUBL 3RVXC 1AQKL 5C0JA 3D39B 4GS7C 2IANA 2DM7A 2EDXA 2RJMA 3EIFA 4RRPA 3TPUA 4CVWA 4XCYA 4FQXA 4UT7L 1EFQA 4BSWA 2DWDB 1KPUB 3P9LA 3LMJL 2C4FT 3O9WC 1KPRA 3VFTB 5HYJB 1YMME 3O8XB 1UCTA 3RL2B 2AXHA 1SEBB 3STLA 4YWGL 1IT9H 4F9PA 3WNLA 1JWSA 3A6CL 4Y4KA 3VXUA 3I84A 2Y06H 5MEOA 3PDOB 2XA8H 4I0PC 5B8CB 1P4IH 3C09C 3H8NA 1MCSA 1NMAH 2X7LA 3MCKA 5DMKB 3L3KA 4PJIF 4YFLF 4M61B 4P2OB 2BC4A 7CGTA 3DMMD 5KSUB 2XZQL 3AAZA 3KPQA 4XPHL 4Q58C 1CGWA 4I48A 2YZ1A 4ENEC 3PQYD 2WIIA 3EO0B 3R8QA 4ZXBB 3BUTA 3QRGL 3NCYP 5TDNA 1XMWA 3KLAA 1F90L 5JORA 3QXWA 4B7IA 4M7LL 1U3YA 4W6XB 1MI5D 3GSQA 2VLRB 3ZDXF 3V6OA 2VSDA 4PRID 3SE3C 1OHQA 4JKMA 3BESR 3FZUD 3C08H 5DMJB 4TQEL 3RX7A 1SMOA 5ID0B 1SVZA 4HS8H 4YFDB 5E2JA 5JA8B 5JIKA 3FL7A 2VDOH 4G80B 4RFEA 1IEBA 5JXAL 4EOWH 3BZFB 2C1OB 4P4KC 32C2A 5I75B 5CSZA 3ZMRA 2QSVA 1INDL 1DVFC 3FQRA 4LASL 1RULL 1VCAA 4OLYL 2OXGA 3V4VL 1U58B 5T5NG 1L7IH 4GKSB 3G5VA 1N6UA 4AIOA 4BH8B 5IHBA 4V2BA 3INUL 1Y6NR 4OM0H 4XBPB 5IGXH 2W91A 1DBAH 2UUDK 1T2JA 4JPKH 4NO2A 1XGPA 4X7DC 1IAIL 3S37L 3GMNB 2R2EB 2F53A 3TBYB 5HVHC 2AJZA 4JRYE 3RY4A 4MJID 5E2WL 1A5FH 1HNFA 1MCIA 3HE6B 2YMXH 3NCYS 3QCTH 1KN2H 2ZSVB 3WFDH 2OX5A 4GRLD 1T20A 1IM9B 1NCAH 2XA3A 4YHNA 8FABA 2OTUA 3RX5A 4KGJA 2Z8VC 1JHLL 3UTZB 1RURL 3S7GA 2O5XL 1MCPH 1WAAA 4Y5VA 2NX5E 1JRHH 1TJHL 4WW2B 4PPTA 2YK1L 4NWTL 4ZOCA 1ZEAH 1WVZA 4XNZC 3RGVB 1EV2E 4M8VA 2P8PB 2IQ9H 3ULUD 4WEBL 4HPYH 2NR6D 3QIWA 4E42A 3IVKA 5KSBA 4HQQL 2CXKA 5CSBA 1FFNA 4KDTA 1ND0B 1XGYH 3WNOA 5EIIB 1JGVH 3BJLA 4MA8L 4ZFZA 1FGVH 3SDXA 4D9QE 3W5MA 5SWSD 3PV6B 2BOCA 3V79C 5L7XH 3BKYH 4PJAA 5C0EA 5J1SC 3HHRB 2DIBA 3BGFB 4QHUA 4GAYB 4ODSL 2HMIC 3B9KA 4R8WH 3SOBH 2Y6SD 5FHAL 4HW6A 2P4AB 3MRGB 1OTUD 3T3PF 3OGOE 4TN9A 1NEUA 5T3ZL 3BMVA 5BVJA 4KRLB 3S36X 4DGYH 1V3LA 1S7XA 3KLHD 4G59A 1UZ8B 1UC6A 2V7NB 4JFZL 3TA3C 4JFFE 2PCPA 4GRWB 4MZ2A 1WWCA 2CLZA 5C0BE 2XTJB 2HKFH 4JKWA 3WNPA 4P49A 4QCIA 2HLFD 3X13B 4MJIE 4OIIL 1FL3A 3MJ7A 1J0IA 3WFHB 4YBLC 3HZYB 1KCSL 4BUGA 5IF0B 1FV1B 1ZSDB 5JDJA 5JNYA 1CQYA 5EC2B 2M2DA 4PJCE 5CSGA 3VFGH 5HYFA 3KHOA 3HS0A 1U42A 2VNCA 3BP5B 4IRSB 3MLWH 2DQGL 4O51A 3B5TA 4NKIL 1U41A 3LMJH 4LVNC 1P7QB 5JMOC 1GGIL 1HHIB 4E5XB 4HX1B 5D1XA 1T03L 4H8WC 1E6JH 3E3QC 5HGGS 2VZ3A 4XAWH 5J6HB 1FGNL 4KQ4H 1FE8L 2BNQE 2DQJH 4HS3A 3U6RA 5ACZA 2AJSH 2YRPA 3RWEB 2OTWB 2DQEH 5JW3L 5DZNA 1VFAA 2EZ0C 1ORSA 5E8NA 1AE6H 4IOFC 4NOFA 5D1QB 5EU6E 1S9YB 4JZJB 4JAMA 4PJGE 1OSZB 2V9QA 6FABH 1CBVL 3VXRD 5FYKU 3DV4A 4Q6IC 1F4WH 4UAOB 4WO4D 4YEFA 1IE5A 1CE1L 1E6OL 3CSYB 3DX8A 4N0YL 5D4QA 4LCYB 4OUUA 1IGMH 3RAJH 1PY9A 4IRJB 3LOWA 2XN9A 1T7ZA 3EDKA 3OXRA 5BJTA 2P5EE 3QPQD 1RZ8B 3U9PL 1A1OA 1FFPA 4O58H 3MLZL 4I5BB 1W0VA 5I16A 2IFFH 1ZHKB 4JB9H 2OK0L 4UDUA 2MPAL 3I6GA 2BX5A 1CLZH 2YEZA 2BMKB 5HHQB 5HDQH 1YEKL 4LPXA 3O3EA 3UZVB 5SWSB 2CH8A 4ZTOL 4BZ2H 4H1LH 4HD9A 5TE7H 5C2BH 4HGWB 4PRPE 5M94B 4Z7UE 1XF5B 2DI8A 3BO8B 5GPRA 1QFWL 2B2XL 3UC0H 4LP4A 4FQIH 4PJ8C 2GSIA 1IGJB 4NRXA 1XZ0A 5C08A 3D0VA 4J4PD 1FSKB 3VRLF 5J9PB 4L3AA 4OLZL 3S35L 5D1XC 3CXHJ 2Z4QB 3LKQA 4KK8D 1FVEB 3WJLC 4F7TA 2V6HA 2E7LA 5F3HB 4P2QB 4Z7UB 3ARQA 4Y4FD 2FGZA 1MCLA 4XPBH 3L3DB 2B1AL 4ZDHB 4CDHA 4K3GA 5FCUH 1JI2A 3IFOB 2C5DC 1MCOH 4X6BB 3CH1A 3O2VH 4AQOA 3FKUS 3DMMA 4FTVE 2BY0A 2IQ9L 1H3WM 1CGXA 2PKDA 5CZXC 4LGSB 2JIXD 3H9SB 4KHTH 4DCQB 4YDLC 2E6JA 5D6DA 1AGEA 4LHUD 1NAML 4R4BB 4ZUTB 1DL7L 4YDIH 1FAIL 4MAYA 1EMTH 3MJGX 1NFIB 5EWIL 1JHLH 5I8EB 1C5CL 2X9YA 3GIZH 3QFDA 3GNML 1GPOL 5C8JB 1ORQB 5D6CB 1RIVH 1FYHB 4EBQH 4YZFF 2JELH 1WIOA 1I3GH 4U31A 1AKJB 2APBA 1A1NA 1YNTB 3S37H 3EFFA 4BQ8A 1HINL 4ZO8A 2ZOKB 4WWKB 5DVMA 3QEGH 4UT7H 5EPMB 1V5JA 3DI3B 3B9KD 1KTKE 5BV7H 1BEYH 2CDGB 4X6DF 5KVDL 4CN6A 5IMKB 4MD0A 2HT3C 4E41A 1G6VK 1ZA3B 3NABH 3FO0H 2V2WA 1X5ZA 4XMPL 3SE9L 5IWLC 4MDJA 5C07E 5DI8A 3JUYA 2VZVA 3G04B 4U1KB 4PY8J 4P0DA 1JYWA 1DLFL 1T1XB 3OAZH 1CGVA 3IGAB 5DEGA 1K4CB 4XZUA 3MJ9H 3UTQB 1EA9C 4HS8L 2BRQA 4LKCB 3ERYA 1I1FB 3DXAD 3QJHA 3E3QA 3KPMA 2IGFH 2R1XB 1CIDA 5DTFA 4RDQG 2P7TB 4M48H 4LBEA 3EUUA 3MJ8A 3AS2A 4M9OA 1D6VH 3ARUA 1CF8L 4MJIA 5BRZB 2BOBB 2HKFL 5I76B 1MQKL 3BUYA 5IB3A 3B2UC 2R15A 5H35B 3Q5YA 2ZSWA 4POZD 3VH8B 1JMXA 3UROR 4KC3B 4YUEH 4I0KA 1U8LB 3LHPH 4I2XE 5JTWA 4CUCA 3S96B 1CG9A 4M6NH 1RUQL 2WQ8A 3BI9X 3NFPB 4I0PD 3T0EA 2EDBA 4WWKD 5BW7A 3HR5A 1A7QL 3P30H 4IHOA 4EI6A 2BNQB 1S5IL 4OZ4B 4ETQB 4X6CA 1TNNA 2WIIB 4Z18A 2CLRA 3PWUB 3Q6FB 1LK3H 1U91A 2DDQH 4LLYA 4C83A 2MHAB 3ULVH 3SDCA 3O45A 4KJWC 1MH5A 4ZFGH 5JIHA 4NSKB 4OAWB 4MGXA 3L3HB 1OAZH 2XRAH 4G9DB 1GGBH 4XB7A 3BDXA 1YEIH 3VD9A 4KKCD 4OFVA 3SDYH 1VACB 5JPMA 5BZDB 3MXWH 2BCKA 4JPWL 1PEZA 2AP2A 4A6YB 2EKSB 4ODTL 3FOLB 1CGSH 2PUQT 3HAEB 1PZ5B 1JNLL 3QEGL 1SYSB 3CDCA 5FYKH 4MQSB 3W81A 4CN4A 3R0MA 1T0NA 1BEYL 4BKLA 1UB5A 1WICA 4XNXH 4BUHA 5LCVL 5FO7B 4CU7A 1NJ9B 3IDMA 4PJFA 3BH8A 1BVZA 1NCBH 3WN5C 3MBEB 1BFVL 2Q76B 2NW2A 1DDHB 2J8HA 2DQCL 4HK3J 3ARBB 5IVZB 3WFEL 4PRDA 3GSOB 4M8QA 5H37G 1TCRB 2Y5TB 2O93L 4OZFG 1QRNE 3ZTNH 1BM3L 4ZUSB 2WP3T 1C08A 3FN3A 2JJSA 1CFNB 1IM9A 1S7WB 1IFHL 3SDAA 5D1QC 4LOUD 4Z95H 4D0DA 3EYVB 4HIEA 3ECBB 4TTDD 3WHXB 5DJ2A 2BERA 1Z0MA 2Q7YA 4V1DE 1EHLH 2QQKL 4OFKA 4ODXA 1P84K 1MVFA 3BD5A 2E7BA 3D2UD 4QKXB 1ZHNA 3AU1A 1BOGA 4JCMA 4LQFH 3O41A 4HDIB 4JO1H 4BSVA 3HI6H 1MWAH 5T3ZH 2FH8A 5BQ7A 3QIWB 1ZWIB 4L4TB 1KPRB 1WIUA 3VXNA 3CXDH 5DQJA 5D7LA 4LCIH 1QTYT 2J3SA 2XKSA 4I0CC 3MNVA 4PJIE 2VXTH 2EICA 2GW5A 2HN7A 1J05B 1FH5L 5DJ0B 4RISH 3P73A 1IKFL 4X6FB 1JP5A 2P5WA 1DBJL 5F88B 5IB1A 2W9EL 5FYKE 5IB2B 1F8TL 5CP7A 2N1KA 4EZMA 3IETA 3WIHL 3ZKND 4J7RA 5KOMC 5JOPE 4JM2A 4OI7A 1KPUA 3P9LB 1T21B 1A7NH 4NUJA 5H94B 5BVJB 3OTTA 4L8DB 3GSVA 2P47B 3LEVL 3V6OC 2JK5B 5E8DL 4UT9L 5GRJH 2PW1B 2X40A 4PG2C 1MPAL 5I8KL 2YKLH 1TJHH 2ADIB 3MLTB 2I60L 3BPLB 1QR1B 2E5EA 5KS9F 2HFEB 3EYQC 3NFNA 4LEXH 4QGYA 4YBHA 4ORZC 1F3DH 1KIRB 3CD4A 3D85A 4J4PA 3SPVB 2DOCA 4L4JA 3VXQA 4KI5E 4PYHA 2IPUK 3P40A 2RCSL 2XZCH 4TUKL 4CMMA 4NQTA 4G7VL 1HEZA 2GT9B 3MV11 4LDEB 3BMWA 1A14H 3O6LL 4YX2L 1CIUA 3KS0H 3LPWA 3IU4H 3MACH 4NZTL 1ADQA 3K8KA 3E6HA 1SJEA 2X44D 2CKBB 3SDDD 4FMFA 1U8PB 5D5MA 5IVXA 4IEFB 1HQRB 4Z5RA 3BZFA 4TUJB 1KIQA 4KTEH 1PGRB 4X6CE 2ESVA 4AZ8A 1GL4B 4N8PA 3N0PB 5GGVY 1H8SA 4K3EL 3AREB 4GW4B 4P46B 3MJ9A 3NZ8A 3EJYC 1XGTA 3P0YL 4RAUA 1TXKA 1WWBX 3WFDL 4IOSD 1NAMH 1M4KA 4HC1A 3RWGA 2VERN 3IYLW 4XC3H 2YPKA 4NN5B 1AC6A 4LCWD 5JXED 5GS3A 4M7KL 4ELME 3VDBA 5DEFB 4UIMA 2PXYA 4K71C 1ZLVH 4OIAA 5E9DD 1G9MH 3MLSH 4ZS6D 2VAJA 1DBAL 2AKRB 5C0EB 3R06B 4V1DD 2IBZX 1JGEA 4RDQF 4HUUB 4YHZH 4DZ8A 2QR0B 4KHTL 1AC0A 1IILE 1QEWA 4MXVE 1NFDE 4X5XB 1ZGLM 1IZJA 1UKSA 5CWSA 4O2CB 3VXTA 1DQJB 5HHOD 1IC7H 4ZUUB 1U92A 1KB5H 3QISA 4DOHB 3Q6GH 2V2TB 3HZMB 2VL4A 5JW5A 4UT6L 2W59A 3VFSB 5TGBB 1E4XI 4GAGL 4MS8A 3DVGA 2WBKA 3BZEB 2FO4A 2BVPA 2VXUL 3PV6A 5IHLB 4FQ1L 3MPCA 1Z9SA 3OF6A 4NBZB 3V4UL 2RIKA 3SGKC 2Q8BL 4EVNB 4L8CB 2VC2L 2X4UA 3NCFB 1FBIL 4HPYL 5GRYA 3HC4L 1IL1A 4LHUG 3X3GH 5GRUH 1N0XL 4P2QA 4HQQH 3ZSTA 3GJFH 4P5MB 4YHOH 1QVOB 3VFTA 5HYJA 3IJYA 2H9GB 1F4YL 4Y4FC 3GBNH 3UXFA 1FPTL 5MHSD 4X6DA 4PJGA 1GOFA 3SDXF 1RAMA 3LZFL 5DRZB 1P7QD 2XFXA 3B83A 3EYUH 4M5ZH 1UXSA 3KPNB 4GLRH 1CICA 3CAFA 4JRYB 4OF0A 4RMSA 5C6PB 1H9VA 1N4XL 2EIZB 2NY5H 4PB9L 3SHSA 5IKCB 2FJHB 4A2MA 5FYKL 2PYEE 5F70A 4LMQE 2VWEE 1U3HC 3DO7B 2ZUYA 3MUJA 3KLAB 4X4YA 5JORB 3MOAH 2NXZD 1XR8A 4ZUWB 2EDEA 1GGBL 1QFUH 3MBEC 5EC2A 1HH9A 2AK4E 3O4LE 5FHBL 5D1ZD 2XKUA 2VMFA 1OLZA 2WANA 5F9WC 1DE4B 3ARBC 2NY7H 4LLDB 3V52H 3EFFB 4U1HB 7FABL 5MI0B 4DQOL 2P5WD 4MHHI 3BGMB 1DUYB 3B3IB 4N8VG 4OIBA 5DSCA 5DD5H 2VQUA 2F9BT 1LK3L 4G7VH 2FR4B 3U0TA 4U6XA 3CMGA 3HMWL 3FMGH 2EH7H 3HNVH 25C8L 4ONFH 1S9XB 5IB5B 1W0VB 2GFBA 4N0CA 2D3VA 2H2SC 1VGEL 2GTZB 5GISH 3ZDZE 5L8LB 4P5TB 2ZJSL 3U2SB 4UINL 3RUGB 4KAQH 4LEOB 1P7HL 1KCSH 1A3RL 1KTLB 1YQ2A 4QT5A 1GAFH 1LGVA 1U8JB 2R1XA 4U1LA 3WD5L 1C5BH 5AZEL 2ATPA 2HKHL 4LLUB 3STZB 4QRSB 3TF7C 3CSYA 5BMFL 2R69L 1EJ6A 1M7DA 2X1WL 4FQJH 4F7PA 4JFDA 2YPVL 2P24B 3RZWA 2FEDC 5EUOF 1OGAD 2FX9H 1NAMB 1RZ8A 1C7SA 1ZHLA 2NZ9D 4JHBA 4M1DH 3VFWA 3VXSA 2IALA 4P4RA 4XXCC 1OAXH 3DURB 1OAQL 1IQDB 3RWHA 2M8XA 1NBQA 2HP4A 2AVGA 3IFPA 5D8JH 1SY6L 2R1YA 1MWAL 1XR9B 3H42H 3CXHK 5I1JL 2VQ1A 1K6QL 2UZXB 2BNQA 2VDNL 4NZRL 1U8QA 4AMKL 3FB8B 3QHZH 4PP1C 1IGFL 3BO8A 3O81A 2UVEA 5LKNA 3ZE2E 4FP8H 1URLA 3ARDD 3TNMA 3KYNA 5MEOB 4IIQB 1NPUA 1OL0A 1YY8B 5TH2A 1P9MA 4O02L 2X2YA 4PGDB 2GK0A 3HB3C 5F96L 3VW3H 4KKNA 2QQQA 1T7XA 4WCYL 1KELH 1NFDA 1R24A 5F8QC 1RZKH 3ME0A 4X5LA 1EEQA 1EFXA 1MJJA 5BZWA 3GGWA 4KI1A 4HEPG 2E3VA 1ZLUK 4K94H 1EAJA 5EU7C 1T6WA 3RGVD 2VWEC 1T0NB 4BQ6A 2F15A 1TPXB 1YPZE 5ERWB 5HGAA 1GRWA 5A2JH 3IFOA 5B39A 1RHFA 4ODHH 1MCWM 3KG5A 1CDBA 2D03H 2X9XA 5C0AB 4J6RH 1CYGA 5HYSB 2A83B 5E24E 3GMLA 2OYPA 3BKJH 4PRDB 1BPVA 4E41B 1Z9MA 3MROB 2ZCKH 1AGDA 3WS6C 5EH1A 5DK0A 1O5DT 1NMBH 4ORGB 3UTTB 1XCQA 3MGAA 1MFBL 4NNPL 4P46C 2E27L 2DKSA 4RFNC 3QFDB 4MJ6B 4KXZH 1L7TH 3OZ9H 3QDGA 5D6CA 5IBTH 3V6BR 2ID5A 1KB5L 3QYCA 3SOBL 4JRXD 5FA4A 5FYJD 2NNAA 5I19L 4KTEL 3HN3A 3QUKB 5DD3H 4PRIB 3N1GC 4PJXF 2ADGB 5I1KH 2WY3A 1WCQA 4OZHF 3FQXA 3MYJA 2V5YA 3TYFB 5C0RH 2OTUB 2J8UF 1XIWA 4KJYA 4PLKD 3CVHB 3L3IB 5DMGC 1JRHI 1OW0A 1WTGT 4RGOH 4Y19B 4DFIA 5J57B 1MJ8L 2VDPL 3UTQA 3PQYE 3ROOB 4LKCA 1JHKH 1M6OB 3DX8B 4NZUL 1EAPA 5DJDA 3MC0A 5E5UB 5I15H 1BIIB 1JNNH 2DTML 4JCLA 5GRXG 4PV9A 5C9JA 2Y07L 1CXHA 3CK0L 4TSBL 4U3HA 3MRLA 5DJ8B 1MELA 4Y7MA 5DQDH 1NBVH 3VFRA 4WNQB 4HJJH 3HKFA 5IB3B 3VXUE 2G9HA 2WBJD 5JW4N 5E94A 1UWXH 2FHCA 4YJZL 2J5LC 3W9DA 3VGDA 1GIGL 1NKRA 4UIKL 1YEJL 2H45A 2BY3A 3RKDC 3O3BA 4R0LC 4L3CA 1A9BA 5ESAA 1CFQB 4I77L 1XFPA 2NY5C 3QG6B 4OGAD 3RTQD 3VXQB 3VXRB 4D9QD 4R90H 2QHRH 4E42B 4UMGA 1WBXA 4KZDH 4LIQL 2AQ1A 1D9KB 1HEZB 2GT9A 4OCYH 2FL5A 2E9WA 3U9UA 4W6WB 3C60A 2BSRB 3QUXA 3E6HB 3WFHA 1IMHC 3KAAA 1ZT1A 5JPNB 5DJ6A 5ACLA 3GUTA 1MFDL 3Q1SH 4HKBB 3TV3L 4Z7OE 4AENA 4WFHD 2DBJA 3CVIH 2ESVD 3MRGA 3CPLA 4FQQB 4RBPH 3LEVH 1XGUA 1CICD 2O5YH 2VXSH 4FXKA 4KAQL 5DJ2B 2BY2A 2QADC 5MI0C 5TPWL 4PJDF 4FTVB 3QXDA 1VGKB 4NP4H 3CFEB 4K7PX 4OQTA 4R7DB 5IW1A 1TNMA 4PFEA 4F8QA 1I8IB 4OLXH 5AUMA 3LS4H 1FL3B 2Y7QB 3L5WB 5MP6L 2ICEA 5FYJU 4F2MA 3ARBA 1HSAA 4FQCL 1DUZB 3U79A 5DK2A 5DMIL 3MYZA 4MJ5B 2VZTA 4P5TC 1H8OA 4I18A 2UY7A 2CPCA 3V52L 3SO3B 4IOIA 4NYLA 1ITCA 3ECBA 2VDRH 4M7JH 2OSLA 1QEWB 4C59B 35C8H 5DJAB 2DQEL 1OAYH 4NKMA 4YHPA 3WS6A 2W0KA 3WEXB 3BQUD 1HQ4A 5EBWB 3UZEA 5IMMA 3MRCB 5C86A 4TSCL 4DN3L 3GRWH 4HUKB 1KB9J 1K2DB 3B9EA 2AABH 1J8HA 1A1OB 1NGQL 3LY6A 4H26B 2KQMA 5LG1A 3GSVB 4I5BA 2MJWA 4U6HA 1B2WH 1U3HB 1UEYA 3IDNB 3MRQA 4X6EA 1A21A 3U9PH 4WUUD 2ZWLT 2I5YL 2Q86A 1NCCL 1ZS8A 4JZJA 1ZAGA 4Y16A 5HI3D 5F7NC 1KJ2A 5D7IE 2GCYA 3OG4B 4U1IB 3NAAL 4M7KH 3I2CH 1PX4A 4KKCC 5B4MC 2W9DH 3FMGL 3TO4C 1R3KB 3UTSA 4H88L 1RZFH 4HULB 1AD0B 5FGSA 4TNWF 5C08D 1Q9LA 1MCCA 4HAFA 3VH8A 2R4SL 3OQ3B 2JK5A 4RISL 5F96H 1V7ML 4OT1H 1KTRL 1A4JB 3VFMA 3ARRA 1EHAA 4HIHB 1ZHBA 4JZOA 5ISZB 1JWMB 4URTB 4MDIA 2Z0BA 5ALCL 2J88H 1HHKA 2X4OA 5EU5A 1TPXC 2X4QB 5JOFA 5F6IC 4FQXC 5I73C 4KDTC 4JHWH 2JCCE 5I1HH 1UA6L 1YMHA 3MREA 3MACL 4ISVB 4JQXA 3IAPA 3VXMA 4UIKH 4YPGA 2DN7A 4K2UL 2XWBA 1AD9B 5E9DA 5IV2B 1IEAA 2GITA 3HC0A 3U4BL 1J5OL 1O0VA 2P44B 3SJVA 1OAZL 2XRAL 4H20L 4OFPA 3QULA 3LDBC 2AERT 1RZ7H 3VRJA 1FVCB 1EEYB 3TT3L 3MRNA 1SVCP 5BOPA 4ZFFA 1BF8A 3QP3A 4LLMA 5DJYB 5KSVA 2R0LH 1KC5H 4AYFA 2VDPH 4M03A 4N0CC 5EBGA 1DQLL 1KB9K 2D2OA 1OTSC 2AGJH 1KCVL 3I75A 5DJCB 4U1GB 4Y0GA 5EULV 2Q76A 1P1ZB 5JQHC 4PJCF 4PJ9A 4U1JB 4M8QB 2Q8AH 1AGEB 2VDQH 3P4MA 4G9FB 1OD9A 2YS4A 1ED3A 4KHXL 2NY1B 3SJVE 1JF6A 1K8DA 3H0TA 4Q9BA 4KI5C 4QRQA 2FB4H 5DQ9A 1N7MH 4HFWB 3QWRA 2NW3A 2F5BH 4WEMB 1JFMA 4DZ8B 4ZUVA 2L4OA 4YXKL 1IL1B 3DUSB 3QDGD 5ID1A 5IMLA 5EU3A 2FECL 3MOAL 4WJ5A 3ILPB 4LCCC 4JJ5A 3RNQB 5IQ9B 2CDGA 4P2OD 4NWTH 2DF3A 2AXFB 4OV6F 4MD5B 3V6ZA 4PV8A 2V2TA 2G2RA 2D9QB 5ALBH 4ZPTA 4JRYD 4YDJB 4Z7OF 4LPWA 4MDJB 2YUXA 2VXQL 3KPSB 3LEXA 4XAWL 2B20A 4XVUC 1W72H 5BXFB 4LAQH 1IC4L 1RHHB 3EHBC 3JV0A 4MA1C 5I17B 3LRSB 5KS9A 2Z92A 5GSRA 2VR9A 4LU5L 3KPMB 5DJZB 2CLRB 3PWUA 4C83B 4XI5C 1D9KC 3LKNB 3H7BA 3SGKA 2AJZB 3U4EB 2FX9L 1MJUL 1TZHB 4GKOA 2ZJSH 4QRPE 2I5YH 5T1MA 5CEXA 5HHVL 4RGNC 3SE4C 2NY1D 4Q2ZA 3H3PH 3L1OL 1C1EH 2AK1L 2A83A 4M7LT 4KWUA 3O2DH 4L3ED 1T1WA 1DEEB 3OPZL 1N3NB 4M4RA 3PABB 4OCNC 1FIGH 4KKLC 4QXUH 4XPAH 2HT2C 1A0QH 4D9LH 4ORGA 3UTTA 1RJYB 1QSED 5E5MB 3PWPA 4ONHB 4KV5E 4DUWA 3ZTJH 3IVKB 2R29H 4C55A 4FQIL 2J1KA 4PJ7E 1OGAA 1MVUA 1OAKL 3GK8L 4L5FL 1J1OH 1B90A 4JDVB 2I25N 4Y2DA 2W1NA 3GSRB 4JM4H 2J5LB 1RZFL 5F9AC 5C92A 3HG1A 3JV4A 4DTGH 1GZPB 4QHUB 1DUYA 5DSCB 4FZ8L 5IOPA 4JFQB 4TVPL 1FO0A 2ORBH 1A47A 3J8F7 5FB8A 1UB5B 1QSVA 1OP3H 3P11H 2VE6A 2VRAA 3O11A 1BBDH 3NZHL 4J12A 4E9LA 5E2UH 5FYLH 2GJZB 3F7VA 4NZJA 4J6RL 5F21B 1BBJB 43CAA 3SE4A 3BDYH 4YBQD 1YEHL 1U8JA 5LGHL 4AG4H 1CD0A 1CBVH 1Q0XL 1BIIA 3L95A 3JXAA 5DDHB 4HHAA 4F7PB 5TQ2H 4QHNA 1HIML 3IFLL 3QI9C 2XY1A 5KN5B 4ZAKD 1P69B 1K8IB 4LARH 4JN2A 3MGTB 4ODXB 4OF5A 3PHQB 5JQ6L 1QNZL 1ES0A 3IETB 5IVXE 3F58H 5L2JA 4GG6E 5D9SA 3VFPB 3MLWL 1OT1A 3GJEB 1HHGA 4QRTA 1FVDA 4DAGH 3IRPX 2DWEA 2WLZA 1JZ7A 2X41A 1C5DB 4L4TA 4P2RB 5D2LF 1GGIH 1SEQL 5EO1A 1MUJA 3ALWA 4P9MH 1PLGL 3KLHC 1RK1A 3TA3D 2FO4B 3UJJL 3CFDA 5K9KB 1H15A 1XGRB 5KVGL 3U9UB 3PQYB 1AI1H 1BLNB 2FBJL 5J12C 1XGYL 3BRDA 1OQOA 5EN2B 5I73B 4Y19E 4NC1C 4QHMA 3D85D 2P43B 1AGDB 3U4AA 1F4AA 1S7RA 1OVZA 3FO1B 2NTFB 3WE6B 4M62L 1R0AL 1OARH 3SKMA 3LIZH 1WITA 3B6SB 4QXWA 3HI1A 2G60H 2HYMA 1V3KA 3QXUA 3GSNL 1OF2B 4L8DA 1T22A 1N64H 5ACMA 3DSFH 3M07A 5ERWA 1E4KA 5HGAB 3GI9H 3LDBB 1S3KL 1VGKA 1SJEB 4H0IA 2UWEB 3U0PB 5IW6B 5FA4B 2YUWA 3D3VE 3V4PL 4G8GE 1CFSB 3BJ91 4R96A 5B38B 3HMWH 1DQML 3I6KA 2XA8L 3QQ4B 4FQ2H 1CWVA 2VXQH 3ES6B 1QSEE 1WISA 3PNWA 2RHEA 4KJYB 3ARYA 4LHJB 4U1GC 4NO5A 4PGCB 1FJ1B 1KJVB 3VXOA 5I0ZA 5D2LB 3MLUH 2VLKE 2PNDA 3LV3A 4I77H 3ETBF 4RNRA 4X80H 2EDWA 4X5WB 3ARTA 4GAFB 1M6OA 1BX2A 3OR7B 2I9TA 4P57B 4FOMA 1W8NA 1NC4B 1R3JA 1IKNC 5I8CA 5C9JB 2Y36L 1HN1A 1J18A 3C8KA 5TE7L 2CDEB 3W9EB 4XP5H 3TF7A 5LAXB 4FQXB 3B5HA 2BNRE 1MJ8H 4V1DA 4DKEH 1F45A 3L5JA 4DVBB 3QQ3B 1EMTL 3LN5B 5SX4H 3GEWB 3EOBB 2P42B 3N1PC 2J4WH 3MODH 2NXYC 1IGTA 2FGWL 2O5ZH 4O2CA 4L3CB 4QRRB 3VXTB 1MEXH 3QA3A 2HH0L 4NQXA 1FDLH 3WL9B 3T3MF 3QWOB 4NQDA 3REWA 3STZA 5H2BA 3RWGB 1AHWB 1AQDA 3L3KB 4JPVL 1KC5L 3PWVB 3AAZB 4QO1A 3U7YL 3GSXB 1F97A 4UIMB 1YYLL 2APWA 5CD5C 1NGXB 5IG7A 5ADOL 1DLHB 2HVJA 2C3VB 3U7WL 5I19H 1KCLA 3GSQB 4G5ZH 3DRTB 2EZ0D 5IP4A 2MCG1 5HI5C 4RMRA 5DJ6B 1A6VL 2IBGA 2F54D 4HFUH 5AAWA 5E03A 2X4OB 5EU5B 5JOFB 2A9MH 2B5IC 1EPFA 3R4DA 1IQWH 4NQED 3ZKXC 1Z3GH 1IGIH 1IEBB 4RGNB 2F5AH 5FO9B 4PDCE 2Z93B 4ISVA 1X6LA 2XFXB 2VLKD 3DX7A 1U9KA 3QO0B 1NL0H 1I1AA 4O4YL 2B4CL 2CRZA 2AK1H 2YOCA 4JO2H 5I1LA 4Z8FH 1NSNL 1CL7L 2IQAA 3QCVL 3WD5H 4LPTA 3X12B 1MFCL 4AEHL 2D0GA 2DYPD 3QNXA 4IBLT 4PP2B 2QSTA 5KVFL 1WQVT 3DO7A 1DUZA 2JLLA 3VWJB 1CTNA 5KSVB 3E2HB 2QSCH 1KEML 4KJPD 1TJGL 4MA7H 3GSUB 3SGDI 2BVEA 5L2KE 4MCZB 5BRZA 4NCC1 5DLML 4JM2C 2ZSWB 4MA1B 5CZVL 1I8IA 2BRRL 3IDJA 3C9NB 5DZLA 1HIMH 3IFLH 1M71B 1NC2D 5E95B 1CD1B 1VPOL 4X6EB 3UTPE 1Z9LA 4PP8C 3GMRA 2VR4A 2C9AA 1GIGH 4TVPD 5D2LE 3H3BC 4JFXB 5GS1A 3HRZA 3VGAB 1W72B 4ZPVB 5HJ3B 2XWJB 3GMMA 1GHFL 2HJFA 3BN9C 1N0LA 4U1HA 5ESQB 3ILQC 3CSPA 3GNMH 3HB3D 4HMEA 3QWQB 5LGHH 3OX8B 4NQEE 3OXSB 4JFDB 1U95A 4I4WA 3GSNH 1NBVL 5MHSE 4O9HH 2PF6A 1Z9OA 3BXNB 2VLLB 3HTLX 3B8YA 3C2AH 2PO6D 2J6EA 4JG0H 5I1CH 2CGRL 2XZQH 5D7LD 4DW2L 1KJ2H 5E2UL 1HK6A 1H5BB 4HIIA 4MMXC 2H32H 1A4JA 2ZCHH 4H0GA 2P5EA 4OLXL 4P9HL 1ZHBB 2XTJE 2V7NA 4GKNB 4QTHA 1SMAA 5INDB 5I71C 1KACB 4RBPK 5DJZA 3FO2A 4F58H 4JFDE 1DBML 4RWYL 1KF9B 2GIYA 3THMH 1O7SA 3TIEA 1M7DB 3M8OH 1SEQH 4CDGC 3U4EA 3HZYA 3GSOA 2EDYA 2GEEA 3GK8H 2DI7A 5J12B 2JCCB 2A38A 4OD1L 1W2KT 5ICZB 3QUYA 4JY6A 2V17H 3T0DA 2F54E 1L6ZA 2NLJA 3RZCD 1IGYA 2Q7YB 4AEEA 3FONA 1XR9A 3IXAB 5HYQB 3HC3L 4XBGA 3U7AA 1OARL 4PP1D 4OFIA 1KENH 2YD3A 3KYMA 3HCVB 1YYML 3TZVB 4BH7B 1BFOA 5K9QG 1MCRA 5E4EC 5MENB 4FMKA 1JHTA 3BPOC 5C2BL 5LGJB 1G6RL 2GKIA 4S1DC 2IPTH 2OMNA 3ZHLA 4OCXL 1V7MH 1NCDH 4RAVB 2BDNL 3IU3B 3MV01 1YPZF 3W11D 5F1OB 2GY5A 3C60B 5GRVK 1E4WH 3QHTC 1JF1B 1MHEB 2ZUQB 5BS0B 1I8MB 2WINB 1DANU 1ORSB 5I1AB 1DQQB 4HF5L 1VA9A 1CE6B 2XT1B 4FRWA 3QUMA 4PRPA 5C0CD 4HWBA 3MRPB 1GJIA 4IMLA 1BVKA 3BT2H 3FFDB 15C8L 5IB2A 3CLEL 4QNPF 3H0TB 3WDHA 4JFEA 4WI7A 5E2VH 1UQSA 5L2KD 4LSPL 5TQ0H 3CNKA 5EG6C 4B7LA 1JGDA 4LU5H 4APQA 5H94A 3VD3A 3STBA 1S9VA 3MMEB 4JKLA 1V3JA 3UYPA 4R7DA 5DC0A 5CP3H 4HZAA 2J8OA 4PRAB 3BKYL 1KCRH 3MLTA 2LABA 3DROB 4H5SB 3RKDD 3TZVD 2BMKA 4U0QB 5E8EB 2EIDA 1QYGH 1LE5A 1L9MA 4MNHB 1WC7B 4KPHL 1YJDC 1SYVA 3MNWB 1SJHA 4JPWH 2BVQA 3CVHA 2C3GA 5IJVA 2FATH 1Q0YL 5DVLA 4GKZB 3CCHB 4ZAKA 4J3UA 3AM8C 1RHHA 4QRQB 1TTUA 3RZCC 3C6SB 3MGOA 2IAMC 1F4HA 2A0LD 3D0VB 5DGQA 2HWZH 1GPOH 4EOWL 2FX7L 5IM7A 2WAHA 3EKCA 1HQ4B 4OLZH 3LIZL 1A3LH 1HKLH 3DBXA 3FB7A 4PJHE 1HHGB 4QRTB 4L3EA 1DEDA 5ID1B 5IMLB 2NX5D 4HWBH 3MRLB 2FH6A 5DJ8A 1JPSH 3U7YH 5ITFA 3CFKA 5IQ9A 1I9IL 1KCUH 5KTEL 4X4ZA 4NKQB 4KRNA 1OTSD 2XKNA 2AGJL 3TA3A 4CU6A 3S5LA 3TO4A 1ONQB 2GTWA 1T1ZB 3UDWC 1A9EA 1A9BB 1MCOL 3DPBA 1A7NL 1UWGH 4FFZH 3SKNB 5HGBB 5SWSE 3WKNA 1BAFL 1KN4L 4TYUA 2A9ML 1UWEL 2OL3A 2Z91A 2YUVA 4JG0L 3RUGE 4W81A 3CX5J 2NTFA 3EO0A 3MV7B 1WBZB 4M7ZC 4CGTA 2LVCA 5CJXA 4R2GB 3MLVL 3QXAB 4DK3A 1OF2A 1TZHA 5J3HD 4WNQA 5GS1C 2WQRA 1RZJH 4YHML 1IGCL 2ZUUA 3QIBA 4QWWD 5IJKA 5DC4B 3ULUC 3HG1B 5C09D 1ODAA 1AKJA 2ERJC 4D0BA 4K9EC 2H8PB 4OFDA 1IEHA 2CUHA 1CFQA 4X5XA 4EN3C 2DD8L 4JFQA 1FO0B 2DLHA 2VLKA 3P77B 4GSDL 2VISB 5BV7C 5JHDA 5BV7L 4Z7VB 4FXKB 4J3TA 2C7UA 4JO3L 3T2NH 4LRIA 2HTLD 2V2WB 3HZKB 5IV2A 1LO0L 2VR5A 3WNNA 4RNRB 1U8HB 2CJUL 1IVLA 5ICXA 4NPYA 4K8RC 2B7DT 5C0FA 2MQCA 5GZOC 5KAQG 3BZEA 5CZVH 4JJHA 4F2MB 3VE0A 4NHUB 3I2CL 2Z35B 3K2UL 3VU2A 1QBLH 1CLOL 4KTDL 3VXMD 2VITB 4I2XB 1F3JA 2Q87A 2EE6A 3HRPA 4I18B 5EZLB 3HC4H 4ERSL 4NN7C 3GFUA 3K2MC 2R0KH 4XVSL 8FABB 4L5FH 3F8UB 3RWFB 5ADPH 3RTQA 1INEH 3VWKD 1ZMYA 4IMKA 4O00A 1U8KB 4TPRH 4QRRA 5IWLA 2Q6WB 4PJGB 5KG9B 1NLBL 1CD9B 4U3CA 2AJXH 2FLRT 2IPTL 4G9FA 1FNEB 3KPOB 2AJVL 3V4VH 1CICB 5J1TC 4HXBH 3GM0A 1KN4H 4TRPL 2Q8AL 4ZFOA 4JR9L 2C3XA 4OD1H 5DK2B 2FRGP 3GRWL 5DUPL 3QIBC 5IJKC 1O7VA 4WEUD 5DWUH 5DS8B 1A6AA 4NO0D 5I71B 1A6ZA 5GGSY 3WIFB 1X4ZA 4GAYA 2K3TA 5KANI 4F37F 2YXFA 2HT4C 5HDOA 3UYRL 5J6GA 4LLVA 4EDWL 3CLFL 1PW3A 1CLYH 3RNQA 5D71L 3EOAA 1CQKA 3HI1B 1VADB 2WZPD 2VLRD 5D9SB 4XNMA 1K2DA 1EH9A 2XOTA 3NBNA 1Z6JT 4M1CC 3W0WD 1N59B 4AEIL 5GGTA 5CGYC 2PTTB 5CEYB 5C09A 3KJ6L 1RUML 3VFMB 3JV5A 4EEEA 1E27B 2XICA 1CFSA 5FEBA 1N5YL 5C3TA 2NZIA 4PR5B 3IJHB 2YD5A 4OGAC 1WJ3A 4DAGL 3HA0A 1JNJA 2EEAA 4JLRB 3T08A 1A1MA 4ODVL 3H7BB 1S7UA 5I30L 3QPXH 5BS0D 4QRSA 1WUNT 2YD6A 1YQVH 5T1MB 5CEXB 2X70A 3MBED 3VWKC 2MSPA 5EU4B 2F5BL 3V0VB 4I13B 3WV0A 1MI5B 1MRFH 3C6LA 4HIXH 2RFXB 4HUVA 1NGZA 2M1KA 1NC4A 5ELIA 1DR9A 3GO1H 4MVBD 5DURB 5SWZA 1I1YB 3I02A 5DJYA 1I7ZA 3FRPG 1JK8B 4P2YA 3F7YB 1FFOA 3CSGA 5T3XE 4GMSL 4N8CH 5LAXA 4ODUB 1YNLH 2NMSA 5IFHH 3ARZA 2IADB 3SN6N 2A1WL 3DXAE 3ES6A 4LMQI 2JJWA 1T83C 2W65B 1YMHB 1TIUA 4QRRD 4AK1A 1VFAB 5E8NB 3C60D 2DMCA 5C6WH 3X14B 3ZO0A 3HNTL 4G43B 2VDOL 1LVEA 2E8YA 2D7NA 1LEGB 3TBSB 1DQLH 1MHPH 2E7CA 4R7NB 1NBZB 4OD3L 1YN7B 4QHKJ 3LAFA 2A6JB 4O4YH 4OB5H 4QRPA 1QBAA 3TZVC 3WIHH 3VFUB 3CFBA 3FRPA 4M6MH 2BVTA 3MTRA 3QWRD 2CLVB 1MFCH 4AEHH 4HT1H 3WIIL 2AI0L 5GJSH 5A3ID 1OWWA 2VYRE 5IESH 1G9EA 1KT2B 4U49A 1FIGL 1OPGH 2XACC 3QXVA 4XAKD 5H2BB 1AQDB 2OBGA 1D5XB 3MFFA 3SEPA 2AEQL 4NM8L 3BIKA 2XI9A 3DVIA 5DD5L 4W4OA 3ABZA 2VLJA 4PJ7A 1T66C 2EC8A 1U8IA 5GGUA 4WV1B 4J3XA 2ED9A 3DGCR 5AWNL 3X12A 1UM5H 1AQKH 4JPIB 4X4XA 3MZGB 1X5LA 3EBAA 1ZA6B 4MJ6A 1AIFA 5C70A 3MRIB 3UBXA 3CMOH 5KSAC 1J8HD 3PP3K 4XCYB 2VLRE 4LLQA 2H6PB 2PXYC 5CHNA 4Z7UA 3WLWC 3ILPA 3HCVA 2WUCL 1JZ8A 3FQWB 2NNAB 5MENA 4MD5A 5F1KC 4PRIA 4RAHA 5FO9A 2D31B 4O2EB 2B8OT 3L7EA 3WXVH 5CMAA 2A6KA 3LQAL 4J1UB 1MCWW 1FDLL 3REVB 4K9EL 3D3VB 3HE6D 4OSUH 3NIGF 4RMWA 4EN3B 1A02N 4HS6B 2DYPB 3V0WH 4RGOL 3TWCL 3TJHD 3LSOA 4ZO9A 2BXZA 1FNFA 4QF1B 2A9NL 3JWDH 4MAYB 1T0PB 1BGXH 4K7PH 4H1LA 1RZIB 4CADA 5EO0B 2YPKB 5EZIH 4RFOH 2JJVA 3LKPA 3LKSA 1LQVA 4FFYL 4WWID 2QKIB 1JGDB 4APQB 3PXHA 4JO4H 4IM8A 4XP6H 2DKMA 2XTLA 4RFEB 4ZAKC 5C1MB 1QLFB 3L9RA 4HT1L 4H0HB 1T1WB 4OFYD 3RWIB 3K8MA 2VL5A 4MSWB 4L8SB 1LO2L 3WLBA 4ZNEA 2NY6D 4OCMC 1UXWA 5DC9B 3FHQA 5EFIA 3DX9B 3FTGB 3KPRA 1R3IL 1LO3L 4Y8DC 4KK5D 3TBWA 4F80A 2BVOA 3GHEL 1YA5A 1ZOXA 2AEPL 3DVGB 4X5WA 5CEZH 4JFXA 1D9KA 2X4SB 5GS1B 3D0LB 1MHCA 3QZWA 3OL2A 4I9WD 1ZVSA 3Q2CA 3LN9A 2CKBL 2RR3A 3O6KH 1IBGL 3ZE1F 3RNKB 1D6VL 2KDGA 3BGAA 1RZ7L 5D7JD 4CL7A 4ELMB 1UCBH 3T2OA 4WO4A 2Y36H 3X17A 1KV3A 1MFDH 4FXGA 4YGVB 4AIXA 1F58H 3QEUB 3ARSA 1K8IA 1AGBB 1JE6A 4LPUA 1CGUA 3RHWK 25C8H 4ONFL 3OHXA 2EDQA 3KJ4C 3QA3B 1ZTXH 1QLRB 3RGVA 4F7CA 1I85A 5CS7A 3GJEA 4EI6B 5INDA 5I8OL 1BQSA 1ZT4B 3NACL 2E6QA 4HZLA 2UVFA 5IR1A 2ZUWA 1BZQK 3D6GA 1EX0A 3CSBA 1FGVL 3PGCA 3DTXA 4WUKL 1JTOA 1LWRA 4GQPH 1WZLA 1Q0YH 4RZCA 5K9OB 4OCWL 4I18C 4FNLL 1CCZA 4BA8A 4QHNB 3ARFB 3FN9A 4TPRL 5EN2A 2JE8A 5A16B 1N5YH 2OJZH 3UPCA 1XF2A 3KPLB 4HWNA 4JVWA 1G9NH 1KPVA 3FQNB 3OJDB 4QHLB 4ELKB 4ERSH 5L2JB 1N8ZB 5ENWA 4PRNA 5IMMB 1ZGLA 1Q0XH 4OKVB 1D5IL 4JZNB 2V7HA 4K3JH 2I60H 5J56B 3HZKA 4LRNH 3G5ZA 2OTPA 2NY2B 4HWEH 2H26B 1JF5A 2CLZB 3HMXH 1CXIA 4F33B 5MEPB 3FOMA 3O9WA 1BAFH 4NOBA 2WINA 2LVEA 5TPWH 3P4NB 4ZMAT 3QUMB 5FKPA 3RIAK 4ZUSA 1UJTA 3LN4A 1PKOA 3VMNA 3DGGA 5AWNH 3E0GA 4NT6B 5CGYD 2YD4A 3B9KC 3OAUH 3ELAT 4M00A 5IHUL 5J06A 3RUGF 4Z0XB 3FT2A 4S1RH 4NRZA 2CDFA 2Q6WA 4FABL 3F7RA 1J9CT 4WI4A 5E00B 1I7UB 1S5HA 2HJLA 2IH1A 5CGTA 3D39E 2LU3A 3BP6A 4JQIH 4HKJA 4UNVA 4P23A 4H20H 2CDEA 4PJIA 3QQ4A 4YE4L 4ZFOB 4LVOB 4J3SA 3MLSL 5C6TL 2Z8SA 2X4QA 3K7UA 2FX8L 2FZ3A 2FSEB 3GM8A 5C0GA 3HRZB 1CXEA 3S8WA 5KBNC 2Z31A 4JB9L 3VWKB 3VXOB 2OK0H 3MREB 3WIFA 3TNMB 1CDGA 3KYNB 3WHE1 4WHDA 1N64L 3MGOB 1YY8A 2Z91B 1BX2B 1KCVH 3MNZA 3OR7A 5FIEA 4HBQA 3LZFH 4BFEA 4EIGB 3GKZA 4W70A 3TJHA 3CLEH 1XH3A 1S7QA 4QHKI 4Q6YA 1G9ML 1NGWB 1AY1H 1YC8A 1RZKL 3ISWA 4XGZA 4YO0B 3WS3A 4WV1C 2R0KL 1JPGA 4B53A 1MJJB 4G9FE 3N06B 4FZ8H 1AGFB 5ESVA 5FK9B 2O61B 5HD8C 4HBCL 3TA3B 4X7TB 2F19H 1XGQA 5TDPB 4LGRB 1F4WL 2HFEA 1W0WA 3TN0C 5DHYB 2KZ1B 3D2UA 2BRRH 3QT2A 3FO0L 3T0BA 5GRWA 1ZLWK 1F13A 3UYOD 3TPUE 2YC1B 4UTBL 1ZXQA 1X6NA 4CMMB 3SQOH 2DM2A 2DICA 3MSPA 4N0FA 5DUMH 3DETC 4ODWA 4X99B 1K6QH 2F53E 3GHBL 2BNUA 4LPYA 5I1LB 3EO1A 5A40E 2W0LA 5EO9B 4FFZL 3QUYB 5C0FB 3S35H 1A22B 3MRRA 1FVEA 3S9DB 1SHMA 3DARA 3PP3H 4LVHB 4U05A 1NANH 1KLGB 2BNRD 3I02B 1XEDA 4FZEL 4UV7L 3TPUB 3L3DA 1FG2A 3MLVH 4BSWB 3EYFA 2X9WA 3P77A 2C3HA 5JHDB 4YHYC 5C0AE 1JYXA 4WTXA 3O8XA 2AXFA 3SBWA 3DMMB 3BE1L 4RAVA 5JO5B 4YHKH 3V6ZB 1CXKA 2JB6B 2HAZA 3QHFH 3O6KL 4NZDA 1QBML 5BOZG 2CK0H 1KNOB 2ARJA 2IQAB 3VGGA 4M6AA 2FYYA 1TVHB 3BHBB 2A74B 4TNVK 1CVSC 4FFWC 2YD7A 1HZHL 1JTPA 1P2CA 5TDOA 1WCBA 2PXYB 5I8EA 3G9VA 4L3EE 3SKOA 5CAYB 1P6FA 5IQ7L 4U6VL 1ORQA 3LKNA 3GSUA 5TFSL 2J8UB 3RVUD 5HBBA 3RVWC 1NFDF 3G6AA 4MCZA 2IPUG 4DN4L 2IH3A 2VUOA 4OJFH 4JR9H 2FB4L 3CU7A 4WHYH 1H3UA 2XZZA 2VLMD 2CRYA 3FB6B 2JIXA 3BIBX 5F1IB 4ZSOE 4M1GH 3PWNB 4QLRA 4XXCA 4JKKA 5I66B 4MNGE 4P4KD 1ZLVK 4MAYC 1BECA 5LJYH 3KJ4B 1YEDB 5DEGB 3G5VB 4X7CC 5F7EL 4K7FA 2NY4B 3U46A 3KPRD 5KSAA 3IJHA 3T0XA 4ZPVA 5HJ3A 2GJ6D 5KZCB 3ZTNL 2DJ4A 4LLVB 4NDMA 4JDVA 1D9KD 3LEYL 4G6FD 4WHYG 3RAJL 4OZIE 3TH2T 3H9SE 3MV9D 4HIJB 1WSST 5FM8A 1PSKL 1F58L 4WDIA 2Y9RT 4TVSa 2D31A 1BQLH 2ATKA 3TCXA 4Z7UF 3MBXH 1MI5A 3C6LB 4LPVA 4P3WA 2PTTA 5CEYA 3WDIA 5L8KB 1X9QA 3IRZA 1MCDA 4GXVH 2KUTA 5I18L 5HI4C 2D9CA 1NC2A 2EH8H 3T0EB 4YDLB 1FZMB 3SDYL 4FTVA 4AMKH 3SGEI 1EERB 1P5UA 4NBYB 1G7QB 4PGZA 2DL9A 2GI7A 2EDFA 2Y7QA 3L5WA 4H1LB 4CADB 4ZFGL 3KVQA 1G0XA 2J12B 4FFVD 4PJ5A 4FQCH 1OAXL 4HC1H 2R39A 2AJUH 1T7YA 2AV7A 1A6TA 3KNBB 5GGRB 1QPXA 3VD4A 5ABDE 3ALPA 1DQQA 3EYQD 1DZBA 2KH2B 5GZND 3QI9A 3MRJA 3L9RB 1NGZB 4QXTA 2OP4H 4IMLB 2H32A 5GGQH 4OCSL 3B9KB 3U0TB 1MRCH 3WEXA 2VISA 3KYMB 4QRPB 4BH7A 4X7FC 5F7LB 5FAAA 3PUCA 1I1AD 5I15L 5CJXC 3TV3H 4AH2B 1C5DA 2G5RA 1AR1D 3U2SA 1ND0A 3I9GL 4MNQB 1MY7A 4CBPA 1BQHB 1E28B 5GSVA 4JEGB 1FG9C 3IXTA 1NDGB 3G5XA 1NGPL 4R3SB 5E8EA 3V6FA 4OV5B 1OP3K 2N56A 2A6IB 5F1NA 5C71A 3MFFB 2XXCB 5JW4R 4G8GD 2P24A 5F7KC 2R2HB 3HNSH 1ZSDA 4GBXC 2EXYD 4IDJL 5KVEL 5KS9E 4MJ2A 1KJMA 4XPGL 4N5UA 2E7LE 1A4KA 4LFHG 4HWZB 3S34L 2IEPA 1E0OB 3UPAA 4UTBH 4R97B 3UX9B 3QH3B 4NRYA 3P0GB 1UH3A 1BM3H 3PWJA 3U36B 3KR3H 4NQEB 4KVCH 1ONQA 1F6AB 2GTWB 3R1GH 4GW5A 5CCKH 3LB6C 5I9QC 4GQ9L 5F89A 4XP9L 3TN0B 1A6AB 3KPRE 5E2VL 3BAEL 5DJ0A 4KKAC 4UQ2B 3VXMB 1T5WA 1B2WL 3IDUA 1PEWA 2HMID 4CW1A 3LH2L 4XXDA 2XNAB 1AIFB 4HKXB 1MFAL 3WIHA 1UM4L 5I2IB 2F74B 2A1WH 2PO6A 1UCBL 4X9HA 4D9RD 4P57A 4NQSB 3SDDC 3OMZA 3PP4H 5L0QC 3TO2A 5JOPD 3JTSA 4HUWB 2QL1A 2IBZY 1MI5E 1IC1A 3WJLA 4X9BA 1UM5L 4NQUA 4F33A 3W39B 3WKML 3O9WD 5BW7C 2C4XA 1MHHB 3U6RB 3OKOB 2CMRH 1L7IL 1KYOK 1KIRA 4P9ML 2E9IA 1BOYA 1AFVH 2ILLA 4Y5VB 3RBSA 1ETZA 2B4CH 3HUJF 3VCLB 2EECA 2XG4A 4YHYB 4QTIL 1GOGA 3MV8D 3PGFH 4NQXB 4PJ8A 4Y88A 4ODVH 2R56H 5EBLB 3MUGB 4IJ3C 4F7MA 3N1MC 1KFAH 1IGIL 1T5XA 1R3HA 4PGEA 1VSCA 4ENED 4F57L 1TMCB 1INQA 4NZTH 1J0HA 1PQZA 5FGCB 3BP4A 4NRZB 2VXVL 3VE0B 5HDQL 2BVYA 3IFNH 2EEDA 5KJRH 3RNKA 2IF7A 4U6TA 1U93B 3NH7L 5A3IC 3MYJB 4WVRA 1MJ7H 5SX5K 3TYFA 4MSWA 5CIPA 1CTOA 4ZDHA 2LV4A 5T33L 1JWUB 3QNZA 5CBEA 1DVFD 2LAGB 1XGTB 3ARGA 2IPKA 5ICXB 1OCWH 2C1PA 1TVBA 3HE7B 5IVOA 4PJXB 1HOCB 3SQOL 3KPSD 2Z92B 1JFQL 1V8HA 5LBSL 1OAUH 2MNUA 4NJAL 5CINL 1KIPA 4ZXBA 4DEPC 3R06A 5IT2L 1PG7L 2VDLH 1MREL 3DHJA 4FQ2L 2VDKH 1LMKA 4JREC 4XCEB 4FXGB 1DCLA 4TVPH 35C8L 3PWLA 5DURD 3BPLC 1ZLUH 2YN3A 3RTQB 4CU8A 3V7AG 5D2NB 2YRZA 2ZOKA 4WWKA 4Y4KB 5E56A 5HHMD 5ANMA 1VFOA 2NY2D 5MEQB 4C56A 2PTVA 1FAIH 3H9SA 4AEFA 4OZGA 2X05A 5TGBA 2R4RH 4F37K 3PABA 4J8RA 1YEHH 5I74B 5IBLC 4PJBE 3VI4F 2LAAA 2QQNL 3ZE0E 4NWUH 3S6CA 2QSCL 3I6LE 2DLIA 3V7AE 4EXKA 4LCUA 2NY4D 2BSRA 1TQCC 3QEQE 4L8CA 1CN4A 3EFDL 1NCNA 1Q9WB 4JLRA 4Z7WA 5BMFH 1P4BL 5J6GB 1J1XH 2IFGA 3GMNA 1W72A 3HLAB 4Y2DB 3GMMB 1CI5A 2EYSB 1T2QH 1HI6B 4XVTL 4DGVL 4Z7VF 3WMSA 4G80A 3MJ8B 3PJSA 4MAYD 5GISL 2W0PA 3ARDC 5DA0B 3RFZC 5HHOB 4S1QH 2JB6A 2EXWC 3AREC 3D3VA 3LS5L 2Q7NA 4D2NA 3MQIA 3KPNA 4YHIB 4OZIB 5DWUL 1H5BA 2HRPH 3B2UD 2DIJA 3AUVA 2NY4C 3GMQA 2BHUA 3NFPA 4UDUB 5F7UA 4Y4HC 4Y5XC 3P0VH 1BBJA 2R9HD 43CAB 1WT5A 4G5ZL 3NIGE 2B0SH 2R2EA 4L4TE 5EO0A 2XQBH 4YXLL 4U2YA 4E0RB 1K4DB 1MCEA 2UUDH 4K71B 3TESA 5DUML 2A2QT 1DBMH 4NT6A 5B39G 4NUGL 2Z31B 2ZSVA 5J13C 1OAUL 4Y5YA 4Z7WE 3QEHA 5GZOD 4MJIB 4HMDA 5IEHB 1LNUA 3GSWA 4L9DA 7FABH 5IT2H 2FJGB 4PJ5D 2IH3B 1P4LB 4YK4C 4PJEB 4MA7L 1MLBB 3UTZA 4LARL 1AR1C 5JPMB 3T0EC 1TTGA 2VL5B 2D0HA 3HPLB 4ACPA 4HKJB 3D39A 2EKSA 1F42A 3GKWH 4L1DA 3GBNL 1FYTD 3HAEA 5K9JL 1DQDL 1TDQA 4NKDA 3Q0HA 1FO0H 1JYNA 5DFTA 3F7PC 2DM4A 3X3FL 4GW1A 5F7FA 3U46B 9CGTA 1AXIB 4D3CH 4ZFZB 3N85L 3SJVD 2BOCB 5I6XB 1CDYA 3RWCB 3L3HA 1K3IA 4NKOB 4I0PA 5F71A 2GCYB 5FUOH 1E4WL 4WUKH 4NZRH 5DMKA 5FM5M 1TCRA 4PJ8D 5IIEA 2KQNA 4N0FB 4ZD3L 4KMQA 4Y4FB 2A6JA 4U33A 3VMOA 3WS3B 3G5YB 3QDMA 4QOKA 3VFUA 4P4RB 3S98A 4D0DB 2ZUSA 1JZ3A 1IQDA 1CLCA 1OSPL 3WO4B 2V5RA 1JUFA 3BP5A 1RMFL 5CD3A 3LQZB 5JW4M 3ORJA 3KXFE 4TSAL 5F9DC 3NIFE 3MRDB 4JDTH 5FOJA 3AS1A 1F8TH 4O51B 1HE7A 4OZHB 3UEZA 5EIQA 1U8QB 5L7XL 5DGRA 3GHBH 4W68A 1QA9A 4NGHL 3OAUL 4F7EA 2MQ0A 2W07A 4N1CA 3FQRB 5K59F 1UWEH 1FYTB 5HYIA 5BCAA 2EKJA 3REVA 4GRLB 1QYGL 5TH2B 1SYVB 5ANME 3BFOA 3BGFC 2JJSC 3ZHDA 1GOHA 4M6ML 2RGSA 5D1QA 2IG2L 5EIVA 3IGAA 1I9RL 2RQ8A 4DGYL 2BSED 4QF1A 3IKKA 1XGPB 4XMKL 2Y06L 4UDTB 3FJTA 2YPVH 4UTAL 3AC0A 3ZZ1A 2FBJH 4R97C 4GH7B 2QQNH 2PETA 1OOAA 4GXUM 5T5FH 2NQCA 4LBEB 4XWOD 3QIUD 4YAQA 4XVUD 1D5ZA 1FRGL 4FABH 1ZWIA 5ITFB 3G6AB 1P4BH 4OZGF 3VXSE 4R4FH 1Z5LB 2VZSA 2BSTA 2R2BA 4UQ3B 2E7LC 1B6UA 3G5XB 4W4NA 4PJ9B 4NQCB 3A6CH 4U1JA 2ARJB 5SWSA 5SWQA 1YY9C 4RIRA 1NCBL 4GBXA 3TJEH 3KDMB 2VDKL 5EFIB 2QQLH 3D85B 3T04D 1MCHA 4KRPD 3VJ6B 2OL3B 4NKIH 1YEDA 1ZKAA 1T1YA 4RA3A 5TF1L 4Z0BL 4M43L 3ARVA 2A77L 3MV8A 3ARBD 5EB9A 3SDCC 3O45B 1ZLWH 3HG1E 4YXHL 4WW1B 1A4KB 1J11A 2HA1A 4B50A 4YXKH 1KOAA 3I3EA 4KU1A 5TE4H 2E7HA 5GGVH 4X7EC 5I1EL 1QBBA 5BZDA 2R0LL 5HPMB 4G9FD 3QB7C 2G2RB 4TULL 5IK3A 4D8PA 3QO1B 3RTQC 3VRIB 3BKML 4EIZC 4DKAA 4HJJL 4IIQC 3W0WB 1JZ5A 1J88A 3TN0A 5ISZD 3QBTB 3S3PA 3I50H 2YA2A 3DRQA 1RUPH 4UAOC 5FA3A 3IFNL 4K7PY 4NRXB 4E41D 1MAML 4WENB 5J9PA 4ZO7A 4FG6D 3MLZH 3O3DA 1Q1JH 3VFOA 3Q6GL 3QIUC 4WUUA 2JTDA 1B0GA 4M6NL 5FF6B 5GGSB 1I9RH 3VFNA 3C5ZA 3LKOB 3CZJA 1AGCB 1RUKL 5ILTH 1X44A 5F3HA 1HCFX 1PX3A 2APFA 3RP1A 5FUZH 1KIQB 2AKRA 3SDAB 1JGEB 1QQDB 5L2KB 3EYVA 3S88L 4Y2DC 1OP5H 5DT1H 3UC0L 5T1KB 4X6BA 1DLFH 2H32B 1QLRA 5EPMA 3G6JE 3WSQL 5FKAB 1AH1A 4R90L 3NZ8B 4DCQA 1G7JB 2VTFA 1QKZH 4HPOL 4PJ8B 3HE7C 5D7KE 1BQLL 1TJIL 2FD6H 4X99A 1MOEA 4F58L 1FIEA 4RFNB 3G04A 5J6HA 2DQTL 4HJ0C 5EU6D 5D96B 2R8SL 3IDGB 2EIEA 3GJFA 3EYUL 4PJDE 1TQBC 3O4LA 1ZT1B 1PG7W 2WBJA 3ZDZF 1H3XA 4MA3A 2WLYA 5ESQA 2R2HA 3D3VD 2V9TA 3LKRB 3G9AB 3H9HB 4XCCH 4PY7B 3CX5K 1JWUA 1A5FL 1PY4A 5C0IB 4Z0XA 2GJZA 2H26A 1BHGA 4FNLH 5BS0E 3S96A 3IDIB 4MNQA 4QGTA 2FYYB 3BHBA 4LFHD 2W0FB 4D9LL 3OKNB 4ZOBA 4LSVL 5IKCA 1UEMA 3CU1A 2R56L 3FO2B 1ZANL 2FZ3B 4WFED 5E6IB 5DD0H 3KPPA 4ODTH 3ZT7A 1GGCH 3HI6L 1LEIA 1T3FB 1Z3GL 3HI5H 4AL8H 3H9ZA 1LP9B 1AFVL 1CGYA 1QVOA 2O5ZL 2AAVA 4YX2H 4EUPH 2AW2A 3BUYB 1DQMH 4R0LB 1S78D 1X5AA 1I7UA 2F74A 4WFGD 5LGKA 2JIXB 3H9SD 1WZKA 2P5ED 1MFNA 3NH7H 5FGBC 4A6YA 5SWZE 5L9DH 4AM0B 3QH3A 4G3YH 1FRGH 2FIRT 2Z4QA 3LKQB 3JWOC 1LO5B 1OY3B 2FR4A 4DKFL 3QZWG 1MUJB 3ZKQD 3TPKA 4M1DL 3QAZB 4ODUA 4B5EA 2OM5A 3DYMA 3W39A 1HXYA 3I85A 3O6ML 5DRNA 4PLNC 2X1OA 4HK3N 1G7MA 4HV8A 3RPIA 2VO5A 2Z31C 5DHYA 5J13B 1A8JH 3F6LA 2EDHA 3D1MC 4YHLL 4NJ9H 4H25A 4LDOB 5IMOB 1CFTB 4G9DA 1OWRM 3MJ9L 3QDJE 3GIVB 5D7IB 2EDRA 3ULUF 3KYKH 1TETH 2DQFA 2HWZL 2EYSA 1CLZL 1DQDH 3NTCH 4HC1L 4HKXA 1LEGA 3ZHKA 3KGRA 5F9OL 3C5JB 1CVRA 4DKEL 5M7QA 2EDNA 3LQAC 1YEGL 2NY3D 1BVKB 5F8RC 1YN7A 1AGFA 5ESVB 2YWYA 2D7MA 3U30B 1KJ3H 5LQBL 3B5GA 4WU5B 3EOYG 3FFCE 1DBKH 3CFBB 3L3JB 3Q3GB 4Y5XA 4Y4HA 3B4NA 3KWWB 5JW3H 1U36A 1QNZH 3QCUH 3UO1H 3TFKA 1IFHH 2J88L 4WI8A 5LBSH 4GXVL 5FYKD 4Q74A 1KLFA 3D2UB 4TVPE 5I6XC 1L0QA 3BN3B 4BSVB 1G0YR 1MJUH 1ZT7B 3MRHB 4A6YH 5IVZA 3TWCH 2DI9A 5A2KH 3SO3C 3VFSA 3QEHB 1MY5A 1T89C 2P49B 4OZFB 1T5XB 5DLMH 4KJPC 3DUUB 4PJ9C 2D03L 3IS1X 1P9MC 5DHVH 4PGDA 4UT9H 5D7LE 3RY6C 4RMTA 3GMOB 2IFFL 2PR4L 1R3JB 4WTZG 4S0SD 5DVOA 1WCBB 2D7PA 5CILL 4Z7VE 4GQ9H 4JQVA 4MXQC 2P8LA 3CFIC 4Y4KD 3HR6A 1Q8MA 5DQJB 4TNVF 4Z8FL 1A6WH 3DYOA 4LSUL 3WN5B 2CXGA 4G6AD 2B1AH 4YC2B 2G75B 4GRLC 5J4MA 4MYWB 4U6YA 1G7HB 1FNGA 5CP3A 1QKZL 1RZGA 4IRSD 3QDJD 4HH8A 4NKOA 1U8LA 3REWB 4BK5A 3O2VL 3ZE0F 4NQVB 4NQDE 3GMLB 1UXSB 4JRYA 4XBEL 5C07D 5JHDD 1EO8H 4F15C 5I66A 4PJXA 5IROC 1A2YA 3N1FC 1FC1A 1LQSR 3NGBB 3O0RL 2Y5EA 4K7FB 3TCLB 1VFBA 3T4YA 3GMPB 3V5HA 3FFCD 5FYJL 4JFYA 4FQHA 1H3PH 4PJFF 4Z78A 4HLZH 3K1KC 3FN0L 4QTIH 2QADD 2AJ3B 5DHVA 3QIWC 43C9A 4JJ5B 3THML 5F6IB 5EOTA 5D5MB 1F4XH 4CNIA 1NMBL 2BCKB 1FL6A 3QR2A 4D0BB 1QA9B 2AXGA 4OZGB 2O26U 1MHPL 3S4SA 4UU9A 4S2SA 2LFGA 3FQXB 1F11A 1DL7H 3I50L 4Y16D 2HT2D 1IGML 2LTQC 2J4WL 1KCKA 1S9XA 1FZMA 1CT8A 1CR9L 5GSRB 4MXWL 1FPTH 1Q9OA 3PG2A 1YMMB 5EORH 3OKLB 4PJ7F 5TF1H 2ZPKH 3MA9L 4PJ5B 3X3FH 3E2HA 4WDIB 1FBIH 4M9PA 4EUPG 4ODBD 2ADFH 1F3JB 3O3UN 1NBYA 2H3NB 2X4PB 5FO8A 4XPGH 3RVVC 1KEGL 1NEZB 3QUXC 1WZ1L 4HIEB 5D8JL 1SJXA 3K4ZA 4QXTB 5DR5H 1NC2B 3TBTB 4D0CB 4YIQB 2I07B 3M17A 1PD6A 1SY6A 3RJQB 1MWAA 1NEZG 1RUKH 1ZLSH 1JPFA 1FGNH 4OGZA 1PG7H 2VDLL 5E7FA 3G6DH 1HYRC 4FHBD 4XCCL 4WI9A 3MUGA 4G7YH 4HZLB 1WFTA 3L5XH 5C0CE 1QO3B 3TT1H 5M95B 3UPRA 1GZQB 3H9YA 1L9NA 3HUJA 2X5PA 3SE3A 3JWDL 1MAMH 4GUPB 3DTXB 3PGCB 3VG0L 1RFDH 1U3ZA 3A0OA 3QIWD 4PJGF 2FEEI 5IEHA 1VEPA 2DB8A 5C07A 3SDAC 5FCUL 1J8KA 2V2XA 1M05B 4GG6A 1GZPA 4DUXA 2GK0B 3GIZL 2QEJA 3OXSA 2FJFA 3ULVC 5B22A 3O3BB 5DUBA 4UV7H 4LSTH 5EDXA 3EW3B 3QG6A 4XNMB 4EI5B 1LP9F 2AS5M 2R69H 1BD2E 5F3BB 3F7VB 5ENWB 1LILA 1DFBH 1FHGA 1R5WB 2BK8A 3GBMH 5D96C 1ACYH 2F58L 4BJLA 4WI6A 4MAUL 1UYWH 3VA6A 5GSVB 3CFEA 5CD5D 4EKXA 4NN5C 1TVBB 2BP3A 1NCWH 2ARJQ 2EDJA 1LO0H 5HHMB 3F7QA 3P0YH 5IVXF 3GB7B 1FH5H 4MNQD 3M8OL 2FATL 1AGCA 1QHOA 3L3GB 3S3JA 5T3ZE 1V7NH 1BQUA 4GRLA 4ZQKB 4NFBA 1DANT 4AENB 5HYJD 2XY2A 4PS4H 3OZ9L 4HCRA 1F6FB 3CZFB 4NJ9L 5D1ZB 3TVMC 1RPQA 4XVSH 5D2NA 1J1PH 2P46B 5DJAA 3MRDA 5ANMB 2KPNA 1YUHA 1WZ1H 2PYFB 1KCUL 5KTEH 2CDFB 1RJZA 5IVNA 5E00A 4OCLC 1S5HB 3K3QA 1A6WL 3PWJB 4U6XB 4DW2H 1HQRA 3RI5K 1MLCB 4Z5RB 3DWTA 2ADGA 1OGAE 1RK1B 3RJDA 3U83A 2FJHA 4PRHA 3W2DH 1UKTA 3MODL 5GGTH 3KPTA 3AY4A 1Z0NA 2W65A 4LCUB 4X8JB 5FDWA 3OGCB 4PJBF 4XHJC 1I3RA 1HH9B 3RX8A 2VXUH 2Y6SC 4KI5D 3KJ6H 4KRPB 4N1EA 4Q9RH 1PYWB 3UZQA 2OSLB 2XTJD 3FFDA 4YPJA 3V5KA 3LKRA 4NQSA 1TTFA 1FN4B 2EEBA 1N0XH 2YPLD 3GSNA 2ICWI 4YE4H 3JTSB 5FYLE 1IGCH 3TO4D 4HUWA 3ZTJG 3VFWB 4JDTL 3T3PE 3UO1L 3QDMD 3MR9A 3F5WB 5IFJB 4NFCA 3SKUD 1Z5LA 1NAKH 3C5ZC 3DVNB 4CVXA 1ZVYA 4JFFB 3WIIH 3AROA 5IHUH 2OR7A 3DNKA 1GC1L 4MB3A 4XC1H 3WXWH 2ICWB 4MAUH 4H88H 4OLEA 5IK3B 4D8PB 3ULVE 1OAQH 1F90H 1SJHB 4U1LB 2A6DA 4J3VA 3VRIA 1C12B 3QUZB 5DEZA 4OD2A 2AJYL 5HGHA 3LD8C 5TF0A 4U1IA 4L4VE 5EUOA 4F7MB 5D2LA 4JANB 1LP9A 3MV8B 4IIQA 4M93C 1NANI 4PGEB 2H2PD 2PO6C 4LKXA 2YK1H 3MXVH 1IEAB 4JFPB 2BVPB 2PN5A 4JFOB 4KK9D 3SJVB 4M48L 1AKJD 4LLWA 3T3ME 5I8CB 3RBGA 3W82A 3MRFA 3WHE0 1JPSL 1FNSL 3MRRB 2A73A 1F3DJ 4PBXA 2VZ1A 3RRQA 1WWWX 3FB8A 1XCTA 3FT4A 1QQDA 5L2KA 4NCC2 2QTEA 3MV9E 5DD1L 4OF6A 5KW9L 1ZLSL 2A6KB 2IMNA 5IMOA 5FA3B 4HUNB 4J1UA 3QSKB 5MEQA 1A14L 3V5DB 2OR9H 1Y6MR 3QQ9C 3FO9A 1X5IA 4K3EH 5EU6B 3HPJB 3T1WA 4HXAL 2EE9A 3MV7A 2YZ8A 1U3HD 5DUPH 1TVHA 2ICEB 3NPSB 2LTQB 1UADC 2W38A 2HTKD 5HPOA 3GJFB 2ICCA 1SBSH 3P9WB 3FQTA 2GSGB 1T04A 4GJTB 2NCMA 4LCCA 5FUCE 3TNNB 4F3FB 2BSSA 5CZXD 4UBDD 2WBJC 1QLFA 5FKAA 1JI1A 3B3IA 3EO9H 3QUYD 1ZT7A 4KHXH 4H1LG 2GJ6E 1RQ5A 1EGJA 2Z93A 3FB6A 1KEMH 3ZT5A 3PIQB 4R2GD 1Q94B 4ELMF 1Q72H 4ZSOA 4YDJA 5E08H 4V3EB 2BY1A 1I1AB 5T5NF 3NGBC 3KPSA 3LEXB 1U8HA 2VAAA 1S7SB 5HHPB 2HJKA 4OCWH 1CLYL 4PTTB 4KMTH 3BAEH 4V3DB 2ZOLA 3D18A 4Z76B 5DQ9B 4GRMB 4Z9KB 1HYSD 3IF1A 3K4DA 1RVFH 1MHCB 1NUDA 4M43H 1ACZA 3L5IA 1KN2L 1KJ2L 4M1CD 1HI6A 2ATPB 4LLUA 4PS4L 1FE8H 2MFNA 3JWDC 2HLAA 1DJSA 1OPGL 3S37X 5GQBA 5F44A 2QHLA 1RSFA 2B0SL 3H9HA 2ITDB 2V17L 1OAKH 4U0RB 1AD0A 3QDME 4XT1C 3V2AR 2P5WE 1DN0A 1DBKL 1S7VB 3VXSB 2OZ4L 3WSQH 4NM4H 4YHIA 4OZIA 4P59H 12E8H 1XF3A 1AHWC 5DQDL 2K1MA 3PL6B 1SM3H 4UNTA 2UV3A 3PE9A 1L7TL 5K59E 4P2OA 3HI5L 1IARB 4FQLL 5FGBA 3VXRA 3KPQB 5HD8D 5DJDB 3RIFK 2NY0C 4P3DB 4Y5YB 4CKVX 1T3FA 3C6LD 1FORH 1RURH 1LNUB 3GSWB 4BELD 3O4OC 1JJUA 1LO3H 2P8MB 1AD9A 4G8IA 1C5CH 3QUXB 2NY3B 4XH2B 4RX4A 3LQAH 1FYTE 1KIUA 43C9B 1U95B 4I4WB 4MQ7A 4PIRF 3P9MB 1I3GL 4G7YL 1UACH 2J6EL 3G5YA 5BZWB 3QO1A 4QOKB 3E6FB 5L6YH 1QSFB 2VC2H 3CPLB 4FQQA 4WW2F 2I9LA 5D1ZC 3TVMB 5HVGB 5CD3B 4OBSA