3TZZA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in the carboxypalmitoylated form at 2.5 a
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
463
structure length
463
Chain Sequence
b'LPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyketide synthase PKS13
publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 175
structure length 463
sequence length 463
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzzA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzzA01
2G2ZA 4AMPA 2H1YA 5DZ7A 3HJVA 5DZ6A 4RL1A 3TQEA 3G87A 3TZZA 3IM8A 3EZOA 3QATA 2QJ3A 3R97A 2G1HA 3RGIA 2QC3A 2G2OA 4AMOA 1NM2A 2CUYA 3SBMA 2G2YA 4AMMA 4RR5A 3TZWA 3TZYA 3H0PA 2JFDA 4QBUA 3PTWA 3BV8A 2JFKA 3R8YA 3IM9A 1MLAA 3HHDA 3CJ8A 3TZXA 2C2NA 3K89A 4AMNA
chains in the Genus database with same CATH superfamily
2K3KA 5GMDA 2RKIB 1IBLF 2PI5A 4P73A 2PEBA 5E3PA 7FDRA 2HHQA 1HA1A 4OX9J 2GFFA 4DV0F 2GVZB 1A6LA 2JHEA 4AT1B 2QL7B 3JQMA 2HNDA 2ZBCA 1KRPA 4CYUB 2GGPB 2ZC3A 1UJ5A 4LQ9A 3GJQB 4ID5A 3HX9A 1RT7B 3CWJA 3MM7B 2Y1IA 1S72S 3BH7B 4DZDA 4M5LA 4DUZJ 2B7BB 2D3O1 4B3RF 2DIVA 3NKYA 3ELHA 2K7KA 2DY1A 2LU2A 1MWQA 4C0HA 3LWMA 2FJEB 1Y5NB 3QZ7A 3VALA 1PIEA 2NPIA 2JNJA 2F4FA 3J81U 3MMCA 2BE2B 2YPYA 2WONB 2FGCA 2QT7A 1SKUB 2ZKUA 4HR2A 1JKHA 1TKTA 3GG0A 3Q86A 3SSQA 3JTOA 2AJ2A 1O51A 1FJCA 2AGPA 3PV8A 3MCNA 5IV3A 4TVAB 4LVNP 3OL6A 2B3TB 5CYMB 2BEFA 5J2NB 3HZGA 2MQLA 4DMZA 2FUG9 5KFSA 2ZZTA 3R2DJ 3T6JA 3CJKB 1AUDA 2VOPA 4X65J 1N48A 5L1LA 1R0AB 5F8GA 1R6VA 2KYZA 1VRQC 5BYSA 2IDLA 2C2EA 1NKBA 3W9JA 2CQDA 1BC6A 2KG1A 2MLYA 3OFGA 2KFYA 4ZITA 2M88A 4QIGA 1BHNA 3D1QA 4JI0F 3EWGA 2MLXA 3G9CA 3CJRA 3BGRB 2BQ3A 1GTHA 1KWMA 1RSCA 1OPIA 1SI9A 1S6OA 1OYDA 3GJSB 4LVOP 3QGGA 2JL9A 3KG4A 3ZO7A 4PQUA 4C7QA 2A0FB 1N5TA 4NA3A 4KH0B 2ZOMA 5KG5A 3VAJA 4PR6A 2NCKL 1NJWA 4E2FB 3W64A 3T1HF 2NUUG 2V50A 4C0BA 2ZH6A 5LMNF 4OYXA 4DXLA 2F3JA 2AYBA 3KLIA 2L48A 4ZS6A 1T7PA 1F2HA 5BR8F 2KB2A 3QWUA 1VLYA 2HHTA 1RBLA 4ZPAA 1V9OA 1LQ9A 2M0GB 5DGBA 1XERA 3W2VB 1LXJA 2CG8A 3QIPA 2CPIA 4I2QA 3G6ES 3N0VA 4ALZA 3PYEA 4LF9J 4JI2J 1ZOTA 5HVHA 2WB1D 1RT1B 3R9LA 5I42A 3HHNB 1WTBA 1SL2A 2GVDB 1VQ5S 3C14B 4UOGA 3EE3A 1TKZA 3KHLA 4DS4A 2AEFA 3I0RB 2DGXA 4NX9A 4V1Ak 2R7VA 3IRWP 2BW7A 2OKQA 4N76A 4C48A 4USUA 2DNLA 4Q0BB 2RDDA 3OUYB 2QLXA 3U7JA 1F5CA 1Y4ZB 1UWBA 4BDPA 2JH3A 2UUTA 4PUOB 5JUMA 5H9EJ 1OWXA 3AD7C 4R25A 2CJXB 1HKAA 2CJQA 3SXLA 4PXDA 4DR5J 4K4SA 4FVMA 4QW9A 3QATA 3QQCD 3X1LB 1M1HA 2XB2D 1HWIA 1KLMB 3N01A 3UCZP 3CO9A 3HHDA 2XLJA 1S12A 4EBCA 1FDDA 4ED2A 2BQUA 4DG1B 4ELVA 2HVIA 4TY8A 3V4IB 3WHIA 3N6LA 5L8RC 4DU8A 3FEZA 3TEGA 5J2QA 4NOHA 1SL1A 4AL6A 2DCLA 2IPOB 2ASJA 4KGZB 4M5GA 2J9EA 2Q43A 4X64J 3N79A 2XYHB 4FYDA 1D9AA 3PCOB 4AMNA 4LF4F 5DLGA 3TO8A 1DQ9A 3NWGA 3I96A 2OPSB 3DGPA 2YQ0A 1REGX 2JWNA 1WDDA 1FNOA 1S6PA 4ELUA 3IG1A 4DFJA 2CG4A 3VTIA 4Y28C 4CT8A 4WXWA 4PXEA 1UVLA 1QAJA 2HIQA 4EBEA 3DM2A 4F4YA 4OYAA 3L09A 4YUDA 2KJVA 1UAWA 4PPDA 1P9YA 1SKSA 4ZPDA 1TL1A 4F4KA 2XQCA 4A8YA 2M3DA 3I9V9 4GO5X 2WK4A 2FGOA 4OHVA 4DHVA 3UVJB 1DBDA 3JQJA 1RDRA 1WHYA 5I3UA 4PYDA 2YWGA 2KHCA 3R6LB 4HVZA 4F4XA 2XMJA 4DV5F 2GQQA 1VC5A 3NMRA 4ZVGA 1QAXA 4AQYJ 3TQ1A 4ZCKA 4OHWA 2VF3A 2GJFA 2YKNA 3SCIE 2E1AA 3VAIA 4LSLA 4OYPA 4RO0A 4F3MA 4HHJA 2XO6A 1MU2A 3ETMA 2ALZA 4WF9Q 2HSEB 3ILJA 3LH2S 3C6TA 4M1KA 5CZXA 4OX6A 2JLEA 2BE7D 1VC6A 4WFNQ 2CWKA 1HWLA 2FY1A 2ZDOA 2UU9J 1S1VB 2LEPA 5H1SV 3EICA 3PIPQ 4KV8A 4TNOA 5A2QU 2HHSA 1CJUA 3MEDB 3PHTA 3CCUS 3NS5A 4I7FA 4WCEQ 3DRPA 2UXDJ 4WTYA 3DRYA 1HMVA 2GIRA 2ZZNA 2KU7A 1JLGA 2IJFA 3UD3P 1M90T 1HHTP 2I6WA 3BH6B 2M8DB 3HSJA 2D7SA 4AE5A 2VQEJ 3PYFA 4CCHA 3KLHA 1UA1A 2FJAB 3DYAA 1G4CA 1D0EA 3KUGA 3RGIA 1RCOB 4X66J 3DLGB 3K5NA 1WEZA 1TKDA 3F56A 4TU8A 3BF4A 3S01A 2MKIA 1UVJA 5AJ3J 3UR0A 2FPHX 2RF2B 3FQKA 3GWCA 1XNRJ 3DCAA 4NRUA 4RPFA 4J91A 4EFAC 3C46A 1F9FA 3LW5C 3CJ0A 3B4DA 3A4TA 1PJ7A 4AD6A 1FTCA 1MWYA 1S48A 2DD8S 3J81Y 4JYAF 3L7OA 3RRKA 2LMIA 2FJWA 4HT7A 5LXRA 3TOQA 3N28A 5AE1A 1CVJA 1VQNS 5EWFA 1TVRB 1LW0B 4YDDB 3Q8UA 4UQTA 1S6QB 2UXCF 1N33F 2V6AA 4OZ0A 2YH1A 3GJRB 5IT9Y 3BSCA 2B4PA 3JSBA 2MZ1A 4DN0A 4UZCA 2ASYA 1C1BA 1S1XB 2XTJP 3LPEA 2PEHA 1IWAA 2QYGA 2BANB 1HR0F 1EIYB 3MFHA 2DITA 3KMSA 2O3DA 1WD6A 2D69A 2RIJA 3DI6A 5KFMA 2DEJA 1JLFB 3OTOJ 3GMGA 4O23A 3ZZYA 4LT6A 5IC6B 8ATCB 2C3OA 4TYAA 1FX2A 3A3OB 4KKOB 3ULHA 2I2YA 2ALYB 4YFUA 1QSLA 1FX4A 3D9BA 2PGCA 2WRMA 3CDWA 1H38A 3THTA 2QMWA 1SPBP 4X4OA 2AQ4A 2H4WB 4RW6B 1HHQA 1ZAXA 5HROB 4CO4A 1KNZA 2DNKA 1S1WB 2JFDA 1YVFA 4ITSA 1WDTA 1JJ2R 1WKJA 2Y8WA 3GSDA 3MFIA 3F44A 1H7XA 1J5OB 2UVUA 2OIHA 3EGNA 5D3GB 4RBUA 3IBWA 4EZ9A 2BJEA 1FFWB 5E7OB 5GAEI 4IOCQ 4XO0A 4DV1F 2VDIA 4FS1A 3LP1B 2QTWA 3CC7S 4JI6J 2MPUA 1KKHA 3ZTQA 4DV4J 2MKYA 5F8MA 2DR8A 1RTDB 3MMBA 4DQSA 5F41A 1L3VA 4K4UA 4TLQA 1NXIA 3M8RA 1A7GE 2CNOB 4PAAA 2LYVA 2AGOA 3PM9A 5HMYA 4KHRA 4M5KA 1KQGB 4ZJQA 1OIAA 4IQXA 1HWKA 1KLNA 3LA0A 1Q8KA 2CQ3A 1H2UX 3IRXA 2R8JA 4U8YA 1NBEB 1VK3A 5SUHA 2G0JA 3HCXA 3PIOQ 1ZTWA 3EMTA 4OLPA 3I0SA 3EYZA 1IM6A 2EK6A 1RTHB 1OY9A 3CC4S 1IKYA 1XMOF 2LVWA 3M6WA 3U27A 4RW4B 4FF3A 4YN3B 1U4BA 4DFKA 1ZAWA 1S0VA 2EFOA 1HNWF 1JX4A 2V5HG 2N3OA 1DLOB 2UUAF 2BVZA 1MN9A 3ADAC 2QMXA 3QJJA 1T11A 1KN6A 3IS9B 3E51A 4DZ6A 4NMLA 4EYHB 3Q8RB 2G0CA 3WC0A 3CCSS 3PEHA 3C3LA 2F65A 2W2QP 3D1OA 1Y10A 4FKXA 3DLEB 4M63A 4ZOSA 3OFHA 1DURA 3KK3B 5E3CA 4LMZA 1ZM2A 3G96A 2J6TA 1HBNA 1X5OA 2X51A 2I1RA 2RVJA 5CXTA 1N6QB 3FCVA 4P52A 2IM0A 2V4QA 5EN1A 4MKVA 1RACB 2B6AB 4DLGA 3SQGB 1N52B 1H2TZ 2DPIA 3GFZA 5CAAA 4DWIA 2YWWA 4HHUA 4KFBA 3O5TB 3NP5A 2CNLB 1GFWB 3LOUA 3MAHA 3ZTOA 3I5AA 3CULA 3O2IA 2H9ZA 3C15B 4O4GA 1VIXA 1XNQJ 2HQIA 4K4WA 3QT8A 4O3RA 4OIXA 3CC2S 3R7BB 3VVTA 2AX0A 1RT5A 4MKBA 2MKHA 2RQMA 4USHA 4ECUA 3T1HJ 2DGWA 1N5YA 3RRHA 3ITHB 2F4VF 1LV5A 5FLXU 3DHWC 4FS2A 2B43A 3G8SA 2CZ4A 2BJ3A 4WFZA 3OXFA 1EX8A 3LP0A 3TWZA 1UJ6A 4NXNJ 1S76D 3AB2B 4L75A 2WW8A 1WI8A 5KFQA 2ZH4A 3DOKB 4NLOA 3ZTSA 3L9ZA 2HNYB 4C8LA 1VDHA 1HI0P 4J90A 9ATCB 4PABA 1AUSL 3U1NA 3QJLA 5B0GA 3Q23A 4L3KA 1WC1A 1WORA 1KC8T 1G1XA 3A8IA 3ILLA 3VQSA 2V2QA 3E2EA 1F3VA 1S57A 3NXZA 4USIA 2ZVIA 4DL6A 2VC1A 2WBMA 5MAOA 3P4UB 5A8WB 1DTTB 4USMA 1K1QA 3HVTB 4GVBB 2WVDA 8AT1B 2MTLA 1TK8A 2IVFB 3C66A 2IA6A 3FQLA 1B0VA 4IH6A 5A2QY 1S49A 2GHVC 1D3WA 2DISA 4B9MA 2WW4A 5CZVA 4KGMA 1RT3A 2RQCA 3HVRA 4C8NA 1JIHA 1MG7A 4XAKA 2N4CA 4JI5J 1HNZJ 3D68A 4F4ZA 1DQ8A 3CCRS 1NDPA 4LSNA 1UETA 2XS7A 2XMMA 1NJIT 5DQGA 5DGAA 8RUCA 2QFIA 2G0IA 4OLOA 3UN2A 3P5BP 4LR9A 2GNKA 4NLTA 1NLKL 2PDAA 3A8EA 3WC2A 1U1OA 4BCAA 2ROGA 4Z37A 1GX5A 5ETKA 2O66A 2XMWA 5J2MB 3B54A 3GFHA 1EJ7L 1Q53A 1WF1A 2I9SA 2R7QA 4P2MA 4C2MA 1NH7A 5KT6A 3HP6A 3DLKA 3LAMA 2DNOA 2QSWA 4ZP8A 1TKXB 5AXNA 2YNGB 2AHOB 1JMTA 3X3UA 4L76A 4HACA 1QY7A 1XK8A 2OPRB 2N7YA 4X62J 4PWDA 3IMQJ 2HBQB 2YX7A 3T1AA 2IBKA 4OJHA 1WACA 4IQMA 2QZ8A 4EU0A 1RYSA 1IM4A 1YX2A 1BWVA 3WIUA 1APSA 4KHPJ 4MFBA 3MCSA 3SV3A 5D4PA 2BOPA 3DRRA 3C6UB 2N4DA 3CB4A 4DX7A 1LW2A 1XR5A 3TYTA 5GADU 4DV6F 4NCGA 1H73A 1FJGF 1PJ5A 1HNVB 2I5JB 5HMWA 1NK6A 3TNVA 1P9QC 4DSFA 3MTJA 4XDCA 3NCPA 1OJ4A 4NCBA 2QA1A 2B9WA 2CQ0A 2QLJB 3DLBA 2HZAA 1F6TA 4F0KA 2MB0B 4P72A 4LF7J 1OY6A 2VL1A 2W4PA 1CJKB 5D0HA 1H72C 5IC4B 3DXBA 3H2UB 2KKHA 2G1HA 4U96A 5KFEA 3L7PA 1MMDA 5B0DA 5E5NA 2C3PA 2R42A 3CO0P 4Y3CA 3JSRA 3GYXB 3UDVA 1Y0HA 4H4KA 3FNNA 1JLCB 2XY5A 1VQ7S 4PG7A 2A1BA 3DU5A 3PW7A 4IRKA 1VRTA 2VA3A 3NEKA 5CCLA 2CIMA 4PG4A 2QLBB 4ZLPA 5HK4A 3GFXA 4NZ0A 5KFGA 5KTQA 2C2MB 4OZ3A 5C2CA 3MM8B 4I2PA 3HD2A 1G2EA 2BQRA 3AFGA 2OMLA 3AD9C 1LEOA 3I4HX 2IVYA 5D4LA 2JDJA 1X0PA 2QEXS 2HAFA 1PC4A 4WFAQ 2R7TA 4RU9A 4HYKA 4UY85 4TU9A 3M30B 2X3DA 2HMIA 4ER8A 1BQNB 4M5NA 4BS2A 3QSIA 1FHTA 1RT6B 3U02A 5HP1B 1HQEA 1U25A 4ENOA 2QO3A 2EFVA 4JYAJ 2KVIA 2IAJB 3VGUA 3DU6A 3HHLB 2MGZB 3A3NB 4K4ZA 4CO3A 3HPOA 3Q89A 4DV3F 1N33J 3ET6B 3G82B 3AOAA 2V94A 4MYTA 4DPTA 1CJTB 1WF2A 1FJEB 3MEGB 1YZ6A 4RUHA 4JV2A 2EFQA 3J7YU 2Z58B 4R8UA 2UUCJ 2E66A 2HFOA 1WC0A 3OTCA 2I0XA 3SFUA 1BLUA 3QT5A 2BABA 4L3NA 3NGSA 4ZHRA 1HNIB 3PTWA 3D0IE 1Q82T 2KM8C 2LCWA 3UWTA 4I4BA 2ZD1A 4IO1A 4YMEA 2OPPA 2RHQB 1Q78A 3IBFB 1HW8A 3LAKA 4CWBA 1F5BA 3ILIA 4ZLNA 2HW3A 4OI6A 1NSPA 1NEEA 4DPOA 1SCJB 1JQGA 1K44A 2MYFA 4DR4J 2NXCA 4W92B 3HSGA 1IWGA 4M5HA 1NK4A 2R7UA 2EK1A 3OV7A 4ILLA 5FLXY 3FRYA 3FVYA 4H4KC 1B99A 1VQPS 4DV1J 2DHXA 5KFWA 2CPHA 3PW2A 2Y8YA 3OL9A 4C0OC 3GIMA 2K8GA 4R5PA 4LFAF 2XSFA 2ASLA 3KK1A 3M1VA 3QRRA 2F8MA 2LQBA 2MKCA 3CCQS 2IY5B 2C2OB 1E6YA 4WE1B 2VG5A 1IBMF 3B6BA 4J9SA 4TXSA 1ULRA 2CQ2A 3W61A 3WX8A 4KC5A 4DV7J 2W7AA 3M8SA 4PYAA 2FYXA 4LBHA 2D9OA 3BGUA 3FK4A 3DRSB 1S1TA 4YB5A 3QO9A 2ZHOA 2AEJA 1LWEB 4UUXA 3HHLD 1N36F 3AHPA 1TUGB 2N82B 3BS9A 5L46A 2WZ1A 1ZM4A 3TAMB 3VGSA 2DO0A 4FF4A 5B7WA 2PSZA 4TKTA 1ACMB 3RBDA 4HI2A 1AB8A 1T05B 2FLPA 1EP4A 3V2UC 2DK2A 2DR5A 4O3SA 3NY0A 5K14A 4HHHA 4LR8A 4H4MB 3CNQP 1CS4A 2IIHA 1HNWJ 3K89A 4YR3A 2UUAJ 3TAPA 2XWYA 4RL1A 4MK8A 3KK2B 1FKPB 3J7ZT 1AFJA 1X4HA 2VJUA 1VBYA 2V9WA 1U0HB 3NNHA 2WSCC 3FJ2A 3LF0A 4JI1F 3Q8VA 3HT0A 2J9DA 1CJVA 4ZDNA 3MR5A 3MMJA 3NWRA 1PGZA 2YNIA 4PG8A 4ED5A 1FWKA 1RTJB 1ROFA 1PBUA 4NEZA 1WJ9A 1VJWA 3L95X 1KOHA 5HBMA 1AA1B 2KT2A 1RA6A 5DG7A 2DB1A 3GSIA 3VAMA 1NB2A 1H0HB 3US5A 2ZM6J 2VZ8A 3SDEA 1NPKA 2O1PA 2QRRA 3ZZ0A 1DQAA 3OR1B 2C3YA 4QYZK 3C16B 1Y9OA 2M7SA 5FDLB 3K0JA 5F9NA 4JI3F 2MKJA 2J7KA 4UOCA 1GT8A 4NXMJ 2E9RX 4A8XA 2VHGA 2YVSA 4USJC 1WSVA 4F3OA 1TV6A 2F4VJ 3KG1A 3OTDA 1N54B 1SJQA 2LKZA 2FIUA 5B0CA 1YQHA 5GVQA 1U1QA 3KLEB 3MM6B 2KXFA 2W01A 4NL5A 4LBPA 4DR3F 4DR2F 3CMES 2AGQA 2DXDA 3MAAA 3RAMA 1GK8A 1OSDA 4NI2A 4K4YA 1U7LA 2DHAA 3ISNC 1K47A 5DETA 1VOMA 1P27B 3VAGA 2R2TA 4DFPA 1X9SA 5DJBA 2AYEA 4CLSA 1TL4A 2W25A 4C11B 1OSCA 3QRQA 3I56S 2J7UA 1OQ6A 2VPWB 5B09A 4ZPWR 2GVZA 4F2RA 2C1EB 1HW9A 3S8SA 1C4CA 2NXJA 1RAGB 2A2DA 4CYUA 4JBCA 3P49B 3UD4P 3RUBL 3H2VE 3RAQA 4KO0A 1TL3B 3M32A 3T9NA 4M5DB 1R7IA 4DUTA 5ITHA 4MK7A 2CA9A 4LF2A 1RHRB 2FVQA 4A8MP 3J80Y 4EO6A 1DTQB 1SH2A 2BE2A 2D9PA 2WONA 2CPXA 1N56A 3SQOP 2FHKA 4XIUA 4JI7J 2VD3A 1M5KC 5C25B 3M2UB 2XNQA 5E0OA 1S9GB 1X8DA 3M8PA 1U6FA 3UO0A 2YKMB 2M5YA 5CHCB 2O5DA 2Y1LB 4CLZA 3A12A 2D3OR 1NNDA 1BWEA 4YQWA 1VISA 2CPEA 4FNIA 3FCHA 1SJRA 1Y3JA 4OYMA 1J2VA 2AEMA 4OZ5A 1LOUA 4UZBA 3BQ1A 4IG3B 4ID5B 3VV2B 3H59A 1B7YB 1S99A 3CIMA 2OTJS 2IYGA 4J9PA 2CJYB 2P8IA 4C97A 4RW8B 4FYVB 2J8SA 2EC0A 2VICA 5LL6d 2LECA 2WB4A 1FRXA 1YBUA 2JLFA 3I4PA 3MMCB 3SBMA 2XYGB 3UN5A 1CULB 1JKHB 5K8PA 4B3MJ 2MQQA 5F3TA 1RBOB 1FD2A 3TX0A 1X4EA 3KLGA 1T9TA 1SC6A 3TI0A 4GC6A 4CLYA 2K06A 2B7CB 1RJJA 3HFVA 2VC0A 3CJ2A 2ILYA 2MMYA 3NGDA 2HZVA 2H1YA 2RRAA 1U45A 3W2VA 1SKWA 3OPKA 3RTVA 4C4WA 1MWZA 3IAS9 2NUHA 2BRLA 2C2KB 3WZ0A 3RB0A 3JSMB 3OTBA 1R27B 1SIZA 3EDQB 1PAEX 4Y0FA 2B9YA 1RAJA 3PEJA 3C14A 4CNYA 4BLGA 4F67A 2QE5A 3TZXA 1WKLA 1FERA 4JI4F 1XJWB 4B9NA 5KT3A 4LF1A 2AP6A 4Q0BA 3RJMB 2GO8A 2CQBA 4PQUB 1Q8BA 4KPYA 3KNAA 2HZCA 5H9EK 2F40A 2NS1B 2MJNA 4ZCIA 1S79A 4PUOA 2CJBA 1N34F 3MDFA 4GKJF 4C8ZA 4CLLA 3CD5A 3H5XA 2UV8G 1KS2A 2YNFA 4MKYA 2XCAA 1V3SA 1V6HA 1YG0A 4K4XA 3RRGA 2BKNA 3IR6B 3K59A 5E3QA 1I51B 1S97A 1FXRA 2QJ3A 2AT1B 4WK1A 4DG1A 2UV8A 1FE0A 3HXMA 2W2NP 2HRUA 2EBEA 2CDQA 2WVEA 3GZ7A 5HAOA 4WKYA 4DV2F 2MKKA 5I4MA 2IA0A 5DQIA 1HNXJ 1M0SA 1DY3A 1IXKA 1JB0C 2HYIB 1UPMB 2V63A 3HHEA 4ES1A 3PX6A 3W5XA 2HFVA 4OI1A 1U2CA 1NU4A 1MMNA 2EVZA 4IUFA 3PG9A 3PR5B 1FRLA 2OPSA 2PA3A 3P3DA 3GP9A 4F50A 1UTAA 1U0SA 3D54A 1Q5VA 4RU2A 5CZCA 5K8OA 4N5SA 2B9XA 4DSEA 4RZRA 2IHR1 1UWBB 4K0KF 3C2PA 4AXJA 1H3DA 1NZAA 2HLTA 4J7CA 3MI7X 1ZA2B 3I5BA 4ANEA 4YB6A 2IM2A 3JTNA 4DV3J 2H5JB 1W7WA 4WU3A 3CJSA 4F0MA 4NLYA 4QWCA 4DCOB 2K3IA 5ETRA 2AJ4A 1VBZA 4ZPVR 1T9XA 1KFDA 3H0PA 3FFIA 5HMXA 2D3ZA 4TY8B 2HBYB 5L1IA 1H74A 5T41A 4RX6A 1NKCA 3FZ2A 1YK9A 3GILA 5J2QB 3QRPA 5C7PA 1RE1B 2ZZMA 2UUWA 2DNZA 2CAJA 1IKXB 4QPXA 1N0UA 4ERDA 1FXDA 2GO9A 3D2WA 5DDQC 2OJ3A 4LRFA 3CCMS 1T9YA 1NJYA 1Q79A 4LFCJ 2CUYA 1RWVB 3BQ0A 1FXLA 1S4FA 3DGPB 4QU7A 3ENVA 1U6ZA 1S6PB 2BBEA 4ELTA 3IG1B 5HVGA 3PNIA 2FJDB 1HFEL 2VQFF 3ZC4A 4RUAA 2KG0A 4U7UD 3Q8QB 3WX4A 4YHHJ 5EX3A 3CJ5A 3DM2B 5BXIA 2QGFB 3VQTA 4C8OA 1L3SA 4HH1A 2R7SA 4S0MA 4RNOA 2V9KA 3VF0B 2FC8A 4MIAA 4OX7A 5DDPC 3LTOA 3MEDA 3MPDA 2BE9B 4OHYA 6FDRA 3BZQA 2IVMA 1AW0A 2KZMA 4X4UA 4QJVA 3NGUA 3SIPB 5ADZA 1R8CA 5EX0A 3FZBA 1UW9A 2JJ4D 4KJIA 1QUPA 2YX4A 3RU0A 4LFAJ 1F9EB 3R2CJ 5F8HA 4B17A 2WVFA 2BM0A 3PYGA 3TJ8A 4PQAA 4F7VA 2QA4S 5CA5A 3OFFA 3VAKA 2J6SA 2YPZA 4WP8A 2MSSA 1HYSB 1T9WA 2YKNB 3OLBA 1VI7A 1RAIB 1HBOB 1SQFA 4YS2A 4A8KA 2RF2A 3FC9A 2ZFHA 4OV1A 4X4QA 3MZIA 3VWSA 3H4BA 2GHWA 1S59A 4KYZA 3W66A 3Q8PB 2RMLA 1PYSB 2R4FA 3NCRA 2OEJA 2JC0A 5A8RB 4YR2A 1FK9B 3C6TB 4DPWA 3KDOA 5F9LA 3B4MA 4AFFA 4KGKA 4GVLA 1BE4A 3FKBA 1NB7A 2ZOFA 2R8KA 1ZAVA 1CC8A 3IWXA 2M70A 1SXLA 2R2UA 3NRBA 1CJUB 5A76A 5CH7B 1IKVB 1SH3A 4I6YA 1T02A 1TVRA 3A1YG 1U2RA 4MH8A 2W7PA 5EDWA 4C8YA 2J0XA 1S6QA 2IJRA 3RW6A 2XMKA 4F25A 4NRTA 2IC3A 1NHUA 3OSPA 1UVIA 3HKZD 4FBUA 1BUXA 3EZOA 3MR2A 5K5MA 2DGQA 1S7IA 2CVIA 2MQPA 3DYAB 4LIWA 3OSNA 4W98A 2BANA 4A8SA 4RW7A 3RBEA 3POTA 2EFPA 2ZVSA 2P9CA 2D74B 1WG5A 1JLFA 1CBKA 4FXDA 2PO4A 3ZZTA 4KKOA 4LFBF 3OQ2A 1HPZB 4JOUA 3OT9A 1IQZA 4K59A 4WXOA 1GX6A 1BQMB 2LDIA 4EBDA 3EVMA 2JX2A 3KWMA 4RW6A 3H42A 1RT2B 5DQHA 2UUBF 3EZ5A 1S1WA 3Q2SC 4F3QA 2CPYA 1ZM3A 4RNHA 4GO7X 4JI3J 5GADI 3MPVA 4DX6A 2ADCA 4ID8A 1V3RA 3P45B 1SBRA 2L9WA 5D8HB 5DZ7A 4JV0A 2V4JB 1O5JA 3IR5B 2B4VA 1S0NA 3BR9A 3W62A 1IKWA 1B0PA 2Z4PA 2KI2A 3LP1A 2HQDA 1C1BB 1RTDA 4M5MA 1J5EJ 4DR3J 5CYJA 4DSKA 4WZQA 2E7VA 3B8HA 1QSSA 3JB9k 2H5IB 4ZMMA 1FT8A 2DH8A 1U1KA 1PG5B 1REVA 2AWZA 2VDHA 2PI4A 2IMOA 4DPXA 2ZC4A 1URNA 2P9EA 1K1SA 3U1LA 3G6YA 4QYZJ 3KJVA 5KFJA 1YJ9S 3D66A 3K5MA 4ZCLA 2PFDA 2NLWA 1HD0A 2UVWA 4NPOA 3M7VA 2VJVA 3UCUP 3P6YC 4O3OA 1G6BA 1XMQJ 1T0TV 4RW4A 3QWPA 3MM9A 4AMMA 4P74A 3W5ZA 4Y34A 4OJGA 3WDOA 2XNRA 1O6XA 1DLOA 4HDHA 2VV5A 2CPJA 2FZKB 2BOAA 3BBCA 1M5SA 3G71S 4MT1A 4QOTA 4XK8C 5A0YA 3BO2A 3MOJB 3N6MA 3OLAA 5HANA 2A10A 2AYGA 4OYZA 4X84A 4J9RA 1LWFB 3PW5A 3H98A 2RAQA 3DLEA 3OVBA 5KFOA 1BMQB 3TJAA 4O3PA 1S1UB 4BC9A 2RSQA 3CJQA 3UE2A 4CO0A 1DRZA 2E5LF 1EKSA 4WWSA 5JVGQ 4K4VA 1QSYA 4NZ7A 1RLCL 2J8AA 4HKQA 4DCJB 4N56A 2WOMB 4K8RA 4ES2A 1HARA 1UEKA 2R8GA 3V6DB 2XI3A 2DJWA 2GZOA 3R5DA 2ZUAA 4RKUC 2CRLA 2O67A 3M2VB 1YSJA 3J7YI 3SZ2A 2HGMA 4IRCA 3VCDA 4OZ1A 4WFYA 4DUYF 4KTQA 4ZLLA 2HQ3A 3MTKA 1SVDA 1S9FA 3BGOP 2HAIA 1Y5IB 2CQ4A 2B4OA 3BB5A 1RKIA 2ASDA 1AROP 4RBTA 4NLVA 2QLFB 2APOA 3ITHA 4ZP7A 1HBUB 1ZM9A 2BMBA 4B3TF 2R2SA 3UCGA 3THPA 2EI5A 3MD3A 3W5YA 4RWXA 3MR6A 3H7HB 3W63A 2XS2A 3GQCA 4RW9A 1YJUA 4G1QB 3RZAA 2HNYA 4HEA9 5KG6A 1U1LA 2ZBPA 3A13A 4CT9A 3I9ZA 3CD6S 2BJDA 1HBNB 3NL0A 1T3NA 3E01A 4LF8F 1SC3B 1NKEA 3ENQA 3LPYA 4J9MA 1TELA 5LSOA 1NUEA 2XYPB 2E1MC 5ETTA 2ZKTA 3DMJB 2JEGA 3J7A1 5LSLA 5M2RA 2Z8QA 4IR1A 3DOMA 4O44B 2W9AA 4H4OB 4FBTA 4XPEA 1XIQA 3DRXA 1AYEA 2D3UA 3V81A 2DHGA 1DTTA 2HQFA 4H54A 5D77A 2HRYA 3HVTA 1ELOA 4OJ1A 4NMXA 3LO3A 3KHHA 2XS5A 2RDJA 1J27A 1PKUA 1S7HA 2DHSA 5HVFA 3K17A 1N5YB 2K2PA 4P75A 2RH3A 3T1YJ 2IBOA 3K5OA 3V5RA 1M1GA 2CPZA 4DFMA 5EGYA 4USWA 3LP0B 1GNKA 4ECWA 3MPYA 2ZITA 2RRBA 3IM8A 4F0HA 2OMOA 5D0EA 1VJQA 2YWFA 2LLZA 4DV2J 2EBGA 1RKJA 5A6WA 3CTRA 1RQ0A 4K2JA 1PYTA 1NPPA 2E9ZA 2VB6A 3IR7B 1RZMA 4ECXA 2WSFC 4PXBA 1P6TA 4ECYA 2X1GA 2ZOGA 2ZJQQ 1E6VA 1TAUA 5F8JA 1F3FA 5KFVA 3UNGC 3LANA 3MAQA 1L3KA 4DUZF 5J1NA 2F7VA 2G1DA 1S9EB 2QV6A 1WC4A 1AT1B 2YNGA 2DRBA 4QU6A 4L73A 2HK3A 1RT3B 4QWEA 2GX8A 4F8RA 5DDRC 1TFYA 3KOAA 2GQ2A 1YKWA 4IKAA 1KHVA 4OHXA 2R8IA 3LUYA 1JLQB 1IR0A 1WKKA 4QWDA 3BQ2A 2PMWA 3PRVA 1Q4RA 4ZVUB 1GMWD 2LP4A 3AXMA 2XZTB 2JC1A 3C6UA 4D3GA 1TK5A 2XLIA 5FD1A 3E3XA 2IM3A 3PR4A 5KT4A 3ZTRA 4DCPB 2MEWA 1FCAA 1RHJB 4EEYA 2HHPA 1HNVA 2DO4A 5F3ZA 3PACA 1R8AA 4GKKF 1Z4UA 1TAQA 2ZBRA 4KIAA 3TQEA 2ZH7A 4M5JA 4X65F 4QWAA 2MSTA 3UDCA 2R2RA 3UI3A 4PRFA 1VGYA 2RUSA 3K5LA 4C3MA 4MK9A 2M9KA 4Q2MA 5IT4A 3DLKB 2GMLA 1Y00A 2HWTA 2QMUB 3CCES 2Z2LA 5IQ6A 2NXEA 3BR8A 4ZIWA 1ZPWX 2C2ZB 2VQFJ 2OFHX 3G8QA 3LGHA 4HACB 4ZVRB 3PX4A 4PWDB 2MZTA 2UXBF 5B08A 1JLAA 3AJ1A 4USTA 2B0GA 2L08A 2OUGA 1M5VC 4OX8A 1UEUA 5H9FJ 1S6UA 3PW0A 1RWXB 2H48B 5KFYA 3DRRB 4ZVPB 4ECSA 3OXGA 5G0RB 3MGJA 3CIZA 1SC1B 2GQCA 1LW2B 4ANDA 3AJDA 4NCGB 4EZ6A 1WEYA 4I69A 3HLUA 4O4RA 5D15A 1RU1A 4DR6F 5GAEU 4P7TA 3M2RB 1KR4A 4RNNA 5IWAJ 4UW2A 4DF4A 4J9OA 1LNQA 4ICLA 1IR1A 4P9SA 3RYLA 3MM8A 4KPCA 1FE4A 7AT1B 2P2CB 1VQ9S 1SJ4P 4UF4A 3IP0A 3TUZC 2IRXA 1JLEB 2HFSA 2F9JA 2HLUA 3ETOA 2UZAA 3A3PB 4DPUA 5B0BA 4CTAB 3B82A 4ZVQB 3M30A 1BQNA 1YJNS 2W2MP 2AJ1A 2J0QD 3DC2A 5CYQA 2M52A 2MY7A 1RT6A 1XC9A 4J5OA 5HP1A 2QC3A 1P1LA 3MF5A 1U47A 2HHVA 3DDNA 5HLFB 1U48A 3AQOA 5F0UA 5KFIA 2J6UA 1V5IB 3KLFA 2Z2ZA 3TVZA 2MGZA 3T9ZA 4ETZA 3GV8B 4CZCA 5B0EA 3VR1A 3QT6A 3C8YA 4DR5F 4O0NA 3V4MA 5A8KB 1QTMA 4A48A 1WUUA 4IDKA 4M8LA 4HDGA 2EEYA 4W4MA 5KFXA 3CCVS 4LUBA 1SV5A 1ZPVA 4DLEA 2A3JA 2HURA 3TA0A 4PXCA 4CQ1A 4I2PB 3BKTA 3ZZOA 1VQKS 2NZCA 3BPSP 3L4BC 1H98A 2CQ1A 3BDPA 3F41A 5AXKA 5JXSA 2ZUGA 1KQKA 1VQ6S 3I55S 1S0OA 5K8NA 4NA1A 4X64F 3QLHB 4EI2A 3OR2B 2HMIB 2PIIA 1S77D 3HF5A 1VQ4S 4F02A 3MOZA 4C8MA 1HQEB 3IBCB 5DM6Q 4JP8A 1RUSA 2XBPA 1T94A 2QFJA 2VOOA 3R27A 1TUWA 1QD1A 2LDYA 2WAQD 2EG2A 3DNCA 2FVSA 3CMAS 1R31A 2HHWA 1K0VA 4MIWA 4Y2IA 4X4VA 1EARA 2QL9B 1R0CB 1R8PA 3IFEA 3SSSA 1URRA 3QPIA 2DR6A 4N8NA 4CO5A 1EHWA 2RILA 4QBUA 2AYMA 3UD5A 3I32A 1PO6A 2FC9A 2X1BA 5CD4A 3A8KA 5KG3A 5KFAA 4DR7J 2PC6A 3G86A 3MM5B 4G1PA 4Q7AA 3OL8A 5KFCA 4J9NA 2EPIA 1BY9A 2JEFA 2C2NA 3TW0A 4GMKA 1I1GA 3QAEA 1Y7PA 3KJQB 1RTIA 3ZFVA 3Q8SB 4DR1J 1RT4A 3JQKA 1FI4A 3H8YA 5CQGA 1VCTA 3HSZA 1LWEA 2M4MA 4NLGA 2ZBQA 3ENWA 2BKOA 1UA0A 2OEMA 3TP2A 1FKOB 3G87A 5BYQA 4USKA 2ZBIA 2CZ9A 2FJXA 2OPQB 5M2PA 2AF6A 2HFZA 3TARA 4RNFA 3R7NB 3HO1A 2HIYA 1TK0A 1XEZA 4RNMA 1H6KX 4ZVEA 2G4BA 4LR7A 4FZVA 2JEJA 2HK2A 3KFWX 3UQSA 5A6PA 2UXDF 2QN6B 1U49A 1IBLJ 4WKRA 1V3ZA 1HQUA 2AJFE 2B51A 3KJFB 5HSPA 4I67A 4NASA 4DV0J 2BA9A 1N8RT 2VQEF 2OAUA 2OFGX 3M1VB 4WIIA 2BV3A 1T03B 4KY3A 3MMAA 2WBRA 1HHSA 4FP9A 3CCZA 5D0RA 1FO1A 4KBIA 2V68A 4I1TA 1LWXA 3CGIA 2BZ2A 3ONQA 4FYXB 3M8QA 2C3UA 1RP5A 1RTJA 2E5LJ 4B3RJ 2DYAA 3K57A 1MW7A 4B9SA 1S1TB 2XI2A 1I94F 1YBAA 2CQPA 4B9TA 1XNRF 3QZ8A 2POKA 1RAAB 5G4DA 2BACA 1X4BA 3FEYB 3A8JA 1TTHB 4ZIVA 5HMZA 1EETA 3UR3C 1KBRA 4NLQA 2Y3YA 2ZH9A 1R8BA 5AE3A 1VQSA 5E3RA 2E44A 3AY0A 1EB0A 1EP4B 2LFVA 4N77A 5DO2A 4RLEA 3OR1A 1AFIA 4WFBQ 4G65A 4DUYJ 1X4CA 3GV7B 3R8YA 1VS3A 3UDEA 5IV4A 2VG7B 2ROEA 2E1PA 1UVMA 3R6GB 3OW2R 2I38A 1VK8A 3HFZB 4OZLA 2L41A 1VRUB 4B3TJ 3QMQA 4B3OA 3KLEA 1KTQA 4I6AA 1CJVB 3KDNA 1QE1A 5HJXA 5BYRA 2H4YB 3PX0A 1GMUA 4CI0B 2HVHA 1A0OB 5E41A 5K8MA 4K50A 2H3EB 2YWEA 2RQ4A 3RB3A 4FDFA 1X4DA 2ZWOA 4Y2KA 4PKDB 1JJCB 1NDCA 4JI0J 2LQ9A 3VVUA 3HI9A 2BYCA 4OQJA 2HNZB 4NCAA 3SDEB 3K2YA 3ZNUA 2B5JA 4QWBA 5LMNJ 1JXLA 1FFSB 1RK8A 4TN2A 3FBCA 4ZVOB 3QAUA 4UY8T 5BR8J 5ETLA 1HBMA 2OO4A 3NCQA 1C4AA 5F8LA 3UN3A 5HQLA 1WSRA 1TV6B 5D4NA 4DV4F 2QG9B 2NXNA 2YQ1A 3HM9A 1FA0A 4JI8F 2JSXA 1JXEA 1YJWS 5KG1A 4NI2B 3TZYA 5LJ3Y 3KUHA 4J37A 1PJ6A 1S9GA 3AA8A 1FDNA 3H40A 4F26A 4HI1A 1K0TA 1CG2A 2OSQA 1YLXA 2Q3PA 4IG0B 1HI8A 2DR7A 4AL7A 1NSKL 2RNEA 2VKRA 6AT1B 4IFYB 1T8EA 2HGLA 3R5AA 1U2FA 1M5OC 1EKRA 3BJYA 4IG3A 4AUKA 5F8IA 4KO0B 3M32B 1QTNB 2FVPA 4RW8A 3Q8YA 1IR2A 3N5BA 2HG4A 3MECB 3AQPA 2Z2MA 2MDAA 4XDDA 1BD6A 2KT3A 3I82A 3FDSA 2XULA 2W1BA 2X1AA 4ECVA 4IOBA 1VLOA 3MCOA 2AIRB 1CULA 1FNMA 3F0NA 5HJYA 2Q79A 2FB0A 4D3HA 4KQZA 3AAWB 1PC5A 3MR7A 4DPYA 1A9NB 2G13A 2GCFA 1RWOB 3BBFA 3MURP 3M8PB 5IT9U 3OXLA 2FHJD 1N32F 1Q7LB 4LF4J 4F36A 4GKKJ 1RWWB 3SEOA 2GMJA 2LQJA 1K73T 2F1FA 2XSJA 4B08A 3T5JA 1SUQA 3KTQA 1U8SA 1TL7A 1TZ0A 3JSMA 4NA2A 1LWCA 1YJRA 2KN4A 3D28A 3M8YA 2EG1A 1FEEA 1P8GA 2LU1A 3BGFA 3FSIA 3N5FA 4P2SA 4DN9A 4LF6F 2H5EA 1KQSR 3C19A 3TJ9A 4X4RA 2A2CA 3HMJG 2HQCA 2CZVC 3MEEB 1XNQF 2UXBJ 3FUYA 2O01C 5C24B 1WOSA 2IRYA 3I5CA 1M5HA 2X1FA 4OI0A 3K8WA 3FEXB 2QA2A 4QIWD 3DXSX 1C0TA 1U02A 1T9VA 2NYHA 1UKUA 4DV5J 3LALA 3KLGB 2EFGA 5KFLA 4ZP9A 3TVKA 5DG9A 5IFMA 3P96A 4I6WA 1VQMS 4NXNF 1OYEA 1GMVA 3MPUB 4KAIA 4DR6J 4JUZA 1KD1T 5D0GA 2NXUA 1G3OA 1D9DA 4V19J 2IJNA 2GHPA 3EPGA 1PILA 4LRAA 2XGPA 3VHQA 4K4TA 2RT3A 4OJ3A 2WTFA 1OO0B 4OHZA 2ZDPA 2V69A 4E0DA 2YY3A 4A46A 3KYLA 1JLBA 3KMQA 2F8HA 4FPIA 4PG5A 1UFWA 2GJIA 5L38A 3H20A 2H54B 2Q6BA 2N7CA 2RS2A 4Z2XA 2VONA 1UEVA 4FXWA 4EMDA 2IMWP 3NBPB 1Q16B 4U95A 4ZLJA 3RBZA 1UFLA 1Q1KA 2C2DA 5DLFA 3W2WB 1TUVA 3F73A 1MN7A 3NOCA 4ZVFA 3W8PA 4RBVA 2GAHC 2VG6B 2ACYA 1YRXA 2XHCA 4WJBA 4CP5A 1NK8A 4KB7A 4NEYA 3DOLA 4JI5F 1HNZF 2BX6A 1KEKA 2YNFB 4WFXA 2Z57B 1XQIA 4MAKA 1UCNA 3NLCA 5GMKa 3I87A 3J81j 2ZH5A 5ETVA 5AXMA 2R7OA 1MROA 2ZEJA 1GXLA 3ZZRA 2XGQA 3CPWR 5J2PA 4ES3A 3GPAA 1WWHA 3RR7A 5KFDA 3G6XA 2YNHA 3D0HE 1WG1A 4WTOB 4Y2CA 3KLVA 2EWHA 1IKXA 3D3BJ 2ZH3A 2HWIA 4LREA 2VBXA 1PSDA 2LQ8A 2M8HA 4QCLA 1NMEB 4DOZA 2F8EX 1F9HA 3H4DA 2YWHA 1NCLA 4CDIA 1X4AA 2UXCJ 1S0MA 4OYBA 3BKFA 2ZJRQ 3I31A 2ZE2B 2KZZA 4X62F 5T7LB 1SIWB 2LA4A 3CDBA 1HR0J 2RU3A 2CKWA 5E3AA 5KFRA 3S7RA 1GQEA 2HVEA 4FNHA 1YI2S 4ED8A 2HHXA 2WSEC 3PRBA 2RB7A 1PBAA 4KHPF 3FGVA 3LQVA 4Q44A 4PWWA 3FFIB 1AXQA 2YQ3A 4ZPTR 3GIJA 2H65B 3M6XA 4HLBA 1NO8A 1RHUB 1RABB 4Q8FA 4BWJA 4PG6A 2GJ2A 1YJVA 3SCLE 1VQOS 4OI3A 3SFGA 1BQXA 3T3FA 5EHHA 1YITS 3EGWB 5GAGU 4FPRA 1YHQS 5AT1B 3Q83A 5C2GA 2P9GA 3CUNA 4QPTA 1HYSA 2JOQA 4LF7F 5KG4A 1HBOA 3D6HB 3ZZPA 2NQPA 1WOPA 4CLTA 5ETPA 5EWGA 1XR7A 2C3MA 3W9IA 4IFVA 3OL7A 2W7OA 5A8RA 4LJMA 2HVZA 2DCUB 1FK9A 4MIBA 4KGVB 2SXLA 3VAHA 5I3QA 2AZ1A 5JVHQ 3TX8A 4AMOA 2QSFA 1VQYA 3HSDA 2Q1LA 1UMJA 2DNQA 2CVEA 1NRKA 2VBWA 5HO4A 1IKVA 1S4EA 4DQRA 3LP2A 2XMVA 1ZYQA 1JJHA 2KXNB 1ZS6A 1RHQB 2KDOA 5DM7Q 4OI2A 1EQ0A 2W9BB 2XG8A 5LXYA 4ZK7M 4L74A 2VFRA 2U2FA 2PA8D 1OQ3A 4DL3A 1RAOA 1WOOA 2DRAA 3CD0A 2U1AA 4WP9A 2IFXA 2PFFB 1QVGR 1XMOJ 1AZSA 1X5TA 1X31C 1I94J 2ABYA 4E98A 2CQIA 3O1LA 4ECRA 4USVA 2DVIA 1HPZA 2E1CA 3QJPA 1FRHA 3BN7A 2ERRA 3KNGA 1BQMA 4ECZA 1KOOA 3JYTA 5L9NA 1RT2A 1RWUA 2FVCA 4CH7A 4URQU 3BV8A 1B70B 2ZHBA 3GR1A 2KT5A 2ILZA 3MUTP 2VFSA 3HVAA 2CPDA 4B9UA 2RJZA 3ICLA 2W9CB 1B7FA 3PW4A 4P10A 4Q45A 4K7QA 4Q8EA 3R97A 1PYOB 2V4JA 1FESA 4YDXA 2IC3B 3UW1A 1YRTA 3BEGB 1UW4A 1NJXA 3HKWA 2DNGA 1NAQA 1YRUA 1EZZB 1JWWA 5AE2A 1IVZA 4RW7B 2UUCF 3POTB 2YKQA 4EO8A 1VQ8S 2G2ZA 2K1RA 5HI7A 5LMUF 3BPDA 2W24A 1X4FA 1U26A 4R0JA 5SZTA 3CCLS 3UNYA 1LXNA 1N0VC 3FSXA 3IC1A 4YR0A 3PXGa 4DU7A 2LXFA 5J1EA 1RAHB 3LGNA 2CQGA 1WNEA 4ED6A 3BO3A 3OVSA 2EC2A 3BSOA 2MHEA 1S5ZA 2Z30B 1MMLA 1C1CB 4DR4F 2ACMA 4DL0C 3T5KA 4QR0A 2LEAA 4G3IA 3SV4A 4PZVA 5IT0A 2V0NA 2X3GA 1DHMA 4NLXA 4U67Q 3QNWB 1C0UB 1WC3A 3NOGA 1IKWB 2YWKA 2VIHA 4N8OA 4XPCA 3MCMA 1OMSA 1D09B 1L5UA 2KH9A 3O44A 2RKIA 2OI2A 3Q0AA 3EZUA 3HFKA 1KVIA 5KG0A 4JI8J 4AL5A 3R1HA 3TA2A 3TUJC 3KXDA 4MYUA 1LWFA 2VUGA 5KOXA 1REVB 2MQMA 2GGPA 2FVRA 2JFKA 2IM1A 5IM0B 2X7IA 3DHXA 1RT7A 2L3MA 3MM7A 1YWXA 1S1UA 2FQQB 4DV7F 1K9MT 3ZNJ1 3KJVB 4ZPBA 3NAIA 2R7XA 1U24A 2VH7A 4DL5A 1ZZFA 3QIDA 1R8HA 2XHWA 4MTPA 4LIRA 4ATNA 4DJBA 1QUVA 1NH8A 1RAEB 4TY9A 1GH8A 5FIIA 2HQGA 1NHVA 1HQ2A 4ZJOA 2JVRA 2GIQA 4DI6A 2WOMA 2KXHA 4EWTA 2V2KA 3PFEA 5C42B 2V34A 3V6DA 1Q86T 3GG1A 1WHXA 3CT9A 3M2VA 3CVKA 4BHQA 2J0SD 3MM9B 5I3PA 4RWWA 1SQEA 3M6UA 4WK3A 4QIFA 2PT0A 4Y2AA 5CYMA 5KT2A 5J2NA 2HHHF 2LXIA 9RUBA 3D0GE 4DX8H 1UFKA 1NHKL 2OHDA 5A0YB 3JS9A 3IA0A 2E29A 4KRWA 2Y1RI 1XBWA 3MD1A 3CJKA 1HBUA 2DNYA 2CJ9A 1YJTA 4YY3F 2HNDB 3O6QA 1R0AA 3OJUA 1N32J 3DLHA 2XZWA 3G4SS 3WIVA 2HFUA 1RISA 1RWNB 3WBZA 1YZ7A 4KSEB 2H51B 1Y3KA 4ED4A 4G1QA 2OD6A 4M95A 4ZVTB 5HL7Q 1GMWA 3U1MA 4J9LA 3CDEA 2ROPA 4ED7A 5B0FA 1FKAF 4DQQA 3BGRA 4DL4A 3JXOA 2FZCB 1R0BG 3JTPA 5D6GA 2NR0A 3DMJA 4ECTA 2VPYB 4TQRA 1FRJA 2V4RA 3D6MB 4O44A 4H4OA 2ZM6F 1TKTB 4LRCA 4LF6J 1FWLA 3R7SB 2AKWB 3ZZUA 2C22A 1F0XA 2AMCB 4YB7A 3R5BA 4URSA 4WYLA 4DV6J 4ILMA 3BGLA 4G6VB 4G1IA 1FJGJ 2WCXA 3GLJA 4NXMF 1TQLA 3SCJE 2XC9A 1X9WA 3EXYA 3CMQA 5IZHA 2CADA 4WYWA 1FDAA 1RTZA 1HIYA 4IYQA 4NE9C 2W8LA 2BDPA 5GMEA 3LWLA 1RT1A 2J76E 2JZ5A 4R0EA 2GVDA 2HKEA 4KHMA 2Q6CA 3IXQA 3GIIA 4RW9B 2E5HA 2BJ8A 3E8OA 2VFTA 3I0RA 3TAQA 2DNRA 3E01B 2YBVA 3MXHP 2PE8A 2OD4A 4ED3A 2CJKA 2VASA 2W4DA 1B3TA 3OUYA 3DOMB 1FF2A 2OSRA 1NZ8A 4I64A 1W25A 4OYWA 2RU9A 2KYXA 3MHYA 5FJ4A 2GIFA 2DXFA 4P2XA 2VA2A 2DPJA 3V81B 2MZQA 2FJBB 1NSAA 4M94A 5JJBA 4F4AA 3OD2A 3KLIB 4DSIA 1FD8A 1S9EA 2KFNA 1KLMA 1OPZA 4NWBA 1YIJS 4FVCA 3K8VA 3QIPB 4TYBA 4I2QB 3GR0A 3V4IA 2Q66A 4N41A 3HVWA 4NLSA 2GMHA 3IO1A 4J9KA 4PWUA 2V8DA 1JLQA 5KFUA 3VZIA 2FLLA 5M2UA 1M1KT 5I42B 2R7RA 3M9OB 1NK7A 4JI7F 1HI1A 3GB0A 3CW2C 4FKYA 1JNZB 3G8TA 4IR9A 5EWEA 1TKZB 5KOWA 4UOHA 3H5YA 4KGXB 2NYIA 2J7WA 4X2BA 1VIOA 2Z56B 2PMHA 1G7CB 4A4JA 1D9FA 4X4PA 4N47A 3T5HA 3OHAA 1CLFA 1Z2ZA 1FRMA 3OHBA 2FHMA 1VC0A 2MKSA 2ATCB 1FJ7A 5DZ6A 1E6VB 1R3NA 3IGVA 2DXEA 5CZDA 1EAYC 4YB1P 1CPZA 1RLDA 2V67A 3UPFA 1RAFB 3RR8A 1X5PA 3N4WA 5E33A 2YXLA 2N3LA 3R3TA 2YKAA 3K7RA 4PEOA 3GIRA 4L6V3 4FN5A 2XY6A 2YH0A 3UVJA 4KR0B 2XMUA 5U47A 4CLUA 2OELA 1WI6A 5H9FK 3S1TA 3SCKE 4B3MF 2COLA 4DF8A 2Y0BB 5G0RA 2HRTA 4ETXA 1X7VA 1ITPA 3CJTA 1FVQA 4B9LA 1QAIA 4ILRA 1F60B 2JVOA 1UVNA 4OZNA 2DNMA 1RWKB 3M2RA 5L39A 3GU0A 3G2XA 3SSRA 1O8BA 4Y6IA 2FHOB 2DR9A 1JLEA 2MQ8A 3K58A 1S1VA 1TL1B 4JB8B 3ZXWA 4AMPA 1LFPA 2PMZD 2MY8A 3FSYA 4CTAA 4GRSA 4NYZA 1XR6A 4HTJA 4B02A 1QJHA 1N5SA 3KHGA 3BM7A 3EGZA 4O0IA 3K5PA 4ZCMA 1JLAB 3T19A 2J0WA 3W60A 2CWXA 2MZSA 3BDEA 5HLFA 1FRIA 5I3UB 1QLNA 1ZZNA 5ETOA 4ZP6A 4K5SA 1N4LA 2XLKA 2LEBA 2K7JA 3VGTA 3BYRA 1GAOA 3DLGA 1IBMJ 5KT5A 1KQFB 3RG6A 1LK7A 3KJNB 5A8KA 4LF5F 1FEHA 1RHKB 3J80U 1YBTA 4RUBA 1UVKA 3UFCX 1MSWD 5GAHU 4EK2A 4LSLB 3L3CA 4I56A 1MU2B 3CCWA 4NLUA 3H25A 2VBZA 2XMTA 1N36J 5ETQA 4ICLB 4LRBA 3AODA 1WG4A 2DKOB 1HNXF 1Q8IA 2VFVA 1IN0A 2CJAA 2WVBA 4ZN1A 4WP3A 3J7AN 4FYWB 3BSNA 2Y9HA 4ZN3A 4IRDA 4KV8B 4Y2MA 3MPWA 2MLZA 4I7FB 3QLHA 4QYRA 3OR2A 3DRPB 2VODA 2DGSA 1HMVB 4CLKA 4ZVHA 3ZZZA 1FWPA 3PO4A 5CYQB 1LW0A 1JLGB 2KFZA 5L1KA 4RJVA 1D1UA 4O3NA 4J9UE 2AD9A 1NPRA 4ZJLA 3KKFA 2B8QA 3GE9A 3KLHB 1S1XA 2HHUA 2DEIA 3KLFB 4JI1J 3V6JA 2LA6A 2ATLA 3JSYA 3D4JA 3W1YC 4CH0S 1FNXH 1XTZA 4IDKB 4P2FA 3QGPA 4BBYA 3D6FB 2BW2A 3TVYA 4A8FA 5KFBA 3M6VA 1SV5B 4CO1A 3GTYX 2HVDA 2B4UA 3MM5A 4RR5A 2DGTA 2XZDB 3MUVP 5HROA 5LMUJ 3IGNA 4B3SF 4XTTA 1X60A 4OZ2A 4HT5A 1RU2A 3Q22A 1CSJA 1J5OA 4QR2A 5D3GA 2DH7A 4LFCF 1RYRA 1KVKA 3BBBA 3M9NB 2BR0A 3D1HA 4LSZB 2HWHA 4K5RA 1FKOA 1N88A 5IQQA 1I3OB 4YHHF 2DBBA 4LRDA 3CCJS 2JRSA 3PJWA 2OPQA 4QR1A 4DR2J 1KP6A 1Q0NA 4Q5VA 2HBRB 2L9DA 1SJ1A 5KT7A 5EUHA 2DNNA 3DI6B 3CD7A 4CLPA 2CXEA 2OLWA 1RGVA 3DGVA 4JV1A 3N6NA 1PAUB 2IDEA 3AA9A 2VKZG 1F1BB 4NLDA 5HQMA 2VPZB 1NM2A 3WQPA 2E7WA 2DH9A 2WVCA 3W65A 1Q8LA 1KDNA 3FCWA 1T03A 4N7TA 4OI4A 1JK9B 4HL9A 4EGLA 1KVJA 1M5PC 2CNKB 2RDIA 2QA4G 3MWBA 4B9VA 1RTHA 2V2VA 5KFNA 4Z7CA 3I6PA 5ETSA 1RTIB 1VQLS 2IYIA 1LKZA 1RT4B 3Q24A 3HZEA 2NZ4A 3EGVA 1NJZA 2V8VA 2OEKA 3PJXA 3OVAA 4JV5F 1KONA 3L7UA 1S10A 1SJFA 4CM0A 3HD1A 1IBKF 3BYPA 3BKUA 3MMBB 3IS9A 3NGRA 1OS5A 1WHVA 3W9HA 5DDOC 2A6MA 3OBIA 3QBCA 1CEZA 2CQHA 4QW8A 5ETNA 1C2PA 2FDNA 4EYIB 2OH2A 2HHHJ 1QAYA 2NREA 3PKMA 2W2OP 1D8YA 1TL5A 3AB4B 1HQUB 5MLCV 2VG7A 2OP5A 4IOAQ 4IH7A 5L1JA 3KK3A 3IRXB 2ZH8A 1VRUA 4YY3J 3P5TL 4ZVSB 2BJ7A 3HT3A 3MMAB 4L72B 2NSBA 2B8PA 1N5VA 3IN5A 1F5AA 2CYYA 3CDUA 3I0SB 1N6QA 2A6OA 2EKYA 1NK9A 4DX5A 2CNNB 5KFPA 2B6AA 2HPUA 3DLLQ 3SQGA 2OGUA 3M8QB 4DSLA 1IKYB 3RBXA 2GS8A 3PZPA 4NLPA 3MR3A 4C6AA 1B0TA 2B9EA 6FD1A 3C15A 5KFFA 2QIFA 2FHJA 4GC7A 2JEIA 2KJWA 3PO5A 1FRKA 2HNZA 2VZ9A 1EETB 1NDKA 2RE1A 3CF5Q 2ADBA 5CD4H 1WHWA 1RI7A 2B56A 3KUEA 1FTRA 1O0PA 3T6BA 2DY9A 1VFJA 1L3TA 4KH1B 2V8PA 3CE8A 4OYOA 1UZDA 5DRKA 5GAGI 3CJ4A 3DOKA 5LOQA 1U1MA 3EDRB 1VBKA 2DT9A 3UDLA 1TU0B 1KTVA 3VZHA 4YOEA 3ISZA 5D78A 3S6EA 4B3OB 3VGVA 2KTQA 1J5EF 1OY8A 4DDFA 3CXCR 1QE1B 1VBXA 4PPZA 4W90B 4TU7A 4KFBB 3IAM9 3EVOA 3V6HA 2R7WA 1SC4B 4JI4J 1ZA1B 3VAFA 5A8WA 4U7UK 3H5SA 4GVBA 1YGYA 2E5IA 1VR6A 4O4GB 4IG0A 2AX1A 2J9CA 4QZVB 4P71A 1WELA 2CQCA 3BREA 4IFYA 1RT5B 1V5VA 3NNAA 3QT7A 2YX1A 1UPPA 4A8OA 4QIVA 2B5JB 1H2VZ 1N34J 4GKJJ 3RB6A 1B4SA 4WBFA 3AOBA 4HH0A 5KAKA 1JXVA 1RCXB 5THWA 1VYAA 2Y0SD 3R5GA 1Q5YA 1Y5LB 3GYNA 3PJ9A 1HBMB 1UP1A 1XMQF 4C9DA 5J1PA 4OMFG 3MECA 3IM9A 5KG7A 2E5JA 4OFZA 2R8HA 3T5LA 2C42A 1DJ0A 2MZRA 1U09A 4U7CA 2FZGB 4P6QA 4FF2A 3W3SA 1SJ3P 1KSPA 2RUGA 2HFNA 2Z2YB 1WTFA 4NLRA 2E1RA 4OX9F 2HGNA 3MEKA 3W8GA 3THVA 1YDLA 3G6VA 5LJ5Y 5J2MA 2VPXB 4U8VA 3M8ZA 2BJ9A 1R43A 2HS0A 4ZPCA 2WHOA 3JAMU 4Q43A 4F2SA 3BSAA 2BRKA 1TKXA 2FTRA 3TZZA 4C98A 2UVVA 3HDSA 4K0KJ 2RS8A 5K20B 1LK5A 4KE5A 2OPRA 3FRZA 2CDRB 4U6PA 1U1RA 1CQNA 4V19X 3B78A 3D3CJ 4Y65A 4LSNB 2Y1JA 1ICEB 2W2PP 3CJ8A 1UJ4A 2DNPA 2DNHA 3KHRA 2EW9A 4DL7A 3AT1B 3PDNA 3MEEA 2AW0A 3IWLA 5AXLA 5T14A 1H7WA 5C24A 3R5JB 4WZMA 5LM7E 4OL8A 3OJSA 3QGIA 3CDAA 2KRBA 5KFHA 2I5JA 3CJ3A 2AV5A 1BXNA 2AJQA 2LQ5A 4YEAA 5HATA 5IS2A 3R1LA 2XEXA 1WEXA 3TUIC 3DKDA 3NS6A 4ED0A 3NGKA 1N5QA 1U6BA 2V8GA 4NYOA 4ED1A 1YTYA 1RB0A 1CJKA 1RA7A 5L9XA 1DAXA 2G2OA 2IRUA 1Q81T 3EPIA 1NSQA 2J9DE 2VFUA 2XSJB 1UZHA 1SUQB 4DL2A 3NG8A 2W8KA 2ZNYA 2UVRA 1D8ZA 1TL7B 1Q95G 1KHWA 1YJ7A 4CLWA 1LWCB 3PFOA 3J7Z5 2P6TA 2HEKA 3QYYA 3QFHA 4NZ6A 1I6JA 1JLCA 4QIEA 1F2GA 5DS7A 1U1NA 4TQSA 2CFXA 4MFBB 2XCPA 2F63A 2JLGA 1Q7YT 3NBPA 3TANA 4YP3A 1R6YA 4IH5A 4CIOA 4UTGA 5F0WA 4BWMA 2MQNA 1WC6A 2C28A 3W2WA 3CSKA 5CABA 1XMBA 2VG6A 1C0TB 4LBIA 1WF0A 2KM8B 3NMAA 4J9VA 1Z2LA 3RW7A 3T1YF 1FDBA 4LF9F 4JI2F 1MLAA 4LF5J 1U1PA 4I68A 1QVFR 5B0AA 2NPFA 2KRRA 3PRDA 4DQIA 3V6KA 3M05A 3Q2TC 1ZETA 3SMZA 2E5GA 4A47A 3AD8C 3HK2A 3RAXA 4UQGA 7FD1A 3HJVA 4OZJA 4P7VA 1U8WA 1VHFA 2D41A 5BJRA 4U9RA 1IUJA 2V8HA 2IAJA 1HL6A 4FYYB 4CLFA 1JLBB 1WC5A 3HHLA 2BM1A 4DBQA 4ANCA 1T95A 3R5CA 1VRTB 2G2YA 3GIKA 3SI8A 2D1CA 1ZBTA 3QFWA 1Y11A 3ET6A 3G82A 4DQPA 2YKPA 4TLRA 3DDIA 2XO7A 1CJTA 5KFZA 4UOFA 1W2BR 3MEGA 2OTLS 2ZE2A 1X5SA 3MUMP 3HHKA 1IJEB 2P6SA 2MXYA 5T7LA 1HD1A 3DOLB 2P5VA 2BJ1A 4ZA1A 1HNIA 1DARA 4F04B 4DEZA 2VU5A 2DIUA 4DS5A 1NK0A 2M2BA 2V2ZA 4LFBJ 3BN4A 1IQTA 4MKAA 2ZJPQ 1MROB 1SL0A 1L3UA 2KVQE 3PVXA 1CQMA 3NNCA 1IBCB 1BGXT 2HS4A 5J2PB 2LXUA 2NSCA 1TMMA 2UUBJ 4B3SJ 3GYGA 2YNHB 3O8WA 2QYCA 2VBYA 3AXKA 3N9UC 2DGUA 2QX0A 3DLJA 4KT0C 1W2IA 2MHNA 4O3QA 2R3VA 3M9MB 2F5GA 3AOCA 2DGOA 1QM9A 3GONA 4X4TA 4A8QA 2R9LA 1W26A 2MZJA 2PD1A 3OTEA 1FVSA 4NYPA 3GCXP 3EX7B 2J5AA 5KFTA 3BO4A 2QLWA 1X9MA 1I5OB 1RXOB 1T9UA 4R8UB 4IO9Q 3GJTB 2GW8A 2RQKA 2MJUA 4ZHRB 3NS7B 2FD2A 4WIQA 2ZD1B 3FMBA 4WE1A 1RWPB 5DG8A 2FLNA 2I8EA 3SYZA 3GFYA 4EUVA 2KL8A 4AXIA 2OPPB 3TR5A 4AQYF 4M5IA 1ZTTA 3EJMA 4URGA 3EXCX 1X0FA 3DN9A 4DSJA 4Z7YA 3DRSA 3RB4A 2PN6A 1TMJA 2FY8A 2L9NA 2W9BA 2ZWPA 3M4XA 1ZH5A 4X4SA 2HS3A 4CH1A 1VMBA 1B64A 5IWAF 3CCTA 2CPFA 2RD5C 2DHHA 3TAMA 1NDLA 1RWMB 2BXJA 4Y00A 2EXUA 1GTEA 3GCWP 2ZH2A 1X4GA 4WPAA 1DFDA 4CM2A 2BKPA 4C3KA 1HWUA 3NGTA 1T05A 2KO1A 3W7BA 2UU9F 5K9FA 4H4MA 4JV5J 3HHLC 3NAHA 1UWAA 4IFVB 5IOLA 1GXTA 1IBKJ 2AZ3A 3KK2A 3D6TB 1FKPA 3ZTPA 4WU2A 4MMOA 2GAGC 4Q2LA 2GC8A 4HTIA 4E8UA 4UT4A 4R5PB 3KK1B 1U0HA 3TRGA 1JJ4A 2YKOA 4BC7A 2XY7A 2C2RA 2W9CA 2E9TA 2DTJA 1E6YB 5IXUA 1SQGA 2VG5B 4X66F 3LP2B 4ECQA 1XN9A 2FJVA 1PCAA 1MNEA 5AJ3F 2ZH1A 1SB6A 2YTCA 3QO9B 4FF1A 4C3LA 2Z0GA 3JAMY 4I0WA 1VHIA 3P8BB 2GV1A 3DFEA 2E7XA 5ETMA 2XMAA 5CCMA 1AZSB 5C5JA 2UP1A 1XWLA 3H2LA 2FLOA 5K14B 3AH6A 3EVWA 3C16A 5FDLA 4CNZA 1CS4B 4F4WA 3FBBA 3TA1A 2BUNA 5KFKA 1HLWA 4NLWA 3JYTB 2ZHAA 3OFEA 2AJ0A 4QQBA 1RBAA 1GEHA 3M8WA 4PCQA 1K8AT 2F9DA 1DZ5A 1FFGB 1TR0A 1TP7A 2RRNA 3KG0A 5LT5A 1C1CA 2RHSB 1IJFB 3MM6A 4FXVA 4OYIA 3FBEA 3AJ2A 4CO2A 3FMWA 4MJKA 3GV5B 2KHDA 1T3OA 2A18A 1C0UA 1P1TA 2HBZB 1KFSA 3D5MA 2YNIB 3OTOF 2MQOA 3D67A 1RADB 3PKYA 1SH0A 3ENAA 3QGHA 2XWXA 3H90A 3HJFA 3TEHB 4LF8J 3PY8A 3LGMA 5HBMB 4C11A 3DDKA 3O3LA 3PHEA 1GXUA 5F8NA 3IWNC 4DR7F 3TZWA 1SKRA 3HULA 3ILOA 4CRJA 2QL5B 4A8WA 2K1RB 1JNRB 1Z1ZA 3CEDA 3FBFA 1TFWA 2G9OA 2GA7A 5IM0A 1R89A 5KG2A 4RUCA 2AU0A 5HN0A 3D7SB 1TL3A 4M5DA 1LFWA 3EUNA 1RHMB 3QSYB 2W4CA 4UUWA 5J1EB 1QDUB 4DR1F 1CC7A 4OV6A 4AYBD 4K2XA 3TUPA 3ISND 5JMNA 2XM3A 3T41A 5D4OA 2DGVA 4X4NA 1DTQA 4JI6F 1NK5A 1HWJA 4LQ3A 1UL3A 3H5UA 5GAHI 1EQMA 5C42A 3EM1A 2EFNA 3PYDA 4C8KA 3MAAB 4ZKAA 2DRDA 4J9QA 5HQ8A 5C25A 2ZNZA 3M2UA 5LSRA 2EKNA 5RUBA 2YKMA 5E2QA
chains in the Genus database with same CATH topology
2G2ZA 4AMPA 2H1YA 5DZ7A 3HJVA 5DZ6A 4RL1A 3TQEA 3G87A 3TZZA 3IM8A 3EZOA 3QATA 2QJ3A 3R97A 2G1HA 3RGIA 2QC3A 2G2OA 4AMOA 1NM2A 2CUYA 3SBMA 2G2YA 4AMMA 4RR5A 3TZWA 3TZYA 3H0PA 2JFDA 4QBUA 3PTWA 3BV8A 2JFKA 3R8YA 3IM9A 1MLAA 3HHDA 3CJ8A 3TZXA 2C2NA 3K89A 4AMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2Z A;  4AMP A;  2H1Y A;  5DZ7 A;  3HJV A;  5DZ6 A;  4RL1 A;  3TQE A;  3G87 A;  3TZZ A;  3IM8 A;  3EZO A;  3QAT A;  2QJ3 A;  3R97 A;  2G1H A;  3RGI A;  2QC3 A;  2G2O A;  4AMO A;  1NM2 A;  2CUY A;  3SBM A;  2G2Y A;  4AMM A;  4RR5 A;  3TZW A;  3TZY A;  3H0P A;  2JFD A;  4QBU A;  3PTW A;  3BV8 A;  2JFK A;  3R8Y A;  3IM9 A;  1MLA A;  3HHD A;  3CJ8 A;  3TZX A;  2C2N A;  3K89 A;  4AMN A; 
#chains in the Genus database with same CATH topology
 2K3K A;  5GMD A;  2RKI B;  1IBL F;  2PI5 A;  4P73 A;  2PEB A;  5E3P A;  7FDR A;  2HHQ A;  1HA1 A;  4OX9 J;  2GFF A;  4DV0 F;  2GVZ B;  1A6L A;  2JHE A;  4AT1 B;  2QL7 B;  3JQM A;  2HND A;  2ZBC A;  1KRP A;  4CYU B;  2GGP B;  2ZC3 A;  1UJ5 A;  4LQ9 A;  3GJQ B;  4ID5 A;  3HX9 A;  1RT7 B;  3CWJ A;  3MM7 B;  2Y1I A;  1S72 S;  3BH7 B;  4DZD A;  4M5L A;  4DUZ J;  2B7B B;  2D3O 1;  4B3R F;  2DIV A;  3NKY A;  3ELH A;  2K7K A;  2DY1 A;  2LU2 A;  1MWQ A;  4C0H A;  3LWM A;  2FJE B;  1Y5N B;  3QZ7 A;  3VAL A;  1PIE A;  2NPI A;  2JNJ A;  2F4F A;  3J81 U;  3MMC A;  2BE2 B;  2YPY A;  2WON B;  2FGC A;  2QT7 A;  1SKU B;  2ZKU A;  4HR2 A;  1JKH A;  1TKT A;  3GG0 A;  3Q86 A;  3SSQ A;  3JTO A;  2AJ2 A;  1O51 A;  1FJC A;  2AGP A;  3PV8 A;  3MCN A;  5IV3 A;  4TVA B;  4LVN P;  3OL6 A;  2B3T B;  5CYM B;  2BEF A;  5J2N B;  3HZG A;  2MQL A;  4DMZ A;  2FUG 9;  5KFS A;  2ZZT A;  3R2D J;  3T6J A;  3CJK B;  1AUD A;  2VOP A;  4X65 J;  1N48 A;  5L1L A;  1R0A B;  5F8G A;  1R6V A;  2KYZ A;  1VRQ C;  5BYS A;  2IDL A;  2C2E A;  1NKB A;  3W9J A;  2CQD A;  1BC6 A;  2KG1 A;  2MLY A;  3OFG A;  2KFY A;  4ZIT A;  2M88 A;  4QIG A;  1BHN A;  3D1Q A;  4JI0 F;  3EWG A;  2MLX A;  3G9C A;  3CJR A;  3BGR B;  2BQ3 A;  1GTH A;  1KWM A;  1RSC A;  1OPI A;  1SI9 A;  1S6O A;  1OYD A;  3GJS B;  4LVO P;  3QGG A;  2JL9 A;  3KG4 A;  3ZO7 A;  4PQU A;  4C7Q A;  2A0F B;  1N5T A;  4NA3 A;  4KH0 B;  2ZOM A;  5KG5 A;  3VAJ A;  4PR6 A;  2NCK L;  1NJW A;  4E2F B;  3W64 A;  3T1H F;  2NUU G;  2V50 A;  4C0B A;  2ZH6 A;  5LMN F;  4OYX A;  4DXL A;  2F3J A;  2AYB A;  3KLI A;  2L48 A;  4ZS6 A;  1T7P A;  1F2H A;  5BR8 F;  2KB2 A;  3QWU A;  1VLY A;  2HHT A;  1RBL A;  4ZPA A;  1V9O A;  1LQ9 A;  2M0G B;  5DGB A;  1XER A;  3W2V B;  1LXJ A;  2CG8 A;  3QIP A;  2CPI A;  4I2Q A;  3G6E S;  3N0V A;  4ALZ A;  3PYE A;  4LF9 J;  4JI2 J;  1ZOT A;  5HVH A;  2WB1 D;  1RT1 B;  3R9L A;  5I42 A;  3HHN B;  1WTB A;  1SL2 A;  2GVD B;  1VQ5 S;  3C14 B;  4UOG A;  3EE3 A;  1TKZ A;  3KHL A;  4DS4 A;  2AEF A;  3I0R B;  2DGX A;  4NX9 A;  4V1A k;  2R7V A;  3IRW P;  2BW7 A;  2OKQ A;  4N76 A;  4C48 A;  4USU A;  2DNL A;  4Q0B B;  2RDD A;  3OUY B;  2QLX A;  3U7J A;  1F5C A;  1Y4Z B;  1UWB A;  4BDP A;  2JH3 A;  2UUT A;  4PUO B;  5JUM A;  5H9E J;  1OWX A;  3AD7 C;  4R25 A;  2CJX B;  1HKA A;  2CJQ A;  3SXL A;  4PXD A;  4DR5 J;  4K4S A;  4FVM A;  4QW9 A;  3QAT A;  3QQC D;  3X1L B;  1M1H A;  2XB2 D;  1HWI A;  1KLM B;  3N01 A;  3UCZ P;  3CO9 A;  3HHD A;  2XLJ A;  1S12 A;  4EBC A;  1FDD A;  4ED2 A;  2BQU A;  4DG1 B;  4ELV A;  2HVI A;  4TY8 A;  3V4I B;  3WHI A;  3N6L A;  5L8R C;  4DU8 A;  3FEZ A;  3TEG A;  5J2Q A;  4NOH A;  1SL1 A;  4AL6 A;  2DCL A;  2IPO B;  2ASJ A;  4KGZ B;  4M5G A;  2J9E A;  2Q43 A;  4X64 J;  3N79 A;  2XYH B;  4FYD A;  1D9A A;  3PCO B;  4AMN A;  4LF4 F;  5DLG A;  3TO8 A;  1DQ9 A;  3NWG A;  3I96 A;  2OPS B;  3DGP A;  2YQ0 A;  1REG X;  2JWN A;  1WDD A;  1FNO A;  1S6P A;  4ELU A;  3IG1 A;  4DFJ A;  2CG4 A;  3VTI A;  4Y28 C;  4CT8 A;  4WXW A;  4PXE A;  1UVL A;  1QAJ A;  2HIQ A;  4EBE A;  3DM2 A;  4F4Y A;  4OYA A;  3L09 A;  4YUD A;  2KJV A;  1UAW A;  4PPD A;  1P9Y A;  1SKS A;  4ZPD A;  1TL1 A;  4F4K A;  2XQC A;  4A8Y A;  2M3D A;  3I9V 9;  4GO5 X;  2WK4 A;  2FGO A;  4OHV A;  4DHV A;  3UVJ B;  1DBD A;  3JQJ A;  1RDR A;  1WHY A;  5I3U A;  4PYD A;  2YWG A;  2KHC A;  3R6L B;  4HVZ A;  4F4X A;  2XMJ A;  4DV5 F;  2GQQ A;  1VC5 A;  3NMR A;  4ZVG A;  1QAX A;  4AQY J;  3TQ1 A;  4ZCK A;  4OHW A;  2VF3 A;  2GJF A;  2YKN A;  3SCI E;  2E1A A;  3VAI A;  4LSL A;  4OYP A;  4RO0 A;  4F3M A;  4HHJ A;  2XO6 A;  1MU2 A;  3ETM A;  2ALZ A;  4WF9 Q;  2HSE B;  3ILJ A;  3LH2 S;  3C6T A;  4M1K A;  5CZX A;  4OX6 A;  2JLE A;  2BE7 D;  1VC6 A;  4WFN Q;  2CWK A;  1HWL A;  2FY1 A;  2ZDO A;  2UU9 J;  1S1V B;  2LEP A;  5H1S V;  3EIC A;  3PIP Q;  4KV8 A;  4TNO A;  5A2Q U;  2HHS A;  1CJU A;  3MED B;  3PHT A;  3CCU S;  3NS5 A;  4I7F A;  4WCE Q;  3DRP A;  2UXD J;  4WTY A;  3DRY A;  1HMV A;  2GIR A;  2ZZN A;  2KU7 A;  1JLG A;  2IJF A;  3UD3 P;  1M90 T;  1HHT P;  2I6W A;  3BH6 B;  2M8D B;  3HSJ A;  2D7S A;  4AE5 A;  2VQE J;  3PYF A;  4CCH A;  3KLH A;  1UA1 A;  2FJA B;  3DYA A;  1G4C A;  1D0E A;  3KUG A;  3RGI A;  1RCO B;  4X66 J;  3DLG B;  3K5N A;  1WEZ A;  1TKD A;  3F56 A;  4TU8 A;  3BF4 A;  3S01 A;  2MKI A;  1UVJ A;  5AJ3 J;  3UR0 A;  2FPH X;  2RF2 B;  3FQK A;  3GWC A;  1XNR J;  3DCA A;  4NRU A;  4RPF A;  4J91 A;  4EFA C;  3C46 A;  1F9F A;  3LW5 C;  3CJ0 A;  3B4D A;  3A4T A;  1PJ7 A;  4AD6 A;  1FTC A;  1MWY A;  1S48 A;  2DD8 S;  3J81 Y;  4JYA F;  3L7O A;  3RRK A;  2LMI A;  2FJW A;  4HT7 A;  5LXR A;  3TOQ A;  3N28 A;  5AE1 A;  1CVJ A;  1VQN S;  5EWF A;  1TVR B;  1LW0 B;  4YDD B;  3Q8U A;  4UQT A;  1S6Q B;  2UXC F;  1N33 F;  2V6A A;  4OZ0 A;  2YH1 A;  3GJR B;  5IT9 Y;  3BSC A;  2B4P A;  3JSB A;  2MZ1 A;  4DN0 A;  4UZC A;  2ASY A;  1C1B A;  1S1X B;  2XTJ P;  3LPE A;  2PEH A;  1IWA A;  2QYG A;  2BAN B;  1HR0 F;  1EIY B;  3MFH A;  2DIT A;  3KMS A;  2O3D A;  1WD6 A;  2D69 A;  2RIJ A;  3DI6 A;  5KFM A;  2DEJ A;  1JLF B;  3OTO J;  3GMG A;  4O23 A;  3ZZY A;  4LT6 A;  5IC6 B;  8ATC B;  2C3O A;  4TYA A;  1FX2 A;  3A3O B;  4KKO B;  3ULH A;  2I2Y A;  2ALY B;  4YFU A;  1QSL A;  1FX4 A;  3D9B A;  2PGC A;  2WRM A;  3CDW A;  1H38 A;  3THT A;  2QMW A;  1SPB P;  4X4O A;  2AQ4 A;  2H4W B;  4RW6 B;  1HHQ A;  1ZAX A;  5HRO B;  4CO4 A;  1KNZ A;  2DNK A;  1S1W B;  2JFD A;  1YVF A;  4ITS A;  1WDT A;  1JJ2 R;  1WKJ A;  2Y8W A;  3GSD A;  3MFI A;  3F44 A;  1H7X A;  1J5O B;  2UVU A;  2OIH A;  3EGN A;  5D3G B;  4RBU A;  3IBW A;  4EZ9 A;  2BJE A;  1FFW B;  5E7O B;  5GAE I;  4IOC Q;  4XO0 A;  4DV1 F;  2VDI A;  4FS1 A;  3LP1 B;  2QTW A;  3CC7 S;  4JI6 J;  2MPU A;  1KKH A;  3ZTQ A;  4DV4 J;  2MKY A;  5F8M A;  2DR8 A;  1RTD B;  3MMB A;  4DQS A;  5F41 A;  1L3V A;  4K4U A;  4TLQ A;  1NXI A;  3M8R A;  1A7G E;  2CNO B;  4PAA A;  2LYV A;  2AGO A;  3PM9 A;  5HMY A;  4KHR A;  4M5K A;  1KQG B;  4ZJQ A;  1OIA A;  4IQX A;  1HWK A;  1KLN A;  3LA0 A;  1Q8K A;  2CQ3 A;  1H2U X;  3IRX A;  2R8J A;  4U8Y A;  1NBE B;  1VK3 A;  5SUH A;  2G0J A;  3HCX A;  3PIO Q;  1ZTW A;  3EMT A;  4OLP A;  3I0S A;  3EYZ A;  1IM6 A;  2EK6 A;  1RTH B;  1OY9 A;  3CC4 S;  1IKY A;  1XMO F;  2LVW A;  3M6W A;  3U27 A;  4RW4 B;  4FF3 A;  4YN3 B;  1U4B A;  4DFK A;  1ZAW A;  1S0V A;  2EFO A;  1HNW F;  1JX4 A;  2V5H G;  2N3O A;  1DLO B;  2UUA F;  2BVZ A;  1MN9 A;  3ADA C;  2QMX A;  3QJJ A;  1T11 A;  1KN6 A;  3IS9 B;  3E51 A;  4DZ6 A;  4NML A;  4EYH B;  3Q8R B;  2G0C A;  3WC0 A;  3CCS S;  3PEH A;  3C3L A;  2F65 A;  2W2Q P;  3D1O A;  1Y10 A;  4FKX A;  3DLE B;  4M63 A;  4ZOS A;  3OFH A;  1DUR A;  3KK3 B;  5E3C A;  4LMZ A;  1ZM2 A;  3G96 A;  2J6T A;  1HBN A;  1X5O A;  2X51 A;  2I1R A;  2RVJ A;  5CXT A;  1N6Q B;  3FCV A;  4P52 A;  2IM0 A;  2V4Q A;  5EN1 A;  4MKV A;  1RAC B;  2B6A B;  4DLG A;  3SQG B;  1N52 B;  1H2T Z;  2DPI A;  3GFZ A;  5CAA A;  4DWI A;  2YWW A;  4HHU A;  4KFB A;  3O5T B;  3NP5 A;  2CNL B;  1GFW B;  3LOU A;  3MAH A;  3ZTO A;  3I5A A;  3CUL A;  3O2I A;  2H9Z A;  3C15 B;  4O4G A;  1VIX A;  1XNQ J;  2HQI A;  4K4W A;  3QT8 A;  4O3R A;  4OIX A;  3CC2 S;  3R7B B;  3VVT A;  2AX0 A;  1RT5 A;  4MKB A;  2MKH A;  2RQM A;  4USH A;  4ECU A;  3T1H J;  2DGW A;  1N5Y A;  3RRH A;  3ITH B;  2F4V F;  1LV5 A;  5FLX U;  3DHW C;  4FS2 A;  2B43 A;  3G8S A;  2CZ4 A;  2BJ3 A;  4WFZ A;  3OXF A;  1EX8 A;  3LP0 A;  3TWZ A;  1UJ6 A;  4NXN J;  1S76 D;  3AB2 B;  4L75 A;  2WW8 A;  1WI8 A;  5KFQ A;  2ZH4 A;  3DOK B;  4NLO A;  3ZTS A;  3L9Z A;  2HNY B;  4C8L A;  1VDH A;  1HI0 P;  4J90 A;  9ATC B;  4PAB A;  1AUS L;  3U1N A;  3QJL A;  5B0G A;  3Q23 A;  4L3K A;  1WC1 A;  1WOR A;  1KC8 T;  1G1X A;  3A8I A;  3ILL A;  3VQS A;  2V2Q A;  3E2E A;  1F3V A;  1S57 A;  3NXZ A;  4USI A;  2ZVI A;  4DL6 A;  2VC1 A;  2WBM A;  5MAO A;  3P4U B;  5A8W B;  1DTT B;  4USM A;  1K1Q A;  3HVT B;  4GVB B;  2WVD A;  8AT1 B;  2MTL A;  1TK8 A;  2IVF B;  3C66 A;  2IA6 A;  3FQL A;  1B0V A;  4IH6 A;  5A2Q Y;  1S49 A;  2GHV C;  1D3W A;  2DIS A;  4B9M A;  2WW4 A;  5CZV A;  4KGM A;  1RT3 A;  2RQC A;  3HVR A;  4C8N A;  1JIH A;  1MG7 A;  4XAK A;  2N4C A;  4JI5 J;  1HNZ J;  3D68 A;  4F4Z A;  1DQ8 A;  3CCR S;  1NDP A;  4LSN A;  1UET A;  2XS7 A;  2XMM A;  1NJI T;  5DQG A;  5DGA A;  8RUC A;  2QFI A;  2G0I A;  4OLO A;  3UN2 A;  3P5B P;  4LR9 A;  2GNK A;  4NLT A;  1NLK L;  2PDA A;  3A8E A;  3WC2 A;  1U1O A;  4BCA A;  2ROG A;  4Z37 A;  1GX5 A;  5ETK A;  2O66 A;  2XMW A;  5J2M B;  3B54 A;  3GFH A;  1EJ7 L;  1Q53 A;  1WF1 A;  2I9S A;  2R7Q A;  4P2M A;  4C2M A;  1NH7 A;  5KT6 A;  3HP6 A;  3DLK A;  3LAM A;  2DNO A;  2QSW A;  4ZP8 A;  1TKX B;  5AXN A;  2YNG B;  2AHO B;  1JMT A;  3X3U A;  4L76 A;  4HAC A;  1QY7 A;  1XK8 A;  2OPR B;  2N7Y A;  4X62 J;  4PWD A;  3IMQ J;  2HBQ B;  2YX7 A;  3T1A A;  2IBK A;  4OJH A;  1WAC A;  4IQM A;  2QZ8 A;  4EU0 A;  1RYS A;  1IM4 A;  1YX2 A;  1BWV A;  3WIU A;  1APS A;  4KHP J;  4MFB A;  3MCS A;  3SV3 A;  5D4P A;  2BOP A;  3DRR A;  3C6U B;  2N4D A;  3CB4 A;  4DX7 A;  1LW2 A;  1XR5 A;  3TYT A;  5GAD U;  4DV6 F;  4NCG A;  1H73 A;  1FJG F;  1PJ5 A;  1HNV B;  2I5J B;  5HMW A;  1NK6 A;  3TNV A;  1P9Q C;  4DSF A;  3MTJ A;  4XDC A;  3NCP A;  1OJ4 A;  4NCB A;  2QA1 A;  2B9W A;  2CQ0 A;  2QLJ B;  3DLB A;  2HZA A;  1F6T A;  4F0K A;  2MB0 B;  4P72 A;  4LF7 J;  1OY6 A;  2VL1 A;  2W4P A;  1CJK B;  5D0H A;  1H72 C;  5IC4 B;  3DXB A;  3H2U B;  2KKH A;  2G1H A;  4U96 A;  5KFE A;  3L7P A;  1MMD A;  5B0D A;  5E5N A;  2C3P A;  2R42 A;  3CO0 P;  4Y3C A;  3JSR A;  3GYX B;  3UDV A;  1Y0H A;  4H4K A;  3FNN A;  1JLC B;  2XY5 A;  1VQ7 S;  4PG7 A;  2A1B A;  3DU5 A;  3PW7 A;  4IRK A;  1VRT A;  2VA3 A;  3NEK A;  5CCL A;  2CIM A;  4PG4 A;  2QLB B;  4ZLP A;  5HK4 A;  3GFX A;  4NZ0 A;  5KFG A;  5KTQ A;  2C2M B;  4OZ3 A;  5C2C A;  3MM8 B;  4I2P A;  3HD2 A;  1G2E A;  2BQR A;  3AFG A;  2OML A;  3AD9 C;  1LEO A;  3I4H X;  2IVY A;  5D4L A;  2JDJ A;  1X0P A;  2QEX S;  2HAF A;  1PC4 A;  4WFA Q;  2R7T A;  4RU9 A;  4HYK A;  4UY8 5;  4TU9 A;  3M30 B;  2X3D A;  2HMI A;  4ER8 A;  1BQN B;  4M5N A;  4BS2 A;  3QSI A;  1FHT A;  1RT6 B;  3U02 A;  5HP1 B;  1HQE A;  1U25 A;  4ENO A;  2QO3 A;  2EFV A;  4JYA J;  2KVI A;  2IAJ B;  3VGU A;  3DU6 A;  3HHL B;  2MGZ B;  3A3N B;  4K4Z A;  4CO3 A;  3HPO A;  3Q89 A;  4DV3 F;  1N33 J;  3ET6 B;  3G82 B;  3AOA A;  2V94 A;  4MYT A;  4DPT A;  1CJT B;  1WF2 A;  1FJE B;  3MEG B;  1YZ6 A;  4RUH A;  4JV2 A;  2EFQ A;  3J7Y U;  2Z58 B;  4R8U A;  2UUC J;  2E66 A;  2HFO A;  1WC0 A;  3OTC A;  2I0X A;  3SFU A;  1BLU A;  3QT5 A;  2BAB A;  4L3N A;  3NGS A;  4ZHR A;  1HNI B;  3PTW A;  3D0I E;  1Q82 T;  2KM8 C;  2LCW A;  3UWT A;  4I4B A;  2ZD1 A;  4IO1 A;  4YME A;  2OPP A;  2RHQ B;  1Q78 A;  3IBF B;  1HW8 A;  3LAK A;  4CWB A;  1F5B A;  3ILI A;  4ZLN A;  2HW3 A;  4OI6 A;  1NSP A;  1NEE A;  4DPO A;  1SCJ B;  1JQG A;  1K44 A;  2MYF A;  4DR4 J;  2NXC A;  4W92 B;  3HSG A;  1IWG A;  4M5H A;  1NK4 A;  2R7U A;  2EK1 A;  3OV7 A;  4ILL A;  5FLX Y;  3FRY A;  3FVY A;  4H4K C;  1B99 A;  1VQP S;  4DV1 J;  2DHX A;  5KFW A;  2CPH A;  3PW2 A;  2Y8Y A;  3OL9 A;  4C0O C;  3GIM A;  2K8G A;  4R5P A;  4LFA F;  2XSF A;  2ASL A;  3KK1 A;  3M1V A;  3QRR A;  2F8M A;  2LQB A;  2MKC A;  3CCQ S;  2IY5 B;  2C2O B;  1E6Y A;  4WE1 B;  2VG5 A;  1IBM F;  3B6B A;  4J9S A;  4TXS A;  1ULR A;  2CQ2 A;  3W61 A;  3WX8 A;  4KC5 A;  4DV7 J;  2W7A A;  3M8S A;  4PYA A;  2FYX A;  4LBH A;  2D9O A;  3BGU A;  3FK4 A;  3DRS B;  1S1T A;  4YB5 A;  3QO9 A;  2ZHO A;  2AEJ A;  1LWE B;  4UUX A;  3HHL D;  1N36 F;  3AHP A;  1TUG B;  2N82 B;  3BS9 A;  5L46 A;  2WZ1 A;  1ZM4 A;  3TAM B;  3VGS A;  2DO0 A;  4FF4 A;  5B7W A;  2PSZ A;  4TKT A;  1ACM B;  3RBD A;  4HI2 A;  1AB8 A;  1T05 B;  2FLP A;  1EP4 A;  3V2U C;  2DK2 A;  2DR5 A;  4O3S A;  3NY0 A;  5K14 A;  4HHH A;  4LR8 A;  4H4M B;  3CNQ P;  1CS4 A;  2IIH A;  1HNW J;  3K89 A;  4YR3 A;  2UUA J;  3TAP A;  2XWY A;  4RL1 A;  4MK8 A;  3KK2 B;  1FKP B;  3J7Z T;  1AFJ A;  1X4H A;  2VJU A;  1VBY A;  2V9W A;  1U0H B;  3NNH A;  2WSC C;  3FJ2 A;  3LF0 A;  4JI1 F;  3Q8V A;  3HT0 A;  2J9D A;  1CJV A;  4ZDN A;  3MR5 A;  3MMJ A;  3NWR A;  1PGZ A;  2YNI A;  4PG8 A;  4ED5 A;  1FWK A;  1RTJ B;  1ROF A;  1PBU A;  4NEZ A;  1WJ9 A;  1VJW A;  3L95 X;  1KOH A;  5HBM A;  1AA1 B;  2KT2 A;  1RA6 A;  5DG7 A;  2DB1 A;  3GSI A;  3VAM A;  1NB2 A;  1H0H B;  3US5 A;  2ZM6 J;  2VZ8 A;  3SDE A;  1NPK A;  2O1P A;  2QRR A;  3ZZ0 A;  1DQA A;  3OR1 B;  2C3Y A;  4QYZ K;  3C16 B;  1Y9O A;  2M7S A;  5FDL B;  3K0J A;  5F9N A;  4JI3 F;  2MKJ A;  2J7K A;  4UOC A;  1GT8 A;  4NXM J;  2E9R X;  4A8X A;  2VHG A;  2YVS A;  4USJ C;  1WSV A;  4F3O A;  1TV6 A;  2F4V J;  3KG1 A;  3OTD A;  1N54 B;  1SJQ A;  2LKZ A;  2FIU A;  5B0C A;  1YQH A;  5GVQ A;  1U1Q A;  3KLE B;  3MM6 B;  2KXF A;  2W01 A;  4NL5 A;  4LBP A;  4DR3 F;  4DR2 F;  3CME S;  2AGQ A;  2DXD A;  3MAA A;  3RAM A;  1GK8 A;  1OSD A;  4NI2 A;  4K4Y A;  1U7L A;  2DHA A;  3ISN C;  1K47 A;  5DET A;  1VOM A;  1P27 B;  3VAG A;  2R2T A;  4DFP A;  1X9S A;  5DJB A;  2AYE A;  4CLS A;  1TL4 A;  2W25 A;  4C11 B;  1OSC A;  3QRQ A;  3I56 S;  2J7U A;  1OQ6 A;  2VPW B;  5B09 A;  4ZPW R;  2GVZ A;  4F2R A;  2C1E B;  1HW9 A;  3S8S A;  1C4C A;  2NXJ A;  1RAG B;  2A2D A;  4CYU A;  4JBC A;  3P49 B;  3UD4 P;  3RUB L;  3H2V E;  3RAQ A;  4KO0 A;  1TL3 B;  3M32 A;  3T9N A;  4M5D B;  1R7I A;  4DUT A;  5ITH A;  4MK7 A;  2CA9 A;  4LF2 A;  1RHR B;  2FVQ A;  4A8M P;  3J80 Y;  4EO6 A;  1DTQ B;  1SH2 A;  2BE2 A;  2D9P A;  2WON A;  2CPX A;  1N56 A;  3SQO P;  2FHK A;  4XIU A;  4JI7 J;  2VD3 A;  1M5K C;  5C25 B;  3M2U B;  2XNQ A;  5E0O A;  1S9G B;  1X8D A;  3M8P A;  1U6F A;  3UO0 A;  2YKM B;  2M5Y A;  5CHC B;  2O5D A;  2Y1L B;  4CLZ A;  3A12 A;  2D3O R;  1NND A;  1BWE A;  4YQW A;  1VIS A;  2CPE A;  4FNI A;  3FCH A;  1SJR A;  1Y3J A;  4OYM A;  1J2V A;  2AEM A;  4OZ5 A;  1LOU A;  4UZB A;  3BQ1 A;  4IG3 B;  4ID5 B;  3VV2 B;  3H59 A;  1B7Y B;  1S99 A;  3CIM A;  2OTJ S;  2IYG A;  4J9P A;  2CJY B;  2P8I A;  4C97 A;  4RW8 B;  4FYV B;  2J8S A;  2EC0 A;  2VIC A;  5LL6 d;  2LEC A;  2WB4 A;  1FRX A;  1YBU A;  2JLF A;  3I4P A;  3MMC B;  3SBM A;  2XYG B;  3UN5 A;  1CUL B;  1JKH B;  5K8P A;  4B3M J;  2MQQ A;  5F3T A;  1RBO B;  1FD2 A;  3TX0 A;  1X4E A;  3KLG A;  1T9T A;  1SC6 A;  3TI0 A;  4GC6 A;  4CLY A;  2K06 A;  2B7C B;  1RJJ A;  3HFV A;  2VC0 A;  3CJ2 A;  2ILY A;  2MMY A;  3NGD A;  2HZV A;  2H1Y A;  2RRA A;  1U45 A;  3W2V A;  1SKW A;  3OPK A;  3RTV A;  4C4W A;  1MWZ A;  3IAS 9;  2NUH A;  2BRL A;  2C2K B;  3WZ0 A;  3RB0 A;  3JSM B;  3OTB A;  1R27 B;  1SIZ A;  3EDQ B;  1PAE X;  4Y0F A;  2B9Y A;  1RAJ A;  3PEJ A;  3C14 A;  4CNY A;  4BLG A;  4F67 A;  2QE5 A;  3TZX A;  1WKL A;  1FER A;  4JI4 F;  1XJW B;  4B9N A;  5KT3 A;  4LF1 A;  2AP6 A;  4Q0B A;  3RJM B;  2GO8 A;  2CQB A;  4PQU B;  1Q8B A;  4KPY A;  3KNA A;  2HZC A;  5H9E K;  2F40 A;  2NS1 B;  2MJN A;  4ZCI A;  1S79 A;  4PUO A;  2CJB A;  1N34 F;  3MDF A;  4GKJ F;  4C8Z A;  4CLL A;  3CD5 A;  3H5X A;  2UV8 G;  1KS2 A;  2YNF A;  4MKY A;  2XCA A;  1V3S A;  1V6H A;  1YG0 A;  4K4X A;  3RRG A;  2BKN A;  3IR6 B;  3K59 A;  5E3Q A;  1I51 B;  1S97 A;  1FXR A;  2QJ3 A;  2AT1 B;  4WK1 A;  4DG1 A;  2UV8 A;  1FE0 A;  3HXM A;  2W2N P;  2HRU A;  2EBE A;  2CDQ A;  2WVE A;  3GZ7 A;  5HAO A;  4WKY A;  4DV2 F;  2MKK A;  5I4M A;  2IA0 A;  5DQI A;  1HNX J;  1M0S A;  1DY3 A;  1IXK A;  1JB0 C;  2HYI B;  1UPM B;  2V63 A;  3HHE A;  4ES1 A;  3PX6 A;  3W5X A;  2HFV A;  4OI1 A;  1U2C A;  1NU4 A;  1MMN A;  2EVZ A;  4IUF A;  3PG9 A;  3PR5 B;  1FRL A;  2OPS A;  2PA3 A;  3P3D A;  3GP9 A;  4F50 A;  1UTA A;  1U0S A;  3D54 A;  1Q5V A;  4RU2 A;  5CZC A;  5K8O A;  4N5S A;  2B9X A;  4DSE A;  4RZR A;  2IHR 1;  1UWB B;  4K0K F;  3C2P A;  4AXJ A;  1H3D A;  1NZA A;  2HLT A;  4J7C A;  3MI7 X;  1ZA2 B;  3I5B A;  4ANE A;  4YB6 A;  2IM2 A;  3JTN A;  4DV3 J;  2H5J B;  1W7W A;  4WU3 A;  3CJS A;  4F0M A;  4NLY A;  4QWC A;  4DCO B;  2K3I A;  5ETR A;  2AJ4 A;  1VBZ A;  4ZPV R;  1T9X A;  1KFD A;  3H0P A;  3FFI A;  5HMX A;  2D3Z A;  4TY8 B;  2HBY B;  5L1I A;  1H74 A;  5T41 A;  4RX6 A;  1NKC A;  3FZ2 A;  1YK9 A;  3GIL A;  5J2Q B;  3QRP A;  5C7P A;  1RE1 B;  2ZZM A;  2UUW A;  2DNZ A;  2CAJ A;  1IKX B;  4QPX A;  1N0U A;  4ERD A;  1FXD A;  2GO9 A;  3D2W A;  5DDQ C;  2OJ3 A;  4LRF A;  3CCM S;  1T9Y A;  1NJY A;  1Q79 A;  4LFC J;  2CUY A;  1RWV B;  3BQ0 A;  1FXL A;  1S4F A;  3DGP B;  4QU7 A;  3ENV A;  1U6Z A;  1S6P B;  2BBE A;  4ELT A;  3IG1 B;  5HVG A;  3PNI A;  2FJD B;  1HFE L;  2VQF F;  3ZC4 A;  4RUA A;  2KG0 A;  4U7U D;  3Q8Q B;  3WX4 A;  4YHH J;  5EX3 A;  3CJ5 A;  3DM2 B;  5BXI A;  2QGF B;  3VQT A;  4C8O A;  1L3S A;  4HH1 A;  2R7S A;  4S0M A;  4RNO A;  2V9K A;  3VF0 B;  2FC8 A;  4MIA A;  4OX7 A;  5DDP C;  3LTO A;  3MED A;  3MPD A;  2BE9 B;  4OHY A;  6FDR A;  3BZQ A;  2IVM A;  1AW0 A;  2KZM A;  4X4U A;  4QJV A;  3NGU A;  3SIP B;  5ADZ A;  1R8C A;  5EX0 A;  3FZB A;  1UW9 A;  2JJ4 D;  4KJI A;  1QUP A;  2YX4 A;  3RU0 A;  4LFA J;  1F9E B;  3R2C J;  5F8H A;  4B17 A;  2WVF A;  2BM0 A;  3PYG A;  3TJ8 A;  4PQA A;  4F7V A;  2QA4 S;  5CA5 A;  3OFF A;  3VAK A;  2J6S A;  2YPZ A;  4WP8 A;  2MSS A;  1HYS B;  1T9W A;  2YKN B;  3OLB A;  1VI7 A;  1RAI B;  1HBO B;  1SQF A;  4YS2 A;  4A8K A;  2RF2 A;  3FC9 A;  2ZFH A;  4OV1 A;  4X4Q A;  3MZI A;  3VWS A;  3H4B A;  2GHW A;  1S59 A;  4KYZ A;  3W66 A;  3Q8P B;  2RML A;  1PYS B;  2R4F A;  3NCR A;  2OEJ A;  2JC0 A;  5A8R B;  4YR2 A;  1FK9 B;  3C6T B;  4DPW A;  3KDO A;  5F9L A;  3B4M A;  4AFF A;  4KGK A;  4GVL A;  1BE4 A;  3FKB A;  1NB7 A;  2ZOF A;  2R8K A;  1ZAV A;  1CC8 A;  3IWX A;  2M70 A;  1SXL A;  2R2U A;  3NRB A;  1CJU B;  5A76 A;  5CH7 B;  1IKV B;  1SH3 A;  4I6Y A;  1T02 A;  1TVR A;  3A1Y G;  1U2R A;  4MH8 A;  2W7P A;  5EDW A;  4C8Y A;  2J0X A;  1S6Q A;  2IJR A;  3RW6 A;  2XMK A;  4F25 A;  4NRT A;  2IC3 A;  1NHU A;  3OSP A;  1UVI A;  3HKZ D;  4FBU A;  1BUX A;  3EZO A;  3MR2 A;  5K5M A;  2DGQ A;  1S7I A;  2CVI A;  2MQP A;  3DYA B;  4LIW A;  3OSN A;  4W98 A;  2BAN A;  4A8S A;  4RW7 A;  3RBE A;  3POT A;  2EFP A;  2ZVS A;  2P9C A;  2D74 B;  1WG5 A;  1JLF A;  1CBK A;  4FXD A;  2PO4 A;  3ZZT A;  4KKO A;  4LFB F;  3OQ2 A;  1HPZ B;  4JOU A;  3OT9 A;  1IQZ A;  4K59 A;  4WXO A;  1GX6 A;  1BQM B;  2LDI A;  4EBD A;  3EVM A;  2JX2 A;  3KWM A;  4RW6 A;  3H42 A;  1RT2 B;  5DQH A;  2UUB F;  3EZ5 A;  1S1W A;  3Q2S C;  4F3Q A;  2CPY A;  1ZM3 A;  4RNH A;  4GO7 X;  4JI3 J;  5GAD I;  3MPV A;  4DX6 A;  2ADC A;  4ID8 A;  1V3R A;  3P45 B;  1SBR A;  2L9W A;  5D8H B;  5DZ7 A;  4JV0 A;  2V4J B;  1O5J A;  3IR5 B;  2B4V A;  1S0N A;  3BR9 A;  3W62 A;  1IKW A;  1B0P A;  2Z4P A;  2KI2 A;  3LP1 A;  2HQD A;  1C1B B;  1RTD A;  4M5M A;  1J5E J;  4DR3 J;  5CYJ A;  4DSK A;  4WZQ A;  2E7V A;  3B8H A;  1QSS A;  3JB9 k;  2H5I B;  4ZMM A;  1FT8 A;  2DH8 A;  1U1K A;  1PG5 B;  1REV A;  2AWZ A;  2VDH A;  2PI4 A;  2IMO A;  4DPX A;  2ZC4 A;  1URN A;  2P9E A;  1K1S A;  3U1L A;  3G6Y A;  4QYZ J;  3KJV A;  5KFJ A;  1YJ9 S;  3D66 A;  3K5M A;  4ZCL A;  2PFD A;  2NLW A;  1HD0 A;  2UVW A;  4NPO A;  3M7V A;  2VJV A;  3UCU P;  3P6Y C;  4O3O A;  1G6B A;  1XMQ J;  1T0T V;  4RW4 A;  3QWP A;  3MM9 A;  4AMM A;  4P74 A;  3W5Z A;  4Y34 A;  4OJG A;  3WDO A;  2XNR A;  1O6X A;  1DLO A;  4HDH A;  2VV5 A;  2CPJ A;  2FZK B;  2BOA A;  3BBC A;  1M5S A;  3G71 S;  4MT1 A;  4QOT A;  4XK8 C;  5A0Y A;  3BO2 A;  3MOJ B;  3N6M A;  3OLA A;  5HAN A;  2A10 A;  2AYG A;  4OYZ A;  4X84 A;  4J9R A;  1LWF B;  3PW5 A;  3H98 A;  2RAQ A;  3DLE A;  3OVB A;  5KFO A;  1BMQ B;  3TJA A;  4O3P A;  1S1U B;  4BC9 A;  2RSQ A;  3CJQ A;  3UE2 A;  4CO0 A;  1DRZ A;  2E5L F;  1EKS A;  4WWS A;  5JVG Q;  4K4V A;  1QSY A;  4NZ7 A;  1RLC L;  2J8A A;  4HKQ A;  4DCJ B;  4N56 A;  2WOM B;  4K8R A;  4ES2 A;  1HAR A;  1UEK A;  2R8G A;  3V6D B;  2XI3 A;  2DJW A;  2GZO A;  3R5D A;  2ZUA A;  4RKU C;  2CRL A;  2O67 A;  3M2V B;  1YSJ A;  3J7Y I;  3SZ2 A;  2HGM A;  4IRC A;  3VCD A;  4OZ1 A;  4WFY A;  4DUY F;  4KTQ A;  4ZLL A;  2HQ3 A;  3MTK A;  1SVD A;  1S9F A;  3BGO P;  2HAI A;  1Y5I B;  2CQ4 A;  2B4O A;  3BB5 A;  1RKI A;  2ASD A;  1ARO P;  4RBT A;  4NLV A;  2QLF B;  2APO A;  3ITH A;  4ZP7 A;  1HBU B;  1ZM9 A;  2BMB A;  4B3T F;  2R2S A;  3UCG A;  3THP A;  2EI5 A;  3MD3 A;  3W5Y A;  4RWX A;  3MR6 A;  3H7H B;  3W63 A;  2XS2 A;  3GQC A;  4RW9 A;  1YJU A;  4G1Q B;  3RZA A;  2HNY A;  4HEA 9;  5KG6 A;  1U1L A;  2ZBP A;  3A13 A;  4CT9 A;  3I9Z A;  3CD6 S;  2BJD A;  1HBN B;  3NL0 A;  1T3N A;  3E01 A;  4LF8 F;  1SC3 B;  1NKE A;  3ENQ A;  3LPY A;  4J9M A;  1TEL A;  5LSO A;  1NUE A;  2XYP B;  2E1M C;  5ETT A;  2ZKT A;  3DMJ B;  2JEG A;  3J7A 1;  5LSL A;  5M2R A;  2Z8Q A;  4IR1 A;  3DOM A;  4O44 B;  2W9A A;  4H4O B;  4FBT A;  4XPE A;  1XIQ A;  3DRX A;  1AYE A;  2D3U A;  3V81 A;  2DHG A;  1DTT A;  2HQF A;  4H54 A;  5D77 A;  2HRY A;  3HVT A;  1ELO A;  4OJ1 A;  4NMX A;  3LO3 A;  3KHH A;  2XS5 A;  2RDJ A;  1J27 A;  1PKU A;  1S7H A;  2DHS A;  5HVF A;  3K17 A;  1N5Y B;  2K2P A;  4P75 A;  2RH3 A;  3T1Y J;  2IBO A;  3K5O A;  3V5R A;  1M1G A;  2CPZ A;  4DFM A;  5EGY A;  4USW A;  3LP0 B;  1GNK A;  4ECW A;  3MPY A;  2ZIT A;  2RRB A;  3IM8 A;  4F0H A;  2OMO A;  5D0E A;  1VJQ A;  2YWF A;  2LLZ A;  4DV2 J;  2EBG A;  1RKJ A;  5A6W A;  3CTR A;  1RQ0 A;  4K2J A;  1PYT A;  1NPP A;  2E9Z A;  2VB6 A;  3IR7 B;  1RZM A;  4ECX A;  2WSF C;  4PXB A;  1P6T A;  4ECY A;  2X1G A;  2ZOG A;  2ZJQ Q;  1E6V A;  1TAU A;  5F8J A;  1F3F A;  5KFV A;  3UNG C;  3LAN A;  3MAQ A;  1L3K A;  4DUZ F;  5J1N A;  2F7V A;  2G1D A;  1S9E B;  2QV6 A;  1WC4 A;  1AT1 B;  2YNG A;  2DRB A;  4QU6 A;  4L73 A;  2HK3 A;  1RT3 B;  4QWE A;  2GX8 A;  4F8R A;  5DDR C;  1TFY A;  3KOA A;  2GQ2 A;  1YKW A;  4IKA A;  1KHV A;  4OHX A;  2R8I A;  3LUY A;  1JLQ B;  1IR0 A;  1WKK A;  4QWD A;  3BQ2 A;  2PMW A;  3PRV A;  1Q4R A;  4ZVU B;  1GMW D;  2LP4 A;  3AXM A;  2XZT B;  2JC1 A;  3C6U A;  4D3G A;  1TK5 A;  2XLI A;  5FD1 A;  3E3X A;  2IM3 A;  3PR4 A;  5KT4 A;  3ZTR A;  4DCP B;  2MEW A;  1FCA A;  1RHJ B;  4EEY A;  2HHP A;  1HNV A;  2DO4 A;  5F3Z A;  3PAC A;  1R8A A;  4GKK F;  1Z4U A;  1TAQ A;  2ZBR A;  4KIA A;  3TQE A;  2ZH7 A;  4M5J A;  4X65 F;  4QWA A;  2MST A;  3UDC A;  2R2R A;  3UI3 A;  4PRF A;  1VGY A;  2RUS A;  3K5L A;  4C3M A;  4MK9 A;  2M9K A;  4Q2M A;  5IT4 A;  3DLK B;  2GML A;  1Y00 A;  2HWT A;  2QMU B;  3CCE S;  2Z2L A;  5IQ6 A;  2NXE A;  3BR8 A;  4ZIW A;  1ZPW X;  2C2Z B;  2VQF J;  2OFH X;  3G8Q A;  3LGH A;  4HAC B;  4ZVR B;  3PX4 A;  4PWD B;  2MZT A;  2UXB F;  5B08 A;  1JLA A;  3AJ1 A;  4UST A;  2B0G A;  2L08 A;  2OUG A;  1M5V C;  4OX8 A;  1UEU A;  5H9F J;  1S6U A;  3PW0 A;  1RWX B;  2H48 B;  5KFY A;  3DRR B;  4ZVP B;  4ECS A;  3OXG A;  5G0R B;  3MGJ A;  3CIZ A;  1SC1 B;  2GQC A;  1LW2 B;  4AND A;  3AJD A;  4NCG B;  4EZ6 A;  1WEY A;  4I69 A;  3HLU A;  4O4R A;  5D15 A;  1RU1 A;  4DR6 F;  5GAE U;  4P7T A;  3M2R B;  1KR4 A;  4RNN A;  5IWA J;  4UW2 A;  4DF4 A;  4J9O A;  1LNQ A;  4ICL A;  1IR1 A;  4P9S A;  3RYL A;  3MM8 A;  4KPC A;  1FE4 A;  7AT1 B;  2P2C B;  1VQ9 S;  1SJ4 P;  4UF4 A;  3IP0 A;  3TUZ C;  2IRX A;  1JLE B;  2HFS A;  2F9J A;  2HLU A;  3ETO A;  2UZA A;  3A3P B;  4DPU A;  5B0B A;  4CTA B;  3B82 A;  4ZVQ B;  3M30 A;  1BQN A;  1YJN S;  2W2M P;  2AJ1 A;  2J0Q D;  3DC2 A;  5CYQ A;  2M52 A;  2MY7 A;  1RT6 A;  1XC9 A;  4J5O A;  5HP1 A;  2QC3 A;  1P1L A;  3MF5 A;  1U47 A;  2HHV A;  3DDN A;  5HLF B;  1U48 A;  3AQO A;  5F0U A;  5KFI A;  2J6U A;  1V5I B;  3KLF A;  2Z2Z A;  3TVZ A;  2MGZ A;  3T9Z A;  4ETZ A;  3GV8 B;  4CZC A;  5B0E A;  3VR1 A;  3QT6 A;  3C8Y A;  4DR5 F;  4O0N A;  3V4M A;  5A8K B;  1QTM A;  4A48 A;  1WUU A;  4IDK A;  4M8L A;  4HDG A;  2EEY A;  4W4M A;  5KFX A;  3CCV S;  4LUB A;  1SV5 A;  1ZPV A;  4DLE A;  2A3J A;  2HUR A;  3TA0 A;  4PXC A;  4CQ1 A;  4I2P B;  3BKT A;  3ZZO A;  1VQK S;  2NZC A;  3BPS P;  3L4B C;  1H98 A;  2CQ1 A;  3BDP A;  3F41 A;  5AXK A;  5JXS A;  2ZUG A;  1KQK A;  1VQ6 S;  3I55 S;  1S0O A;  5K8N A;  4NA1 A;  4X64 F;  3QLH B;  4EI2 A;  3OR2 B;  2HMI B;  2PII A;  1S77 D;  3HF5 A;  1VQ4 S;  4F02 A;  3MOZ A;  4C8M A;  1HQE B;  3IBC B;  5DM6 Q;  4JP8 A;  1RUS A;  2XBP A;  1T94 A;  2QFJ A;  2VOO A;  3R27 A;  1TUW A;  1QD1 A;  2LDY A;  2WAQ D;  2EG2 A;  3DNC A;  2FVS A;  3CMA S;  1R31 A;  2HHW A;  1K0V A;  4MIW A;  4Y2I A;  4X4V A;  1EAR A;  2QL9 B;  1R0C B;  1R8P A;  3IFE A;  3SSS A;  1URR A;  3QPI A;  2DR6 A;  4N8N A;  4CO5 A;  1EHW A;  2RIL A;  4QBU A;  2AYM A;  3UD5 A;  3I32 A;  1PO6 A;  2FC9 A;  2X1B A;  5CD4 A;  3A8K A;  5KG3 A;  5KFA A;  4DR7 J;  2PC6 A;  3G86 A;  3MM5 B;  4G1P A;  4Q7A A;  3OL8 A;  5KFC A;  4J9N A;  2EPI A;  1BY9 A;  2JEF A;  2C2N A;  3TW0 A;  4GMK A;  1I1G A;  3QAE A;  1Y7P A;  3KJQ B;  1RTI A;  3ZFV A;  3Q8S B;  4DR1 J;  1RT4 A;  3JQK A;  1FI4 A;  3H8Y A;  5CQG A;  1VCT A;  3HSZ A;  1LWE A;  2M4M A;  4NLG A;  2ZBQ A;  3ENW A;  2BKO A;  1UA0 A;  2OEM A;  3TP2 A;  1FKO B;  3G87 A;  5BYQ A;  4USK A;  2ZBI A;  2CZ9 A;  2FJX A;  2OPQ B;  5M2P A;  2AF6 A;  2HFZ A;  3TAR A;  4RNF A;  3R7N B;  3HO1 A;  2HIY A;  1TK0 A;  1XEZ A;  4RNM A;  1H6K X;  4ZVE A;  2G4B A;  4LR7 A;  4FZV A;  2JEJ A;  2HK2 A;  3KFW X;  3UQS A;  5A6P A;  2UXD F;  2QN6 B;  1U49 A;  1IBL J;  4WKR A;  1V3Z A;  1HQU A;  2AJF E;  2B51 A;  3KJF B;  5HSP A;  4I67 A;  4NAS A;  4DV0 J;  2BA9 A;  1N8R T;  2VQE F;  2OAU A;  2OFG X;  3M1V B;  4WII A;  2BV3 A;  1T03 B;  4KY3 A;  3MMA A;  2WBR A;  1HHS A;  4FP9 A;  3CCZ A;  5D0R A;  1FO1 A;  4KBI A;  2V68 A;  4I1T A;  1LWX A;  3CGI A;  2BZ2 A;  3ONQ A;  4FYX B;  3M8Q A;  2C3U A;  1RP5 A;  1RTJ A;  2E5L J;  4B3R J;  2DYA A;  3K57 A;  1MW7 A;  4B9S A;  1S1T B;  2XI2 A;  1I94 F;  1YBA A;  2CQP A;  4B9T A;  1XNR F;  3QZ8 A;  2POK A;  1RAA B;  5G4D A;  2BAC A;  1X4B A;  3FEY B;  3A8J A;  1TTH B;  4ZIV A;  5HMZ A;  1EET A;  3UR3 C;  1KBR A;  4NLQ A;  2Y3Y A;  2ZH9 A;  1R8B A;  5AE3 A;  1VQS A;  5E3R A;  2E44 A;  3AY0 A;  1EB0 A;  1EP4 B;  2LFV A;  4N77 A;  5DO2 A;  4RLE A;  3OR1 A;  1AFI A;  4WFB Q;  4G65 A;  4DUY J;  1X4C A;  3GV7 B;  3R8Y A;  1VS3 A;  3UDE A;  5IV4 A;  2VG7 B;  2ROE A;  2E1P A;  1UVM A;  3R6G B;  3OW2 R;  2I38 A;  1VK8 A;  3HFZ B;  4OZL A;  2L41 A;  1VRU B;  4B3T J;  3QMQ A;  4B3O A;  3KLE A;  1KTQ A;  4I6A A;  1CJV B;  3KDN A;  1QE1 A;  5HJX A;  5BYR A;  2H4Y B;  3PX0 A;  1GMU A;  4CI0 B;  2HVH A;  1A0O B;  5E41 A;  5K8M A;  4K50 A;  2H3E B;  2YWE A;  2RQ4 A;  3RB3 A;  4FDF A;  1X4D A;  2ZWO A;  4Y2K A;  4PKD B;  1JJC B;  1NDC A;  4JI0 J;  2LQ9 A;  3VVU A;  3HI9 A;  2BYC A;  4OQJ A;  2HNZ B;  4NCA A;  3SDE B;  3K2Y A;  3ZNU A;  2B5J A;  4QWB A;  5LMN J;  1JXL A;  1FFS B;  1RK8 A;  4TN2 A;  3FBC A;  4ZVO B;  3QAU A;  4UY8 T;  5BR8 J;  5ETL A;  1HBM A;  2OO4 A;  3NCQ A;  1C4A A;  5F8L A;  3UN3 A;  5HQL A;  1WSR A;  1TV6 B;  5D4N A;  4DV4 F;  2QG9 B;  2NXN A;  2YQ1 A;  3HM9 A;  1FA0 A;  4JI8 F;  2JSX A;  1JXE A;  1YJW S;  5KG1 A;  4NI2 B;  3TZY A;  5LJ3 Y;  3KUH A;  4J37 A;  1PJ6 A;  1S9G A;  3AA8 A;  1FDN A;  3H40 A;  4F26 A;  4HI1 A;  1K0T A;  1CG2 A;  2OSQ A;  1YLX A;  2Q3P A;  4IG0 B;  1HI8 A;  2DR7 A;  4AL7 A;  1NSK L;  2RNE A;  2VKR A;  6AT1 B;  4IFY B;  1T8E A;  2HGL A;  3R5A A;  1U2F A;  1M5O C;  1EKR A;  3BJY A;  4IG3 A;  4AUK A;  5F8I A;  4KO0 B;  3M32 B;  1QTN B;  2FVP A;  4RW8 A;  3Q8Y A;  1IR2 A;  3N5B A;  2HG4 A;  3MEC B;  3AQP A;  2Z2M A;  2MDA A;  4XDD A;  1BD6 A;  2KT3 A;  3I82 A;  3FDS A;  2XUL A;  2W1B A;  2X1A A;  4ECV A;  4IOB A;  1VLO A;  3MCO A;  2AIR B;  1CUL A;  1FNM A;  3F0N A;  5HJY A;  2Q79 A;  2FB0 A;  4D3H A;  4KQZ A;  3AAW B;  1PC5 A;  3MR7 A;  4DPY A;  1A9N B;  2G13 A;  2GCF A;  1RWO B;  3BBF A;  3MUR P;  3M8P B;  5IT9 U;  3OXL A;  2FHJ D;  1N32 F;  1Q7L B;  4LF4 J;  4F36 A;  4GKK J;  1RWW B;  3SEO A;  2GMJ A;  2LQJ A;  1K73 T;  2F1F A;  2XSJ A;  4B08 A;  3T5J A;  1SUQ A;  3KTQ A;  1U8S A;  1TL7 A;  1TZ0 A;  3JSM A;  4NA2 A;  1LWC A;  1YJR A;  2KN4 A;  3D28 A;  3M8Y A;  2EG1 A;  1FEE A;  1P8G A;  2LU1 A;  3BGF A;  3FSI A;  3N5F A;  4P2S A;  4DN9 A;  4LF6 F;  2H5E A;  1KQS R;  3C19 A;  3TJ9 A;  4X4R A;  2A2C A;  3HMJ G;  2HQC A;  2CZV C;  3MEE B;  1XNQ F;  2UXB J;  3FUY A;  2O01 C;  5C24 B;  1WOS A;  2IRY A;  3I5C A;  1M5H A;  2X1F A;  4OI0 A;  3K8W A;  3FEX B;  2QA2 A;  4QIW D;  3DXS X;  1C0T A;  1U02 A;  1T9V A;  2NYH A;  1UKU A;  4DV5 J;  3LAL A;  3KLG B;  2EFG A;  5KFL A;  4ZP9 A;  3TVK A;  5DG9 A;  5IFM A;  3P96 A;  4I6W A;  1VQM S;  4NXN F;  1OYE A;  1GMV A;  3MPU B;  4KAI A;  4DR6 J;  4JUZ A;  1KD1 T;  5D0G A;  2NXU A;  1G3O A;  1D9D A;  4V19 J;  2IJN A;  2GHP A;  3EPG A;  1PIL A;  4LRA A;  2XGP A;  3VHQ A;  4K4T A;  2RT3 A;  4OJ3 A;  2WTF A;  1OO0 B;  4OHZ A;  2ZDP A;  2V69 A;  4E0D A;  2YY3 A;  4A46 A;  3KYL A;  1JLB A;  3KMQ A;  2F8H A;  4FPI A;  4PG5 A;  1UFW A;  2GJI A;  5L38 A;  3H20 A;  2H54 B;  2Q6B A;  2N7C A;  2RS2 A;  4Z2X A;  2VON A;  1UEV A;  4FXW A;  4EMD A;  2IMW P;  3NBP B;  1Q16 B;  4U95 A;  4ZLJ A;  3RBZ A;  1UFL A;  1Q1K A;  2C2D A;  5DLF A;  3W2W B;  1TUV A;  3F73 A;  1MN7 A;  3NOC A;  4ZVF A;  3W8P A;  4RBV A;  2GAH C;  2VG6 B;  2ACY A;  1YRX A;  2XHC A;  4WJB A;  4CP5 A;  1NK8 A;  4KB7 A;  4NEY A;  3DOL A;  4JI5 F;  1HNZ F;  2BX6 A;  1KEK A;  2YNF B;  4WFX A;  2Z57 B;  1XQI A;  4MAK A;  1UCN A;  3NLC A;  5GMK a;  3I87 A;  3J81 j;  2ZH5 A;  5ETV A;  5AXM A;  2R7O A;  1MRO A;  2ZEJ A;  1GXL A;  3ZZR A;  2XGQ A;  3CPW R;  5J2P A;  4ES3 A;  3GPA A;  1WWH A;  3RR7 A;  5KFD A;  3G6X A;  2YNH A;  3D0H E;  1WG1 A;  4WTO B;  4Y2C A;  3KLV A;  2EWH A;  1IKX A;  3D3B J;  2ZH3 A;  2HWI A;  4LRE A;  2VBX A;  1PSD A;  2LQ8 A;  2M8H A;  4QCL A;  1NME B;  4DOZ A;  2F8E X;  1F9H A;  3H4D A;  2YWH A;  1NCL A;  4CDI A;  1X4A A;  2UXC J;  1S0M A;  4OYB A;  3BKF A;  2ZJR Q;  3I31 A;  2ZE2 B;  2KZZ A;  4X62 F;  5T7L B;  1SIW B;  2LA4 A;  3CDB A;  1HR0 J;  2RU3 A;  2CKW A;  5E3A A;  5KFR A;  3S7R A;  1GQE A;  2HVE A;  4FNH A;  1YI2 S;  4ED8 A;  2HHX A;  2WSE C;  3PRB A;  2RB7 A;  1PBA A;  4KHP F;  3FGV A;  3LQV A;  4Q44 A;  4PWW A;  3FFI B;  1AXQ A;  2YQ3 A;  4ZPT R;  3GIJ A;  2H65 B;  3M6X A;  4HLB A;  1NO8 A;  1RHU B;  1RAB B;  4Q8F A;  4BWJ A;  4PG6 A;  2GJ2 A;  1YJV A;  3SCL E;  1VQO S;  4OI3 A;  3SFG A;  1BQX A;  3T3F A;  5EHH A;  1YIT S;  3EGW B;  5GAG U;  4FPR A;  1YHQ S;  5AT1 B;  3Q83 A;  5C2G A;  2P9G A;  3CUN A;  4QPT A;  1HYS A;  2JOQ A;  4LF7 F;  5KG4 A;  1HBO A;  3D6H B;  3ZZP A;  2NQP A;  1WOP A;  4CLT A;  5ETP A;  5EWG A;  1XR7 A;  2C3M A;  3W9I A;  4IFV A;  3OL7 A;  2W7O A;  5A8R A;  4LJM A;  2HVZ A;  2DCU B;  1FK9 A;  4MIB A;  4KGV B;  2SXL A;  3VAH A;  5I3Q A;  2AZ1 A;  5JVH Q;  3TX8 A;  4AMO A;  2QSF A;  1VQY A;  3HSD A;  2Q1L A;  1UMJ A;  2DNQ A;  2CVE A;  1NRK A;  2VBW A;  5HO4 A;  1IKV A;  1S4E A;  4DQR A;  3LP2 A;  2XMV A;  1ZYQ A;  1JJH A;  2KXN B;  1ZS6 A;  1RHQ B;  2KDO A;  5DM7 Q;  4OI2 A;  1EQ0 A;  2W9B B;  2XG8 A;  5LXY A;  4ZK7 M;  4L74 A;  2VFR A;  2U2F A;  2PA8 D;  1OQ3 A;  4DL3 A;  1RAO A;  1WOO A;  2DRA A;  3CD0 A;  2U1A A;  4WP9 A;  2IFX A;  2PFF B;  1QVG R;  1XMO J;  1AZS A;  1X5T A;  1X31 C;  1I94 J;  2ABY A;  4E98 A;  2CQI A;  3O1L A;  4ECR A;  4USV A;  2DVI A;  1HPZ A;  2E1C A;  3QJP A;  1FRH A;  3BN7 A;  2ERR A;  3KNG A;  1BQM A;  4ECZ A;  1KOO A;  3JYT A;  5L9N A;  1RT2 A;  1RWU A;  2FVC A;  4CH7 A;  4URQ U;  3BV8 A;  1B70 B;  2ZHB A;  3GR1 A;  2KT5 A;  2ILZ A;  3MUT P;  2VFS A;  3HVA A;  2CPD A;  4B9U A;  2RJZ A;  3ICL A;  2W9C B;  1B7F A;  3PW4 A;  4P10 A;  4Q45 A;  4K7Q A;  4Q8E A;  3R97 A;  1PYO B;  2V4J A;  1FES A;  4YDX A;  2IC3 B;  3UW1 A;  1YRT A;  3BEG B;  1UW4 A;  1NJX A;  3HKW A;  2DNG A;  1NAQ A;  1YRU A;  1EZZ B;  1JWW A;  5AE2 A;  1IVZ A;  4RW7 B;  2UUC F;  3POT B;  2YKQ A;  4EO8 A;  1VQ8 S;  2G2Z A;  2K1R A;  5HI7 A;  5LMU F;  3BPD A;  2W24 A;  1X4F A;  1U26 A;  4R0J A;  5SZT A;  3CCL S;  3UNY A;  1LXN A;  1N0V C;  3FSX A;  3IC1 A;  4YR0 A;  3PXG a;  4DU7 A;  2LXF A;  5J1E A;  1RAH B;  3LGN A;  2CQG A;  1WNE A;  4ED6 A;  3BO3 A;  3OVS A;  2EC2 A;  3BSO A;  2MHE A;  1S5Z A;  2Z30 B;  1MML A;  1C1C B;  4DR4 F;  2ACM A;  4DL0 C;  3T5K A;  4QR0 A;  2LEA A;  4G3I A;  3SV4 A;  4PZV A;  5IT0 A;  2V0N A;  2X3G A;  1DHM A;  4NLX A;  4U67 Q;  3QNW B;  1C0U B;  1WC3 A;  3NOG A;  1IKW B;  2YWK A;  2VIH A;  4N8O A;  4XPC A;  3MCM A;  1OMS A;  1D09 B;  1L5U A;  2KH9 A;  3O44 A;  2RKI A;  2OI2 A;  3Q0A A;  3EZU A;  3HFK A;  1KVI A;  5KG0 A;  4JI8 J;  4AL5 A;  3R1H A;  3TA2 A;  3TUJ C;  3KXD A;  4MYU A;  1LWF A;  2VUG A;  5KOX A;  1REV B;  2MQM A;  2GGP A;  2FVR A;  2JFK A;  2IM1 A;  5IM0 B;  2X7I A;  3DHX A;  1RT7 A;  2L3M A;  3MM7 A;  1YWX A;  1S1U A;  2FQQ B;  4DV7 F;  1K9M T;  3ZNJ 1;  3KJV B;  4ZPB A;  3NAI A;  2R7X A;  1U24 A;  2VH7 A;  4DL5 A;  1ZZF A;  3QID A;  1R8H A;  2XHW A;  4MTP A;  4LIR A;  4ATN A;  4DJB A;  1QUV A;  1NH8 A;  1RAE B;  4TY9 A;  1GH8 A;  5FII A;  2HQG A;  1NHV A;  1HQ2 A;  4ZJO A;  2JVR A;  2GIQ A;  4DI6 A;  2WOM A;  2KXH A;  4EWT A;  2V2K A;  3PFE A;  5C42 B;  2V34 A;  3V6D A;  1Q86 T;  3GG1 A;  1WHX A;  3CT9 A;  3M2V A;  3CVK A;  4BHQ A;  2J0S D;  3MM9 B;  5I3P A;  4RWW A;  1SQE A;  3M6U A;  4WK3 A;  4QIF A;  2PT0 A;  4Y2A A;  5CYM A;  5KT2 A;  5J2N A;  2HHH F;  2LXI A;  9RUB A;  3D0G E;  4DX8 H;  1UFK A;  1NHK L;  2OHD A;  5A0Y B;  3JS9 A;  3IA0 A;  2E29 A;  4KRW A;  2Y1R I;  1XBW A;  3MD1 A;  3CJK A;  1HBU A;  2DNY A;  2CJ9 A;  1YJT A;  4YY3 F;  2HND B;  3O6Q A;  1R0A A;  3OJU A;  1N32 J;  3DLH A;  2XZW A;  3G4S S;  3WIV A;  2HFU A;  1RIS A;  1RWN B;  3WBZ A;  1YZ7 A;  4KSE B;  2H51 B;  1Y3K A;  4ED4 A;  4G1Q A;  2OD6 A;  4M95 A;  4ZVT B;  5HL7 Q;  1GMW A;  3U1M A;  4J9L A;  3CDE A;  2ROP A;  4ED7 A;  5B0F A;  1FKA F;  4DQQ A;  3BGR A;  4DL4 A;  3JXO A;  2FZC B;  1R0B G;  3JTP A;  5D6G A;  2NR0 A;  3DMJ A;  4ECT A;  2VPY B;  4TQR A;  1FRJ A;  2V4R A;  3D6M B;  4O44 A;  4H4O A;  2ZM6 F;  1TKT B;  4LRC A;  4LF6 J;  1FWL A;  3R7S B;  2AKW B;  3ZZU A;  2C22 A;  1F0X A;  2AMC B;  4YB7 A;  3R5B A;  4URS A;  4WYL A;  4DV6 J;  4ILM A;  3BGL A;  4G6V B;  4G1I A;  1FJG J;  2WCX A;  3GLJ A;  4NXM F;  1TQL A;  3SCJ E;  2XC9 A;  1X9W A;  3EXY A;  3CMQ A;  5IZH A;  2CAD A;  4WYW A;  1FDA A;  1RTZ A;  1HIY A;  4IYQ A;  4NE9 C;  2W8L A;  2BDP A;  5GME A;  3LWL A;  1RT1 A;  2J76 E;  2JZ5 A;  4R0E A;  2GVD A;  2HKE A;  4KHM A;  2Q6C A;  3IXQ A;  3GII A;  4RW9 B;  2E5H A;  2BJ8 A;  3E8O A;  2VFT A;  3I0R A;  3TAQ A;  2DNR A;  3E01 B;  2YBV A;  3MXH P;  2PE8 A;  2OD4 A;  4ED3 A;  2CJK A;  2VAS A;  2W4D A;  1B3T A;  3OUY A;  3DOM B;  1FF2 A;  2OSR A;  1NZ8 A;  4I64 A;  1W25 A;  4OYW A;  2RU9 A;  2KYX A;  3MHY A;  5FJ4 A;  2GIF A;  2DXF A;  4P2X A;  2VA2 A;  2DPJ A;  3V81 B;  2MZQ A;  2FJB B;  1NSA A;  4M94 A;  5JJB A;  4F4A A;  3OD2 A;  3KLI B;  4DSI A;  1FD8 A;  1S9E A;  2KFN A;  1KLM A;  1OPZ A;  4NWB A;  1YIJ S;  4FVC A;  3K8V A;  3QIP B;  4TYB A;  4I2Q B;  3GR0 A;  3V4I A;  2Q66 A;  4N41 A;  3HVW A;  4NLS A;  2GMH A;  3IO1 A;  4J9K A;  4PWU A;  2V8D A;  1JLQ A;  5KFU A;  3VZI A;  2FLL A;  5M2U A;  1M1K T;  5I42 B;  2R7R A;  3M9O B;  1NK7 A;  4JI7 F;  1HI1 A;  3GB0 A;  3CW2 C;  4FKY A;  1JNZ B;  3G8T A;  4IR9 A;  5EWE A;  1TKZ B;  5KOW A;  4UOH A;  3H5Y A;  4KGX B;  2NYI A;  2J7W A;  4X2B A;  1VIO A;  2Z56 B;  2PMH A;  1G7C B;  4A4J A;  1D9F A;  4X4P A;  4N47 A;  3T5H A;  3OHA A;  1CLF A;  1Z2Z A;  1FRM A;  3OHB A;  2FHM A;  1VC0 A;  2MKS A;  2ATC B;  1FJ7 A;  5DZ6 A;  1E6V B;  1R3N A;  3IGV A;  2DXE A;  5CZD A;  1EAY C;  4YB1 P;  1CPZ A;  1RLD A;  2V67 A;  3UPF A;  1RAF B;  3RR8 A;  1X5P A;  3N4W A;  5E33 A;  2YXL A;  2N3L A;  3R3T A;  2YKA A;  3K7R A;  4PEO A;  3GIR A;  4L6V 3;  4FN5 A;  2XY6 A;  2YH0 A;  3UVJ A;  4KR0 B;  2XMU A;  5U47 A;  4CLU A;  2OEL A;  1WI6 A;  5H9F K;  3S1T A;  3SCK E;  4B3M F;  2COL A;  4DF8 A;  2Y0B B;  5G0R A;  2HRT A;  4ETX A;  1X7V A;  1ITP A;  3CJT A;  1FVQ A;  4B9L A;  1QAI A;  4ILR A;  1F60 B;  2JVO A;  1UVN A;  4OZN A;  2DNM A;  1RWK B;  3M2R A;  5L39 A;  3GU0 A;  3G2X A;  3SSR A;  1O8B A;  4Y6I A;  2FHO B;  2DR9 A;  1JLE A;  2MQ8 A;  3K58 A;  1S1V A;  1TL1 B;  4JB8 B;  3ZXW A;  4AMP A;  1LFP A;  2PMZ D;  2MY8 A;  3FSY A;  4CTA A;  4GRS A;  4NYZ A;  1XR6 A;  4HTJ A;  4B02 A;  1QJH A;  1N5S A;  3KHG A;  3BM7 A;  3EGZ A;  4O0I A;  3K5P A;  4ZCM A;  1JLA B;  3T19 A;  2J0W A;  3W60 A;  2CWX A;  2MZS A;  3BDE A;  5HLF A;  1FRI A;  5I3U B;  1QLN A;  1ZZN A;  5ETO A;  4ZP6 A;  4K5S A;  1N4L A;  2XLK A;  2LEB A;  2K7J A;  3VGT A;  3BYR A;  1GAO A;  3DLG A;  1IBM J;  5KT5 A;  1KQF B;  3RG6 A;  1LK7 A;  3KJN B;  5A8K A;  4LF5 F;  1FEH A;  1RHK B;  3J80 U;  1YBT A;  4RUB A;  1UVK A;  3UFC X;  1MSW D;  5GAH U;  4EK2 A;  4LSL B;  3L3C A;  4I56 A;  1MU2 B;  3CCW A;  4NLU A;  3H25 A;  2VBZ A;  2XMT A;  1N36 J;  5ETQ A;  4ICL B;  4LRB A;  3AOD A;  1WG4 A;  2DKO B;  1HNX F;  1Q8I A;  2VFV A;  1IN0 A;  2CJA A;  2WVB A;  4ZN1 A;  4WP3 A;  3J7A N;  4FYW B;  3BSN A;  2Y9H A;  4ZN3 A;  4IRD A;  4KV8 B;  4Y2M A;  3MPW A;  2MLZ A;  4I7F B;  3QLH A;  4QYR A;  3OR2 A;  3DRP B;  2VOD A;  2DGS A;  1HMV B;  4CLK A;  4ZVH A;  3ZZZ A;  1FWP A;  3PO4 A;  5CYQ B;  1LW0 A;  1JLG B;  2KFZ A;  5L1K A;  4RJV A;  1D1U A;  4O3N A;  4J9U E;  2AD9 A;  1NPR A;  4ZJL A;  3KKF A;  2B8Q A;  3GE9 A;  3KLH B;  1S1X A;  2HHU A;  2DEI A;  3KLF B;  4JI1 J;  3V6J A;  2LA6 A;  2ATL A;  3JSY A;  3D4J A;  3W1Y C;  4CH0 S;  1FNX H;  1XTZ A;  4IDK B;  4P2F A;  3QGP A;  4BBY A;  3D6F B;  2BW2 A;  3TVY A;  4A8F A;  5KFB A;  3M6V A;  1SV5 B;  4CO1 A;  3GTY X;  2HVD A;  2B4U A;  3MM5 A;  4RR5 A;  2DGT A;  2XZD B;  3MUV P;  5HRO A;  5LMU J;  3IGN A;  4B3S F;  4XTT A;  1X60 A;  4OZ2 A;  4HT5 A;  1RU2 A;  3Q22 A;  1CSJ A;  1J5O A;  4QR2 A;  5D3G A;  2DH7 A;  4LFC F;  1RYR A;  1KVK A;  3BBB A;  3M9N B;  2BR0 A;  3D1H A;  4LSZ B;  2HWH A;  4K5R A;  1FKO A;  1N88 A;  5IQQ A;  1I3O B;  4YHH F;  2DBB A;  4LRD A;  3CCJ S;  2JRS A;  3PJW A;  2OPQ A;  4QR1 A;  4DR2 J;  1KP6 A;  1Q0N A;  4Q5V A;  2HBR B;  2L9D A;  1SJ1 A;  5KT7 A;  5EUH A;  2DNN A;  3DI6 B;  3CD7 A;  4CLP A;  2CXE A;  2OLW A;  1RGV A;  3DGV A;  4JV1 A;  3N6N A;  1PAU B;  2IDE A;  3AA9 A;  2VKZ G;  1F1B B;  4NLD A;  5HQM A;  2VPZ B;  1NM2 A;  3WQP A;  2E7W A;  2DH9 A;  2WVC A;  3W65 A;  1Q8L A;  1KDN A;  3FCW A;  1T03 A;  4N7T A;  4OI4 A;  1JK9 B;  4HL9 A;  4EGL A;  1KVJ A;  1M5P C;  2CNK B;  2RDI A;  2QA4 G;  3MWB A;  4B9V A;  1RTH A;  2V2V A;  5KFN A;  4Z7C A;  3I6P A;  5ETS A;  1RTI B;  1VQL S;  2IYI A;  1LKZ A;  1RT4 B;  3Q24 A;  3HZE A;  2NZ4 A;  3EGV A;  1NJZ A;  2V8V A;  2OEK A;  3PJX A;  3OVA A;  4JV5 F;  1KON A;  3L7U A;  1S10 A;  1SJF A;  4CM0 A;  3HD1 A;  1IBK F;  3BYP A;  3BKU A;  3MMB B;  3IS9 A;  3NGR A;  1OS5 A;  1WHV A;  3W9H A;  5DDO C;  2A6M A;  3OBI A;  3QBC A;  1CEZ A;  2CQH A;  4QW8 A;  5ETN A;  1C2P A;  2FDN A;  4EYI B;  2OH2 A;  2HHH J;  1QAY A;  2NRE A;  3PKM A;  2W2O P;  1D8Y A;  1TL5 A;  3AB4 B;  1HQU B;  5MLC V;  2VG7 A;  2OP5 A;  4IOA Q;  4IH7 A;  5L1J A;  3KK3 A;  3IRX B;  2ZH8 A;  1VRU A;  4YY3 J;  3P5T L;  4ZVS B;  2BJ7 A;  3HT3 A;  3MMA B;  4L72 B;  2NSB A;  2B8P A;  1N5V A;  3IN5 A;  1F5A A;  2CYY A;  3CDU A;  3I0S B;  1N6Q A;  2A6O A;  2EKY A;  1NK9 A;  4DX5 A;  2CNN B;  5KFP A;  2B6A A;  2HPU A;  3DLL Q;  3SQG A;  2OGU A;  3M8Q B;  4DSL A;  1IKY B;  3RBX A;  2GS8 A;  3PZP A;  4NLP A;  3MR3 A;  4C6A A;  1B0T A;  2B9E A;  6FD1 A;  3C15 A;  5KFF A;  2QIF A;  2FHJ A;  4GC7 A;  2JEI A;  2KJW A;  3PO5 A;  1FRK A;  2HNZ A;  2VZ9 A;  1EET B;  1NDK A;  2RE1 A;  3CF5 Q;  2ADB A;  5CD4 H;  1WHW A;  1RI7 A;  2B56 A;  3KUE A;  1FTR A;  1O0P A;  3T6B A;  2DY9 A;  1VFJ A;  1L3T A;  4KH1 B;  2V8P A;  3CE8 A;  4OYO A;  1UZD A;  5DRK A;  5GAG I;  3CJ4 A;  3DOK A;  5LOQ A;  1U1M A;  3EDR B;  1VBK A;  2DT9 A;  3UDL A;  1TU0 B;  1KTV A;  3VZH A;  4YOE A;  3ISZ A;  5D78 A;  3S6E A;  4B3O B;  3VGV A;  2KTQ A;  1J5E F;  1OY8 A;  4DDF A;  3CXC R;  1QE1 B;  1VBX A;  4PPZ A;  4W90 B;  4TU7 A;  4KFB B;  3IAM 9;  3EVO A;  3V6H A;  2R7W A;  1SC4 B;  4JI4 J;  1ZA1 B;  3VAF A;  5A8W A;  4U7U K;  3H5S A;  4GVB A;  1YGY A;  2E5I A;  1VR6 A;  4O4G B;  4IG0 A;  2AX1 A;  2J9C A;  4QZV B;  4P71 A;  1WEL A;  2CQC A;  3BRE A;  4IFY A;  1RT5 B;  1V5V A;  3NNA A;  3QT7 A;  2YX1 A;  1UPP A;  4A8O A;  4QIV A;  2B5J B;  1H2V Z;  1N34 J;  4GKJ J;  3RB6 A;  1B4S A;  4WBF A;  3AOB A;  4HH0 A;  5KAK A;  1JXV A;  1RCX B;  5THW A;  1VYA A;  2Y0S D;  3R5G A;  1Q5Y A;  1Y5L B;  3GYN A;  3PJ9 A;  1HBM B;  1UP1 A;  1XMQ F;  4C9D A;  5J1P A;  4OMF G;  3MEC A;  3IM9 A;  5KG7 A;  2E5J A;  4OFZ A;  2R8H A;  3T5L A;  2C42 A;  1DJ0 A;  2MZR A;  1U09 A;  4U7C A;  2FZG B;  4P6Q A;  4FF2 A;  3W3S A;  1SJ3 P;  1KSP A;  2RUG A;  2HFN A;  2Z2Y B;  1WTF A;  4NLR A;  2E1R A;  4OX9 F;  2HGN A;  3MEK A;  3W8G A;  3THV A;  1YDL A;  3G6V A;  5LJ5 Y;  5J2M A;  2VPX B;  4U8V A;  3M8Z A;  2BJ9 A;  1R43 A;  2HS0 A;  4ZPC A;  2WHO A;  3JAM U;  4Q43 A;  4F2S A;  3BSA A;  2BRK A;  1TKX A;  2FTR A;  3TZZ A;  4C98 A;  2UVV A;  3HDS A;  4K0K J;  2RS8 A;  5K20 B;  1LK5 A;  4KE5 A;  2OPR A;  3FRZ A;  2CDR B;  4U6P A;  1U1R A;  1CQN A;  4V19 X;  3B78 A;  3D3C J;  4Y65 A;  4LSN B;  2Y1J A;  1ICE B;  2W2P P;  3CJ8 A;  1UJ4 A;  2DNP A;  2DNH A;  3KHR A;  2EW9 A;  4DL7 A;  3AT1 B;  3PDN A;  3MEE A;  2AW0 A;  3IWL A;  5AXL A;  5T14 A;  1H7W A;  5C24 A;  3R5J B;  4WZM A;  5LM7 E;  4OL8 A;  3OJS A;  3QGI A;  3CDA A;  2KRB A;  5KFH A;  2I5J A;  3CJ3 A;  2AV5 A;  1BXN A;  2AJQ A;  2LQ5 A;  4YEA A;  5HAT A;  5IS2 A;  3R1L A;  2XEX A;  1WEX A;  3TUI C;  3DKD A;  3NS6 A;  4ED0 A;  3NGK A;  1N5Q A;  1U6B A;  2V8G A;  4NYO A;  4ED1 A;  1YTY A;  1RB0 A;  1CJK A;  1RA7 A;  5L9X A;  1DAX A;  2G2O A;  2IRU A;  1Q81 T;  3EPI A;  1NSQ A;  2J9D E;  2VFU A;  2XSJ B;  1UZH A;  1SUQ B;  4DL2 A;  3NG8 A;  2W8K A;  2ZNY A;  2UVR A;  1D8Z A;  1TL7 B;  1Q95 G;  1KHW A;  1YJ7 A;  4CLW A;  1LWC B;  3PFO A;  3J7Z 5;  2P6T A;  2HEK A;  3QYY A;  3QFH A;  4NZ6 A;  1I6J A;  1JLC A;  4QIE A;  1F2G A;  5DS7 A;  1U1N A;  4TQS A;  2CFX A;  4MFB B;  2XCP A;  2F63 A;  2JLG A;  1Q7Y T;  3NBP A;  3TAN A;  4YP3 A;  1R6Y A;  4IH5 A;  4CIO A;  4UTG A;  5F0W A;  4BWM A;  2MQN A;  1WC6 A;  2C28 A;  3W2W A;  3CSK A;  5CAB A;  1XMB A;  2VG6 A;  1C0T B;  4LBI A;  1WF0 A;  2KM8 B;  3NMA A;  4J9V A;  1Z2L A;  3RW7 A;  3T1Y F;  1FDB A;  4LF9 F;  4JI2 F;  1MLA A;  4LF5 J;  1U1P A;  4I68 A;  1QVF R;  5B0A A;  2NPF A;  2KRR A;  3PRD A;  4DQI A;  3V6K A;  3M05 A;  3Q2T C;  1ZET A;  3SMZ A;  2E5G A;  4A47 A;  3AD8 C;  3HK2 A;  3RAX A;  4UQG A;  7FD1 A;  3HJV A;  4OZJ A;  4P7V A;  1U8W A;  1VHF A;  2D41 A;  5BJR A;  4U9R A;  1IUJ A;  2V8H A;  2IAJ A;  1HL6 A;  4FYY B;  4CLF A;  1JLB B;  1WC5 A;  3HHL A;  2BM1 A;  4DBQ A;  4ANC A;  1T95 A;  3R5C A;  1VRT B;  2G2Y A;  3GIK A;  3SI8 A;  2D1C A;  1ZBT A;  3QFW A;  1Y11 A;  3ET6 A;  3G82 A;  4DQP A;  2YKP A;  4TLR A;  3DDI A;  2XO7 A;  1CJT A;  5KFZ A;  4UOF A;  1W2B R;  3MEG A;  2OTL S;  2ZE2 A;  1X5S A;  3MUM P;  3HHK A;  1IJE B;  2P6S A;  2MXY A;  5T7L A;  1HD1 A;  3DOL B;  2P5V A;  2BJ1 A;  4ZA1 A;  1HNI A;  1DAR A;  4F04 B;  4DEZ A;  2VU5 A;  2DIU A;  4DS5 A;  1NK0 A;  2M2B A;  2V2Z A;  4LFB J;  3BN4 A;  1IQT A;  4MKA A;  2ZJP Q;  1MRO B;  1SL0 A;  1L3U A;  2KVQ E;  3PVX A;  1CQM A;  3NNC A;  1IBC B;  1BGX T;  2HS4 A;  5J2P B;  2LXU A;  2NSC A;  1TMM A;  2UUB J;  4B3S J;  3GYG A;  2YNH B;  3O8W A;  2QYC A;  2VBY A;  3AXK A;  3N9U C;  2DGU A;  2QX0 A;  3DLJ A;  4KT0 C;  1W2I A;  2MHN A;  4O3Q A;  2R3V A;  3M9M B;  2F5G A;  3AOC A;  2DGO A;  1QM9 A;  3GON A;  4X4T A;  4A8Q A;  2R9L A;  1W26 A;  2MZJ A;  2PD1 A;  3OTE A;  1FVS A;  4NYP A;  3GCX P;  3EX7 B;  2J5A A;  5KFT A;  3BO4 A;  2QLW A;  1X9M A;  1I5O B;  1RXO B;  1T9U A;  4R8U B;  4IO9 Q;  3GJT B;  2GW8 A;  2RQK A;  2MJU A;  4ZHR B;  3NS7 B;  2FD2 A;  4WIQ A;  2ZD1 B;  3FMB A;  4WE1 A;  1RWP B;  5DG8 A;  2FLN A;  2I8E A;  3SYZ A;  3GFY A;  4EUV A;  2KL8 A;  4AXI A;  2OPP B;  3TR5 A;  4AQY F;  4M5I A;  1ZTT A;  3EJM A;  4URG A;  3EXC X;  1X0F A;  3DN9 A;  4DSJ A;  4Z7Y A;  3DRS A;  3RB4 A;  2PN6 A;  1TMJ A;  2FY8 A;  2L9N A;  2W9B A;  2ZWP A;  3M4X A;  1ZH5 A;  4X4S A;  2HS3 A;  4CH1 A;  1VMB A;  1B64 A;  5IWA F;  3CCT A;  2CPF A;  2RD5 C;  2DHH A;  3TAM A;  1NDL A;  1RWM B;  2BXJ A;  4Y00 A;  2EXU A;  1GTE A;  3GCW P;  2ZH2 A;  1X4G A;  4WPA A;  1DFD A;  4CM2 A;  2BKP A;  4C3K A;  1HWU A;  3NGT A;  1T05 A;  2KO1 A;  3W7B A;  2UU9 F;  5K9F A;  4H4M A;  4JV5 J;  3HHL C;  3NAH A;  1UWA A;  4IFV B;  5IOL A;  1GXT A;  1IBK J;  2AZ3 A;  3KK2 A;  3D6T B;  1FKP A;  3ZTP A;  4WU2 A;  4MMO A;  2GAG C;  4Q2L A;  2GC8 A;  4HTI A;  4E8U A;  4UT4 A;  4R5P B;  3KK1 B;  1U0H A;  3TRG A;  1JJ4 A;  2YKO A;  4BC7 A;  2XY7 A;  2C2R A;  2W9C A;  2E9T A;  2DTJ A;  1E6Y B;  5IXU A;  1SQG A;  2VG5 B;  4X66 F;  3LP2 B;  4ECQ A;  1XN9 A;  2FJV A;  1PCA A;  1MNE A;  5AJ3 F;  2ZH1 A;  1SB6 A;  2YTC A;  3QO9 B;  4FF1 A;  4C3L A;  2Z0G A;  3JAM Y;  4I0W A;  1VHI A;  3P8B B;  2GV1 A;  3DFE A;  2E7X A;  5ETM A;  2XMA A;  5CCM A;  1AZS B;  5C5J A;  2UP1 A;  1XWL A;  3H2L A;  2FLO A;  5K14 B;  3AH6 A;  3EVW A;  3C16 A;  5FDL A;  4CNZ A;  1CS4 B;  4F4W A;  3FBB A;  3TA1 A;  2BUN A;  5KFK A;  1HLW A;  4NLW A;  3JYT B;  2ZHA A;  3OFE A;  2AJ0 A;  4QQB A;  1RBA A;  1GEH A;  3M8W A;  4PCQ A;  1K8A T;  2F9D A;  1DZ5 A;  1FFG B;  1TR0 A;  1TP7 A;  2RRN A;  3KG0 A;  5LT5 A;  1C1C A;  2RHS B;  1IJF B;  3MM6 A;  4FXV A;  4OYI A;  3FBE A;  3AJ2 A;  4CO2 A;  3FMW A;  4MJK A;  3GV5 B;  2KHD A;  1T3O A;  2A18 A;  1C0U A;  1P1T A;  2HBZ B;  1KFS A;  3D5M A;  2YNI B;  3OTO F;  2MQO A;  3D67 A;  1RAD B;  3PKY A;  1SH0 A;  3ENA A;  3QGH A;  2XWX A;  3H90 A;  3HJF A;  3TEH B;  4LF8 J;  3PY8 A;  3LGM A;  5HBM B;  4C11 A;  3DDK A;  3O3L A;  3PHE A;  1GXU A;  5F8N A;  3IWN C;  4DR7 F;  3TZW A;  1SKR A;  3HUL A;  3ILO A;  4CRJ A;  2QL5 B;  4A8W A;  2K1R B;  1JNR B;  1Z1Z A;  3CED A;  3FBF A;  1TFW A;  2G9O A;  2GA7 A;  5IM0 A;  1R89 A;  5KG2 A;  4RUC A;  2AU0 A;  5HN0 A;  3D7S B;  1TL3 A;  4M5D A;  1LFW A;  3EUN A;  1RHM B;  3QSY B;  2W4C A;  4UUW A;  5J1E B;  1QDU B;  4DR1 F;  1CC7 A;  4OV6 A;  4AYB D;  4K2X A;  3TUP A;  3ISN D;  5JMN A;  2XM3 A;  3T41 A;  5D4O A;  2DGV A;  4X4N A;  1DTQ A;  4JI6 F;  1NK5 A;  1HWJ A;  4LQ3 A;  1UL3 A;  3H5U A;  5GAH I;  1EQM A;  5C42 A;  3EM1 A;  2EFN A;  3PYD A;  4C8K A;  3MAA B;  4ZKA A;  2DRD A;  4J9Q A;  5HQ8 A;  5C25 A;  2ZNZ A;  3M2U A;  5LSR A;  2EKN A;  5RUB A;  2YKM A;  5E2Q A; 
#chains in the Genus database with same CATH homology
 2G2Z A;  4AMP A;  2H1Y A;  5DZ7 A;  3HJV A;  5DZ6 A;  4RL1 A;  3TQE A;  3G87 A;  3TZZ A;  3IM8 A;  3EZO A;  3QAT A;  2QJ3 A;  3R97 A;  2G1H A;  3RGI A;  2QC3 A;  2G2O A;  4AMO A;  1NM2 A;  2CUY A;  3SBM A;  2G2Y A;  4AMM A;  4RR5 A;  3TZW A;  3TZY A;  3H0P A;  2JFD A;  4QBU A;  3PTW A;  3BV8 A;  2JFK A;  3R8Y A;  3IM9 A;  1MLA A;  3HHD A;  3CJ8 A;  3TZX A;  2C2N A;  3K89 A;  4AMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...