3TZVC

Crystal structure of an inkt tcr in complex with cd1d-lysophosphatidylcholine
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
270
structure length
263
Chain Sequence
b'FPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSQDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGQASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLQGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAAGLSCRVKHSSLEGQDIVLYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invariant Natural Killer T Cell Receptor chain A
molecule tags Immune system
source organism Homo sapiens
publication title Lysophospholipid presentation by CD1d and recognition by a human Natural Killer T-cell receptor.
pubmed doi rcsb
total genus 61
structure length 263
sequence length 270
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tzvC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tzvC01
2X4PB 4Y4FC 2A9ML 5EN2B 1QTYT 3OKEA 3QISA 3QG6B 3L5JA 5K9JH 3MGTA 5JOFB 3VWKC 3PE9A 5FYKD 5D70L 1G7LA 4H8WL 4D8PB 3WFDL 1QVOB 1S7RA 1MFEL 4LEOA 1LK2B 2Z9TA 4QRQA 5EIVA 4EI5B 3WS6C 2Q6WA 2FJHA 5E8NA 2AJUH 4KMLB 2IH3A 4DZ8B 4CVWA 4GUPA 2XOTA 1UCTA 2VXVH 1T2XA 4MXVE 2O61A 4KUZH 3GMMA 1KLUB 4DUXA 3MRFB 2Y23A 1H3VA 4EI5D 1ONQB 3O2WL 2NY2D 2F5AL 4YHZH 3TJHA 2V5SA 3C9NA 1D6VL 1P7KA 3HRZB 4G6ML 5CWSB 4LRNH 4ZD3H 4KDTA 4KKCD 2BFVH 3O2DH 4F7EA 1FO0H 1MWAA 2XA8H 4U7SA 1JFQL 1WWWX 4LCYB 2CGRH 3TBSA 4XP1L 3GSNB 2D7OA 4WWKD 5IHZB 2X4RB 3L3HA 3GI9L 2EDYA 1RZJH 1FFRA 2ICEA 5FGRA 5AD0B 1EUTA 3KXFA 5IUSA 5H37G 3MLUL 2D7PA 3DROB 4HKJB 4XPHL 3S37L 5HDQL 4TPRL 4XTRC 2NY6C 4V3EB 2C9AA 12E8L 4YO0A 4OZ4A 4KHTH 4JO2H 2NQCA 4HSQA 3RKDD 1DEDA 3MUGB 1IL1A 4WJ5A 4F58H 1TJHL 1HHKB 2WBJB 3Q5TA 4EI6B 3MRMB 4AIOA 1NMBL 3HE7C 2IBZY 2YD2A 4WUUE 2H2PD 1G6VK 1JPTH 1KJ3L 5JA9A 1CXKA 1JGDA 4DK6A 2NNAA 3OJDB 1OLLA 2CUHA 5IHLB 5IMLB 4BKLA 5KANG 3QQ3A 3IXTB 2JF1A 4JFOB 3MRLA 2AEIT 1S5IH 3OX8A 4HKBB 4PJEB 5C71A 4HHAA 3QXUA 1G6RH 1HZHH 4EN3B 3G5ZA 2F19H 3W11D 4KQ3L 3BRFA 3ERYA 2ATPB 1ZLVH 2EDXA 1HILB 3NH7L 5DD0H 2YHGA 5F7NC 4AENB 1DBJL 1UXWB 3T0EC 3MRHA 3FQRB 3OAYH 2Z8VC 4LLVA 3HLAB 5CHNB 2P5WE 4AZ8A 3KS0H 4HUMB 4PJGF 4QRTB 1WICA 5EH1A 4ZFGL 2APXA 4KQ4L 1HHIA 4PG2C 2BHYA 5I19H 3AGVA 4XNMB 5JHLL 3G04B 4XI5C 1KFAH 3N1QC 4R26H 1O5DT 3QUZD 4X9GA 3QDMB 4TUJB 5JNYB 1OCWL 4XNYH 2EDTA 1GC1H 1BPVA 1HCFX 1FE8H 3OKOB 2EDJA 1AHWA 3FOMB 3IU3B 2OXGA 5KSAD 3D3VD 4XPFL 1E4KA 3DX8B 3S36X 5D1ZC 3LEXB 4PV8A 1FYHB 4LPYA 2NLJA 3H0TA 1XMWA 4HUVB 3OSKA 3RZCB 1EEYB 3L7FA 4N0YH 4Y1AA 3PDGA 3TP4A 3QWQB 2FHFA 1IBGH 4TOYL 3C5ZC 4LSUL 3C2SA 3DHMA 3BP7B 4N5ED 3RQ3A 4URTB 1FORL 1G7QA 3SY0A 4P2CG 4ZPVA 4JPKH 3BWAB 1QRND 2MJWA 3QP3A 1JJUA 3ROLB 4LRNL 1P5UA 5KTEH 5F7DA 1RIVH 5M94B 3ULSA 4U49A 4HBCH 5CMAB 1ZS8A 3TO4C 3LN5B 4JCMA 4M3KB 2HFFB 5GZOD 3U82B 3ZDYE 3EAKA 4PFEA 1FZKA 4Y4FB 1AHWC 4YLQT 3BKJH 4R90H 1CIDA 2BY2A 2YS4A 3MLUH 3SKOB 1NBZB 4YNYB 1XCTA 1A7OH 4H5SB 1UWEH 1PKQA 1RZ7H 1Q9WA 3HZKA 5HGHB 3D39A 3QUYA 1PSKL 3KHOA 5I8OL 1QPPA 3QNXA 4KHTL 1M7IA 5EOCL 1NEZG 2I9LB 3ARDD 3ES6A 5T5NG 4KRPD 2VB5A 4DGYL 5CINH 1XIWA 3F12B 4TUKH 3WSQH 3P73A 5BRZE 1K8DB 3VJ6A 1MFAL 1Q9KA 2NW3B 4JFYA 3IDNA 4WFGE 1WUNT 4P2OB 3HI1A 2XACC 3G6DL 5GGTA 4G5ZL 5F7EL 1II4E 2P5WB 1VFAA 1CDJA 3QIWA 4MAUL 1MHHA 1G6RL 4HLZG 4RMTA 4NZJA 2C1PA 3P40A 2NXYC 4QHNA 3MRQB 1OAZL 4UQ2A 1BZ7A 3EYFB 3RVUC 4LP5A 1DQDH 1TTGA 3KG5A 4FZ8L 3FO1B 2FCBA 5FKPB 3N0PB 4PJAA 4Y0GA 3VMPA 1RUPL 4KV5E 1EBAA 4Q0XL 2PNDA 3PP3H 5AUMB 4KQ4H 5D7LA 3GK8H 4MA8L 5IGXL 4LASH 3IU3A 5I1EH 2PXYA 3QUYD 4P9HH 1MPAH 5HYSG 2DMBA 4XNYL 1RJCA 1BGXH 1HQ4B 2HVJB 3RWFA 2ESVA 43CAA 3K80A 5IW1B 2ZUWA 4EI5C 2V6HA 3AU1A 5EO0B 3OWEA 1AGFB 3VWJA 4NQDB 4DGVH 1NMCB 3M17B 4TSBL 5T1LA 4X4YB 1ZTXH 1ETZB 1A7NH 4KJYA 1UEYA 1OAYL 1PKQB 4PB9L 4GXUN 5I1LA 2WBKA 4OLUL 4NPYA 2IG2L 1C5CL 3N06B 4OLYH 3QQ9C 4LSUH 5MEOA 2ICES 4X7TA 1WAAA 5B21A 1VEMA 2EIEA 3LN5A 1ZS8B 4X5WB 4AH2A 5E1AA 4S1DD 3IRPX 5FHBH 3F12A 2HT3D 4Z0XB 4GW4B 2MQ3A 1J1OL 1QO3B 1IKNA 1NCDH 5LCVH 4K3HA 4ZPVB 2PYEE 5T5FL 2BXYA 2ZOLA 3QIBB 4PRIB 3RI5K 3D39E 4KK8D 3R4DA 1FFNB 5EFIB 4M03A 4F3FA 4MSWB 3BGMB 3TT3L 1AFVL 4LCUA 3E8UL 5FIEA 3IDNB 3NGBC 4D3CH 1C1EL 1FFOA 5DJZB 3SBWC 2APWA 4NWUL 5JHDA 4Z7UB 3EUUA 2EC9T 1J05B 1KIRA 4NZRL 2FBJH 5DQJA 4YHML 4LSVL 3RVTD 2XPGB 2IPTH 1I3GL 3GJEB 2P8MB 4MX7B 3ZT5A 5C09B 3L95B 5F1KC 3QXAA 1QG3A 3E1F1 4I18A 2BY3A 2DS4A 3ZKMC 2WZPD 1SEBA 3ROLA 5IQ9B 4Q6IB 2RCSL 4OGZA 1LEIA 1JUFB 3HS0B 2WP3T 2F58L 1NLDL 1TZHA 1BFOA 5C0RH 1N4XH 3NCJH 1J1PL 1GGIL 4XNZC 5IV2A 2J2ZA 4U2YA 4UOW0 5JXAL 1NGQH 2EH7H 2F54E 3LHPH 4U4BA 3DVFA 1VCAA 4U1NB 3G9VA 5I8KL 1ZT1B 4L4VB 1D5MA 3FN0H 4J8RA 4X6CB 3TFKC 5DVLA 4L4TE 1JPGB 5T1DH 2KBGA 4HJJH 1WAAF 2IAMB 3VFSA 5EO9B 1ZGLA 3T0XA 2XN9B 4L29A 1JWUB 1Q8MA 3QO1B 4MAYD 1FZMA 3MACH 2AEWA 2VLKE 2YUVA 2DF3A 3LN4B 4PGCB 3VFRB 5E08H 5J6GA 1WF5A 2X4NA 4HPYH 4TSBH 1R3JB 3CFIC 2EDEA 3IJSA 2ZCHL 2R9HC 3SBWA 1UACH 4P23C 4G7VL 5KVMC 1DBBL 3MV8A 2MPAL 1C16A 4L4TB 3LH2H 4WFED 2FHCA 5CJQL 4QRTA 3DUUA 1CD0A 5ENWA 3G5XA 3B2VL 5ILTH 3FT3A 4KROC 4I2XE 1BWMA 4YXLL 5MERA 1K8IA 4M62L 5CWSA 5IBUG 5LCVL 1OAUL 2E6JA 1DQML 1L0QA 4GAGL 2VH5L 3CLEH 2BNQD 2X4UA 2HN7A 2Y06L 1P69B 4Z8FL 1WBZA 2BNQE 3HNTL 3QXAB 3W9DB 2KDGA 4Y4KB 2WY3A 1GL4B 5T3XH 3FOLB 4FA8A 3ARUA 43CAB 1XIWD 4OGXH 3EJYD 5FOBA 3H9SD 4HGWA 1QHPA 1KCRH 3IDXH 5CCKH 4GSDH 4UAOC 3W0WE 3KPMA 2JTDA 2IFFL 1Z0NA 1LO3L 4Y19E 1VERA 4NO0B 2QQNH 2DAVA 4N8VB 2GTZA 5EZLA 2AXGA 3QUMA 2WUCH 4OIAA 1PYWB 1TITA 2G75B 2XT1B 3ZYZA 3ET9F 3C5SA 1YQVL 3TN0B 5GS3A 2VAAB 4MJ5B 3VFGL 4K71B 5L8KB 3VU2A 5CEZH 2CKBL 4FQJL 1MJ7L 4NSKA 4FFVC 3DGCR 4U1NA 3ZKXB 3U7YH 4J1UA 1P4IH 3KPOB 4FG6C 4WHTB 1EIBA 3FQTA 5SWSB 4G8FB 5JHDE 3TPKA 1ZLWH 4GRWF 5D7IF 4JG0L 2OL3B 1E27A 3FB6A 4Z7QE 1A1OA 3V4VL 1FCGA 3PL6B 5K9QG 2R39A 3VFVB 1BD2A 5LJYH 2AP2A 4EDXA 4PD4K 4LLUA 4R7NB 1QR1B 1VEPA 2V5RA 1R3IL 4G9DB 4OCYL 4GG6A 1HI6A 1KNOA 5T1DL 1OSPL 1S9VB 4CVZA 4GKSA 4LCCA 2OXHA 4WU5A 3UO1H 3QDAA 3ZDZE 1SEQL 1CDGA 4NBZB 2VC2L 3IGAA 4PRNA 5D5MB 4ODTL 4U1SB 5TE6L 5MEPB 2V5MA 1SBSH 4Z7NF 1QLEH 4HPYL 4XXDB 5D1XB 3T2PA 4LHUB 1AC0A 3HNSL 5D72L 3O41B 5LXGL 1A0QH 1UZ8B 5ALCH 4JFDB 3ULSB 5J11C 2R0LH 1CK0H 2GSIA 3U7WL 3OF6D 3FT4B 1DBBH 3UYRH 2B4CL 5F96H 4AT6B 5DHVB 1ODAA 2MCG1 3O8XB 1INQA 3K8LA 5KZCB 4GRWH 4TVSa 4P23A 5I16B 3BQUD 1UA6H 4TTDC 1CCZA 3WYRA 3CVIH 3O3DA 5DC4B 4FABL 2E9JA 2DQGH 2GFBA 1BQHB 2ESVB 5INDA 1K85A 3UTTA 3LIZL 2O5YH 3GSOB 3MC0A 1YMHA 4P2OD 4PIRF 3A67L 4OGXL 5ALBH 4KY1H 5EU5B 4MQ7A 4ZMAT 1WT5C 3C5ZD 5AUMA 5CCKL 3QNXB 2LU7A 4LSTH 1QKZH 1NPUA 2VAAA 2VQ1B 2DIBA 2WQ8A 3GNML 5HGHA 1F4WL 2D4DA 5IW3A 1JPSL 1WC7A 1JZ6A 2DLHA 2HFGL 4JDTL 1EEZA 3B9KD 1T2JA 1EFXA 4Y8AA 5HGBA 4HK0A 5SWSD 5A16A 3K74B 1NGYB 3ZT7A 4R8WH 2E7LC 2D9CA 4NO0A 2JB6B 5DR5H 3ULUL 1YEEL 4ZUVA 5IEKA 1IAMA 1F4YH 2HJFB 3QQ4B 4F7PB 4DAGH 5LVEA 1P4LB 2Y36L 4RWHA 5I74B 1MCSA 2MWCA 3K2UH 2RBLA 3MLSL 4XVUC 1BQLH 3VXUD 2VDRH 3W5NA 3ARXA 2EIDA 3VGFA 3TN0D 1NEZA 2Z92B 4X9HA 4HAGA 4Z95H 3JWDH 1PZUB 3VH8B 1GOFA 1HKLH 5JDSA 1HK6A 4FQQB 4XP1H 1I4FB 3KYMB 5DJ8A 2W9EL 4NC0B 3MRBB 4C54A 3PDOA 4YX2H 4RWYH 4W81A 1U8IA 1GGCL 2DD8H 3PGFH 3VXSD 1VKXB 1F4HA 3U4BL 3X3GH 4LLWA 4GLRI 1XIWB 4M7LH 5F6IB 3LKQA 2BVPA 4QF1A 2VL4A 3T0AA 1WCQA 3DV6A 2FLBT 3QUKB 4U0QB 4HIXH 3EO0B 2VC2H 3JUZA 4FFVD 4KKCC 2PUQT 4ZG1A 4A6YA 1BIHA 5F7UA 3FQXA 4WU7B 4YAQA 1E4WH 4NM8L 4WFHD 1JPTL 3CXDL 2R0LL 4NZTL 2X10A 3IDJB 2AXFB 1MAML 2ATPA 5DJ0B 5DF0A 1QFOA 1QFWM 2IPKA 1E6OL 1S3KL 3MRLB 1N26A 4RFEB 1FNGB 1TENA 4U6TA 3GMMB 2ZKHH 4ZDHB 5B39B 5TQ2L 1JYVA 3STZA 2WLYA 4WTZA 1BFSA 4WO4C 3FOMA 2GSGA 4OF0A 1MCCA 5D7JC 4NKIL 5IW6B 4N68A 3TV3L 3VGAC 3H3BC 3SQOL 2J7LA 3SOBH 1NUNB 5KBNC 2A83B 1ZHBB 4S0SD 4IHOB 1AGDB 2R0KH 4RISL 1WC7B 3HI6H 4G6FD 3V4PL 3B9AA 2NY6B 4R26L 5IFJA 4L9LC 4GS7C 5D2LB 2ITCA 4L4VD 1GC1L 4XCCL 3MRPB 5JQ6H 3VW3H 4PJDA 3ORJA 4IJ3B 5I71C 5IR1B 3ZT6A 4BZ1H 3ARFC 2P8MA 4MX7A 1AQKH 4MQ7B 4UV7L 2F15A 4PJHA 3RWEB 1FGNL 1JF1A 3G5ZB 4JN2B 4QRRE 4PY7A 4UNUA 4LLWB 3JV4B 3LKNB 3QQ3B 4YHKL 1F4YL 5AAWA 4POZC 4PP8C 5FK9B 3RI5F 3IAPA 1FNFA 1ZSDB 2P47B 1IBGL 4NHCL 1N0XL 1J9CT 3O3DB 1TTFA 5IB3B 4N0UA 3JWDC 2FX8H 4Y5YC 3SHSA 4JPKL 3MTRA 2WM0A 3D3VA 4M61B 4MA3B 1B4RA 5F9WC 1RZ8B 2VDPH 1VPOL 1MLCA 4EOWL 3UBXG 4WWID 3MXWL 2I9TA 3ETBF 1G9NC 1A21A 3KS0J 4OZFB 1HCVA 2MQ0A 4XMLH 4X6CF 2Q7YA 5D5MF 1S9XA 1Z9SA 3ILPA 3QEQA 4ZO7A 4WW1A 5CUSH 3QEGL 3WLWC 4QRRB 2Z35A 2YWZA 2RR3A 5I71B 1IAII 3SDXF 5J12C 3MRBA 1AGCA 3VD9A 3U4BH 3HUJB 3V6BR 3MV01 1LEGB 3DUSA 1A7OL 1KELH 5IB4B 4N5EC 5CSZB 1GXEA 1S78D 1AKJA 3RU8L 1AP2A 5I15L 2NY7H 1MFBL 4Z78A 2JK5B 3MV7E 1R24A 5H35A 1L7IL 1ZWIB 2BVQB 3BDYH 3SDCC 3L3IB 1OGTA 1E4JA 1CF8L 1I1AB 3BE1L 1J88A 3WO4B 2JELL 4YE4H 3PDDA 3PWPD 4NNYB 5E9DD 1MJUH 4L8BB 5DJAB 5BS0D 3IAQA 1YNLH 4G43A 1KIQA 1GSMA 3MRKA 3TBVA 4LLQB 3PDOB 2JCCA 2Y6SD 4HT1L 4TYUA 2AW2A 1NAMA 3UAJD 5TQ2H 3MUZ1 2CSPA 3HRZA 4LQFL 1RJLB 5HHQB 4JY6B 2FR4B 1U3JA 3X3FL 1G7HA 2FEEI 4GRMA 1DVFB 4D9RE 2GY5A 3TV3H 5FA4A 2F53E 4JRXA 1LDPH 1W72H 3HNVH 4ESKA 3ZTNL 4KI1A 4NM4H 2DQCH 4EZMA 5CP3A 5L9DH 4UTAL 2M26A 4S10A 1QEWA 1EGJA 4OLVH 4ZNEA 1JF6A 5D70H 5F7LB 4PLJD 4PJGE 4ZUWA 3DUSB 2AJVH 2A74B 5DVKA 3C08H 4MWFB 3RFZC 5FHAL 4I4WA 5ECJE 5FV1L 4L4JA 5E6ID 4F37K 3HR5B 3VXRE 2EIZB 4P4RA 3SO5A 2VLRA 3ARDA 2A38A 1GC1C 4HCRL 4KHXH 4K55A 5DO2D 1PY4A 4MB4A 1I1YA 4TSAH 4GAYA 3BPCA 5GRUH 1XF2B 2PXYD 1IC7L 3I6GA 3NN8B 5E2TL 1A7BA 2OP4H 4MAYC 1K4DA 4JZOA 2FIKB 4G9FE 2AK1H 4LLUB 4KI5F 15C8H 2VLLA 35C8L 5GXBB 1X44A 2R29H 1R3HB 3LKRA 5IVXF 3QIWD 2XA8L 5FYJH 3LD8B 1OPGL 4OF6A 3FJTA 1JVKA 5GRWA 5L6YH 2CXGA 1VFBB 3GM8A 2O26U 3QZWB 4HIJA 3VE0A 3O3BA 2GUOA 3TPUA 3IGAB 4PRNB 5CUSL 1VADB 5DK2B 5C9JB 3D2UB 5EU3A 2VITB 2XZQH 4OTXL 5IR1A 2UVFA 4F80A 2X1OA 3DYOA 5GSRA 5IM7B 3VXNA 3QQ9D 3HMXL 1L9NA 2D7TL 3MRJB 5FKAB 1C12A 2DLEA 1QYGL 5GS2H 2R8SL 2JCCE 1MFBH 5I8EB 1UCBL 4HS8L 3LEVL 1W0YT 3BGFC 4LSVH 1FIGL 1V3KA 4QLRA 4ONGH 3O2VL 3FQUB 3I6KB 2AVGA 1ZK9A 5DJ2A 4N1CA 1MHCB 1ZHLA 3B6SA 1CTOA 3TBWB 2YPLD 5IQ7H 4WI3A 4U1LB 3BPOB 5KVFL 3V79C 1DVFD 1JPFA 3NCFB 5I1JL 3K1DA 5ICYA 2FR4A 1JNLL 4DN3H 1OTSC 4WEUD 4XNQA 3MRIA 4M4RA 4IIQB 3VG0H 3NCJL 1N4XL 1OGAB 4OQ1A 2DKMA 3B43A 4Y4KC 2ZUUA 1N3NA 1LEIB 5FYJD 4YHYC 4JFXA 1KN2L 4U1JB 4C4KT 5KSBE 3ZL4H 1QUNA 3F58L 1ZLSH 4R96A 5JIIA 3OR6A 4PBXA 2AABH 3W82A 3DARA 4DKEL 2WINB 5JOPE 1HQRB 3SGEI 1RFDL 4NNPL 1CD1B 4QT5A 2HA1A 4P57A 2P43B 5CGYD 4UBDC 5GGRA 4QHMA 4HPOH 3GUTB 1KYOJ 5GGTL 5K9KA 3T0EB 1CG9B 2NZ9C 3KDMB 4APQB 4HWBL 3WDIA 2O93L 3MRNB 4OIIL 3RWIA 5EU6E 1J8HA 3ZHKA 4IOSD 3MXVL 4ZS7H 5EU6D 3P9WB 5B22A 1AR1C 3Q6GH 3GZKA 1YEKL 4I2XA 4HJGB 3MV8B 4P9ML 2XN9A 4HCRH 5F7HA 3E2HA 4MYWB 4P59L 1UKQA 2VDKL 3GSWA 4CJ0A 5FM5O 2PTUA 4HQQH 4PRBA 5HYJD 1I8KB 2R15A 3TYFB 2IJ0C 4PGBB 4LLYB 2E7LE 4GRLD 2X4NB 2GJZB 4L3EE 4Y5YB 5BQ7B 5HYJB 3DSFH 2NYYD 2YC1A 2NTFB 3OPZL 1G7JA 4FHBD 3CFJA 1KC5H 4YXLH 3EYUH 5KTEL 3U6RA 4MD4B 5EO9A 1ZGLB 5EU6B 3U0TA 2MCPH 1KCSH 4NO3B 3V5KB 1OWRM 4IMLA 2P46B 3VRIB 5A2IH 5FYKU 3H7LA 4HLJA 2IQ9L 5J6GB 2ADJB 1WFOA 3FT3B 4R6UA 4RAVB 5A2FA 2X44D 1VHPA 4MDJA 2OZ4A 1VACB 4I0PC 3V4UL 5ID0B 4PREB 5GRZA 2IQAA 3IDXL 5IT2H 3MUY1 4A2LA 4GS7B 4WTXA 2QQLH 2D7TH 3NACL 1O0VA 4QRPE 3I6KA 2JKXA 1BMGA 4RAUA 1FNHA 3C2AH 4WV1C 2F54A 4NJ9L 4MB5A 5C0BD 1TCRB 2YPVL 4IMKA 4KRNA 5D1ZD 2DWDB 3QO0A 2ADGA 3DLQR 1CDYA 4LSSH 2ITCB 3C60C 5CEZD 1CXEA 5CINL 3QCVL 5FO7B 3CFKB 2KL6A 3CVHH 5E8DH 3IAGC 5EC2A 1G1CA 1NQBA 4XGZA 1BZ7B 3GJFH 1X7QB 5J4MA 1MHCA 1ZHLB 2HT2D 3B6SB 3FONB 4WWKA 4AQOA 1MJ7H 2EE2A 3NCYS 4TUOA 3U0PB 5CBEA 1P4BH 1D7FA 3AAZB 5TGBB 4LSPH 3VDAA 1CGVA 3SKNB 1G9EA 2APVA 4HF5H 4U33A 1QSFD 4X9FA 3ZKQD 3V4VH 4LPCA 4WO4D 2M2DA 3L1OL 5JMRA 3QEUA 5ADOH 3VXUB 4KKAC 1S7WA 5B4MD 4OCXH 4JHAL 2DLFL 3ALPA 3UBXA 4CMMB 4MQSB 3OGCA 1F2XK 4KJQC 4WW2B 3QDJE 2QSTA 4LVEA 1MJJA 3A6BH 4WENB 5D2LF 3SDCA 4AG4H 1RZKC 3WBDA 4GQPH 3ZKMD 1JZ3A 3CCHA 2FWOB 5JW4N 3S37X 2PYEA 1JN6B 3B9KB 2AJSL 4AH2B 4ALAH 2Y5EA 4KGJA 4NQVB 3RWFB 3U30C 4NQEA 1ACZA 1XF4A 4P9MH 1NCBL 2ZCLH 1D9KA 3FAWA 3PGCA 4I0PA 3OTTA 3LRGA 3RGVD 3H9YA 1C5DA 4U1KA 2ITDA 2XZCH 1MAJA 1U2CA 3OZ9H 3DTXB 4M9OA 1LO4L 1I7RA 3CSYB 2EO9A 4QXTA 5EIIA 3BJ91 2HVJA 3C6LB 3U36A 4AK1A 3BYTA 3HMWH 1MHHB 3QSKB 4WW2C 4ZUTB 1OTTC 1WV7T 1YPZF 1Q9LB 2ED8A 4XWGH 3VWJB 3DNKA 4N9OB 3MRCA 3HAEH 4LLQA 2CD0A 1U91B 3MFFB 1T7ZA 4L8CB 2OJZL 3QQ4A 3QRFM 1ZA6A 1LP9E 1TCRA 1EJOL 5LGKA 4PP2B 1R0AL 3IDYB 3IDGA 4OCSL 5DI8B 1YN7B 2F74A 2HJKB 4OZHE 3TWCL 5A16B 1W0VA 2NZIA 3SGKC 1UH2A 2R2HB 4JQXC 4OT1L 3CK0H 3NIDF 4GLRH 4I5BB 4PG9A 4XX1G 2Q8AH 3DV4A 5ISZA 3GSNH 1OTTD 1OD7A 4PREA 5MP6H 5IESL 4KI5C 4YHMH 2HFGH 3WNNA 1KB5L 2VQ1A 5EIQA 4LCCC 3MRKB 5F9JA 3HE7D 4GW1A 5L0QC 1NBVL 4PRHD 1K9TA 1KB9J 1EHAA 3W39B 3CVHL 4L8BA 5E8DL 4DCQA 4JFHE 4KK9D 1UXWA 3CPLB 3GEWB 5IVXA 3GBML 3EFFB 3GMPA 1IKNC 5BV7B 1KJ2A 2BDNL 2Z35B 4KZEH 1P4BL 5F3BA 4X7DC 3RPKA 1BAFL 1EDQA 2P24B 3BQUB 3JWDL 3RWGA 4NIKB 4G8GA 5TDPA 5J12B 4BQBA 1GIGL 4P3DB 1YC7A 1OW0A 2R0WH 5GRJH 2XWBB 1Q38A 1JZ5A 4HG4K 4Q9CA 3FN0L 1FAIL 2CPCA 3KPSB 2WBJA 5FYLL 3QDJA 5HHNB 2GT9A 4Y1AB 3IJYA 4YDVA 3QYCA 1JTPA 4E41E 3VDBA 3UXFA 3RZCA 2ERJB 4HJJL 2YA1A 4QRRD 3DO7A 1RUKL 3IETB 2Q86B 1CD8A 1JMXA 4ONFH 4J3SA 4DVRL 1FN4B 1NCBH 4UIKL 3JSSA 4NQED 1S7SA 3WFEL 5F7DB 5DO2C 4H25B 2FJFB 3KWWB 1D3CA 4MHHG 4Y2DC 3Q3GA 4XVSL 3IDYC 4NN7B 5FA3B 3VA2C 4Y16D 3IKCB 4NUGH 3SPVB 2V5YA 3GMLA 2J6EL 1QBLH 1LP9B 3BSZL 3QDMA 3HMWL 4C56A 5ANMB 2VLJB 3INUH 1PZ5A 1DQMH 4K8RL 2IAMC 2OZ4H 2A6IB 4X7EC 4YXKL 5CSGA 4DVBA 2X42A 4LLMA 2H32A 2JJVA 1IAOB 3FQWA 3HZYA 5DD3H 4F7MB 4PJ8C 4X98A 5FO8B 2AQ3A 3LCYA 5GRYA 3QZWG 5BVPL 2OJZH 4IHOA 3EOAB 1S7UB 1DBAL 5CSBA 1B6UA 1GOHA 3WLBA 1N2RB 2E7CA 4Y16C 3S6CA 1VENA 3CH1A 5CEXB 3AXLB 3WFDH 2BC4A 2IFFH 2E7MA 5E00B 1G7LB 1T2QL 3GSNL 5IBUB 1BM3L 5BQ7A 5HYJA 1IARB 5BO1H 1UJ3B 2EC9U 2ICWA 5IKCA 1YJDH 3MLXL 3ZDXE 4N8PA 4B41A 3NFPB 4RNRA 3RZCC 3RY6A 3S88H 1OT2A 3ARGB 5DJXA 1I9IL 5GS1B 4KVNH 1ZVHA 4PJ5B 4YFEA 3S3JA 2H8PB 2SEBA 1IEAB 2LVEA 3BGFB 3KXFB 1R3KA 3T4AB 3KNBA 4HJGA 2GW5A 5SWZE 4J3WA 3O2WH 3O3EB 1PQZB 1P84J 5E8PB 3VXPA 1DZBA 4KUCD 2NR6C 3QHFL 1HKFA 5HD8C 4KZEL 3BHBA 3MLVH 5I1GL 1S7VA 4G6MH 2EE3A 2ZP0T 1KEGL 4LIQL 4JFFB 1J5OL 5IJKA 1MIML 4PJBF 2WSKA 4E41B 3GUTA 1KBGL 4QKXB 5IVZA 2CMRL 4MXQC 4S1SH 2ICWJ 2JLLA 4KZDL 4NZDA 5J1AA 1RZJL 4RGNC 1ONQA 4HXBH 5ID1A 1KENH 4X7FC 1CZ8L 1LE5B 2PTTB 1CFNA 2CDGB 3CFDA 3OR6B 4K7PL 5FYLH 3ZSSA 4ERSL 5FYKE 1KELL 3VXSB 3OJDA 4M1CC 1FL6A 2BNRD 4H0GA 1I8KA 3B4NA 4LHUG 4PJXA 1ZGLM 1A9BA 5KAQG 5J3HD 4XBGB 1YEFL 1P7KB 2YN3A 2Y07H 3UC0H 1T1WB 4ORGB 4JFFE 2R1WA 3E6HB 2CLRA 1MREL 1QRKA 1J8HB 3SO3B 4WEBH 3LEYL 3X11B 2J5LB 2PR4H 4MJID 4F2MB 4PJXF 3P9LA 4FTVA 1H8SA 2VZUA 4QHNB 3EYSL 5DHVH 5MEQA 3SDXB 3MLTB 4KI5E 1OP3H 4UB0L 3UJJH 4HFUL 4ODUA 1N0LA 3QA3A 1ZLUH 4R97B 3ILQC 2BJML 2OJEB 2ADIA 1CICB 2P44B 3DECA 3H9HB 2EE6A 1C7SA 3EYVA 4PS4H 4JPWL 4YHPB 3DVGA 5ICZB 4M7ZB 4XPBH 4I8DA 2FJHB 5E8NB 4RRPG 5M7QA 5J3HC 4L8DA 1YEIL 3BPLB 5DD3L 4S2SB 4ZFZA 4OUUA 5C0EA 1SEBB 2PO6C 4NRYA 5JHLH 1EFQA 2JK5A 3FFCE 4OLZL 3SKJH 3LV3A 3RL1A 1Y18A 5F97E 2GSIB 3CAFA 2AJVL 2J88H 1VFOA 3SDDD 2KZ1B 2XICA 3C08L 4IM8A 3C6SB 4HIIA 2CDEA 2DICA 1LP9F 3FKUS 5EZJB 2YMXL 3DUHA 4XAKD 5CJ8A 1HWGB 1B2WH 4UV4H 5H37H 1IGJB 3F7YA 5I1CH 4G8GD 5FV2A 43C9B 5CMAA 3UTQA 4HMCA 5I17B 3I75A 4HWUA 5ERWA 2FJGB 2YA0A 3HPLB 5HPMA 4J4PC 4RFNC 4OBSA 4NHUE 3IB4A 5C0FB 4HS3A 2AI0H 15C8L 4EUPA 2HWZH 1INDH 5DA4A 4NQCE 4OFVA 5DYOB 5HGAA 3HG1E 4X6FA 1K6QH 1UM4L 5T1KB 2ESVE 1W8OA 4YPGB 4HBCL 1KBGH 1EGJH 4NP4L 4LAQL 1WT5A 1YNTB 4PJ9B 5HI5C 3L3KB 3MNZA 4FZEL 3C5ZB 1EHLL 1T1XB 4G6AD 3RNKB 2LAAA 4W6WB 3PGDB 2VR5A 3T65B 1OT1A 1CL7L 4OZIF 1JNJA 4PJCB 3QI9D 3HC3H 2F5BH 1QZ1A 1RJLA 2P5EE 3BAEL 4EDWH 5HHQA 3D25B 3HMXH 3MRDA 2YA2A 4DEPC 3NN8A 3T4YB 4JY5L 5LBSH 1U8MA 2X9YA 3SEPA 4I3SL 3WFBH 4NRZA 3G04A 4POZD 3MJ7B 4HIXL 5IFJB 1OARH 1A47A 4S0UC 3CVHB 1CE6A 2WNGA 5E7FA 2ARWA 2JJWA 1I8LA 5BRZD 4N0FB 2VLRD 1IZJA 1HDMB 5C8JB 4HC1H 1DE4B 4R2GB 3EYSH 3MBXH 4XMPL 5GS1C 1F58L 1BQSA 3BIAX 1MHPL 5LAXB 1KCUL 1T20B 4ZFOL 1TPXB 3R8QA 3WN5B 1MCDA 4M02A 1E6OH 2J8HA 3C5JB 3TN0A 5KJRL 4RMQA 5DJDB 4DN3L 2GJ6A 2WWMC 3VG0L 4I0PD 3V0WH 5GS2D 4QRSB 3I75B 1AJ7H 3RRQA 3AB0C 3SDAA 2PYED 4YBLC 4YHLL 4UDUA 3ZL4L 1XH3A 1F3DJ 2EKJA 1QRNB 3VFMA 4PJIE 5T3ZE 3O6FD 1LNUA 2R4RH 3HI1B 3S3PA 1FL5B 1QLRB 1A6TB 2C3VB 2EDBA 5HHPB 1E0OB 1M1SA 5I30L 4M5ZH 1K8DA 3VJ6B 3IKKA 3HI6L 1P7HL 5HHOB 4UU9A 2NYYC 5DTFB 3V8OA 4WO4A 5C08D 3ILQD 1F90H 3LKQB 3D3VB 4BQ6A 2HRPH 4PJEE 2XWTB 5ADPL 4XP4H 4ZAKD 1ZLWK 4MVBD 5IB5A 1WIUA 1ZANL 4H20H 1REIA 1CE1L 4P5TD 4XC1H 1BVZA 3KHQA 2B7DT 4FQCH 4WI9A 1WEJL 1AR1D 3MLZH 4LMQI 4HDIA 4NHCH 4MNGE 1UENA 4PB0H 3RWHB 8CGTA 1G7PB 4LKXA 4LSQL 2AI0L 3S35H 4UDTB 1NC4D 3RWEA 1I7UA 1UWXK 3SGEH 4QRRA 4FS0A 4UBDD 3FL7A 5ABDE 3QDME 1MUJA 1K6QL 3S5LG 3K2MC 1OM3H 3D0LA 2HKFL 3DO7B 2X7LA 2EXWC 3WFCL 1RMFH 4QY8B 1L0YA 5C0BA 4DN4H 1MI5E 1SJEA 1OAKH 4OZIE 2BVUA 3K3QA 3HE6A 2A6DA 3BZ4B 1NGZA 7FABL 3TT1L 3HPJA 5IF0B 3TBTB 3HC3L 1S7RB 5EWIL 5FM8A 3TIDA 3G6AA 4MNGB 2FEDC 3QI9A 2GAZB 4Z77B 1C1EH 2V2TB 3U0WL 2QADB 4NKMA 1SYSB 1SYVB 3NACH 3WNKA 1ZKAA 1Z9OA 3DIFA 3UDWC 1JGLL 3WHXA 5E6ZA 2F8OA 2DM4A 2FBJL 5FO9B 5SWQA 3V6OA 5F9DC 1KJ2B 2Y4SA 4LGRB 3MJ9H 2PF6A 4NKQB 4PG2A 3TH2T 5A2JH 3X13B 3BEWA 4D0BB 3S34H 2X4TA 3BP6A 1DUYB 4Q2ZB 4E41A 2YRZA 4JDVB 3MBXL 5BV7H 1MJ8H 4JO3L 5KSUB 2DLGA 3CFEA 4K71C 4WUUA 4QCIA 4WFEE 1D5XA 3O6FB 4P46B 5I0DA 5CS7A 4U3XA 5DEZA 3HLAA 1BWWA 3MOAL 3PHQA 4KXZI 4P4KA 3O8XA 2DL2A 4AENA 1QBBA 3V5DB 4LSPL 5IB2A 3UZQA 5C0ND 4BFIB 4LQFH 1QSFE 3L1OH 5F44A 5EO1B 2UWEB 5L2KB 2R4RL 4XP9H 3WN5A 1CLZH 1YY9C 2GITB 3B2UD 4OCXL 4JM2F 5E95B 3MREB 5TH2A 4PJ7E 3C87A 4F3FB 5BRZB 2HJFA 5C7XL 2FD6L 1P7QB 3QUML 5J89A 3QIBA 4PRIA 1N59B 1S7UA 2RIKA 4YFDB 4QGYA 1F90L 1DJSA 3MZGB 2UZXB 2UVEA 2IMNA 2D3VA 2PXYC 3KPRA 4JJ5B 1V5JA 1F11A 4GQ9H 3STLA 3ARVA 5BZDA 3DURB 4R0LB 3MJ8B 2ZCHH 1WEJH 2I25N 4YEEA 1G9MH 2YOCA 3ECBA 3FHAA 3P30H 1BOGA 4U7MA 4MS8A 4WI2A 3L3OB 5HGBB 4LCIH 3ARED 4O4YH 1FPTH 1UH4A 2C5DC 5CZVH 1XGTB 4HLZH 1U8IB 1FVCB 5FGBA 2DIAA 2W0LA 4X6DA 1A02N 5EUKA 2VDOH 2BNUA 5IMMA 3MRCB 1D9KC 3DVIA 1EH9A 4GBXA 1U8PB 3MLRL 1JN6A 2IF7A 1BIIB 2DQFB 4OFPA 5EC1A 5J6HB 2NY2B 4UT6H 1AO7A 4BK4A 3LRSB 1BEYL 2FL5B 3KYNB 5AWNH 4X6DE 5I1KL 2QKIA 4P5KA 4QOKE 5HPOA 4WTZG 4LU5H 3RJQB 1Q94A 2NXZD 1RZIA 4YWGH 3BT2L 4XPGH 3TZVC 2HH0H 5I17A 3OR7B 2HKHH 3P4NB 4GSDL 3I85A 3VXTA 5IEHA 3E2HC 3VXRB 5FECA 4XCYA 2R8SH 1DCLA 3N85L 4JQVA 4PRPB 4Z7UF 1ZHNA 3RTQA 5IESH 4LSDA 3ES6B 4UILH 3EDJA 1KB5A 3MCKA 3MJ9L 4NO0D 5I0ZA 1EV2E 5KSVB 1M6OB 4GBXC 1CXHA 5HYEA 3DTXA 4P4KB 4JAMB 3NIGE 2VL5B 1NAML 3H42L 5HHME 4BQ9A 4XB7A 2L7UA 3MGTB 4PRIE 4RZCA 3VGAB 5JOFA 1MJ8L 3QR2A 5KVFH 1KEML 2NW3A 4YXHL 2OSLB 2YD7A 3OKMA 1OHQA 1ULVA 1D5IL 2CKBH 1YN6A 5CEYB 2DJ4A 3NCBB 4UTBH 3FRPG 3VGHA 1XGYL 3LQAC 1FFPB 1T7YA 1U8OB 4PJ7B 4E42A 2WUBH 2I9LA 1WISA 2X5PA 2ZOKB 3GRWL 2EZ0C 3WLWD 4HWZA 5JZ7C 4XVUD 3VXOA 5KSBF 2YEZA 2FYYB 4MCYA 1AC6A 3I50H 4E0RA 5TJWK 1QLFA 1MRCL 2D31A 3QUXC 4WHCA 4YHYB 3KXFD 4CMHB 4EDXB 3I2CH 1MFDL 4NQDE 5DMGD 5C7XH 2AJXL 1W72B 3HC0B 3EFDH 5D7IA 4F2MA 3R06A 1HINH 1IC4H 1NGXA 3H7BB 1E27B 1K3ZA 3PV6B 5EB9A 2YD8A 4JANB 2QADC 2UV3A 5E6IB 4OJFH 3JV5A 4FXGA 4JJHA 1LD9B 2BSTB 4RGMB 4GW5B 4HWBH 1I8MB 1KGCE 4LMQE 4I48A 4DWHA 3FB5B 4K8RC 3DXAA 4ZS7L 1GRWA 3D0VA 4ZFFA 4JKWA 3TYGH 5T33L 2X41A 1QHOA 4QNPE 2F54B 2Q3ZA 3V0VA 4XT1C 5GHWH 3TIEA 1BZ9A 3RIFF 2VDKH 2NY0D 3BRDA 1RIUH 5TF0A 1GPOL 1N5AA 3KPQA 1H0DA 4KTEH 3AM8C 3CD4A 4M7LT 1V3JA 4QHUB 3BW9B 3UYRL 4GG6B 4O4YL 3L3DB 1HNFA 1J12A 4LSRL 1TZIA 5C0JA 1FQ9C 3M8OL 3ARBD 1CG9A 1DBML 3EYUL 1QBLL 3CVIL 3VWKB 3BD5A 4OZGE 3RVXD 2EDKA 3LIZH 3CDCA 4WHTA 3LPGA 5A40E 1LO0H 2IBZX 3VCLB 4KH2A 2XPGA 4LU5L 1HHIB 4PJ5A 1DBAH 3KLAA 2X89A 2BNQA 1I3VA 3JBG7 1MJJB 5E4EC 4LDOB 2WIIA 4W4OA 4DZBA 3N85H 5DMIL 1F4WH 4NJAH 1RHHB 1JWSB 3H3PL 1FNLA 2VIRB 5GJSL 2YC1B 4Z7VE 3KNBB 1DP0A 5CEXA 1FSKB 3E3QC 4X7SL 2AAVA 4Y5YA 3QCVH 3SKNA 5CILH 5DJXB 4OFDA 1JNNL 1U92B 3RTQC 5F21B 1T89A 4P46C 2NW2B 5FGBC 3FRUB 3PWLB 25C8L 4PRHA 3FQWB 1X5HA 4JM2B 3C60B 1BQLL 3ULVH 1UXSA 1U9KA 3CU1A 2Y25A 4FMFA 4TPRH 4CRPA 1EX0A 5GZNC 1IL1B 1LD9A 2BSTA 2AXJA 3KYOB 4Y19B 5T1MA 4MZ3A 2VLKA 4LNVA 5ITFA 2L4OA 4NBYB 3D6GA 3EIFA 5D7IB 1GHFL 1RULH 2EDDA 3SE8L 4AMKH 3M45A 2V2WB 1YMMB 2JIXD 3WUWG 3DVNB 5FF6B 2VUOA 3STBA 4MCYB 4L4TA 3VGBA 3VXQA 1XGQA 3SCMC 4ZFFB 5CJ5A 3F6IA 5J06A 4RGND 1PZ5B 5TF1L 2VKWA 3S4SG 3HRPA 2ZOKA 1MCOL 1KPVA 2VXSH 1JYNA 3SGDI 1PG7W 4HUUA 3NCMA 3HCVA 4NNXA 5EUOE 3HC0A 4JO4H 4KTYA 1XGUA 2F19L 2ZCKH 2K7PA 4Z7UA 3CGTA 5SWSE 1K2DA 1H3UA 3OKMB 1G0XA 1QSVA 2K1MA 4Q6IA 2PR4L 2R1YA 1TVHB 4YR6A 4LNRB 1M71A 1PGRB 2DM7A 4MJIE 1I3RA 1KPUB 5CZXD 1MWAL 3T04D 1WZ1H 3V7AG 3QJHA 4HFUH 1Q1JH 2FHBA 4S1QH 2VLRB 4YHOL 4W6YB 3DRTB 1MUJB 4YBLB 1CFQB 1LO4H 2AK4E 1IZKA 3O6KL 4TULL 4LQ1A 3N9GH 3FB7B 1U8NA 5F9WB 3WL9B 3RAJH 3CFCL 2CUIA 1U8LA 1NL0L 4APQD 3UJTL 3IVKA 2EXWD 1KIPA 1WTGT 4WDIB 3ZMRA 5FGCB 2CJUH 2FIRT 4JRXD 5DC9B 4ZOCA 3WKML 3SQOH 3MA7A 3LRHA 3BMWA 5T3XD 2QSCH 4U1GB 3X14B 2VDLH 4RISH 4Z76B 5IOPA 1EJOH 4OUUB 4FNLH 5TQ0L 2CIIA 1PVHA 1A7PH 3R1GL 4RGOH 4XCEB 1TZGL 1NCAL 2VLRE 2X4OB 3FFDB 2J88L 2VJXA 2GTWA 2VSDA 4K94L 1HQRA 3VRJB 5EA0L 1JNHB 2HVKA 4BK5A 1AQKL 3GDBA 1NBZA 4ZTPL 4NCC1 2H26B 3T08A 5IBLD 2FECI 1KB5H 1RIVL 4GT7A 4KRPC 4TSCL 2ADIB 4JPVL 4XPAH 5F89A 5ELIA 4OLXH 1RJZA 1ADQA 5JORB 4HWEH 4W68A 3KR3L 3WHE1 5TDOB 1AO7B 1KPRB 3BDBA 3U83A 4M7KL 5J13B 2CK0L 4O2FB 1A7QL 1MCRA 1CFBA 2VZOA 5ETUA 1UWEL 4P5KB 1INDL 1BLNB 1SHMA 1GYAA 5HY9A 3RP1A 3DPBA 4V1DE 1F3RB 3U7AA 5FEBA 3JTTA 3O6FC 1BFTA 5DJCB 1A4JA 5HYIA 1XEDA 4H88L 5I1AB 2X1QA 4PP2A 1BIIA 2DQFA 5L7XL 1FV1A 3U9UB 1UQSB 1SJXA 3HB3C 5SX5H 5I8EA 4ZSOB 1A3LH 1UG9A 5C07E 1J18A 3IDMB 4P9HC 1FP5A 5D5ME 3UEZA 2Q7YB 2DKUA 4X7TB 5FM5M 3LPFA 2AQ2A 1QP1A 1EXUB 1MCJA 2F5BL 2I5YL 3J8F7 4U2ZA 3LKSA 3GSQA 3HZVA 1FGVH 3Q5OA 1JHLL 2C26A 5ESVA 4JFDE 5E94A 4PJEF 3TM6A 4G5ZH 4WEMB 1DLHB 1UM6H 2ZUQB 3QIWB 2BOCA 3E6FA 5EO0A 1T5XB 5GS0D 5EUKB 1L7IH 5IB3A 1D5BA 5F7MC 4JVUA 4N90D 5HYQB 3PHOA 4UIKH 5D6DC 3ARBB 1DQDL 3L3KA 3MNZB 1A7RH 1CF8H 1IFHL 3SDDC 1ED3B 3KPNA 3LKPB 4ELKA 1MHPH 2PXYB 4YGVA 3P0GB 4M1DH 4RMVA 1KCUH 3P4OA 1S9WB 2J12B 1IQDB 5IGXH 3ARZA 2ENYA 2H26A 3O6KH 2NY0B 4TULH 4OCRL 4JJ5A 5H35B 1OL0A 1B9ZA 3VFUB 4L3ED 1AP2B 3IU4H 5EBWA 3KPSE 3G6JE 2EIZA 4YHIB 4ELMB 1P1ZA 4M61A 3EGSA 3TVMD 1P5VA 1UKSA 1U6AH 4QTIH 3KJ6L 1MCBA 4CN1A 5L9DL 2E27L 2P49B 2DQUL 3U48A 1TNMA 5DUML 5LQBL 4PP1C 2VNCA 4F15B 1FL3B 1P84K 4N1HB 3IFLH 4G80A 2WANA 4PY8J 1IQWH 4ZS6C 1ZVYA 2XXMB 3BVNB 3PWVB 4HIEA 4MCZA 2X2YA 1W2KT 5JMOC 2LE9A 4U1HA 2EH8L 5GRUL 1IC7H 3L7EA 1ES0A 2H1PH 3NCCB 4KRLB 4GXVL 2QEJA 5AEAA 4F33A 1MCWW 2A6KB 2CK0H 3S35L 1BP3B 3ULUF 4D3CL 1IAKA 1MIEH 3V6ZA 3QNZB 35C8H 3HZMA 2R29L 4N0CC 3VMNA 1F3DH 4J6RL 1QPXA 1KEGH 2X7LB 1AH1A 1F5WA 3FQNB 4RMWA 2CMRH 4JM2D 4WCYL 4JQIH 2I07A 1OD9A 4UAOB 5JW3H 1F6LL 4Z77A 3IRZA 1NGPL 2CK2A 3P9MB 3GJFB 3L3GB 2EYTB 2J4WH 2W38A 3NPSC 4GRWE 4PLKC 4ZODA 3HPJB 5IF0A 4MZ2A 1NEUA 2C4XA 4K23H 2NY2C 2HLFD 4JRYA 1CLYH 3BZ4A 3EO1A 4MJ4A 3EJZD 2VTFA 4JLRA 1UJ3C 2VLJD 2DI8A 1URLA 1FG2A 2BNRA 4BH8B 1I9RH 5DUPL 4HKBA 2NLJB 4PJEA 3S8WA 1RZGB 4D9QD 4Y16B 4FOMA 4JFQB 1FNGA 2XQBL 3QG7H 3D9AH 3S97C 3JV6A 4H1LG 4PJFB 1A6WH 1S9YB 2PKDA 3O45B 1QACA 1F45A 3VFPB 1RURH 4MGXA 5D96B 3CPLA 2AEQL 2AXFA 5DFVD 3UP1A 1W0WB 1TPXC 1JZ8A 3RA7H 3GMQA 3PHSA 4ELME 3VWKD 2DM3A 3U1SH 1NC4A 2FGWH 1FCCA 4M00A 1OB1B 4NKDB 4DKFL 8FABA 4B53A 5I9QB 4XXCC 5DJ8B 2X70B 1O7VA 2DQTH 3EJZC 1KN2H 1MH5B 4IIQA 5T3XE 1OAQH 2R2HA 4XPBL 5D6CB 2AJYH 3QFJD 2C4FU 3P4OB 4NT6A 2ATKB 3MV7B 4YZFE 3SJVA 2NX5D 1I85C 2FH8A 4Z0BH 3MRFA 3SDAD 5INCB 1LQSR 3RNKA 2FRGP 4IIQC 5DRZA 5D8JH 4PGZA 2DQUH 4LLDA 2ADFH 4TRPL 3BXNA 4HPOL 4JFXB 1ITCA 5IFAH 2W0FA 2VAJA 2Q6WB 3VWJD 5DYOA 3SKUD 1ITBB 5TFSH 2VZTA 4GBXD 1FFQA 4PTTA 3OKDA 4MD0B 5LG1A 3WIHL 3GSRA 3DO3A 1KB9K 5ISZE 1F8TH 2Z31A 5KS9A 3MYJA 2VH5H 4K7FB 1A9EA 3C5ZA 2VZ1A 1S8DA 4KVCH 2A9MH 3D2UD 3D18A 4GXVH 3K7UA 3UTQB 4AEEA 4AEHH 2MMXA 4ISVA 2IH3B 1IM9D 4L8SA 5T3ZL 1FO0B 3MRGA 5CZVL 4G6JL 3ZYIA 2YPKB 1TVDA 4PJBE 4PLNC 3ZHDA 1MI5D 2ICEB 1NFDA 5D7SH 1DEEB 3THML 4OCWH 3QT2A 5CBAB 4I3RH 2QQNL 3BPNC 1L4IA 5JHDD 1Z6JT 1MRFL 1X5YA 1CBVH 3UPRA 4TQEH 4Q58C 1AD0A 4XNXH 3SCMA 3ZHLA 3TH4T 3LY6A 3WDJA 3O0RH 3HAEG 3QDJD 1J1XH 1N6UA 5FUZH 4K23L 4L8DB 4XHJD 1U3HC 1PLGL 3BT2H 3PL6A 3TJHD 1SY6A 2HAZA 5HHXL 3HPLA 1T21A 3WS3A 4OD1H 3MV11 4G8FA 4YIQA 32C2B 4I77H 5JPNB 2M8XA 4MNQA 4KRMB 1A4KB 3VDCA 4GRLA 2J3SA 4CU7A 1RK0B 4NJ9H 3IJYB 4YDVB 2MKWA 4NQUA 3P0VH 4JKMA 5MEPA 4GJTB 1I7TA 1ZOXA 3OXRB 4UDUB 1LE9A 2DWEA 1NSNL 3BKCL 2Y5TB 2ZPKH 4X4ME 5ESQA 2A73A 1T1ZA 1FYTE 2VERN 1UB6A 1UM5H 2IPUK 1FNEA 1RURL 4WFFD 5KS9B 1JPST 5DT1H 4JQVC 1J87A 2GJJA 4G9DA 2BCKB 4K2UH 1KCVL 1JZ7A 4PTTB 4L3AA 1T20A 3CXHK 4HFWA 3U1SL 3QDGB 4DKFH 2E7BA 5JXED 1AI1H 4WI5A 5FECB 2V2XA 5LKNA 4L9DA 4ZUVB 5IEKB 1A5FH 1IC5H 2FEDD 1NFDE 2JCCB 4PJ8A 1TTUA 1PD6A 2V7HA 2OBGA 2XV6B 2ZUVA 5ADOL 3VFNA 3MRRB 4GAJL 4LRIC 1X5IA 1T0MA 4HG4J 5LXGH 5GGQH 1MRCH 1RVFH 5FA4B 2COQA 2WMPA 1FYTB 2HLFC 3EDFA 4FXLA 5DJYA 5C0GB 1YECL 1CXIA 3EFDL 5D6CA 4BUGA 5KS9E 3OJ2C 3BEVB 3KPTA 4OGAD 4MJIA 3CU7A 4Z76A 1G7IA 5IFAL 5IOPB 2B1AL 1EAPA 2R4SH 5TFSL 1NDGA 1B4JL 1EO8L 4KKLD 3QUXA 1T4KA 4DGIL 2R0ZL 3AMKA 3O9WC 5KSBB 3BZFA 2DQGL 4M7ZC 4XC1L 5J57B 4XBEH 3UPCA 2XZCL 4KVCL 5I1AA 4IOIA 3TF7C 3S4SA 1WITA 3HA0A 4JO1H 4M8QB 1XT5A 1A6ZB 3GMNA 1F3JA 3DX9A 3VFRA 4LSRH 5IMOA 3T77B 2EXYC 5D7SL 3THMH 3RVWD 4HMEA 4PJIB 4LSTL 4ORGA 3QULA 1QKZL 3QI9C 3F7VA 2AEPL 1YEHH 3Q6FA 4NC2B 5BJTB 1QFWI 3I6LE 1JGUL 1EERB 4Z5RA 2R1XA 1JPSH 4F8QA 3GKZA 1T6VN 3QB7C 2DBLH 4NO5A 1DANT 5H2BA 3DMMA 3RIAK 1S7VB 1YPZE 4RGNB 4YQXH 5TDNB 2DTMH 2IC2A 4S1RL 5BMFL 1H5BC 3CNKA 5L2KA 3CFDB 5EU4A 1C16B 3HE6D 1NCWL 1Q9OA 2YBRB 2RAMA 5EWIH 3UTSD 1J10A 4JZNA 4DOHE 5JW4Q 3ZE2E 4KRPB 4KDVA 1KJ2H 1JWMB 5HYJE 4LOUD 1UVQB 1IAIL 1TZHB 4OFYD 1U93B 4N8CL 2BNRE 4JN1H 3OAZK 4XNQB 1KCGC 2A2QT 2W9EH 2DLTA 3MO1B 4OV5A 1JPFB 2FO4B 5D96C 2X4TB 4U1HB 3GBMH 4C83B 4BSWB 3MOAH 4JFEB 4MJ2A 4ZFOA 1NCNA 2AV1A 2KH2B 3L3JA 1WK0A 5E0QA 3FB8B 5I8OH 4MXWH 5K59F 5MEQB 2Q86A 3IETA 1IM3A 5CP7A 1ZEAL 3KJ4C 3QO1A 2MQCA 2V2TA 4G8IB 3IF1B 3TNMB 4MNHA 2WWMD 4ZOEA 3T0EE 4G8EA 4HUNB 4A6YH 2R2CA 5C2BH 1F13A 3KYKH 4JM4L 5FXCH 2ZNWA 4JFPA 5KS9F 2D4FA 1PX3A 1P1ZB 2ZUQC 4LVNB 2VN4A 5GPRA 3D2UA 5EU3B 4Q9QH 1JF5A 1I1FA 3FT2A 4GRLC 4NUJB 3VXMB 4OD2B 2Z4QB 1EMTH 3O11A 4ZDHA 3ZKXC 1NDMB 4K3EH 4MJ6A 4NRXA 1FZOA 1P6AB 3FO2B 3VXQB 1WBZB 2PYFA 4WHYH 4JO4L 4H8WC 4M48L 2BSSB 3H3KA 1OAZH 5MEOB 1V7NH 2RFXB 4Y5XC 4V2BA 3IS1X 1JHKL 4NKIH 4FZ8H 5HVHB 2KUTA 3V5KA 1RUQL 2NMSA 2IH1A 4XH2B 3P30L 1DQJA 4EXPX 2CRIA 5K9JL 4O2EB 3CFJB 4QHKJ 2WW8A 4G7YL 3PIQA 3VFOA 3V4PH 5DHXB 5F3BB 4LFHD 1FZJB 2EEAA 3MR9A 5F7KC 3MOQA 3VFPA 2AKRA 3NAAL 1E4XH 3RPIB 5FYKL 3EOTH 3WFZA 2IANE 5IHUH 4U6HB 2YZ1A 4IOIB 2Y9RT 2YKLL 3QWOA 2GCYA 5DJ6A 1A14H 4MDIA 2ICWB 5IKCB 4DGVL 3P4MB 5D7LB 2HTLD 4U6YA 3E2HB 5IVXE 4GW1B 4C58B 5DURB 2Q76B 2IALB 2QSCL 2GT9B 1PBYA 5DVNA 4X8JB 4J4PD 4YWGL 4XPGL 1N0XH 3R1GH 1A7PL 1N2RA 2HKHL 4RGOL 4XRCB 4CADB 1CT8B 3DMMC 5DQ9A 2NY4B 1BHGA 4JB9L 4Y5VB 3QFJB 4OF7A 1WBYA 1D6VH 3N1GC 4GW4A 5T1LB 3P9MA 4ZD3L 3VXRA 2XWJB 1VPOH 3C5JA 3AU1B 4JFEE 5ICXA 1T1YA 2PTVA 1H9VA 5EOQH 3K81A 3UTZB 2IANB 1KLFA 4MB3A 1A3QA 5IBTH 3RL2A 4HWEL 3GI9H 4PJGA 1I9IH 1N6QH 3EKCA 4N0FA 5AG9A 1KEMH 5E9DB 5DUBB 3LRSA 5DJCA 1UYWL 2I24N 2WBWB 4QEGA 5E2WH 4AEFA 4J3TA 4UTBL 1ZVSB 3MLVL 2VOTA 4M7JL 4I0KA 4IEFB 1A6UH 3L3DA 4WI7A 1G9NL 4DTGH 1L6ZA 5MHSD 5IIEB 2HFTA 4X6DB 5CP3H 1NBYB 3L95A 5HI3C 1FLRL 5L7XH 1P2CA 1I3GH 1ADQH 2ITDB 4LVHC 5C2BL 1NMBH 5D7KD 2A9NH 1RJZB 2E9IA 4MD5A 4PRDB 4Z7OE 1I7TB 5TPWL 1KJ3H 1FAKT 4ODHH 4K7PH 4ERSH 3MUJA 1KTLB 2AJXH 3RVVC 4ODBD 1NLBH 1HINL 1UQSA 4XBPA 1Q94B 4QXGH 4OJFL 5C0IB 4FFWD 3GSUB 3R06B 1AY1H 2OL3H 5C09E 5ITBH 1YEFH 4Z7WA 2NY5C 2Y07L 3UC0L 4EXKA 3RPIA 3V95A 3AC0A 1NGWA 5T33H 3TYGL 1V7NL 4P5TA 5CFHA 4UINH 3V9FA 3LZFL 2ENSA 2MSPA 3PIQB 3VFOB 1DANU 3VXMD 3X3FH 2OTWA 4QNPF 3QEUB 4X5XB 3V8CA 1ERNA 2DQJH 2Z91A 5F88A 3UPRB 3VFUA 3ZTNH 3OKLA 4KK6D 4PPTA 4HUXB 5I19L 3I3EA 1IQDA 2HT4D 5J9PB 3QWOB 1Z5LA 3ARFD 5E9DA 1CGWA 1CXFA 1OLZA 1MEXH 4Y4FA 4BJLA 5IB2B 1KXQE 3WHE0 1CVSC 3PG2A 1E28A 1C08B 5IHUL 4YDIL 4TTGA 3BDXA 2PYEB 4X6DF 1I1YB 3IFNL 1RU9H 3UAJC 2ICWI 3D39B 2Y72A 1LMKA 5CLTA 2NR6D 3ROOB 3MROA 1SJVA 1LO0L 1U6AL 4QTIL 2YUXA 3N1PC 5E70A 2V2WA 3AS2A 2A6JB 4D0BA 5DI8A 2VXQH 3C5SB 1ZA6B 3H2WA 4Z7UE 5SWSA 5HDBE 3D85A 5A43C 3BGAA 2OJEA 1NFIA 1BX2B 5K9OB 5B39A 1CI5A 4OD3L 3CIQA 3WJLC 4NN5B 4P99A 2XN9D 3MJ9A 4ZUSB 4Z7VF 3RVTC 3ABZA 3DXAD 3EYQC 3KAAA 1S78C 2FH6A 2G5RA 3QHZL 3CFBA 5E2WL 2LFGA 4LCWE 2B1HH 3ULVL 1ZA3B 1AXTH 3MMEA 1U95A 1SM3H 3O6FA 1LWRA 4EJ1C 1PSKH 2GTZB 4OZIA 1A6UL 4P2RB 1OSZA 4AL8H 2OQJA 3P73B 3AB0B 1AGBB 1U3HB 1EGJL 5T3ZD 1HOCB 1GAFH 2CKBA 2D03H 4HUUB 5AZEH 1QA9B 5F3HA 3DRQB 1FRGH 5IHBA 4BSJA 3B2UC 4V2CB 4HCRA 1IT9L 4S1DC 1I9EA 4Y4KA 5DWUL 1FNAA 2VIRA 2BSRA 2OTUB 3FFCD 3TO4D 3TVMB 3WIIH 1CLYL 2Z8RA 4RDQG 2ZSWA 4LLYA 3F65A 3DMMB 2XN9E 1N59A 4I3SH 3WFBL 3T0EA 5C2UB 1AD9A 4IJ3C 2CRYA 3QRGH 1P4IL 1U41A 4MAUH 2QQQA 3OXSB 3JV0A 1CFSA 4O2CB 2I60L 4LKCB 4U1MA 4OI9A 1KLUA 3KDMA 2XYCA 1U8LB 4F57L 4R96B 3SDDB 1WGOA 4X99A 1RUPH 4NCC2 1FYTD 1WZ1L 4PGBA 1MLBA 2D0HA 3GK8L 4MA8H 5KSAC 4MA3A 5F1IB 1CVRA 3V52L 2ILLA 2VE6B 4PGDA 4M4PA 2OS7A 3MCLH 4ONOA 4Z7QF 1VB9A 3MUGA 1T03L 5FO7A 1M71B 1AJ7L 4JCLA 4U1GC 1PG7H 2OX5A 3CH1B 1HEZA 4C4KO 3AM8A 3MLYL 4KKAD 4OLWH 2CJUL 4POYA 3HN3A 1TIUA 3H8NA 3L5IA 1HN1A 3BMVA 3HCVB 1T83A 3U2SB 4JFZH 4R4FH 3RIFK 5ALCL 5E2VL 2H32B 1CK0L 4OF3A 3UTPD 1ORQB 4X6CE 2G5BA 5EUOB 5JIKA 1YQ2A 2FO4A 4R4NC 1Q9OB 3L9RA 4NBXB 3OHXB 4RAVA 3IKCA 4OIBA 4UOJA 4NRZB 4FP8L 5L2JA 2DQDL 2BY0A 5FYLE 3WIHH 3T0WA 4FFYL 1BBJA 1KJVB 1Z2KA 2BERA 1U8KA 3MRDB 4G42A 1KOAA 1T6WA 3O8XD 3Q6FB 4M1GL 2YEZB 4MMXC 5FUCE 2W07A 4MNHB 4LVNC 4NFCA 3CJJA 2JJSA 3SE4C 5BCAA 3CLFH 4XP5H 2A0LC 4KY1L 3O81A 2B1HL 3FB8A 4HH9B 5HHVH 1M7XA 3TIEB 3FFCB 3TO4B 1CFTA 2VABB 5MI0B 3M1BA 4OCWL 1IGFH 2XG5A 4U1SA 5JHDB 1QBAA 3F8UB 3QZWA 5LGJB 3IJHA 4ISVB 3ULUE 1IGYB 4OM1L 4TQEL 3WXWL 4LGSB 2BX5A 3OXSA 3CVHA 1S7XA 4D0CB 1FRGL 1D5BB 5HYQA 1IM9B 1MRDH 2A73B 1KB5B 3MCKB 1OTUD 2XWTA 4P3CL 4YFLF 4O9HL 1Y6MR 3DBXA 3NPZB 3UTOA 1VFBA 3OG6B 5CZXC 3WE6A 4HULB 3SDXE 3GSQB 4IRSD 1A4KA 3QRGL 5C0RL 3UBXI 4NQCB 3ARDB 4P5MA 3GMRA 5KZCD 5AYQA 1N7MH 2HT2C 3MBEA 3WIFA 2Y7QB 3Q5YA 1R5WB 1FFPA 5DEFB 1U8HB 3NBNA 5JPMA 5BOPA 2CLVB 3GHEL 5IB1A 1JV5B 1HXYA 1OQOA 2ZPKL 1QRNA 3VFMB 5H94B 5I8KH 4JO3H 3C60D 3FZUD 3MLTA 2DLFH 4EVNA 4M1DL 5DT1L 5HJ3B 5EORL 3BPCB 3RKPA 2Q8BH 1FYTA 5C0GA 3E3QA 3SCMB 4AM0A 1OQXA 5EZOL 1WZLA 3DX7A 2HFEA 5B4MC 1FNEB 4M93B 3MV8D 3PWJB 2NX5E 1IKFL 4I4WB 5GRVL 4ZAKA 4JGUA 4YK4C 4HJ0C 4J4PA 4PRAB 3WJJC 3O4LE 3KPMB 3QDGA 3T0ED 3VI3E 5IFHL 5EZJA 3SDXA 2KZWA 5DRNA 4JFYB 1KTDA 5ICXB 2UYLB 1P53A 1NDGB 1SMOA 3EYFA 4FQ1L 5D1QC 5DUMH 2EXYD 4D2NA 3LV3B 3RL1B 5I2IB 3EO9L 3MFGB 1G7IB 4XC3L 5GGVH 3KPRE 1MLCB 2Y5TA 2B1AH 1CT8A 5K33A 3ME0A 5DJYB 2HYMA 1A9BB 2W59A 3CMOL 1FBIL 3H9ZA 4N0UB 1OAUH 2DLIA 4YHPA 3RNQA 5KVGH 2HMIC 1CDIA 3G5YB 4NFDA 5EO1A 4KKLC 3P77A 4Z8FH 1U8QB 3IJHB 1RUML 5LGJA 4MQTB 2I9TB 1JYWA 3S5LB 1KG0A 3HTLX 1FPTL 2MHAB 1IAIM 1UT9A 1J7VR 1R0AH 1K5NB 1MIEL 3U46A 4IRZL 3ILPB 3QEQB 5DRXB 4OT1H 1IM9A 2X1WL 3UPAA 2FZ3B 2R23B 5CJOH 2WUCL 3GJFK 5IK3B 1FIEA 1GOGA 3BP5A 4JQIL 2DBLL 1S7QA 5EULV 4MA7H 5B3JE 5FM4A 1AGDA 4N0UE 2YD3A 1YQVH 43C9A 5HXMA 2J4WL 5BMFH 3O45A 3TCLB 5EZIL 3BIBX 2CDFA 3HB3D 3DI2B 2G60L 4XBPB 1SY6L 3C6SA 4HIIB 2AJ3A 2WWKT 4HWBA 4XAWH 5BVJB 1RV6X 3JUYA 4NO2B 5DSCA 4NN6B 5E00A 4C55A 2HTKC 3EOBA 1YEGL 3QUZB 3QXDA 1S9KC 3Q3GB 5T1LD 1MI5B 3VFVA 1I9JL 2NY4D 4F7MA 4MXQA 2FJFA 1ZSDA 2AEQH 4H25A 4EIGB 1YEJH 3I9GL 4OM0H 4BA8A 4JRYE 4XPTL 1U8JA 5EORH 5DRZB 4EQ3A 3K0WA 1D5IH 1W0WA 4Y4HD 1XGYH 3UO1L 1J0IA 4NWTH 2UUDH 2LU4A 3GMLB 1KXVC 5D7LD 5I15H 3B5HA 5IMKA 2BVQA 3NFPA 4ONFL 2X70A 1XR9B 4H1LB 3KPRB 1UJ3A 1SBSL 4WI6A 4HUXA 3HUJE 2IAMD 2PCPA 4IRJA 4PD4J 5HHPA 4YH6A 4Z7WF 2EYRB 5IB5B 4Y88A 5HHNA 3NA9L 2BK8A 2PETA 3GHBL 4HX1B 4GXUM 2VSCA 5IVNA 2ZSVB 1IILE 4FQHB 5DFWH 4JPIA 4DK3A 3CMGA 4XC3H 1EMTL 2K3TA 3NGBB 2NTFA 4FQXC 2E6QA 4JRYD 4PJFE 2J6EH 1IGCH 4R4BA 2A77H 4X9BA 4ZTOL 4D0DA 4JY4A 2CDFB 1ROWA 1S5HB 4M6OL 1GPOH 1L0XA 1TJIH 5L2KE 3HNVL 2B5IC 4ELKB 3AREB 5I9QC 3W9EB 4I3GA 4HZAA 4JGJA 4UTAH 4S11A 1HYSC 4G7YH 4L5FH 3I6LD 1Z3GL 2C7UA 1TVBA 3CX5J 4GMTH 4XH2A 2VXUL 4JG1H 2NY3D 3LMJL 2Z31C 5ETUB 3NAAH 3UZEA 3PNWA 4I3RL 1J0KA 4IDJH 1QSEB 1DLHA 5CJOL 5SV3A 3BEWB 4GH7B 1BM3H 4WI8A 4D94A 1A14L 1F42A 5BO1L 1X5LA 2VZVA 4FQXA 4P49A 1B6DA 3Q1SL 3SCMD 2NXZB 3KPNB 5SWQB 1NGYA 1UWGL 1YMHB 1F97A 5DSCB 1F02I 4PJGB 5F89B 1PJ9A 5EZIH 1X5JA 4WUKL 3R8BB 3S96A 1JE6A 3K2UL 4LIQE 3MLSH 4JHBA 1I85A 4OD1L 2GK0B 2JB6A 1T66C 4JB9H 3T2NH 1OVZA 3MA9L 3BEVA 4IRJC 5D2LE 5GJTH 2CIKB 4LIQH 1MIMH 5F72S 4CADA 5FYJL 1HKLL 3CC5B 3JVGA 4QY8A 5C0BB 4S1SL 4X8XA 3BKCH 2DJSA 2UY7A 4G80B 4H1LA 4CL7A 3D0LB 4U0RB 4PJ8B 1NCUA 4XHQA 4MA1B 4R90L 2HRLA 25C8H 3MQIA 5EBMB 5EN2A 2IPKB 3UTTE 1KCVH 2IAND 1RZ7L 4F9LA 4QXUL 6FABL 5E2JA 3BFOA 1AI1L 1H15B 32C2A 1YMMD 1TMCB 2JJTC 3QAZB 4E5XB 4YAQB 3ZZ1A 2NX5A 3HAEA 4ODWA 5K93A 4G59A 5DGQA 3QUYB 4FQPA 4Z7OF 4Z7WE 1MELA 1Y0LA 3SGDH 3EW3B 4X7CC 4X6BA 5CJXA 4TUKL 4JKLA 1A64A 3OXRA 1BBJB 1KJVA 1AE6L 2X4PA 3LB6D 2IEPA 3NA9H 2CLVA 5IB1B 1E4XI 1NLBL 4UOW1 1QNZL 2CKNA 4F15C 2YBRA 2CR6A 5CGMA 3TBYB 1AY1L 2BJMH 2OL3L 2ZJSL 3ALXA 1WTLA 1YNKH 2P1YA 3ISWA 4CVXA 3DBXB 1M4KA 4ZUTA 4PJAF 1G84A 5KOMC 3QEQD 3X12A 2JJTA 3F7VB 2OYPA 5M95B 1MAKA 4Z7WB 1T7WA 5J6HA 4RX4D 5IIEA 1RFDH 4NNPH 1F00I 1S7XB 3PF2A 2YWYA 1MQKH 3RGVB 4LASL 4OLZH 3SKJL 5I1EL 4ONHB 1BD2D 5HJ3A 4BH7A 1U8KB 3O9WA 1RY7B 2QR0A 3LMJH 4QOKB 3WL9A 5EDXA 4XCFH 4GG8B 4MD5B 4PRDA 5DVOA 4PDCE 2VABA 1NL0H 5J11B 5KSAB 1Y6NR 3MXVH 4PJBA 4X4XB 5KN5A 1Z9LA 2EDRA 1T4KB 2H32H 2AJUL 3S3SA 5JW5A 2HFEB 5HBBA 3GMRB 3ZTJH 2YD1A 1S9VA 2DTML 4PLJC 5F1OB 2VXVL 4PB9H 3EOYG 5C0EB 4CKVX 3BH9A 1ND0A 2EKSA 4OLUH 2OK0L 4Y4FD 1F4AA 1FHGA 3GMOB 4PTUB 1RD6A 1EEUA 4Y5XA 5HVWA 1JMZA 2YPLB 3WUZA 3OPZH 1XGRB 5FHBL 3TZVA 1BQHA 4PJXE 4ZNCD 5FDWA 4P5MB 3IVKB 3SE3A 1NMAL 1WIOA 2AK4A 1IEAA 4QRPA 3PL6C 4UNVA 4OZGB 4MDJB 3DRQA 4MS8C 4D9LH 4O02H 2X4OA 5TGBA 3QHZH 3PWUB 1TETH 4WUUD 1CFQA 3BAEH 3VD7A 1BLNA 3QJHB 1XGPA 4QXWA 3TFKA 2JB5L 1A1MB 4F7CA 3C2AL 5C08B 5IB4A 4YO0B 2H9GB 1XZ0A 3RHWF 3ARGA 3EOAA 1C5BH 1VESA 4U6HA 4Z7VB 4FN0A 3ARQA 3VXSA 1VDGA 3MBEB 1T7XA 2OTUA 1G6RA 2H6PA 3WIIL 5K9OA 4Q9QL 3OKNB 3HUJF 4I48B 3U30B 3FFDA 4FXGB 4LGPB 3GSNA 3IJSB 3ZE0E 2EDLA 4XCEA 3VMOA 2DYPB 4HK3J 2A6JA 1J1PH 3VH8G 1OSZB 4KQ3H 5DD1H 1JRHL 4Y8DC 5AZ2L 5C0JB 5KANI 3VXUA 5T1KD 2EDWA 2JIXA 2BSSA 1CDBA 3QPXH 3IF1A 1DL7H 3TNMA 4HWZB 5B38A 5F71A 4OCMC 1BJMA 3S9DB 3HC4L 4I9WE 5KN5B 4ZXBB 2BP3A 1NJ9B 1G1YA 3ARSA 4BSVB 4HXAL 3SY0B 2OR9L 3MCLL 1MF2H 5CEYA 3LN4A 4NQCD 5FYKH 3RWHA 1FE8L 3VXUE 1U8JB 1K4CB 3IU4L 3GKWL 1OGAE 2WLZA 3BKML 4KAQL 4YPJA 1ACYH 4C59B 2YD5A 2ICCA 3OG4B 4CUCA 3ULVE 1G0DA 5E5UB 5AYUL 4EQ2A 4JREC 4PJXB 5IVOA 3L6FA 4G7VH 1TJGL 3AS0A 4I1NB 2AK1L 4X99B 1HIML 3D0VB 3VD3A 2K7QA 3EHBC 4OI7A 4PRPD 3MNWB 1JWSA 3DXAE 4Y19D 3VXRD 5L6YL 2D7MA 1CICD 4BZ2H 1LGVA 1WWCA 3NABH 3Q2CA 4O02L 4R9HA 3IFOA 1VADA 3S98A 3QBTB 5T3XL 4WFHE 3WNPA 2Z91B 2B2XH 2PO6D 3G6JA 5C0CE 2VQTA 1G9NH 1JL8A 1X5KA 1J8KA 5IWLC 5L2KD 4X0KA 5DJ2B 1JGLH 5IVXB 1SQ2N 4OM1H 3QH3B 4I18C 3WXWH 4NO5B 5H2BB 4ODVH 3W39A 2DDQL 1JRHI 3RVVD 1NCCH 3BOVA 5TE7L 3QUXB 2LV4A 4PJAB 3QDJB 3GBNL 3QIUB 3ZYJA 3WD5H 4ZO8A 4QYOA 4ACPA 5J1TC 2FB4H 3NCYP 2WIIB 4DZBB 2X9WA 4APQA 5A3ID 1M05B 2W0KA 1H3TA 2IFGA 4Y4KD 4QXGL 4JR9L 5IROA 2W9DL 4YDJB 5DHYB 1H3GA 1I9RL 5DUPH 1TQCC 5FB8B 5C0CB 3GJFA 2GK0A 1U42A 1P7QA 1CWVA 1U8PA 1N8ZB 5EU7C 5DD1L 5D2NE 2Y1VA 4OZFG 4K8RD 1U91A 5E9DE 5EU7E 1BJ1H 1GH7A 3TC9A 3EFFA 2AABL 3PQYE 4J2XA 2XRAH 3RHWK 5IP4A 1N3NB 3MRQA 2ESVD 5I1LB 3RA7L 4PJAE 2FD6H 4P9HL 5EZOH 2UZIH 4F33B 4XVJL 5GGTH 5T5NF 4HXAH 4HS3B 2KKQA 4QWWD 4GBXB 8FABB 1BGXL 5KG9B 2VL5A 1ZVSA 5B3JF 2Z8WC 4HIHA 4WWKC 1VGKB 3IFOB 1HQ4A 3DMMD 4RCAA 1NKRA 3X14A 4OSUL 1A7NL 1KJMB 2FX9H 1G9ML 4JY4B 5E5RB 3KPLA 5D1XD 1C5CH 2OSLA 1MFNA 2H2SD 3NIDE 2VKXA 4WV1A 5F88B 4LCUB 4LLAA 1HIMH 5B8CA 5GGVL 4JAMA 1EA9C 1AO7E 5JR1L 3T1FB 3PP4H 2D31B 2YD4A 3IT8D 3FONA 2MCPL 1LEGA 2X6MA 4E9LA 3MA7B 3BYYA 4XXCA 4CVXB 5GGSB 4YXKH 4U1IA 3NABL 5GRVK 4FXKB 2R1YB 1UADC 3TJHC 3P11H 5BXFB 3OAUH 3QH3A 2E9BA 3GO1H 1FDLL 1AXTL 3QIUD 2HH0L 1A22B 1SM3L 4ZSOE 2DI7A 1RIHL 3I02A 1XF4B 4P4KD 1CDUA 2EDFA 2ZUTA 1AGEA 2X4SB 4MAYA 1JK8B 2JJUA 5JNYA 4OKVB 5EC1B 1MRFH 3D18B 3LVEA 5JUEH 4HDIB 2IQAB 5KG9A 4P2QD 4FTVB 4UILL 1CGXA 3HFMH 3K4DA 2YXMA 4EBQL 2Z31B 5KSVA 1NFKA 4KROD 3SDCB 4R3SA 4R0LC 5DR5L 3ULUH 3GRWA 4YDJA 3LEXA 4PV8B 4PYHA 4Y1AE 1PLGH 4DAGL 5AAMA 2Y36H 1DSFH 4L8SB 2W0FB 1Q0YL 1V7ML 3V6OC 5JXEA 2IWGA 5BV7C 3QIBD 4PRID 3PQYD 5I1GH 3LS5H 2KQNA 3O11B 1YEGH 2WUBL 1GGIH 1W8NA 2RB8A 5KVEH 1MY7A 4HF5L 1A6AB 5C0CA 5ID1B 3TA3B 4LVOB 3JTTB 1LNUB 1G7PA 4LKXB 2XRAL 2A6DB 4LEXL 5TE4L 3GGWB 3LDBC 4XPTH 4G8EB 4YHIA 4HD9A 1FNSL 4CU8A 3MRMA 3WXVH 2GSGB 5IK3A 2X05A 1RHHA 3UX9B 4M7LL 2QSQA 5BW7A 3SDAC 4AEIL 4NYLA 5F1IA 1RQ5A 3FQRA 1C5DB 1A5FL 4NQDD 4U1KB 3V6OE 4CN4A 2AJSH 3HMXA 4ALAL 1BQUA 3PGCB 4I0PB 4IDLA 1MREH 3EJJX 1INEL 2BVPB 2NY6D 5FOBB 2AK4D 4RDQF 1MCHA 3MR9B 4HHAB 5DS8A 2PYFB 1E4WL 4NM8H 1HSBA 2DQEL 4BFGA 1CGSH 5FDWB 2XFXA 4ZXBD 1DDHB 1P7QD 1SYVA 4N9GA 1MAMH 5FUOL 3GFUA 4RX4A 2IGFL 1QR4A 3LAFA 4KGLA 1FVEA 4OKDA 1MI5A 4XRCA 3EO0A 5JDSB 1ZGLP 1YA5A 2N4IA 4X8JA 5ICYB 2ZKHL 1DBMH 1NAKL 4OZHF 4M62H 5JA8B 2R0ZH 3U4EA 4JPWH 1X4ZA 3NZHH 3PGDA 2NY1B 2CH8A 1FVDA 1I75A 2A0LD 4M6ML 1XR9A 1KLGA 1QOKA 1F6AB 4F8TA 3NA4A 5E8EA 3O6MH 5CD3B 5BS0A 5B38G 3SKMB 4P46D 5SWZB 1L9MA 1L7TL 4LDEB 3V5DA 5DJ0A 4L5FL 1QSZA 2R9HD 3EDKA 4NQSA 4PGCA 4QRQB 5HHVL 2HTLC 5C0AB 4JFHD 3V6ZB 4UIMA 3BN9D 5MENE 3AS3A 3IDJA 3FMGL 4PJIA 1IGFL 3GB7A 4RSVA 2AGJH 5FGSA 3T77A 1LHZA 1EAPB 5GS0L 5KAQF 5KSUA 2YMXH 4NJAL 3LKNA 3PWUA 2FJGA 3O2DA 4EBQH 4BSVA 2DYPA 1IGTA 1UWGH 3PUCA 4GFTB 4P57B 4XB8A 2XKNA 4LFHG 4OQTL 5H94A 3WIHA 3QXVA 5DURD 1M7DB 4LPVA 4JREB 4U0RC 1NCWH 5JPMB 1T0MB 3BN9C 4O9HH 5JW4R 1Q0YH 1V7MH 4KFZC 1KJ2L 2BHUA 2XY2A 4YPGA 5MENB 3LS5L 4P5TC 1J8HD 4EOWH 3QHTC 1N7ML 3KPSA 3MXWH 4J7RA 4NGHL 5CAYB 1LK2A 1U93A 1MCPH 2R1XB 1GIGH 1WIPA 3SE8H 4KKBC 4FZEH 4NZUL 5DZOA 4JFED 5FUCC 1YZZA 3B5TA 5HHOA 1JP5A 4L1HA 4D0CA 2ED9A 1FNSH 2IMMA 4OF5A 3FAXA 3C60A 1OSPH 1IGYA 2FBOJ 3PABA 5TF1H 4AIZA 1A6ZA 4QXUH 3OAZH 5B3NA 3EBAA 1IEBA 4XXDA 5D1XA 1RUKH 1FL5A 2C3VA 4JY5H 3MLWL 5LBSL 1U2HA 4P2YA 4AEIH 4CVUA 1Z5LB 5T1KA 1BQHG 3PWNA 3C8DA 1FFOB 1OARL 3MLPA 1JTOA 3TCXA 4DW2L 4PJCE 5TE6H 2ZCKL 1Q0XH 3PWJA 2NXYD 1S8DB 3FT4A 5C0AD 1DUZA 5EG6C 3RNQB 3HNSH 2J5LC 4LBEB 4ZPTA 2DM2A 3GSRB 3UTSB 2JELH 4YE4L 2CIKA 5DMGC 1YC8A 4M8QA 4RQQB 1T7VA 1JGVH 1UZ6E 4K7PX 5FUOH 3S5LA 5E94B 2IGFH 4WO4B 1UJTA 3D87B 4M8VA 3WNLA 3ARGD 4JZNB 4K3DH 4J23A 5C07D 3O4LA 1DFBH 1QBML 3GSOA 5FOJA 1QEWB 2B0SL 1FBIH 1KXTB 1KTDB 3BSZH 4F9PC 4Q9RL 5DJAA 4Y2DA 4NQCA 4PJBB 1QLRA 4X4XA 4MNQE 5KVGL 4P4KC 1OF2B 2NY3C 4NPYB 4V1DA 4NC1C 5FB8A 4N0CA 3HHRB 1RUQH 4QOKA 1RUMH 3UZVB 5DD5H 5DMYA 4HZLB 3N1FC 1ND0B 5I30H 1DQTA 3RGVA 1NEZB 2NX5B 3HAEB 3B8SA 4FNLL 5TQ0H 4KJPD 4MQXC 3BUYB 3HG1B 3FMGH 1QRNE 2XI9A 3HR5A 3V6FB 4RGMC 4G6AC 1T3FA 4TVPH 1UZ8A 3GNMH 3EOTL 2H3NB 2HLAA 4PJIF 3KLDA 2DWEB 2H8PA 2Z93B 4RA3A 4GG8A 5JORA 1KF9B 3SKMA 1YJDL 3MLXH 2QR0B 4TVPE 3O9WB 4RIRB 4R8WL 3CDGB 5D93C 5DVMA 4FQCL 5IG7B 3ARFB 5E6IA 3WS3B 3TJEL 2OP4L 1KGCD 2G60H 4LKCA 4U1MB 1NGXB 5AG8A 4JZJC 4LSQH 1UB6B 3BI9X 5L0QB 3GI8H 4FQHA 4E0RB 5FDYA 4FQLH 5C09D 4JFFA 1X5GA 5EOQL 1RK0A 5I1HL 2NY5H 4UT9L 3TA3C 4WUUB 3PABB 4R7DB 1CFNB 2CDGA 4AIXA 1WCBB 4NZUH 4JDVA 5DC0A 4HXBL 1A3LL 2SEBB 1GGCH 3W5MA 1UYWH 1H8NA 3AAZA 1ZHKB 4G3YL 5JDJA 4OLEA 4OAWB 3U2SA 1CFTB 4CN6A 3HZMB 3IXAB 1C8PA 4EIZC 2FDBP 3Q0HA 3S36H 3P9LB 3JWOH 5D2LA 5EOCH 2CLZA 2PW1A 1HEZB 5DEGB 2J8UE 4KK5C 2HTKD 2YN5A 4H5SA 4HS8H 3VI3F 5CJXC 4G42B 5JLZA 2NTSP 1LE9B 3QUZA 4ZYKA 4ODHL 1GGTA 1TQCB 5BV7L 5ACMA 5LWYH 3TA3A 3EOBB 4MNQB 5J13C 3WHXB 1ZT1A 1YUHB 1S3KH 2P5EB 2G5BB 3FOLA 1E6JH 3UJIL 3QIUC 1BVLB 1DFBL 1YYLH 5CIPA 4UT7H 4YR6B 1IGCL 2R1WB 1SVZA 1ZHBA 4UQ3A 3BP7A 4YUEH 4ZFZB 4JRYB 2HG5B 4M6OH 5FFLA 2Z8SA 3DOSA 1AXSB 4ELMA 2DQJL 3PXJA 4XP9L 1CLZL 4B7LA 4XNZB 3L3GA 4DKEH 5C86A 2WAHA 3EYVB 4MD4A 5ENWB 3STZB 1FLTX 5DD5L 4PRHE 3MGOB 3K4ZA 4B7IA 1B90A 3RWGB 1I8LC 4GMTL 4YC2B 1JF1B 4H8WH 3VXME 2QV2A 2XKSA 4JM2A 1MF2L 4EN3D 4XCCH 4TNVK 4ZS6D 3I02B 1MFEH 3BVNA 4N8VG 3SN6N 4XZUA 1MH5A 3S7GA 4DOHB 1CXLA 3GKWH 1CGUA 3OKYA 3OJVC 3C6LD 4MJ5A 4Y16A 3TLRA 5BXFA 1EPFA 2LTQB 4Z78B 1I1RA 3PV7A 5AYUH 2EH8H 2BNRB 4Y4HB 4BH8A 2P5WD 3VGGA 3TJEH 3B83A 4IMKC 3W9EA 1TJGH 4WUKH 3SDAB 4PRHB 3HUJA 3SO3C 4WVRA 4L1DA 1WBXA 3JV6B 1S5HA 3T2NL 3NZ8B 3GI8L 1UM4H 5C0IA