3TZZA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in the carboxypalmitoylated form at 2.5 a
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
463
structure length
463
Chain Sequence
LPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Polyketide synthase PKS13
total genus 175
structure length 463
sequence length 463
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzzA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzzA01
3HJVA 4AMPA 3QATA 3CJ8A 3SBMA 2G2OA 4AMNA 4AMMA 1NM2A 2C2NA 2H1YA 2QJ3A 3BV8A 1MLAA 3PTWA 4AMOA 3RGIA 3H0PA 3EZOA 2CUYA 3G87A 3HHDA 4RR5A 3IM9A 4RL1A 2G2YA 5DZ7A 3TQEA 2JFKA 3TZWA 3TZYA 3R97A 5DZ6A 4QBUA 2QC3A 3K89A 3TZZA 2G2ZA 2G1HA 3IM8A 2JFDA 3TZXA 3R8YA
chains in the Genus database with same CATH superfamily
3GG1A 3H2VE 3MM9B 3CJ4A 4RKUC 1S0MA 2IVMA 1MG7A 1S48A 2N4DA 1S9GA 9RUBA 3LWMA 3FCWA 2KYZA 2UUAF 3DNCA 1TL5A 1VQYA 2CQ3A 1TL3B 3C6TA 3GJQB 3UWTA 1Q8BA 2DXFA 3I55S 4MT1A 3WQPA 1DTQA 1RWNB 2KXNB 3CE8A 2MKCA 2CQHA 4Q45A 2FZKB 2HNDB 5F3TA 1Y10A 4NLUA 2H4WB 3O2IA 5GAGU 3W5YA 3P6YC 2CJXB 3W1YC 1SQEA 4GVBB 1SJRA 2PD1A 2V67A 3EJMA 3UCUP 1FRXA 3DLKA 2E9TA 1PG5B 3HO1A 3ISNC 3S8SA 1U26A 3R3TA 4EZ9A 3TP2A 1SPBP 2E9RX 2XMKA 1HNVB 2LU1A 2YWFA 3D1HA 4DUZJ 4PXDA 3FGVA 1FD2A 3TJ9A 3HFVA 3UN2A 3KHLA 4ECWA 2WSFC 3NRBA 2XNRA 3DRPB 1KFSA 1HBOA 1EAYC 2DNQA 3M30A 2JEJA 2FB0A 3MGJA 1RT4A 1RK8A 3NCRA 3BGRB 2LEBA 1TMMA 3PYDA 3SSQA 1SJFA 4PAAA 5E7OB 5ITHA 1U4BA 4TQSA 3MWBA 2NSBA 3MMCB 1VFJA 4KSEB 2CQ2A 1HBNB 1YBAA 2DR9A 3IGVA 1IKWB 1WORA 2M52A 2YPYA 1FA0A 2D3UA 4NLWA 4QWCA 2B7BB 3A8EA 2BE2A 1RWXB 2ZEJA 3W66A 4B02A 4Q7AA 5RUBA 5ETRA 4RW4B 5DQIA 2RRBA 2L41A 4MK8A 2H5IB 3NNCA 4LIWA 1VQSA 2IDLA 1RT6B 2OH2A 2HRUA 4GKJJ 2Z8QA 4R25A 4K2XA 4JYAF 2DH7A 1ZAVA 3P5BP 3BKTA 4RLEA 2LQ8A 3HVAA 3OL7A 2NPFA 4C6AA 4IOBA 4FXDA 5F8JA 5IV4A 3MM8B 2ZH5A 2Z2ZA 2ATLA 2XS2A 2OPRB 1Q81T 2VG5A 5BYSA 1RT3A 3HSZA 1TFYA 2HIQA 4WXOA 4QWAA 1J5EJ 3KUHA 2FIUA 2HRYA 3DI6A 3MECB 2RKIA 1IM4A 3TEHB 4F67A 4OI6A 1VRUA 4OZLA 2MLYA 3G87A 1H7XA 4PPDA 2B9EA 4E98A 2OD6A 2XS7A 2R4FA 2HBYB 3AQOA 4B9SA 1K0VA 2FPHX 3HHEA 4CI0B 2W24A 5GAHI 4ILLA 3BGLA 2ADCA 5IZHA 2MQNA 2KRRA 3PFOA 1ZETA 2W7PA 2V9WA 1FRLA 4DBQA 1FESA 2ZC3A 4Y0FA 4NCGB 5I3UA 5CA5A 2LA6A 3T1HJ 1KQSR 4LRCA 4JV5J 3KYLA 3BPDA 3GYNA 4O3OA 2MSTA 3ZZYA 2CPZA 3FC9A 5B0GA 4KQZA 5EN1A 3VGSA 1TV6B 3SXLA 1VQLS 4QR0A 3CO9A 1X4DA 1B70B 5KT6A 5CHCB 2P2CB 1TKZB 4EMDA 3TVZA 1NK5A 4YR3A 3J7AN 1ZM4A 1H2VZ 4ES2A 1KHWA 2M5YA 1SH3A 2P6SA 3AFGA 3D66A 4G1QA 3PNIA 2MGZB 2V4QA 1R89A 1IBLJ 3LP0A 2V63A 2DR5A 1U0HB 3UNYA 4NZ6A 2B7CB 3OTOJ 1IKXA 1JKHA 1UZHA 1HARA 1SI9A 5ETLA 1HD0A 4C0BA 2B9YA 3TAQA 1FJEB 3PKYA 4I6WA 4DR5J 4LRAA 4ZVSB 5LMUJ 2VL1A 4NOHA 3UD4P 3VCDA 4K4YA 2AYGA 3KLGB 2G9OA 4CLSA 3K5PA 3W2WB 4A48A 2Z58B 1HMVA 1H7WA 1PYTA 1WSRA 3IP0A 3JTNA 1FEHA 3PJWA 3PM9A 4KFBA 1VRQC 2ZVSA 3V2UC 5MLCV 1RJJA 1BHNA 4IFVB 4K0KJ 1RTIB 2J6TA 3CJ8A 5DM7Q 3TJ8A 1T9WA 1XC9A 5D4LA 1UKUA 3VV2B 4UT4A 4N47A 2E5HA 2G0JA 2P6TA 5J2MB 3VAFA 3V4IA 3G8SA 4NXMJ 1XNRJ 3ZZOA 4N8OA 4DV2J 1TKTA 1TVRA 2RRNA 2X51A 4CH7A 1G4CA 4Y2KA 4ED3A 5D6GA 4RNFA 5FD1A 2CUYA 1NZ8A 2ASLA 1HL6A 1R8AA 2FJXA 2RQ4A 2AJ1A 3R1HA 1DY3A 1S1TB 3ENWA 4ED0A 3E01A 1NK8A 1F3VA 3LPEA 4HHJA 1KEKA 1C2PA 2W2MP 3BN7A 3AB4B 3PIPQ 4MFBB 4ZVOB 5KT3A 3NNAA 1IN0A 2GIFA 2KFZA 3BDEA 5A76A 3J7Z5 1ZM2A 4CNZA 2CJAA 1N88A 2CYYA 4F0KA 5J2PB 1IKYA 1FEEA 1KTQA 3MCOA 5HO4A 2U1AA 3G96A 5H9EJ 2UUCF 3I9ZA 5D0EA 2XO7A 2CKWA 3OV7A 1RAHB 3HX9A 3TOQA 4KKOB 5E3RA 4EZ6A 2HQCA 5KG2A 2V94A 5IWAF 4J9QA 1NPKA 2M4MA 1BUXA 1XIQA 4B3OB 3JSBA 3AOAA 4JI7J 1YRTA 5IT0A 2L9NA 1TQLA 2ZWOA 1K44A 5LSLA 4NCAA 1JB0C 2HG4A 2ZH7A 1OY6A 1E6YA 2WONA 4DHVA 4Q2LA 3PW4A 1RTJB 4CO0A 5HVFA 3H2UB 5AE1A 4X65F 5KFRA 2HAFA 3UCZP 3CCQS 3KK1A 1OYDA 3UD5A 2BV3A 3Q8RB 4PQAA 4KO0B 5FDLB 2ZFHA 4ER8A 5G4DA 4UZCA 4WKYA 4ZKAA 2IM3A 1UPMB 1NUEA 2LCWA 4OX7A 5SZTA 4Q2MA 4DEZA 2ADBA 1NSQA 4YDDB 2IAJA 4KBIA 4CP5A 5KFHA 4DSEA 3VAHA 1FVSA 1OWXA 2NLWA 1MSWD 1FERA 4IFYA 2Z57B 4JBCA 4W4MA 4JI0F 5DETA 3LH2S 3ZTQA 3RRGA 3NBPA 4USJC 3PX6A 4YR0A 4ZVQB 4V19J 1S59A 3PO4A 3QRPA 2CNOB 4F3OA 1WTFA 2FJEB 2MQQA 2CWKA 2R7UA 5F8LA 5KFBA 2Y1IA 4DV6J 1H3DA 1REVA 5K14A 2W8KA 2HMIA 1IWAA 3MXHP 3KWMA 2DGTA 1T0TV 1PC5A 4FDFA 4X4OA 3QGPA 3M8QB 2CPYA 2CQBA 3VALA 4DR4F 1VS3A 2LDYA 1RAOA 3KG0A 1QTNB 3D6FB 1KOOA 2BACA 3N6MA 3EVOA 3IAS9 3KK2B 2Y0BB 4CCHA 3NGDA 1WF1A 1ZBTA 2DITA 3HULA 1NSAA 1M5HA 3R5CA 4FNHA 5D0GA 1HNZJ 4USUA 1R8HA 2FC9A 4O4GB 4EI2A 3JSRA 2FUG9 1DHMA 1H6KX 4F26A 2ZUGA 2ZDOA 5J1EB 1IQZA 3RB3A 1PIEA 2PDAA 3KLFA 4BCAA 4TNOA 2XWYA 1WI6A 2KFNA 4Q5VA 1W2BR 2IBOA 3ZZUA 1S6PB 4OX9F 4LBHA 1JLCA 2IVFB 1WTBA 2D69A 4KR0B 4QU6A 2RH3A 3I9V9 3VAGA 1P1TA 1EP4B 2AEFA 2VPZB 5A2QU 3G8QA 4TXSA 3C2PA 2GMJA 3Q8QB 3IBWA 2FVQA 4TY8A 3K57A 2DVIA 4RUHA 1MROB 4DZDA 4USMA 3PKMA 2VJUA 2VZ8A 4M5DA 1GMVA 1X4GA 2HGMA 2HGLA 5M2RA 4C7QA 5LJ5Y 2I5JA 1DRZA 1FRHA 4WBFA 2JJ4D 3BBCA 2KDOA 5SUHA 1CC7A 4LF5F 2EK1A 3CJ2A 1SJQA 2XY5A 3VAKA 1WWHA 1RU2A 3FEYB 2CQ1A 5GMKa 2RU9A 2M8DB 2H65B 4GRSA 5U47A 3HT0A 3JSYA 4CLWA 2AGPA 1D9FA 3Q86A 2MZSA 1X5OA 2BW7A 3UVJA 4B3TF 2FJVA 1M1KT 2VFRA 4N77A 4LF7F 4ED6A 2PMZD 3F56A 5KFNA 5AE2A 5KAKA 1HQUA 2J9CA 1YJRA 2UU9F 3F44A 3QO9B 1LWFA 2VF3A 2VASA 2CQCA 2K2PA 2H51B 3DLHA 1XR6A 1Y5IB 1U24A 2D9PA 3BSNA 3KLEB 3BREA 3FSIA 1CJTA 2Q6BA 1V5VA 4OYOA 5GMEA 4ZCKA 3UD3P 2WB1D 5JVGQ 1JLAA 2XHCA 2C28A 3RTVA 3DRSB 2AV5A 3KNGA 4OJHA 5KFZA 3ET6A 3TANA 1MN7A 1BD6A 1KLMB 3NGTA 4PUOA 2HURA 3NWGA 1KVJA 2RHSB 1IBMJ 1HIYA 1E6VB 2MJUA 1HBMA 3CGIA 1F5CA 2BJ3A 1UA0A 4DSKA 1UW4A 3TZZA 1N33J 1HWLA 2BRKA 2CIMA 2V68A 2HLTA 5HANA 2V2KA 4QR1A 2ZJQQ 4EBCA 1FCAA 1N34J 4R8UB 3J80U 4ANDA 4I69A 4LSNB 4NMLA 1Q1KA 3QLHA 4EGLA 1SKRA 2E29A 4NMXA 4ZK7M 4ED4A 1N48A 4OHYA 2HHHF 3MMBA 1KQGB 5KFJA 1S97A 1RBOB 1QVGR 3R2CJ 1X4HA 3IBFB 2NUUG 4NA2A 4EBDA 1WJ9A 3FCHA 3C16B 1R0CB 2IC3B 2QJ3A 4FPRA 3E3XA 1JLGB 4QYZJ 2R7SA 5KFEA 3I0RA 5HMWA 4LRBA 3NGKA 5LMNF 4D3GA 2QRRA 4RZRA 2XCPA 3TA1A 2IJRA 1N34F 3PDNA 1VDHA 3MM6A 1TU0B 2OPQB 3LOUA 2RSQA 2YQ3A 3BH6B 3HSGA 5A8WA 2RQCA 4IRKA 4ELVA 4DG1A 4DV1J 4TVAB 3RAMA 3QNWB 3M8RA 1MWZA 3M8PA 1NJIT 1I51B 2HQ3A 4NYOA 3V4MA 1CQMA 3EZ5A 2ZH6A 4DL6A 2Y0SD 5M2UA 1VC0A 4C11B 2QL7B 5DRKA 4X62F 2ZD1B 1KR4A 5HMZA 3M4XA 2OUGA 4YEAA 1YJNS 4DQIA 1OPZA 1ZM9A 1PSDA 3GFYA 5F0WA 5T14A 1DURA 1ZAXA 4F02A 5HMXA 3BPSP 4DV4J 2J9EA 4AMNA 1D8ZA 4UY8T 3DDKA 4DSLA 3HMJG 2EKYA 2DGQA 3M8WA 3THPA 3FBCA 2RDIA 3FFIB 2HVDA 3GIRA 3B8HA 3BBBA 1IXKA 1PYOB 2V8VA 3CJQA 4ICLA 4NEZA 4USWA 1DJ0A 3PVXA 5GADU 1C1CA 5KOWA 4DR2J 2EC2A 2CQGA 2XLJA 2DEIA 4RNHA 3MMAA 3QT7A 3LTOA 4TLQA 4XAKA 3K59A 3SMZA 1JMTA 1U48A 3I4HX 4I2PA 3PHTA 4F3QA 3S7RA 2KM8C 2QYGA 4ED2A 3NGUA 3S6EA 1R0AA 1X4EA 2VHGA 3DM2B 3CCTA 3BN4A 4RWXA 1R43A 2CPIA 4HT5A 4I7FB 4RO0A 3C15B 2UV8A 2I2YA 1YZ6A 2EFQA 2W7AA 3D5MA 3G86A 2I8EA 2MKYA 2V0NA 3L95X 4J9KA 4PWWA 4U96A 1X4BA 1KTVA 3BKUA 2NZCA 2KO1A 2OTLS 1HQEA 3M2VB 1MWQA 2EKNA 2HNYB 2RF2A 4DCJB 3MUVP 4J9RA 4FYXB 1YJWS 4QWDA 2KXHA 4QPTA 3FRYA 3IM9A 2QA4S 4CO3A 2ZHOA 3FZ2A 2CXEA 1PYSB 3MI7X 1W25A 4WZQA 2HS3A 1KP6A 3PJXA 4M5LA 2WVCA 2HNYA 2RF2B 2RAQA 3G2XA 3PX0A 2QLBB 3Q8SB 1FFSB 3OXFA 1SCJB 3CJ3A 3K5LA 4DUYJ 3OW2R 3C15A 3IGNA 4I7FA 2AGOA 2FHJA 3RRHA 4QU7A 2J8AA 2F9JA 2BKPA 3T1YJ 2X7IA 2LEPA 2XM3A 1EZZB 5D15A 2CJBA 3G4SS 1LEOA 2QFJA 1UFWA 2DH8A 2AU0A 2DNMA 1N56A 5C2GA 1V9OA 3CSKA 2YXLA 5EHHA 3BF4A 1SKSA 2R3VA 4DR4J 3MOJB 1BQXA 2SXLA 3D6HB 2CQ4A 2IM0A 4IUFA 3HK2A 4KGXB 1G1XA 2VFTA 1ZM3A 3TZYA 2ILZA 3ZTOA 1C1CB 4H4KA 3EGZA 2OPPA 2V8HA 3UDLA 1KFDA 4ICLB 2UUBF 3OR2B 3PRDA 3POTA 1F3FA 3KJVB 4AQYF 3EPIA 1NK7A 2J6SA 4M5MA 1HKAA 2B8PA 1VHFA 3QYYA 2XNQA 1TP7A 4ZVEA 3PW5A 4DV7F 2B51A 5BR8F 4WE1B 4DR3J 3FRZA 4DFKA 4U8YA 2CA9A 1O5JA 1AUSL 2V2QA 2LP4A 4TU9A 1V3SA 1TL1A 2CJQA 4IDKB 4IQMA 3SSRA 5J2QB 1F9HA 2W2QP 1X5SA 2RJZA 3TNVA 3CCSS 1RT5A 4DOZA 1SB6A 4IO1A 2X1FA 2XLKA 4CO5A 1U1KA 2GX8A 4OJGA 4CLTA 1RAAB 3G71S 3OBIA 4LJMA 4P72A 3HI9A 4W90B 2DGWA 1CLFA 1WDTA 3CW2C 1RHUB 1R7IA 2KU7A 3SEOA 2K3KA 3OHBA 4QOTA 4C9DA 1ROFA 1R27B 3CDBA 2PN6A 3DDNA 3MHYA 3P96A 1IWGA 1YJ9S 1WG4A 1RHRB 5J1NA 1UL3A 3TA0A 4ZLPA 3IWNC 5LL6d 2JSXA 3L7PA 2OI2A 3MMBB 4N41A 1GMUA 2B4PA 3RBXA 4G65A 4FPIA 4R0EA 2FLNA 1LOUA 1WOOA 2OMOA 3WX8A 4ZJQA 1VQKS 3CD5A 2MLXA 4RUAA 3PV8A 3HVTA 1VBXA 1N36J 3NGSA 3R7BB 4IH5A 2FZCB 1AA1B 4M5IA 1EKRA 4Z7YA 3DLBA 1VQ9S 4DFJA 1HBMB 3V81A 3MM7A 1ICEB 3U1NA 4F4WA 5DDQC 1WHYA 3KNAA 4L73A 4CYUA 5F8HA 3PZPA 3HHLC 5KFGA 2BOAA 2CPJA 2IFXA 2K1RA 3ET6B 3AHPA 3R5AA 4I6AA 5E3QA 4YMEA 2XMTA 4B3SJ 4MIBA 4OZ2A 2FD2A 2DNNA 1S1XB 2W2NP 4A46A 4LF7J 3CTRA 3BQ0A 4Q8EA 1RBAA 2RILA 4P7TA 1SUQB 1CJTB 2QN6B 4I68A 5KFTA 3VTIA 3WIUA 5LMNJ 4A8OA 5I42A 1U1OA 2HHQA 4K2JA 2E9ZA 3GLJA 2LQBA 3M1VA 1CEZA 1DLOA 3DRXA 4MK7A 3IAM9 4DV2F 2D1CA 1X5PA 5IQQA 1CS4B 1HQUB 4DX5A 2R2UA 4USTA 3EYZA 4NXMF 5KT5A 3QT5A 4Z7CA 3M6XA 1QVFR 1FJGF 2APOA 4N56A 1RQ0A 2EW9A 1VQMS 1Q79A 5CD4A 4ZLJA 1AZSA 3DRRB 1Q4RA 3OJSA 2CVIA 2D7SA 4K0KF 4A8SA 4L75A 2PEHA 2E5IA 2H5EA 5DLGA 2A6OA 2FHJD 1U6ZA 3RBDA 1U45A 1KRPA 5J2NB 4DJBA 5EGYA 5KG3A 3K89A 3EMTA 4WJBA 3OL6A 2NS1B 3W64A 1IBMF 1O0PA 4CH1A 3E8OA 1S0VA 2NXUA 4XIUA 3R6GB 4HACB 4C0HA 2Z4PA 3ICLA 1H73A 1PBUA 4P2XA 3BYRA 3MFHA 1NEEA 1G3OA 2RDDA 2YNGB 3D67A 4M5DB 4CTAB 3R5GA 3MR2A 1FI4A 1G7CB 3CF5Q 1JJ2R 3HJFA 1KKHA 4DPWA 4TY8B 1Q8KA 2LXIA 1LV5A 1FX2A 1VQ6S 2CPFA 2HQDA 1R8BA 2B43A 4BWJA 3KTQA 3JSMA 3SCJE 4CWBA 4OLOA 2RUGA 1EP4A 2OP5A 1UA1A 1T95A 1SKUB 2RDJA 1NDLA 2C3PA 2ZE2B 3H8YA 3H59A 2R8IA 1KSPA 2B5JA 3OSNA 1C0TA 1D0EA 2JLFA 4NRTA 2JEGA 3WDOA 1UJ6A 4NI2A 2J0WA 3R5BA 4Y65A 3SV3A 1TKDA 4O3RA 3MUMP 2XYHB 1FNMA 2YPZA 1OY9A 1CJVB 4RBTA 3D1QA 4OYIA 4U7UD 4DPTA 3DRYA 3KMSA 4ECRA 4O44B 5CYMB 2VJVA 1WG5A 2GQCA 4QJVA 1RDRA 4GC7A 1Z4UA 2A6MA 2Z2YB 4X4SA 1F9EB 1TFWA 4YB7A 4LF5J 5ETTA 2JLGA 1YVFA 2HFZA 4DL3A 2CAJA 2CDQA 3HFKA 3QQCD 4NYZA 1P1LA 3QRQA 4ZA1A 1FT8A 4BBYA 2HVEA 4GC6A 4HHUA 2UXBF 3H5SA 3V6DA 1NH8A 3BV8A 1SVDA 1UEVA 3DN9A 1I1GA 1UJ5A 1Y5NB 1U2RA 2M70A 4URQU 3RRKA 3MZIA 4A4JA 1UTAA 5D3GA 1TL7A 4GKKF 5K14B 3KMQA 5CZXA 3JTPA 3KJNB 1T03A 3ITHA 1B0TA 2VPXB 5ETNA 5KFPA 1NJWA 4ZN3A 3KLIB 1L3UA 3Q24A 1X9WA 2DISA 2GV1A 3I56S 3RB0A 4L3KA 2DGOA 2FJDB 3NBPB 4DR1F 1GX6A 1HBUB 4JV0A 1SV5A 4YS2A 4M95A 3I87A 5H1SV 4JUZA 5F9LA 2QMUB 3N5BA 3WHIA 3HJVA 1NB2A 1VC6A 1KDNA 1BXNA 4J91A 4LBPA 5DGBA 2Y3YA 1JLFB 3IR5B 1XMOF 4KV8B 1RHQB 1XMBA 3I96A 3LAKA 1S0OA 4C8OA 1F2GA 3N79A 3J81U 3OPKA 5BJRA 1AFIA 2AP6A 2MSSA 5FDLA 1GAOA 1N0VC 4LR7A 2MHNA 1NRKA 4A47A 1SJ3P 4XTTA 1MU2B 3PYEA 3A3OB 2IRXA 3SDEB 4J9OA 1V3RA 2DHXA 4LRDA 5DM6Q 2DRBA 1FE4A 3OVBA 4DUZF 2ZH9A 3GONA 4CM2A 2LECA 3AAWB 4KPYA 2UUTA 2MHEA 3X3UA 4UOCA 4F4AA 3M8ZA 1IR2A 4IG0A 3CC7S 1KQFB 3D54A 2PC6A 2RD5C 5JVHQ 4LSLB 2IDEA 2PMHA 4DQRA 1UVKA 1B0PA 4LT6A 4CLLA 2C2DA 4RW6A 4K7QA 3UN3A 3NS7B 1AB8A 3TZXA 1L5UA 4B3OA 2DCLA 2KTQA 2KZMA 3D1OA 5E3AA 4URGA 1XMOJ 5L1KA 3MEDB 1GNKA 2MZQA 3T19A 2VFSA 2FTRA 3R7NB 4ETXA 4JI0J 2I9SA 1RGVA 4K5SA 1X0FA 1HI0P 3Q22A 1UVLA 1FK9A 2B9XA 5D8HB 1IKYB 2NSCA 2ZNYA 3L9ZA 2BJ8A 4B17A 2XCAA 5J2PA 4X2BA 1PGZA 1JWWA 1RWMB 2YWKA 3IRXA 3PYFA 5ETSA 3FJ2A 3F0NA 3NXZA 2QIFA 1IBKF 2FY1A 3FBFA 1U6BA 4Q0BB 3K8VA 1FX4A 1X9MA 3BSCA 3JAMU 2XBPA 2R8GA 2LQ9A 4MKVA 4MFBA 2JDJA 3MUTP 1GEHA 2DB1A 2XSFA 1EIYB 4A8FA 5ETQA 5HBMA 2UVUA 1GXLA 3C66A 1S1TA 3HHLD 2AHOB 3OVAA 4ZITA 3QAUA 4MIAA 3OT9A 3G6YA 3QFHA 3DXBA 4Q0BA 5HATA 2ZDPA 2E5GA 2DRAA 2ZITA 1J27A 3ADAC 4AFFA 3PW2A 1KD1T 1HR0J 4OFZA 3J81j 4HH1A 2QMXA 1S4EA 2GVZB 2HK3A 3MPVA 1NHKL 4OJ1A 4OX8A 5DG8A 2K8GA 5IWAJ 5J2MA 1D1UA 3J7YU 1Q0NA 3GIMA 5L1JA 3G9CA 3PTWA 4LFCJ 3VVUA 3RU0A 3GJTB 1GXTA 2P9CA 5HVHA 4AL7A 2ZH1A 1VBZA 4DN9A 4ELUA 1HMVB 5J1PA 4ECYA 4KAIA 2DTJA 3Q2TC 4IOAQ 5THWA 2HHSA 1PJ6A 2F4FA 4F36A 3KLGA 4E8UA 4LF6J 4Y2MA 4IG0B 1U7LA 1ZH5A 4TLRA 1N6QA 3RYLA 1VK8A 5KG6A 4UZBA 4LF9J 1SQGA 3MDFA 1N5YA 1RA7A 4OMFG 1IKXB 4DU7A 3HZEA 3PEHA 1U0HA 1LQ9A 3ZNJ1 4A8YA 3L7UA 2AMCB 4NCBA 4KHMA 1OY8A 4G1QB 3VAIA 4Y2CA 4ZCIA 1N6QB 1RWPB 4LREA 4MK9A 4JI1J 3AY0A 2OSQA 5BYRA 6FDRA 4DFMA 1WUUA 3TYTA 2VB6A 4KPCA 1SC3B 3ETOA 3ZFVA 4C2MA 2XY6A 5A0YB 2G0IA 3THVA 4WFNQ 3B78A 1RWOB 3MPWA 2OSRA 2DJWA 2FQQB 2DKOB 1T3OA 5L8RC 4NCGA 2HZAA 3DOKA 1QAJA 4PWDA 3EXCX 5E3PA 4ZP9A 3QSYB 1LFWA 1RAGB 1SV5B 2YKPA 3FCVA 3GR1A 3PJ9A 2GS8A 4V19X 5L39A 1N32J 4MKYA 4YHHJ 1KNZA 6FD1A 2MZJA 4WK1A 1BY9A 1GTEA 1T9XA 2AT1B 2XZWA 1I5OB 1U2CA 2V50A 1UPPA 3ITHB 5K8MA 2AW0A 3SCIE 3PR5B 1TL7B 3SIPB 5AE3A 4M8LA 1DTTB 2V6AA 1H38A 3IR6B 3OXLA 1QD1A 3KFWX 4KY3A 5EX3A 4DI6A 2ZJRQ 4DX7A 2D9OA 4TYAA 5GAGI 4FXWA 3EVMA 3MM8A 5LXYA 4B9UA 3GG0A 3M2UB 2AF6A 1XN9A 1NPRA 1U2FA 1XJWB 2VD3A 3QPIA 4LF9F 3QJPA 1RSCA 1Y3KA 2YWGA 4AMOA 2YY3A 3F41A 2EVZA 3C19A 3IRXB 3IWXA 2ZKTA 2JEIA 1CVJA 1X60A 1U02A 2FC8A 5CYMA 4RBUA 4OQJA 3CULA 1U09A 1CJVA 2KHCA 2KYXA 1O6XA 2BR0A 3MMJA 2IHR1 3ZZ0A 3C8YA 2MZ1A 1WG1A 2BE2B 4X84A 4NI2B 3I6PA 3UN5A 2QEXS 3D68A 3N0VA 2B5JB 1FO1A 1RAFB 3CWJA 3CT9A 2VKRA 3O44A 4J7CA 4PABA 2QSWA 3QRRA 1YTYA 1K1SA 2CNNB 2EEYA 5I3QA 2AGQA 2CZ4A 4LSZB 4QIGA 4JOUA 4LSLA 3JSMB 2BJDA 2GMHA 1UVJA 1S99A 3BGRA 3NGRA 4ZPTR 2EFGA 2DR6A 1FDBA 3GCWP 4IH7A 1FXRA 2GZOA 1HBOB 4KGVB 1Q82T 1OPIA 4ENOA 1U1NA 4CTAA 4WCEQ 4NWBA 4WIQA 4PR6A 2V8GA 2YWWA 3M32A 4KT0C 4KRWA 3U27A 5HMYA 1RAIB 2XZDB 2N82B 2J0QD 2XYPB 2HQGA 1IJEB 1IBKJ 4M94A 4O0NA 4JYAJ 5D4NA 5I4MA 2HBZB 5J2NA 3FEXB 1F5BA 1APSA 1X4AA 2KXFA 3WC2A 3ISND 2VG6A 4WFXA 4USIA 2RQKA 2I38A 1RTDB 2QYCA 1KONA 5KFFA 2RE1A 2HEKA 4NL5A 3TJAA 1IQTA 3U1LA 5HQLA 1FJCA 1DTQB 1HBUA 4IRCA 3GU0A 1UAWA 1AW0A 5KOXA 4G3IA 2P9GA 3RZAA 3C6TB 4W92B 1JXLA 1NU4A 3KLIA 5FLXY 2H48B 3M1VB 4P75A 5HL7Q 2FVRA 1HNWJ 1YHQS 2QLWA 1LK7A 2UVWA 2W4CA 2YWHA 1ZA1B 4ELTA 4MYTA 3KK3A 4ZPDA 3M9MB 3G82B 2QL5B 5K20B 4OHWA 4LF8J 5K5MA 3V6DB 3VGUA 1WEZA 2CQDA 2PFDA 4ID8A 1FWKA 2ABYA 2H9ZA 2K1RB 1K73T 3ZXWA 5HROB 3HVRA 1A0OB 4CLPA 4ID5A 2VU5A 3MM7B 3DLGB 2M88A 3MPUB 3TAPA 4F4XA 4ITSA 2R2TA 4HEA9 3D0IE 1OQ3A 1UWAA 1FKPA 3P5TL 4O44A 2DNHA 2PA3A 4C8ZA 1RT1B 1T9VA 3MEGA 1VIXA 5BR8J 3JQMA 2O01C 4OL8A 1JLEA 1MNEA 1Y9OA 4DLGA 4K4XA 1C0TB 1S49A 2FVSA 1CQNA 2KT3A 2V4JA 2E66A 4RWWA 2ZE2A 4ETZA 4UOFA 3Q8UA 2C2RA 4GKKJ 1ZTTA 1H72C 1H2UX 1NAQA 1P9YA 2CPHA 3T3FA 2R8KA 1VBKA 4J9PA 2D3ZA 2W7OA 1RT2B 2PMWA 4A8XA 3R2DJ 1YX2A 2HRTA 2R7QA 3TAMA 2YNGA 5GAEI 4MH8A 1R6VA 4KYZA 1WF0A 1YJ7A 2ZNZA 4HACA 5KG5A 1S12A 3TI0A 3OUYA 3KOAA 3TO8A 2E44A 4DPOA 2O1PA 5A8KB 2E5LF 4JI2J 4AL6A 5DDPC 2Q66A 3Q8VA 3DOLB 4LQ9A 1S57A 1AZSB 3DRRA 2OTJS 2B8QA 2E1RA 4ECTA 4M5HA 2IPOB 3NCQA 2CNLB 2GQQA 4ZVHA 4WFBQ 2NXNA 4B9MA 5LSRA 4FYYB 3KJVA 1CS4A 3W61A 2WW4A 4CM0A 1NCLA 4C3KA 4P71A 1LWXA 2OPPB 5ETOA 2IMOA 1FDDA 4J9SA 2VG7B 2KT2A 4IRDA 1FF2A 1S5ZA 1VRTB 3DMJA 1NPPA 3BEGB 5I42B 4ECVA 4DSIA 3AJDA 2GC8A 4P2SA 5AT1B 2QC3A 5L46A 3KK3B 2OEJA 4LF1A 2ZJPQ 1RXOB 3NS5A 4PPZA 2UP1A 2OO4A 3IG1B 4IOCQ 1TMJA 2Y9HA 1QE1B 4ZIWA 3BQ1A 2QLJB 3TWZA 1LFPA 5A6WA 2PFFB 2D41A 4UQGA 4CYUB 3M05A 4DXLA 2HS4A 2JLEA 2C42A 2KKHA 4H4KC 3ZTRA 3Q23A 2F9DA 2DO4A 4FF3A 2KHDA 4XDCA 2QLFB 2HQIA 2XZTB 2CG4A 1IR1A 3CB4A 3HVTB 3PIOQ 4RW8A 4UW2A 3MD3A 1VBYA 1SL2A 1Q5YA 2EPIA 4QIEA 5F8MA 3DGVA 2WCXA 4Y2AA 1Q16B 2JC1A 1X4CA 3GB0A 3KUEA 1TKXB 4OYXA 3FDSA 3OR1B 5F9NA 3H4BA 2VUGA 1R8PA 4ZVFA 3PY8A 3R27A 4PXBA 5AJ3J 3AA8A 1QSYA 1Z2LA 1XERA 4M5NA 3BJYA 1L3SA 3M2VA 4ANEA 2X1GA 2BJ9A 1N8RT 2BBEA 5L9NA 2NQPA 4PG7A 2WVEA 3CJ0A 1U1QA 3BBFA 5AXMA 2QO3A 4R5PB 2CWXA 3VHQA 1DFDA 5LT5A 4ECZA 3HD2A 1N33F 2BE7D 2EWHA 3B4MA 2ZM6F 1LWEA 4X4RA 4HTIA 2DNKA 3UQSA 4DZ6A 2W8LA 1NHUA 4X66F 4C8NA 4PWUA 4N8NA 5J2QA 5HP1A 1UVMA 1HD1A 1M1HA 3H7HB 3I5AA 2R7WA 1YI2S 3CJKB 3CC4S 1WEYA 2YX4A 4WTOB 3K7RA 1FWLA 2CJKA 2MY8A 1Z2ZA 2WOMB 4WE1A 3VVTA 5HSPA 3AOBA 3FSXA 4FKYA 3MCSA 1SKWA 3D6TB 4Q8FA 2XS5A 5B7WA 3JAMY 3HHKA 1N5SA 2HWTA 1KWMA 2C2KB 3X1LB 3K5NA 2AJQA 2PO4A 3OR2A 3FFIA 3POTB 4ZDNA 3GV8B 2LEAA 3EM1A 3QWPA 2B4OA 4ZP6A 3WBZA 2VBXA 2AJ4A 3ISZA 1FD8A 4DX8H 5C5JA 1VOMA 2V9KA 3AD7C 2HHHJ 2J5AA 1LKZA 4DDFA 1XR5A 2WOMA 1QLNA 2F1FA 4B3SF 3EDRB 3ZNUA 2ZD1A 2AEMA 3EICA 3CJKA 4C11A 4HKQA 3MR3A 1RWVB 2F8MA 2MQLA 5DQHA 5HP1B 1F60B 2QMWA 1T02A 3CPWR 4FYVB 5A8WB 1D09B 3O6QA 1S6UA 1OS5A 1OO0B 2JNJA 3DU6A 3NEKA 3UR0A 4R5PA 2W9CB 5IXUA 1TK0A 4NXNF 2UUWA 2AZ3A 3LALA 1QY7A 3MF5A 1SL0A 3U7JA 3CMES 4DN0A 3OFEA 4DSJA 2NCKL 2Q79A 3GYXB 4D3HA 2OKQA 3IN5A 4F25A 2F3JA 1HW9A 1NMEB 1IKVB 2C1EB 3LAMA 2IC3A 3AXKA 3Q2SC 4YFUA 2Y1RI 4CLFA 3GJRB 3IWLA 4F3MA 5K8PA 4YP3A 4DLEA 1T7PA 3AB2B 1B7YB 5KT2A 1TKXA 3BR8A 1FE0A 2FY8A 3AODA 1JNZB 3D3CJ 3QLHB 4ALZA 5DDRC 5KFQA 3M6VA 4RW8B 1RKJA 2W1BA 1WHVA 3A8IA 4RU2A 4K4ZA 3G8TA 4OV1A 4K4TA 1QSLA 4KH1B 1QAXA 3OXGA 2J8SA 3FBBA 1E6VA 2ZH8A 3DM2A 4RL1A 3VWSA 3OLAA 3ZC4A 2B6AB 1A6LA 1NDPA 5DZ7A 4YB5A 2OFGX 3SCLE 3EX7B 4XPCA 4FBUA 2DNPA 4V1Ak 1NJXA 4WK3A 5KFSA 3IG1A 1RHJB 4DF4A 2XQCA 2FHOB 3T5KA 2E1PA 1SH0A 4B9VA 1KVIA 1RLCL 2EBEA 4DR3F 4L76A 5IV3A 4FF4A 4WZMA 2GO9A 2E1MC 2PIIA 2VG7A 1UWBA 3LP1B 3NKYA 3QT8A 4HDHA 1JLBB 4P10A 2AX1A 3LA0A 3QO9A 3GE9A 1NJYA 4QYZK 2Y8WA 2IJNA 2JVOA 1U1LA 2H5JB 5K8OA 3RB4A 2UUBJ 5CD4H 4AL5A 5CQGA 3SQOP 4ZLLA 1L3TA 5CAAA 3H4DA 2O67A 5B0BA 5IT9Y 2GQ2A 5LOQA 4OHZA 1K1QA 5A8KA 3SV4A 5HVGA 4DQSA 1RYRA 1Q95G 3EPGA 4B3MJ 1FRKA 3EVWA 1PC4A 4LFBJ 1LW0A 4O4RA 5G0RA 1UW9A 5HQ8A 2KH9A 4P2MA 9ATCB 3THTA 1O8BA 2I5JB 1F1BB 2Z2MA 2K06A 2MB0B 5GMDA 2XMUA 4EWTA 3D7SB 5BYQA 2VKZG 3DYAA 5KFWA 1WELA 2HQFA 1HHQA 3CIZA 1YDLA 3RAXA 1HHTP 2JEFA 4AMMA 4K8RA 2YKAA 3N5FA 3WIVA 4DPUA 1NKEA 4ATNA 4DL5A 4DR2F 3VZIA 2K7JA 3I0RB 4DV6F 1JLGA 1PAUB 1VQ4S 2HYIB 1HNWF 2M9KA 3MR6A 4HYKA 1WOPA 2LU2A 2V4JB 4JI7F 1AT1B 5KFAA 2HW3A 2GJ2A 4ES3A 3FVYA 4CDIA 4ZHRA 3C46A 1RE1B 2B56A 4N7TA 5B09A 3BO4A 2NZ4A 2L9WA 3CEDA 4OZ5A 1R8CA 2MKJA 1V5IB 1SC1B 4LSNA 1VISA 4R8UA 2YQ1A 1FKPB 2MQPA 2QX0A 5D0HA 2DR7A 2ZUAA 4O4GA 4HI1A 2XG8A 3UDCA 1AROP 3DLGA 1RP5A 1VK3A 4QWEA 2DCUB 3MAAA 4ID5B 2HVIA 4DV1F 3KK2A 3V5RA 1N5VA 3TUJC 4UF4A 4C48A 3N4WA 2XHWA 3H42A 2J0SD 2YNHA 3DRSA 3DHXA 4QZVB 4ZPWR 5IOLA 3G82A 4FYDA 3P45B 4NRUA 5FLXU 1F2HA 1RKIA 3N28A 4JI4J 3GWCA 2DGVA 1PAEX 2HNZA 1WOSA 1TK8A 3NP5A 4PG5A 1AFJA 4DF8A 4J37A 2A2DA 2UXDJ 4Y00A 1LWFB 2VDIA 1NDKA 1M5SA 2G2ZA 2G1DA 2MMYA 3J7ZT 2YNFB 3R1LA 2XGQA 2DNRA 3JXOA 4DV4F 1WACA 1LWCB 1L3KA 2WZ1A 1RTZA 2OLWA 1RTDA 3T5JA 2VG6B 2J9DE 2DXEA 3OTCA 1GMWD 2CNKB 1WC4A 4FVMA 4PXCA 2WVFA 4N5SA 2KFYA 3K5MA 2OIHA 3OFFA 2EFPA 2F8HA 4A8KA 3GIJA 2AYBA 4KO0A 5HJXA 2ZHBA 1RZMA 4DS4A 4F7VA 1FTCA 3CCZA 1W7WA 3KK1B 3DKDA 2ZC4A 3CJSA 5ETMA 2ZM6J 3M32B 3QT6A 2OHDA 1BQNA 1F6TA 3OTOF 3KLHB 1RTJA 1YJVA 3HHDA 1IBLF 2W4DA 1E6YB 3R5DA 4ERDA 4DL0C 1UCNA 4DFPA 4EFAC 4C8LA 1URNA 3UNGC 4JI4F 2WVBA 4OJ3A 5IC6B 2D3O1 5DZ6A 3FQKA 4OYBA 3QIDA 4CO4A 4X4VA 3IR7B 2WAQD 5E2QA 1UJ4A 3IBCB 1S6PA 3NL0A 4MAKA 2BDPA 1OQ6A 1RLDA 3QATA 1SBRA 3R9LA 5FJ4A 3TRGA 3KLFB 2HFSA 4USVA 5HN0A 1D8YA 2HPUA 4KHPF 5KFYA 2ALYB 2WK4A 4ED5A 3MEKA 5F8NA 3BS9A 3U02A 2I0XA 4PG4A 4YQWA 4DR7F 4ECSA 2X3GA 5KFMA 3PO5A 1YKWA 4F04B 1KN6A 2YX7A 5LMUF 2MZTA 4LVOP 3VQSA 5A8RA 2VBZA 4JI1F 2J76E 3NY0A 4NE9C 4OYWA 4FN5A 1HWUA 3M2UA 4OHVA 2BUNA 3AQPA 3I5CA 1OMSA 2DHHA 2JZ5A 3E01B 4P9SA 5E41A 5HLFB 1GXUA 4C3LA 1TUGB 3LGNA 1PCAA 1DTTA 2JH3A 2YKMA 1MMLA 1HNIA 2HMIB 3CDUA 1S1UB 1REVB 2EFNA 3M6UA 3RW7A 5K8NA 3M9OB 1V3ZA 4LF6F 3GR0A 5EWGA 1HI8A 1TVRB 3FK4A 5H9FK 5KG1A 3B4DA 4DQPA 4NLXA 2LLZA 1TL4A 2NYHA 2AIRB 4LIRA 1Y00A 4C97A 3V4IB 2OD4A 4LFCF 1WDDA 2EFVA 4IQXA 1X9SA 3DOKB 4PG6A 3C6UA 4IFYB 2NXJA 3UPFA 4KB7A 2OEKA 3ZTPA 2AQ4A 3NG8A 3ENAA 1B4SA 4JI2F 2E5LJ 1WF2A 3PX4A 5A0YA 3QGIA 7FDRA 3RUBL 3RJMB 3V6KA 1TUVA 4OYZA 5EWFA 1HNZF 3AD8C 2AX0A 5B0FA 4ZVGA 2A3JA 2Z30B 2DIUA 3HCXA 3H5UA 4M1KA 4RPFA 4WFAQ 2IYGA 3QGGA 3OJUA 2VA2A 2MGZA 1IM6A 2DHGA 1N5YB 1DQAA 2LMIA 3BGUA 4F2SA 2WONB 4EU0A 1TKZA 1U0SA 4CIOA 4ZVTB 1WHXA 3KLVA 3UW1A 2I1RA 4HL9A 1NK9A 3NMRA 1ITPA 2NXEA 2CQPA 1FJ7A 3D0GE 4OX9J 1IJFB 1TAQA 4WU2A 5D78A 1BE4A 1OIAA 4ZPCA 2VICA 1Q78A 3LGHA 4WFZA 4ZPAA 2DGUA 1F5AA 3OL8A 4KKOA 2RHQB 4ZOSA 1YLXA 3M6WA 1H74A 2KJWA 2GVZA 2CPDA 4LUBA 4OI3A 4YDXA 4AXJA 1GMWA 2GIQA 1DQ9A 4OHXA 2DGXA 2MLZA 2FLLA 2Y1LB 4PKDB 3CIMA 3OTBA 3TW0A 3PW7A 4X4TA 4UY85 2V8DA 3D6MB 2J7UA 3OQ2A 1S7HA 3CCJS 2HFOA 5F41A 1PJ5A 1FKOA 5I3PA 2XMAA 4K5RA 3CCRS 2MZRA 2DY9A 5HBMB 3Q89A 3WX4A 2YTCA 5A6PA 5MAOA 4LF8F 3RR8A 1TZ0A 2LA4A 2K7KA 5H9FJ 1NK4A 1XMQF 2VA3A 2VOPA 2CQIA 3EXYA 2X1AA 3H5YA 1RT6A 5B0EA 2KB2A 2GHPA 4CNYA 1P9QC 2XYGB 1RUSA 4WWSA 1FHTA 2PGCA 2BVZA 2QA1A 5KG4A 4A8WA 1FK9B 2HBRB 2ASDA 3JQKA 2XI2A 5LM7E 5E0OA 3MEDA 1ZZNA 4UTGA 1ZS6A 4Q43A 3BSOA 4B9TA 4J9MA 3V6JA 2JFDA 1RB0A 3VAMA 4K4UA 5F8IA 4Q44A 2HHTA 1KLNA 4RW6B 1Q53A 2BA9A 5IQ6A 3OL9A 1HW8A 2HAIA 4A8MP 5CZCA 4NLQA 2OMLA 1R6YA 3W65A 4DV0F 1GTHA 2NPIA 3HHLB 3EGWB 4BDPA 4NEYA 3I31A 2JVRA 1UFLA 3LPYA 4QPXA 3HSJA 2BZ2A 4ECUA 2H4YB 3EGVA 5ETPA 1CG2A 1VYAA 3UE2A 1QJHA 3KG4A 2XMVA 5EDWA 3BO3A 4C8YA 3NAHA 4OYPA 2VBYA 3SDEA 3T6BA 1MU2A 4J5OA 3SYZA 1N0UA 2Q3PA 1J5OB 3EZUA 1K47A 3BYPA 2IM1A 7FD1A 2QFIA 3LUYA 1R31A 4KV8A 1RAJA 1SXLA 1JLFA 4UUXA 4CQ1A 1EKSA 1XBWA 2CPXA 2PSZA 1BWVA 2HNDA 2KVIA 3GPAA 5JXSA 2R2SA 2ZHAA 5I3UB 1FVQA 3IA0A 1VLYA 1CC8A 2XEXA 4Y28C 3RR7A 2DNYA 2FHMA 2P5VA 4OI2A 2ZZTA 5LJ3Y 4G6VB 1T03B 1S9GB 3DU5A 3IC1A 5CCMA 3Q83A 2QT7A 5D3GB 2YWEA 3DI6B 3MECA 1NH7A 3M9NB 2CG8A 2RRAA 3QGHA 1LNQA 4MKAA 3RG6A 2HWIA 2VG5B 4O0IA 4UOHA 2B0GA 2VZ9A 1FDNA 4P2FA 4BS2A 1M1GA 3TQEA 3WC0A 2DK2A 2DO0A 5F8GA 4JI3J 1ZOTA 4NA3A 4AE5A 4AXIA 1AUDA 4CZCA 3KJQB 3H25A 4JV2A 1H0HB 1VQNS 2EK6A 2O66A 1NDCA 1XNRF 2NUHA 3W60A 4YHHF 1U1PA 2HZCA 4CRJA 4JV5F 4KC5A 4F0HA 2BW2A 1B99A 4RW4A 1B0VA 1HHSA 2W2OP 3HHNB 2HGNA 2WW8A 1FJGJ 1XK8A 2CFXA 4H4OB 2ACYA 5C25A 1U47A 2PA8D 3WZ0A 3ZZTA 1VCTA 1HBNA 3R7SB 3PR4A 4YY3F 1XNQJ 2JHEA 4Y34A 3TX0A 2AD9A 1Z1ZA 3UR3C 3PYGA 1Q7LB 2RB7A 2DNGA 2ATCB 1N4LA 1RABB 1F0XA 2BQ3A 2WRMA 1Y3JA 1CBKA 1JXVA 4FXVA 3B82A 3RBZA 1NJZA 3HPOA 2COLA 3DRPA 4PZVA 1FRIA 2IJFA 3NLCA 2A2CA 2BE9B 3OTDA 4URSA 4CLUA 1WNEA 2IIHA 4CH0S 3VAJA 1HLWA 1SJ1A 4J9VA 3KDNA 2F40A 4ZIVA 2QG9B 4EK2A 5GAHU 1RTHB 2ZOMA 3DLKB 1VMBA 2W25A 3O1LA 2BYCA 5D4OA 2HHPA 4BWMA 4LRFA 4GVBA 4DUTA 1T3NA 5DJBA 4WIIA 4F0MA 4RU9A 1B7FA 3GILA 3L3CA 2ZWPA 2IRUA 1N36F 3GV5B 5CZVA 1Q8IA 1ZPWX 2GIRA 3CC2S 3SI8A 1NM2A 3FSYA 2F4VJ 4TN2A 1BLUA 1T9YA 3MURP 3RGIA 3AJ1A 4DPYA 3W9IA 4X4UA 5B0AA 1LK5A 2MTLA 3MR7A 1DLOB 2A1BA 1EQ0A 2FJBB 3CDWA 2Z0GA 4DQQA 1CJKB 3ONQA 2DGSA 2JFKA 2J6UA 1BGXT 1RISA 2M2BA 2RMLA 3MCNA 1N54B 1SUQA 2AWZA 3NOGA 3HKWA 1BQMA 1J5EF 3BDPA 3SQGB 3T9NA 3W9HA 4FS1A 4GMKA 4C8KA 3TQ1A 1S1XA 4UOGA 1FNOA 1SC4B 2JC0A 2EFOA 3GP9A 4WTYA 3UI3A 3HKZD 1VI7A 3A12A 4CLYA 5C42A 5AXNA 2M7SA 4OZNA 1X7VA 1S9FA 2XMJA 2BANA 3R6LB 1D9AA 4PXEA 1NNDA 3ZZRA 1UETA 3L4BC 2PI5A 2BMBA 3V81B 4HI2A 1CPZA 4I67A 2KI2A 4CO1A 2RS2A 4PQUA 2Q1LA 3FBEA 1CJUB 4C0OC 3CCUS 4P74A 1AYEA 2CQ0A 1WC3A 1U8WA 2WSCC 1UZDA 3G6ES 3MAQA 2DHSA 4ED7A 3QWUA 4DV7J 5EUHA 4RW7B 1O51A 2ZBRA 2GA7A 5M2PA 1CULB 1HQ2A 1LW2B 3FZBA 4R0JA 4PYAA 1PO6A 3DGPA 1NXIA 1K8AT 5DDOC 1S7IA 3TEGA 3RW6A 4ZVRB 3G6VA 4U9RA 4WKRA 4NLRA 3GTYX 3ILOA 4PQUB 1S6OA 3DLLQ 2J0XA 2XO6A 1RT5B 2R8JA 2BANB 2KVQE 3ILJA 2VPWB 4RW9A 3MFIA 3CCMS 2DD8S 5C42B 2O5DA 1TL1B 1FFWB 4IDKA 4DL4A 7AT1B 4ZP8A 3T1YF 1VQ8S 2GJIA 1WEXA 2RIJA 2ZVIA 5IT4A 2N7YA 4Y3CA 3M8SA 3D2WA 3SQGA 4X4NA 5CH7B 3CNQP 4NYPA 3W9JA 2LKZA 1HWIA 4KTQA 2AJFE 5IM0A 3K58A 5K9FA 2ROGA 4MTPA 3CJ5A 5ADZA 2OPSA 3W8PA 2KRBA 4DR1J 3W8GA 4NLOA 2W01A 2MXYA 3OTEA 2C3UA 4TKTA 3HLUA 3W7BA 3HP6A 3T6JA 2P8IA 4N76A 3HM9A 1RI7A 2MEWA 3SFUA 1PKUA 4ZVPB 5GADI 2RU3A 4FS2A 5CXTA 5B0CA 5BXIA 4HDGA 1SC6A 1HWJA 1MLAA 3ULHA 2UXBJ 4PWDB 1RTHA 2VFVA 1HFEL 3NNHA 3MM5A 4OZJA 2ZH2A 5IS2A 2C3YA 2K3IA 2GMLA 2XY7A 4IKAA 2BQUA 2ZZMA 1VQ5S 3KDOA 2HFUA 2IM2A 4NX9A 2HWHA 2VC1A 3MR5A 3CJTA 1Y0HA 2VOOA 4WFYA 1YITS 3DXSX 3G6XA 5IT9U 3DLEA 4I1TA 4CLKA 2QTWA 4ZCMA 2CRLA 4YB6A 3S1TA 3TUZC 1Q8LA 3LWLA 8AT1B 3QBCA 1SH2A 5C24A 4ZN1A 1RBLA 3BGFA 3SBMA 4LQ3A 4RUBA 4DU8A 1S10A 5C2CA 4MYUA 2DPJA 1S9EA 4MMOA 4OZ3A 3CD0A 2HKEA 2R8HA 1DZ5A 1HQEB 3B6BA 1TAUA 4TU7A 2IMWP 2BOPA 4RNNA 2YH0A 3EDQB 1UVIA 1R3NA 3ZTSA 1SL1A 1XQIA 3UCGA 1UFKA 1YJTA 2MDAA 2LVWA 5HJYA 2AYEA 4YB1P 4F8RA 2MKHA 2KG1A 3RAQA 4RX6A 1V6HA 4EO6A 1R0AB 1B64A 2IY5B 2LQJA 3ENQA 1F9FA 5L1IA 2BM1A 4WF9Q 4I2PB 1YWXA 2EI5A 2EG2A 1RWUA 2L08A 1Y7PA 3JQJA 4Y2IA 2ZZNA 3E2EA 1RACB 2AKWB 4AD6A 3MAHA 1H98A 3J7YI 4C3MA 2HHXA 3MMAB 2M8HA 3HFZB 4H4MA 4U6PA 1RWWB 1URRA 4YN3B 4JI8F 2EXUA 2L48A 4DR7J 5KT7A 3FEZA 2IA0A 3CXCR 2D74B 3KHRA 2GAGC 4KHPJ 1N5QA 1Q86T 3JB9k 2IA6A 4WP3A 2C2MB 5AXLA 2MKKA 2ZH4A 4K4WA 2R7OA 4X4PA 5F0UA 1VQPS 4DWIA 1UP1A 5HQMA 1JIHA 3R5JB 3GQCA 5LSOA 4MIWA 1RA6A 1T05A 2F63A 2Q43A 3A8KA 4P52A 4TYBA 4J9NA 1S0NA 2ZKUA 5FIIA 3OD2A 1YQHA 5HAOA 3HXMA 1J5OA 2ROPA 3TR5A 1I94F 2HHWA 2DNOA 2C3MA 2GGPB 3KHHA 3M8PB 3S01A 4CT8A 2ZH3A 3HT3A 4DG1B 2YH1A 3ZZPA 5KG0A 4ZJLA 2HSEB 3P4UB 2VQFF 2OPQA 3MM6B 3FKBA 1QAYA 1RCXB 1ZA2B 2GHVC 5IFMA 1M5PC 4HT7A 4KH0B 1P8GA 3HHLA 2HVZA 3ENVA 1TK5A 3H90A 1WKKA 3LGMA 1JXEA 4WYLA 1UEKA 3HD1A 3IS9B 1UMJA 4L74A 4W98A 1DAXA 5D4PA 1VLOA 4EUVA 5KFOA 1U1RA 3C16A 1DBDA 3FUYA 4FF2A 2DEJA 1RT7B 3P3DA 1FXDA 4EYHB 1HPZB 1P6TA 3QAEA 4USKA 1X31C 1YJUA 2FDNA 4GO5X 4NLPA 3W2VA 3Q0AA 3A4TA 3IRWP 4TU8A 2C22A 4B3TJ 2L3MA 1QUVA 2G1HA 3BB5A 1JX4A 2ILYA 2UXDF 2E5JA 4LF2A 1RU1A 2OEMA 2GFFA 4K4SA 4F50A 4AMPA 2CVEA 3U1MA 5E5NA 4PG8A 1NBEB 1S1VB 5C7PA 4F4YA 4FP9A 1HNXF 1WI8A 4PUOB 1YK9A 1OJ4A 3MTJA 1OSCA 1KLMA 4P6QA 1REGX 2POKA 2BXJA 3GFZA 2Y1JA 1VHIA 1FKOB 3D28A 1K9MT 1JLAB 1YIJS 2JL9A 2XTJP 1KBRA 2WSEC 2GVDB 2HIYA 2X3DA 4DV0J 1C1BB 3KLEA 1X8DA 2XULA 5B0DA 3HVWA 4X64F 3J80Y 3CD7A 5DQGA 4TQRA 1EETA 1X4FA 4AQYJ 3CUNA 1S6QA 2MQMA 5E33A 2XI3A 3VF0B 8RUCA 4M5JA 2N3OA 2XC9A 4DV3F 1WHWA 2W9BB 1HYSA 2AEJA 3LANA 3H98A 4LMZA 1QAIA 1IUJA 4OZ1A 1NK6A 1B3TA 4LR9A 3UVJB 1VR6A 3ILIA 3QIPB 2MKSA 4FF1A 2QA4G 4NLTA 6AT1B 4JI5J 3UDEA 3CCVS 1XMQJ 2OGUA 4LR8A 2R9LA 1P27B 3M8YA 2IVYA 4B3RF 5KFCA 3QJJA 2YKOA 2F7VA 2WVDA 2XLIA 4NLGA 5EWEA 4EYIB 3I0SB 3N6NA 4BC9A 2UVVA 1S72S 3ZZZA 2HFNA 1MROA 1H2TZ 4E2FB 4DUYF 2FJAB 2IBKA 3M2RA 3MPDA 3IFEA 5T7LB 4XO0A 3DCAA 4JB8B 3IMQJ 4J9UE 2BQRA 4B3MF 4M5GA 4LFBF 1ACMB 3SZ2A 4QCLA 1YGYA 3Q8PB 3W3SA 1JLCB 2V5HG 3HDSA 5D0RA 4DPXA 3OHAA 3LP2A 5DG7A 4WP9A 2ASYA 1ZPVA 3C6UB 3V6HA 2NR0A 3UDVA 4ZPBA 3NMAA 3PW0A 1C0UA 2AYMA 1J2VA 2DT9A 3C14A 1S1WA 2LXFA 4U95A 2VPYB 2VFUA 3LO3A 3PEJA 4KJIA 1K0TA 5J1EA 2XSJB 1WKLA 4QIWD 3DC2A 4ZJOA 5KFKA 4X64J 1S1UA 3PHEA 1Y5LB 5CYQB 3BH7B 1HNIB 2DNLA 3LQVA 4LFAF 1GH8A 2VQEJ 2YKMB 1G2EA 2PE8A 3A3PB 4HHHA 5HLFA 1YRUA 3N6LA 3EWGA 1D9DA 3T1AA 3TZWA 1QTMA 2WTFA 2W9AA 1A7GE 3M8QA 3R97A 2HZVA 4X65J 5A8RB 2V4RA 3D0HE 4B3RJ 4C98A 4IG3B 2VONA 2O3DA 5CYQA 2UU9J 4ED8A 4JI5F 2R2RA 1SQFA 2YNIB 4E0DA 4LF4J 3D3BJ 2XSJA 4PEOA 4L3NA 2F5GA 4HR2A 4OLPA 4RNMA 3KHGA 4S0MA 1UVNA 2R7RA 3C14B 3EGNA 3TX8A 3AXMA 4F4KA 3DOMA 1C0UB 3O8WA 4O3SA 2C2EA 1JNRB 4KGMA 4DV3J 1U8SA 1YZ7A 4NPOA 3KXDA 1GT8A 1XWLA 1FKAF 2IAJB 3GSDA 2NXCA 3ZO7A 4QR2A 4X62J 2U2FA 2CZ9A 2R7TA 5KG7A 2HS0A 5T7LA 1HA1A 2ZOFA 4U7UK 3QJLA 2VV5A 3H2LA 4UUWA 2W2PP 1PJ7A 1U49A 4NXNJ 1GQEA 1C4CA 1BQNB 3KLHA 2DBBA 2UXCF 1XEZA 2V69A 2WHOA 3I0SA 3T5HA 1T11A 3VGTA 3UFCX 4K59A 2G4BA 2RQMA 3IXQA 4DR6F 1OYEA 4AYBD 4QYRA 2C2OB 1TR0A 1W26A 2QE5A 2YX1A 8ATCB 1YRXA 2GNKA 5CZDA 3BR9A 4I0WA 4ZCLA 3VGVA 3I4PA 5HK4A 2OAUA 2CPEA 4O3PA 3AD9C 1ZYQA 3MTKA 2BJ1A 1FXLA 1LWCA 1MW7A 3PACA 2XMWA 4U8VA 1UEUA 1JJCB 4ZS6A 3GIIA 2A0FB 3J7A1 1ELOA 2YNFA 3AJ2A 1U6FA 3DOMB 4I56A 4JP8A 3SSSA 2W9BA 1GX5A 4F2RA 1S6QB 4DCPB 3NCPA 4IR9A 2VC0A 2BABA 2DYAA 4OYAA 1LXNA 1T94A 2YNIA 2ROEA 2HNZB 2DRDA 2FGOA 1SJ4P 1C1BA 2H3EB 2F8EX 3PXGa 1RAEB 2LQ5A 3KJFB 4IG3A 3K5OA 4NZ0A 4NLYA 1FDAA 1RHKB 1YG0A 4DR5F 3M7VA 4DR6J 4OX6A 1VJQA 2YNHB 1RWKB 3HF5A 4P7VA 4EBEA 3CDEA 3CCLS 2G13A 2QZ8A 4KHRA 4NZ7A 2B4VA 5DG9A 4FYWB 1VC5A 2YVSA 3MAAB 4FNIA 1S1VA 5JJBA 3OFHA 5KFXA 4C8MA 4USHA 1I94J 4M5KA 3VR1A 5A2QY 1RYSA 1NO8A 1M90T 2DIVA 2ZOGA 2Y8YA 1FRMA 2H54B 1TKTB 4CT9A 1VQ7S 1C4AA 3L7OA 1YBTA 3DFEA 4NA1A 4DL2A 2FJWA 3PCOB 1JJ4A 1S1WB 3A13A 3K2YA 4KGKA 1YSJA 4WPAA 4ZHRB 1HPZA 4QIVA 4DS5A 3AOCA 1RT7A 1RTIA 2DXDA 5AJ3F 3K17A 4IFVA 4O3NA 4ZMMA 2DR8A 2Q6CA 5IC4B 3C3LA 1W2IA 2VDHA 3LP2B 3NWRA 4KFBB 3B54A 5KFUA 2LYVA 4QIFA 4CO2A 1NK0A 3IS9A 4PYDA 4ECXA 4P73A 3W2WA 4H54A 1U1MA 1KVKA 4ZLNA 4L6V3 2V2VA 3ETMA 1R0BG 2J7KA 3QZ7A 2ERRA 3FNNA 4IH6A 3M2RB 1GFWB 4K4VA 3GIKA 3MCMA 2QLXA 3DYAB 3QSIA 3NS6A 4FZVA 1JKHB 4NLVA 1I6JA 2UXCJ 1X0PA 2J7WA 3BKFA 1KQKA 3LP0B 1N5TA 3CCES 4A8QA 4ED1A 2AJ0A 3EZOA 2DNZA 2KN4A 2WBMA 2VQEF 5G0RB 1LW0B 2R7VA 1Q5VA 3CVKA 4NLSA 3GZ7A 1TV6A 2F65A 3JTOA 3L09A 3BM7A 4PRFA 3CCWA 2B3TB 4OIXA 2UV8G 2FVPA 1SIZA 2OFHX 3QIPA 3W62A 2BKNA 1KS2A 1HI1A 2YKQA 5KTQA 2YQ0A 3GFHA 4PCQA 5GVQA 3GV7B 4FBTA 4ES1A 4B9NA 1KC8T 1HYSB 2V34A 4TY9A 3OFGA 5E3CA 4KGZB 1LXJA 4U67Q 2NREA 4LF4F 1EETB 2ACMA 1JLBA 3QFWA 1CSJA 1UWBB 1PBAA 2BM0A 1PILA 3LP1A 2QA2A 2V2ZA 4B08A 4H4MB 4CLZA 3MOZA 1VRUB 1VJWA 2GVDA 2E7WA 4YUDA 2RKIB 5HI7A 5D77A 3H40A 3T41A 2C2ZB 2JOQA 5F3ZA 3NAIA 1RT3B 2E7XA 2QSFA 2OPRA 2BKOA 4IO9Q 2AJ2A 3W5XA 2G2YA 2VBWA 2Z2LA 2B6AA 3QMQA 5L1LA 2KZZA 4LFAJ 1NLKL 3PRBA 2GJFA 4Z37A 3F73A 2HHUA 1RCOB 2KL8A 2LDIA 1NSKL 3H20A 1Y11A 4HLBA 2DH9A 4ECQA 4RNOA 3TARA 2RVJA 4XK8C 3SCKE 3VQTA 4BC7A 3GSIA 2GHWA 3GMGA 1X5TA 3RBEA 3PFEA 3W2VB 1S9EB 2I6WA 4QW9A 4DL7A 2OJ3A 2EC0A 2VODA 2DY1A 4HH0A 4QQBA 4XDDA 1T8EA 3BZQA 1IKWA 1YBUA 2UZAA 1XR7A 3HSDA 1IR0A 2L9DA 4QWBA 2QV6A 5C24B 5L38A 4WU3A 3A1YG 3OLBA 2NYIA 3MMCA 5DLFA 1IKVA 2GO8A 3TUPA 3IO1A 3UO0A 3P49B 2UUAJ 2KG0A 2GW8A 3D9BA 4QW8A 3VZHA 3KG1A 1SIWB 2FGCA 1RT4B 4AUKA 3M30B 4ILMA 2BRLA 4RBVA 2W9CA 3BSAA 1M0SA 1T9TA 3EUNA 4LBIA 4DCOB 1NKBA 5KT4A 2CDRB 5KFVA 1HNVA 2ALZA 3CD6S 1HNXJ 3MM5B 2GGPA 2HLUA 2LFVA 2B9WA 4ZPVR 2EG1A 2V8PA 1VGYA 1XTZA 5KFDA 1TTHB 2XWXA 1NHVA 1T05B 4HTJA 4ZVUB 4DMZA 3HZGA 4DV5J 1EJ7L 4WXWA 2AZ1A 3EE3A 1QUPA 3GJSB 1NB7A 2G0CA 4NLDA 2GCFA 1U25A 1T9UA 2CZVC 2CJYB 4HVZA 2UUCJ 3T5LA 1TL3A 3NOCA 1WSVA 2R7XA 1Q7YT 5CYJA 1MMNA 2RS8A 5IM0B 1QSSA 1DARA 3LF0A 4JI6F 2MJNA 2JX2A 4JV1A 1Y4ZB 3MM9A 4J90A 3MPYA 3CMQA 3GCXP 1FTRA 2HHVA 5LXRA 1ULRA 3N9UC 4ZP7A 3AA9A 5JUMA 3JYTA 1MWYA 2C3OA 3BGOP 3CDAA 1JJHA 4RW9B 5EX0A 1ZTWA 1S79A 2HBQB 2P9EA 2PI4A 1LWEB 1RADB 3RB6A 3FMWA 2IYIA 4X4QA 2VIHA 3A3NB 2EBGA 2C2NA 3GFXA 4UQTA 3OVSA 3D4JA 4F4ZA 3JS9A 4U7CA 2FZGB 3AT1B 2LXUA 1FFGB 2HK2A 1RHMB 4IYQA 1EX8A 1OSDA 4G1PA 2YKNB 4KIAA 3J81Y 1VQOS 2E1CA 4B9LA 3O3LA 1DQ8A 1A9NB 2X1BA 5AXKA 3W5ZA 1LW2A 1GK8A 4MKBA 3PG9A 2XGPA 2MKIA 3BO2A 2Z56B 5CCLA 5DS7A 4EO8A 3AH6A 5DGAA 2QGFB 3OR1A 4FKXA 4RW7A 3T9ZA 2J9DA 2MY7A 3IM8A 3SFGA 2FLPA 4JI8J 2MPUA 2F4VF 4XPEA 5H9EK 3DLJA 1WC1A 3DLEB 2CADA 1CJUA 1MMDA 2MYFA 2OELA 4FVCA 2VQFJ 3BQ2A 4C4WA 4K50A 2PT0A 3CJRA 1NKCA 1KOHA 1BMQB 2ASJA 4JI3F 4X66J 4OI4A 1HWKA 1WC0A 2DHAA 2H1YA 1QE1A 1L3VA 5ETKA 3PRVA 2DPIA 4RUCA 1NZAA 2ZBQA 3H0PA 1AXQA 4I2QB 4M63A 5JMNA 2RUSA 3Q8YA 1S4FA 3DHWC 1TELA 4GVLA 2UVRA 1S77D 5CABA 4YOEA 3ILLA 1BQMB 2FVCA 3TUIC 1JLQB 4RR5A 3CMAS 3O5TB 4WP8A 2YBVA 3P8BB 3T1HF 1VRTA 3DMJB 1CJKA 4IR1A 1EHWA 1M5VC 1JQGA 4QBUA 4YY3J 1XNQF 4NASA 5KFIA 2MQOA 3MEEB 3DDIA 1NSPA 3A8JA 3MEEA 2XB2D 3QZ8A 3H5XA 1N32F 2HVHA 4AT1B 2FLOA 2OPSB 4BHQA 3K8WA 2N7CA 3GYGA 3TVKA 1JK9B 3LW5C 5GAEU 3W63A 3DOLA 2KT5A 1VIOA 2N3LA 2JRSA 2QL9B 2BJEA 2G2OA 2ZBIA 3KKFA 4J9LA 1JLQA 5T41A 2KM8B 1M5OC 4OI1A 3CO0P 5ETVA 1EARA 3US5A 1MN9A 1BC6A 1G6BA 1WC5A 2M0GB 3OUYB 2W4PA 1ZAWA 3MD1A 2FHKA 2KJVA 4I2QA 4EEYA 3TVYA 2R42A 4DX6A 5DO2A 1FWPA 3I82A 2M3DA 3FQLA 3TAMB 3ELHA 1RT2A 2BEFA 2RT3A 1EQMA 4GKJF 4I64A 2E1AA 2E7VA 3I5BA 2FYXA 4MJKA 4OYMA 3OSPA 4L72B 1BWEA 3K0JA 2CJ9A 2MQ8A 2PEBA 1KHVA 4JI6J 3R8YA 2JWNA 3FMBA 3DGPB 2WBRA 2B4UA 2N4CA 4KE5A 4LVNP 4O23A 2A18A 1CULA 4H4OA 2VH7A 5C25B 5KFLA 4YR2A 3N01A 1FRJA 1M5KC 1JLEB 1EB0A 4O3QA 5L9XA 1WD6A 3TA2A 4OV6A 4DSFA 3MEGB 2RNEA 1WKJA 2ZBPA 3I32A 1RT1A 2XMMA 2YKNA 2GAHC 2ZBCA 4BLGA 4I6YA 4DV5F 1D3WA 1QM9A 2WB4A 3E51A 4I4BA 1ZZFA 4OZ0A 1HR0F 2D3OR 4G1IA 4WYWA 4ILRA 2BJ7A 1IVZA 2A10A 1IBCB 4Y6IA 4Z2XA 4OI0A 2IRYA 1N52B 5HROA 1FNXH 2BX6A 4GO7X 1QDUB 4ANCA 3KUGA 1WC6A 1I3OB 5B08A 3JYTB 1S76D 4RJVA 2HFVA 1TUWA
chains in the Genus database with same CATH topology
3HJVA 4AMPA 3QATA 3CJ8A 3SBMA 2G2OA 4AMNA 4AMMA 1NM2A 2C2NA 2H1YA 2QJ3A 3BV8A 1MLAA 3PTWA 4AMOA 3RGIA 3H0PA 3EZOA 2CUYA 3G87A 3HHDA 4RR5A 3IM9A 4RL1A 2G2YA 5DZ7A 3TQEA 2JFKA 3TZWA 3TZYA 3R97A 5DZ6A 4QBUA 2QC3A 3K89A 3TZZA 2G2ZA 2G1HA 3IM8A 2JFDA 3TZXA 3R8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJV A;  4AMP A;  3QAT A;  3CJ8 A;  3SBM A;  2G2O A;  4AMN A;  4AMM A;  1NM2 A;  2C2N A;  2H1Y A;  2QJ3 A;  3BV8 A;  1MLA A;  3PTW A;  4AMO A;  3RGI A;  3H0P A;  3EZO A;  2CUY A;  3G87 A;  3HHD A;  4RR5 A;  3IM9 A;  4RL1 A;  2G2Y A;  5DZ7 A;  3TQE A;  2JFK A;  3TZW A;  3TZY A;  3R97 A;  5DZ6 A;  4QBU A;  2QC3 A;  3K89 A;  3TZZ A;  2G2Z A;  2G1H A;  3IM8 A;  2JFD A;  3TZX A;  3R8Y A; 
#chains in the Genus database with same CATH topology
 3GG1 A;  3H2V E;  3MM9 B;  3CJ4 A;  4RKU C;  1S0M A;  2IVM A;  1MG7 A;  1S48 A;  2N4D A;  1S9G A;  9RUB A;  3LWM A;  3FCW A;  2KYZ A;  2UUA F;  3DNC A;  1TL5 A;  1VQY A;  2CQ3 A;  1TL3 B;  3C6T A;  3GJQ B;  3UWT A;  1Q8B A;  2DXF A;  3I55 S;  4MT1 A;  3WQP A;  1DTQ A;  1RWN B;  2KXN B;  3CE8 A;  2MKC A;  2CQH A;  4Q45 A;  2FZK B;  2HND B;  5F3T A;  1Y10 A;  4NLU A;  2H4W B;  3O2I A;  5GAG U;  3W5Y A;  3P6Y C;  2CJX B;  3W1Y C;  1SQE A;  4GVB B;  1SJR A;  2PD1 A;  2V67 A;  3EJM A;  3UCU P;  1FRX A;  3DLK A;  2E9T A;  1PG5 B;  3HO1 A;  3ISN C;  3S8S A;  1U26 A;  3R3T A;  4EZ9 A;  3TP2 A;  1SPB P;  2E9R X;  2XMK A;  1HNV B;  2LU1 A;  2YWF A;  3D1H A;  4DUZ J;  4PXD A;  3FGV A;  1FD2 A;  3TJ9 A;  3HFV A;  3UN2 A;  3KHL A;  4ECW A;  2WSF C;  3NRB A;  2XNR A;  3DRP B;  1KFS A;  1HBO A;  1EAY C;  2DNQ A;  3M30 A;  2JEJ A;  2FB0 A;  3MGJ A;  1RT4 A;  1RK8 A;  3NCR A;  3BGR B;  2LEB A;  1TMM A;  3PYD A;  3SSQ A;  1SJF A;  4PAA A;  5E7O B;  5ITH A;  1U4B A;  4TQS A;  3MWB A;  2NSB A;  3MMC B;  1VFJ A;  4KSE B;  2CQ2 A;  1HBN B;  1YBA A;  2DR9 A;  3IGV A;  1IKW B;  1WOR A;  2M52 A;  2YPY A;  1FA0 A;  2D3U A;  4NLW A;  4QWC A;  2B7B B;  3A8E A;  2BE2 A;  1RWX B;  2ZEJ A;  3W66 A;  4B02 A;  4Q7A A;  5RUB A;  5ETR A;  4RW4 B;  5DQI A;  2RRB A;  2L41 A;  4MK8 A;  2H5I B;  3NNC A;  4LIW A;  1VQS A;  2IDL A;  1RT6 B;  2OH2 A;  2HRU A;  4GKJ J;  2Z8Q A;  4R25 A;  4K2X A;  4JYA F;  2DH7 A;  1ZAV A;  3P5B P;  3BKT A;  4RLE A;  2LQ8 A;  3HVA A;  3OL7 A;  2NPF A;  4C6A A;  4IOB A;  4FXD A;  5F8J A;  5IV4 A;  3MM8 B;  2ZH5 A;  2Z2Z A;  2ATL A;  2XS2 A;  2OPR B;  1Q81 T;  2VG5 A;  5BYS A;  1RT3 A;  3HSZ A;  1TFY A;  2HIQ A;  4WXO A;  4QWA A;  1J5E J;  3KUH A;  2FIU A;  2HRY A;  3DI6 A;  3MEC B;  2RKI A;  1IM4 A;  3TEH B;  4F67 A;  4OI6 A;  1VRU A;  4OZL A;  2MLY A;  3G87 A;  1H7X A;  4PPD A;  2B9E A;  4E98 A;  2OD6 A;  2XS7 A;  2R4F A;  2HBY B;  3AQO A;  4B9S A;  1K0V A;  2FPH X;  3HHE A;  4CI0 B;  2W24 A;  5GAH I;  4ILL A;  3BGL A;  2ADC A;  5IZH A;  2MQN A;  2KRR A;  3PFO A;  1ZET A;  2W7P A;  2V9W A;  1FRL A;  4DBQ A;  1FES A;  2ZC3 A;  4Y0F A;  4NCG B;  5I3U A;  5CA5 A;  2LA6 A;  3T1H J;  1KQS R;  4LRC A;  4JV5 J;  3KYL A;  3BPD A;  3GYN A;  4O3O A;  2MST A;  3ZZY A;  2CPZ A;  3FC9 A;  5B0G A;  4KQZ A;  5EN1 A;  3VGS A;  1TV6 B;  3SXL A;  1VQL S;  4QR0 A;  3CO9 A;  1X4D A;  1B70 B;  5KT6 A;  5CHC B;  2P2C B;  1TKZ B;  4EMD A;  3TVZ A;  1NK5 A;  4YR3 A;  3J7A N;  1ZM4 A;  1H2V Z;  4ES2 A;  1KHW A;  2M5Y A;  1SH3 A;  2P6S A;  3AFG A;  3D66 A;  4G1Q A;  3PNI A;  2MGZ B;  2V4Q A;  1R89 A;  1IBL J;  3LP0 A;  2V63 A;  2DR5 A;  1U0H B;  3UNY A;  4NZ6 A;  2B7C B;  3OTO J;  1IKX A;  1JKH A;  1UZH A;  1HAR A;  1SI9 A;  5ETL A;  1HD0 A;  4C0B A;  2B9Y A;  3TAQ A;  1FJE B;  3PKY A;  4I6W A;  4DR5 J;  4LRA A;  4ZVS B;  5LMU J;  2VL1 A;  4NOH A;  3UD4 P;  3VCD A;  4K4Y A;  2AYG A;  3KLG B;  2G9O A;  4CLS A;  3K5P A;  3W2W B;  4A48 A;  2Z58 B;  1HMV A;  1H7W A;  1PYT A;  1WSR A;  3IP0 A;  3JTN A;  1FEH A;  3PJW A;  3PM9 A;  4KFB A;  1VRQ C;  2ZVS A;  3V2U C;  5MLC V;  1RJJ A;  1BHN A;  4IFV B;  4K0K J;  1RTI B;  2J6T A;  3CJ8 A;  5DM7 Q;  3TJ8 A;  1T9W A;  1XC9 A;  5D4L A;  1UKU A;  3VV2 B;  4UT4 A;  4N47 A;  2E5H A;  2G0J A;  2P6T A;  5J2M B;  3VAF A;  3V4I A;  3G8S A;  4NXM J;  1XNR J;  3ZZO A;  4N8O A;  4DV2 J;  1TKT A;  1TVR A;  2RRN A;  2X51 A;  4CH7 A;  1G4C A;  4Y2K A;  4ED3 A;  5D6G A;  4RNF A;  5FD1 A;  2CUY A;  1NZ8 A;  2ASL A;  1HL6 A;  1R8A A;  2FJX A;  2RQ4 A;  2AJ1 A;  3R1H A;  1DY3 A;  1S1T B;  3ENW A;  4ED0 A;  3E01 A;  1NK8 A;  1F3V A;  3LPE A;  4HHJ A;  1KEK A;  1C2P A;  2W2M P;  3BN7 A;  3AB4 B;  3PIP Q;  4MFB B;  4ZVO B;  5KT3 A;  3NNA A;  1IN0 A;  2GIF A;  2KFZ A;  3BDE A;  5A76 A;  3J7Z 5;  1ZM2 A;  4CNZ A;  2CJA A;  1N88 A;  2CYY A;  4F0K A;  5J2P B;  1IKY A;  1FEE A;  1KTQ A;  3MCO A;  5HO4 A;  2U1A A;  3G96 A;  5H9E J;  2UUC F;  3I9Z A;  5D0E A;  2XO7 A;  2CKW A;  3OV7 A;  1RAH B;  3HX9 A;  3TOQ A;  4KKO B;  5E3R A;  4EZ6 A;  2HQC A;  5KG2 A;  2V94 A;  5IWA F;  4J9Q A;  1NPK A;  2M4M A;  1BUX A;  1XIQ A;  4B3O B;  3JSB A;  3AOA A;  4JI7 J;  1YRT A;  5IT0 A;  2L9N A;  1TQL A;  2ZWO A;  1K44 A;  5LSL A;  4NCA A;  1JB0 C;  2HG4 A;  2ZH7 A;  1OY6 A;  1E6Y A;  2WON A;  4DHV A;  4Q2L A;  3PW4 A;  1RTJ B;  4CO0 A;  5HVF A;  3H2U B;  5AE1 A;  4X65 F;  5KFR A;  2HAF A;  3UCZ P;  3CCQ S;  3KK1 A;  1OYD A;  3UD5 A;  2BV3 A;  3Q8R B;  4PQA A;  4KO0 B;  5FDL B;  2ZFH A;  4ER8 A;  5G4D A;  4UZC A;  4WKY A;  4ZKA A;  2IM3 A;  1UPM B;  1NUE A;  2LCW A;  4OX7 A;  5SZT A;  4Q2M A;  4DEZ A;  2ADB A;  1NSQ A;  4YDD B;  2IAJ A;  4KBI A;  4CP5 A;  5KFH A;  4DSE A;  3VAH A;  1FVS A;  1OWX A;  2NLW A;  1MSW D;  1FER A;  4IFY A;  2Z57 B;  4JBC A;  4W4M A;  4JI0 F;  5DET A;  3LH2 S;  3ZTQ A;  3RRG A;  3NBP A;  4USJ C;  3PX6 A;  4YR0 A;  4ZVQ B;  4V19 J;  1S59 A;  3PO4 A;  3QRP A;  2CNO B;  4F3O A;  1WTF A;  2FJE B;  2MQQ A;  2CWK A;  2R7U A;  5F8L A;  5KFB A;  2Y1I A;  4DV6 J;  1H3D A;  1REV A;  5K14 A;  2W8K A;  2HMI A;  1IWA A;  3MXH P;  3KWM A;  2DGT A;  1T0T V;  1PC5 A;  4FDF A;  4X4O A;  3QGP A;  3M8Q B;  2CPY A;  2CQB A;  3VAL A;  4DR4 F;  1VS3 A;  2LDY A;  1RAO A;  3KG0 A;  1QTN B;  3D6F B;  1KOO A;  2BAC A;  3N6M A;  3EVO A;  3IAS 9;  3KK2 B;  2Y0B B;  4CCH A;  3NGD A;  1WF1 A;  1ZBT A;  2DIT A;  3HUL A;  1NSA A;  1M5H A;  3R5C A;  4FNH A;  5D0G A;  1HNZ J;  4USU A;  1R8H A;  2FC9 A;  4O4G B;  4EI2 A;  3JSR A;  2FUG 9;  1DHM A;  1H6K X;  4F26 A;  2ZUG A;  2ZDO A;  5J1E B;  1IQZ A;  3RB3 A;  1PIE A;  2PDA A;  3KLF A;  4BCA A;  4TNO A;  2XWY A;  1WI6 A;  2KFN A;  4Q5V A;  1W2B R;  2IBO A;  3ZZU A;  1S6P B;  4OX9 F;  4LBH A;  1JLC A;  2IVF B;  1WTB A;  2D69 A;  4KR0 B;  4QU6 A;  2RH3 A;  3I9V 9;  3VAG A;  1P1T A;  1EP4 B;  2AEF A;  2VPZ B;  5A2Q U;  3G8Q A;  4TXS A;  3C2P A;  2GMJ A;  3Q8Q B;  3IBW A;  2FVQ A;  4TY8 A;  3K57 A;  2DVI A;  4RUH A;  1MRO B;  4DZD A;  4USM A;  3PKM A;  2VJU A;  2VZ8 A;  4M5D A;  1GMV A;  1X4G A;  2HGM A;  2HGL A;  5M2R A;  4C7Q A;  5LJ5 Y;  2I5J A;  1DRZ A;  1FRH A;  4WBF A;  2JJ4 D;  3BBC A;  2KDO A;  5SUH A;  1CC7 A;  4LF5 F;  2EK1 A;  3CJ2 A;  1SJQ A;  2XY5 A;  3VAK A;  1WWH A;  1RU2 A;  3FEY B;  2CQ1 A;  5GMK a;  2RU9 A;  2M8D B;  2H65 B;  4GRS A;  5U47 A;  3HT0 A;  3JSY A;  4CLW A;  2AGP A;  1D9F A;  3Q86 A;  2MZS A;  1X5O A;  2BW7 A;  3UVJ A;  4B3T F;  2FJV A;  1M1K T;  2VFR A;  4N77 A;  4LF7 F;  4ED6 A;  2PMZ D;  3F56 A;  5KFN A;  5AE2 A;  5KAK A;  1HQU A;  2J9C A;  1YJR A;  2UU9 F;  3F44 A;  3QO9 B;  1LWF A;  2VF3 A;  2VAS A;  2CQC A;  2K2P A;  2H51 B;  3DLH A;  1XR6 A;  1Y5I B;  1U24 A;  2D9P A;  3BSN A;  3KLE B;  3BRE A;  3FSI A;  1CJT A;  2Q6B A;  1V5V A;  4OYO A;  5GME A;  4ZCK A;  3UD3 P;  2WB1 D;  5JVG Q;  1JLA A;  2XHC A;  2C28 A;  3RTV A;  3DRS B;  2AV5 A;  3KNG A;  4OJH A;  5KFZ A;  3ET6 A;  3TAN A;  1MN7 A;  1BD6 A;  1KLM B;  3NGT A;  4PUO A;  2HUR A;  3NWG A;  1KVJ A;  2RHS B;  1IBM J;  1HIY A;  1E6V B;  2MJU A;  1HBM A;  3CGI A;  1F5C A;  2BJ3 A;  1UA0 A;  4DSK A;  1UW4 A;  3TZZ A;  1N33 J;  1HWL A;  2BRK A;  2CIM A;  2V68 A;  2HLT A;  5HAN A;  2V2K A;  4QR1 A;  2ZJQ Q;  4EBC A;  1FCA A;  1N34 J;  4R8U B;  3J80 U;  4AND A;  4I69 A;  4LSN B;  4NML A;  1Q1K A;  3QLH A;  4EGL A;  1SKR A;  2E29 A;  4NMX A;  4ZK7 M;  4ED4 A;  1N48 A;  4OHY A;  2HHH F;  3MMB A;  1KQG B;  5KFJ A;  1S97 A;  1RBO B;  1QVG R;  3R2C J;  1X4H A;  3IBF B;  2NUU G;  4NA2 A;  4EBD A;  1WJ9 A;  3FCH A;  3C16 B;  1R0C B;  2IC3 B;  2QJ3 A;  4FPR A;  3E3X A;  1JLG B;  4QYZ J;  2R7S A;  5KFE A;  3I0R A;  5HMW A;  4LRB A;  3NGK A;  5LMN F;  4D3G A;  2QRR A;  4RZR A;  2XCP A;  3TA1 A;  2IJR A;  1N34 F;  3PDN A;  1VDH A;  3MM6 A;  1TU0 B;  2OPQ B;  3LOU A;  2RSQ A;  2YQ3 A;  3BH6 B;  3HSG A;  5A8W A;  2RQC A;  4IRK A;  4ELV A;  4DG1 A;  4DV1 J;  4TVA B;  3RAM A;  3QNW B;  3M8R A;  1MWZ A;  3M8P A;  1NJI T;  1I51 B;  2HQ3 A;  4NYO A;  3V4M A;  1CQM A;  3EZ5 A;  2ZH6 A;  4DL6 A;  2Y0S D;  5M2U A;  1VC0 A;  4C11 B;  2QL7 B;  5DRK A;  4X62 F;  2ZD1 B;  1KR4 A;  5HMZ A;  3M4X A;  2OUG A;  4YEA A;  1YJN S;  4DQI A;  1OPZ A;  1ZM9 A;  1PSD A;  3GFY A;  5F0W A;  5T14 A;  1DUR A;  1ZAX A;  4F02 A;  5HMX A;  3BPS P;  4DV4 J;  2J9E A;  4AMN A;  1D8Z A;  4UY8 T;  3DDK A;  4DSL A;  3HMJ G;  2EKY A;  2DGQ A;  3M8W A;  3THP A;  3FBC A;  2RDI A;  3FFI B;  2HVD A;  3GIR A;  3B8H A;  3BBB A;  1IXK A;  1PYO B;  2V8V A;  3CJQ A;  4ICL A;  4NEZ A;  4USW A;  1DJ0 A;  3PVX A;  5GAD U;  1C1C A;  5KOW A;  4DR2 J;  2EC2 A;  2CQG A;  2XLJ A;  2DEI A;  4RNH A;  3MMA A;  3QT7 A;  3LTO A;  4TLQ A;  4XAK A;  3K59 A;  3SMZ A;  1JMT A;  1U48 A;  3I4H X;  4I2P A;  3PHT A;  4F3Q A;  3S7R A;  2KM8 C;  2QYG A;  4ED2 A;  3NGU A;  3S6E A;  1R0A A;  1X4E A;  2VHG A;  3DM2 B;  3CCT A;  3BN4 A;  4RWX A;  1R43 A;  2CPI A;  4HT5 A;  4I7F B;  4RO0 A;  3C15 B;  2UV8 A;  2I2Y A;  1YZ6 A;  2EFQ A;  2W7A A;  3D5M A;  3G86 A;  2I8E A;  2MKY A;  2V0N A;  3L95 X;  4J9K A;  4PWW A;  4U96 A;  1X4B A;  1KTV A;  3BKU A;  2NZC A;  2KO1 A;  2OTL S;  1HQE A;  3M2V B;  1MWQ A;  2EKN A;  2HNY B;  2RF2 A;  4DCJ B;  3MUV P;  4J9R A;  4FYX B;  1YJW S;  4QWD A;  2KXH A;  4QPT A;  3FRY A;  3IM9 A;  2QA4 S;  4CO3 A;  2ZHO A;  3FZ2 A;  2CXE A;  1PYS B;  3MI7 X;  1W25 A;  4WZQ A;  2HS3 A;  1KP6 A;  3PJX A;  4M5L A;  2WVC A;  2HNY A;  2RF2 B;  2RAQ A;  3G2X A;  3PX0 A;  2QLB B;  3Q8S B;  1FFS B;  3OXF A;  1SCJ B;  3CJ3 A;  3K5L A;  4DUY J;  3OW2 R;  3C15 A;  3IGN A;  4I7F A;  2AGO A;  2FHJ A;  3RRH A;  4QU7 A;  2J8A A;  2F9J A;  2BKP A;  3T1Y J;  2X7I A;  2LEP A;  2XM3 A;  1EZZ B;  5D15 A;  2CJB A;  3G4S S;  1LEO A;  2QFJ A;  1UFW A;  2DH8 A;  2AU0 A;  2DNM A;  1N56 A;  5C2G A;  1V9O A;  3CSK A;  2YXL A;  5EHH A;  3BF4 A;  1SKS A;  2R3V A;  4DR4 J;  3MOJ B;  1BQX A;  2SXL A;  3D6H B;  2CQ4 A;  2IM0 A;  4IUF A;  3HK2 A;  4KGX B;  1G1X A;  2VFT A;  1ZM3 A;  3TZY A;  2ILZ A;  3ZTO A;  1C1C B;  4H4K A;  3EGZ A;  2OPP A;  2V8H A;  3UDL A;  1KFD A;  4ICL B;  2UUB F;  3OR2 B;  3PRD A;  3POT A;  1F3F A;  3KJV B;  4AQY F;  3EPI A;  1NK7 A;  2J6S A;  4M5M A;  1HKA A;  2B8P A;  1VHF A;  3QYY A;  2XNQ A;  1TP7 A;  4ZVE A;  3PW5 A;  4DV7 F;  2B51 A;  5BR8 F;  4WE1 B;  4DR3 J;  3FRZ A;  4DFK A;  4U8Y A;  2CA9 A;  1O5J A;  1AUS L;  2V2Q A;  2LP4 A;  4TU9 A;  1V3S A;  1TL1 A;  2CJQ A;  4IDK B;  4IQM A;  3SSR A;  5J2Q B;  1F9H A;  2W2Q P;  1X5S A;  2RJZ A;  3TNV A;  3CCS S;  1RT5 A;  4DOZ A;  1SB6 A;  4IO1 A;  2X1F A;  2XLK A;  4CO5 A;  1U1K A;  2GX8 A;  4OJG A;  4CLT A;  1RAA B;  3G71 S;  3OBI A;  4LJM A;  4P72 A;  3HI9 A;  4W90 B;  2DGW A;  1CLF A;  1WDT A;  3CW2 C;  1RHU B;  1R7I A;  2KU7 A;  3SEO A;  2K3K A;  3OHB A;  4QOT A;  4C9D A;  1ROF A;  1R27 B;  3CDB A;  2PN6 A;  3DDN A;  3MHY A;  3P96 A;  1IWG A;  1YJ9 S;  1WG4 A;  1RHR B;  5J1N A;  1UL3 A;  3TA0 A;  4ZLP A;  3IWN C;  5LL6 d;  2JSX A;  3L7P A;  2OI2 A;  3MMB B;  4N41 A;  1GMU A;  2B4P A;  3RBX A;  4G65 A;  4FPI A;  4R0E A;  2FLN A;  1LOU A;  1WOO A;  2OMO A;  3WX8 A;  4ZJQ A;  1VQK S;  3CD5 A;  2MLX A;  4RUA A;  3PV8 A;  3HVT A;  1VBX A;  1N36 J;  3NGS A;  3R7B B;  4IH5 A;  2FZC B;  1AA1 B;  4M5I A;  1EKR A;  4Z7Y A;  3DLB A;  1VQ9 S;  4DFJ A;  1HBM B;  3V81 A;  3MM7 A;  1ICE B;  3U1N A;  4F4W A;  5DDQ C;  1WHY A;  3KNA A;  4L73 A;  4CYU A;  5F8H A;  3PZP A;  3HHL C;  5KFG A;  2BOA A;  2CPJ A;  2IFX A;  2K1R A;  3ET6 B;  3AHP A;  3R5A A;  4I6A A;  5E3Q A;  4YME A;  2XMT A;  4B3S J;  4MIB A;  4OZ2 A;  2FD2 A;  2DNN A;  1S1X B;  2W2N P;  4A46 A;  4LF7 J;  3CTR A;  3BQ0 A;  4Q8E A;  1RBA A;  2RIL A;  4P7T A;  1SUQ B;  1CJT B;  2QN6 B;  4I68 A;  5KFT A;  3VTI A;  3WIU A;  5LMN J;  4A8O A;  5I42 A;  1U1O A;  2HHQ A;  4K2J A;  2E9Z A;  3GLJ A;  2LQB A;  3M1V A;  1CEZ A;  1DLO A;  3DRX A;  4MK7 A;  3IAM 9;  4DV2 F;  2D1C A;  1X5P A;  5IQQ A;  1CS4 B;  1HQU B;  4DX5 A;  2R2U A;  4UST A;  3EYZ A;  4NXM F;  5KT5 A;  3QT5 A;  4Z7C A;  3M6X A;  1QVF R;  1FJG F;  2APO A;  4N56 A;  1RQ0 A;  2EW9 A;  1VQM S;  1Q79 A;  5CD4 A;  4ZLJ A;  1AZS A;  3DRR B;  1Q4R A;  3OJS A;  2CVI A;  2D7S A;  4K0K F;  4A8S A;  4L75 A;  2PEH A;  2E5I A;  2H5E A;  5DLG A;  2A6O A;  2FHJ D;  1U6Z A;  3RBD A;  1U45 A;  1KRP A;  5J2N B;  4DJB A;  5EGY A;  5KG3 A;  3K89 A;  3EMT A;  4WJB A;  3OL6 A;  2NS1 B;  3W64 A;  1IBM F;  1O0P A;  4CH1 A;  3E8O A;  1S0V A;  2NXU A;  4XIU A;  3R6G B;  4HAC B;  4C0H A;  2Z4P A;  3ICL A;  1H73 A;  1PBU A;  4P2X A;  3BYR A;  3MFH A;  1NEE A;  1G3O A;  2RDD A;  2YNG B;  3D67 A;  4M5D B;  4CTA B;  3R5G A;  3MR2 A;  1FI4 A;  1G7C B;  3CF5 Q;  1JJ2 R;  3HJF A;  1KKH A;  4DPW A;  4TY8 B;  1Q8K A;  2LXI A;  1LV5 A;  1FX2 A;  1VQ6 S;  2CPF A;  2HQD A;  1R8B A;  2B43 A;  4BWJ A;  3KTQ A;  3JSM A;  3SCJ E;  4CWB A;  4OLO A;  2RUG A;  1EP4 A;  2OP5 A;  1UA1 A;  1T95 A;  1SKU B;  2RDJ A;  1NDL A;  2C3P A;  2ZE2 B;  3H8Y A;  3H59 A;  2R8I A;  1KSP A;  2B5J A;  3OSN A;  1C0T A;  1D0E A;  2JLF A;  4NRT A;  2JEG A;  3WDO A;  1UJ6 A;  4NI2 A;  2J0W A;  3R5B A;  4Y65 A;  3SV3 A;  1TKD A;  4O3R A;  3MUM P;  2XYH B;  1FNM A;  2YPZ A;  1OY9 A;  1CJV B;  4RBT A;  3D1Q A;  4OYI A;  4U7U D;  4DPT A;  3DRY A;  3KMS A;  4ECR A;  4O44 B;  5CYM B;  2VJV A;  1WG5 A;  2GQC A;  4QJV A;  1RDR A;  4GC7 A;  1Z4U A;  2A6M A;  2Z2Y B;  4X4S A;  1F9E B;  1TFW A;  4YB7 A;  4LF5 J;  5ETT A;  2JLG A;  1YVF A;  2HFZ A;  4DL3 A;  2CAJ A;  2CDQ A;  3HFK A;  3QQC D;  4NYZ A;  1P1L A;  3QRQ A;  4ZA1 A;  1FT8 A;  4BBY A;  2HVE A;  4GC6 A;  4HHU A;  2UXB F;  3H5S A;  3V6D A;  1NH8 A;  3BV8 A;  1SVD A;  1UEV A;  3DN9 A;  1I1G A;  1UJ5 A;  1Y5N B;  1U2R A;  2M70 A;  4URQ U;  3RRK A;  3MZI A;  4A4J A;  1UTA A;  5D3G A;  1TL7 A;  4GKK F;  5K14 B;  3KMQ A;  5CZX A;  3JTP A;  3KJN B;  1T03 A;  3ITH A;  1B0T A;  2VPX B;  5ETN A;  5KFP A;  1NJW A;  4ZN3 A;  3KLI B;  1L3U A;  3Q24 A;  1X9W A;  2DIS A;  2GV1 A;  3I56 S;  3RB0 A;  4L3K A;  2DGO A;  2FJD B;  3NBP B;  4DR1 F;  1GX6 A;  1HBU B;  4JV0 A;  1SV5 A;  4YS2 A;  4M95 A;  3I87 A;  5H1S V;  4JUZ A;  5F9L A;  2QMU B;  3N5B A;  3WHI A;  3HJV A;  1NB2 A;  1VC6 A;  1KDN A;  1BXN A;  4J91 A;  4LBP A;  5DGB A;  2Y3Y A;  1JLF B;  3IR5 B;  1XMO F;  4KV8 B;  1RHQ B;  1XMB A;  3I96 A;  3LAK A;  1S0O A;  4C8O A;  1F2G A;  3N79 A;  3J81 U;  3OPK A;  5BJR A;  1AFI A;  2AP6 A;  2MSS A;  5FDL A;  1GAO A;  1N0V C;  4LR7 A;  2MHN A;  1NRK A;  4A47 A;  1SJ3 P;  4XTT A;  1MU2 B;  3PYE A;  3A3O B;  2IRX A;  3SDE B;  4J9O A;  1V3R A;  2DHX A;  4LRD A;  5DM6 Q;  2DRB A;  1FE4 A;  3OVB A;  4DUZ F;  2ZH9 A;  3GON A;  4CM2 A;  2LEC A;  3AAW B;  4KPY A;  2UUT A;  2MHE A;  3X3U A;  4UOC A;  4F4A A;  3M8Z A;  1IR2 A;  4IG0 A;  3CC7 S;  1KQF B;  3D54 A;  2PC6 A;  2RD5 C;  5JVH Q;  4LSL B;  2IDE A;  2PMH A;  4DQR A;  1UVK A;  1B0P A;  4LT6 A;  4CLL A;  2C2D A;  4RW6 A;  4K7Q A;  3UN3 A;  3NS7 B;  1AB8 A;  3TZX A;  1L5U A;  4B3O A;  2DCL A;  2KTQ A;  2KZM A;  3D1O A;  5E3A A;  4URG A;  1XMO J;  5L1K A;  3MED B;  1GNK A;  2MZQ A;  3T19 A;  2VFS A;  2FTR A;  3R7N B;  4ETX A;  4JI0 J;  2I9S A;  1RGV A;  4K5S A;  1X0F A;  1HI0 P;  3Q22 A;  1UVL A;  1FK9 A;  2B9X A;  5D8H B;  1IKY B;  2NSC A;  2ZNY A;  3L9Z A;  2BJ8 A;  4B17 A;  2XCA A;  5J2P A;  4X2B A;  1PGZ A;  1JWW A;  1RWM B;  2YWK A;  3IRX A;  3PYF A;  5ETS A;  3FJ2 A;  3F0N A;  3NXZ A;  2QIF A;  1IBK F;  2FY1 A;  3FBF A;  1U6B A;  4Q0B B;  3K8V A;  1FX4 A;  1X9M A;  3BSC A;  3JAM U;  2XBP A;  2R8G A;  2LQ9 A;  4MKV A;  4MFB A;  2JDJ A;  3MUT P;  1GEH A;  2DB1 A;  2XSF A;  1EIY B;  4A8F A;  5ETQ A;  5HBM A;  2UVU A;  1GXL A;  3C66 A;  1S1T A;  3HHL D;  2AHO B;  3OVA A;  4ZIT A;  3QAU A;  4MIA A;  3OT9 A;  3G6Y A;  3QFH A;  3DXB A;  4Q0B A;  5HAT A;  2ZDP A;  2E5G A;  2DRA A;  2ZIT A;  1J27 A;  3ADA C;  4AFF A;  3PW2 A;  1KD1 T;  1HR0 J;  4OFZ A;  3J81 j;  4HH1 A;  2QMX A;  1S4E A;  2GVZ B;  2HK3 A;  3MPV A;  1NHK L;  4OJ1 A;  4OX8 A;  5DG8 A;  2K8G A;  5IWA J;  5J2M A;  1D1U A;  3J7Y U;  1Q0N A;  3GIM A;  5L1J A;  3G9C A;  3PTW A;  4LFC J;  3VVU A;  3RU0 A;  3GJT B;  1GXT A;  2P9C A;  5HVH A;  4AL7 A;  2ZH1 A;  1VBZ A;  4DN9 A;  4ELU A;  1HMV B;  5J1P A;  4ECY A;  4KAI A;  2DTJ A;  3Q2T C;  4IOA Q;  5THW A;  2HHS A;  1PJ6 A;  2F4F A;  4F36 A;  3KLG A;  4E8U A;  4LF6 J;  4Y2M A;  4IG0 B;  1U7L A;  1ZH5 A;  4TLR A;  1N6Q A;  3RYL A;  1VK8 A;  5KG6 A;  4UZB A;  4LF9 J;  1SQG A;  3MDF A;  1N5Y A;  1RA7 A;  4OMF G;  1IKX B;  4DU7 A;  3HZE A;  3PEH A;  1U0H A;  1LQ9 A;  3ZNJ 1;  4A8Y A;  3L7U A;  2AMC B;  4NCB A;  4KHM A;  1OY8 A;  4G1Q B;  3VAI A;  4Y2C A;  4ZCI A;  1N6Q B;  1RWP B;  4LRE A;  4MK9 A;  4JI1 J;  3AY0 A;  2OSQ A;  5BYR A;  6FDR A;  4DFM A;  1WUU A;  3TYT A;  2VB6 A;  4KPC A;  1SC3 B;  3ETO A;  3ZFV A;  4C2M A;  2XY6 A;  5A0Y B;  2G0I A;  3THV A;  4WFN Q;  3B78 A;  1RWO B;  3MPW A;  2OSR A;  2DJW A;  2FQQ B;  2DKO B;  1T3O A;  5L8R C;  4NCG A;  2HZA A;  3DOK A;  1QAJ A;  4PWD A;  3EXC X;  5E3P A;  4ZP9 A;  3QSY B;  1LFW A;  1RAG B;  1SV5 B;  2YKP A;  3FCV A;  3GR1 A;  3PJ9 A;  2GS8 A;  4V19 X;  5L39 A;  1N32 J;  4MKY A;  4YHH J;  1KNZ A;  6FD1 A;  2MZJ A;  4WK1 A;  1BY9 A;  1GTE A;  1T9X A;  2AT1 B;  2XZW A;  1I5O B;  1U2C A;  2V50 A;  1UPP A;  3ITH B;  5K8M A;  2AW0 A;  3SCI E;  3PR5 B;  1TL7 B;  3SIP B;  5AE3 A;  4M8L A;  1DTT B;  2V6A A;  1H38 A;  3IR6 B;  3OXL A;  1QD1 A;  3KFW X;  4KY3 A;  5EX3 A;  4DI6 A;  2ZJR Q;  4DX7 A;  2D9O A;  4TYA A;  5GAG I;  4FXW A;  3EVM A;  3MM8 A;  5LXY A;  4B9U A;  3GG0 A;  3M2U B;  2AF6 A;  1XN9 A;  1NPR A;  1U2F A;  1XJW B;  2VD3 A;  3QPI A;  4LF9 F;  3QJP A;  1RSC A;  1Y3K A;  2YWG A;  4AMO A;  2YY3 A;  3F41 A;  2EVZ A;  3C19 A;  3IRX B;  3IWX A;  2ZKT A;  2JEI A;  1CVJ A;  1X60 A;  1U02 A;  2FC8 A;  5CYM A;  4RBU A;  4OQJ A;  3CUL A;  1U09 A;  1CJV A;  2KHC A;  2KYX A;  1O6X A;  2BR0 A;  3MMJ A;  2IHR 1;  3ZZ0 A;  3C8Y A;  2MZ1 A;  1WG1 A;  2BE2 B;  4X84 A;  4NI2 B;  3I6P A;  3UN5 A;  2QEX S;  3D68 A;  3N0V A;  2B5J B;  1FO1 A;  1RAF B;  3CWJ A;  3CT9 A;  2VKR A;  3O44 A;  4J7C A;  4PAB A;  2QSW A;  3QRR A;  1YTY A;  1K1S A;  2CNN B;  2EEY A;  5I3Q A;  2AGQ A;  2CZ4 A;  4LSZ B;  4QIG A;  4JOU A;  4LSL A;  3JSM B;  2BJD A;  2GMH A;  1UVJ A;  1S99 A;  3BGR A;  3NGR A;  4ZPT R;  2EFG A;  2DR6 A;  1FDB A;  3GCW P;  4IH7 A;  1FXR A;  2GZO A;  1HBO B;  4KGV B;  1Q82 T;  1OPI A;  4ENO A;  1U1N A;  4CTA A;  4WCE Q;  4NWB A;  4WIQ A;  4PR6 A;  2V8G A;  2YWW A;  3M32 A;  4KT0 C;  4KRW A;  3U27 A;  5HMY A;  1RAI B;  2XZD B;  2N82 B;  2J0Q D;  2XYP B;  2HQG A;  1IJE B;  1IBK J;  4M94 A;  4O0N A;  4JYA J;  5D4N A;  5I4M A;  2HBZ B;  5J2N A;  3FEX B;  1F5B A;  1APS A;  1X4A A;  2KXF A;  3WC2 A;  3ISN D;  2VG6 A;  4WFX A;  4USI A;  2RQK A;  2I38 A;  1RTD B;  2QYC A;  1KON A;  5KFF A;  2RE1 A;  2HEK A;  4NL5 A;  3TJA A;  1IQT A;  3U1L A;  5HQL A;  1FJC A;  1DTQ B;  1HBU A;  4IRC A;  3GU0 A;  1UAW A;  1AW0 A;  5KOX A;  4G3I A;  2P9G A;  3RZA A;  3C6T B;  4W92 B;  1JXL A;  1NU4 A;  3KLI A;  5FLX Y;  2H48 B;  3M1V B;  4P75 A;  5HL7 Q;  2FVR A;  1HNW J;  1YHQ S;  2QLW A;  1LK7 A;  2UVW A;  2W4C A;  2YWH A;  1ZA1 B;  4ELT A;  4MYT A;  3KK3 A;  4ZPD A;  3M9M B;  3G82 B;  2QL5 B;  5K20 B;  4OHW A;  4LF8 J;  5K5M A;  3V6D B;  3VGU A;  1WEZ A;  2CQD A;  2PFD A;  4ID8 A;  1FWK A;  2ABY A;  2H9Z A;  2K1R B;  1K73 T;  3ZXW A;  5HRO B;  3HVR A;  1A0O B;  4CLP A;  4ID5 A;  2VU5 A;  3MM7 B;  3DLG B;  2M88 A;  3MPU B;  3TAP A;  4F4X A;  4ITS A;  2R2T A;  4HEA 9;  3D0I E;  1OQ3 A;  1UWA A;  1FKP A;  3P5T L;  4O44 A;  2DNH A;  2PA3 A;  4C8Z A;  1RT1 B;  1T9V A;  3MEG A;  1VIX A;  5BR8 J;  3JQM A;  2O01 C;  4OL8 A;  1JLE A;  1MNE A;  1Y9O A;  4DLG A;  4K4X A;  1C0T B;  1S49 A;  2FVS A;  1CQN A;  2KT3 A;  2V4J A;  2E66 A;  4RWW A;  2ZE2 A;  4ETZ A;  4UOF A;  3Q8U A;  2C2R A;  4GKK J;  1ZTT A;  1H72 C;  1H2U X;  1NAQ A;  1P9Y A;  2CPH A;  3T3F A;  2R8K A;  1VBK A;  4J9P A;  2D3Z A;  2W7O A;  1RT2 B;  2PMW A;  4A8X A;  3R2D J;  1YX2 A;  2HRT A;  2R7Q A;  3TAM A;  2YNG A;  5GAE I;  4MH8 A;  1R6V A;  4KYZ A;  1WF0 A;  1YJ7 A;  2ZNZ A;  4HAC A;  5KG5 A;  1S12 A;  3TI0 A;  3OUY A;  3KOA A;  3TO8 A;  2E44 A;  4DPO A;  2O1P A;  5A8K B;  2E5L F;  4JI2 J;  4AL6 A;  5DDP C;  2Q66 A;  3Q8V A;  3DOL B;  4LQ9 A;  1S57 A;  1AZS B;  3DRR A;  2OTJ S;  2B8Q A;  2E1R A;  4ECT A;  4M5H A;  2IPO B;  3NCQ A;  2CNL B;  2GQQ A;  4ZVH A;  4WFB Q;  2NXN A;  4B9M A;  5LSR A;  4FYY B;  3KJV A;  1CS4 A;  3W61 A;  2WW4 A;  4CM0 A;  1NCL A;  4C3K A;  4P71 A;  1LWX A;  2OPP B;  5ETO A;  2IMO A;  1FDD A;  4J9S A;  2VG7 B;  2KT2 A;  4IRD A;  1FF2 A;  1S5Z A;  1VRT B;  3DMJ A;  1NPP A;  3BEG B;  5I42 B;  4ECV A;  4DSI A;  3AJD A;  2GC8 A;  4P2S A;  5AT1 B;  2QC3 A;  5L46 A;  3KK3 B;  2OEJ A;  4LF1 A;  2ZJP Q;  1RXO B;  3NS5 A;  4PPZ A;  2UP1 A;  2OO4 A;  3IG1 B;  4IOC Q;  1TMJ A;  2Y9H A;  1QE1 B;  4ZIW A;  3BQ1 A;  2QLJ B;  3TWZ A;  1LFP A;  5A6W A;  2PFF B;  2D41 A;  4UQG A;  4CYU B;  3M05 A;  4DXL A;  2HS4 A;  2JLE A;  2C42 A;  2KKH A;  4H4K C;  3ZTR A;  3Q23 A;  2F9D A;  2DO4 A;  4FF3 A;  2KHD A;  4XDC A;  2QLF B;  2HQI A;  2XZT B;  2CG4 A;  1IR1 A;  3CB4 A;  3HVT B;  3PIO Q;  4RW8 A;  4UW2 A;  3MD3 A;  1VBY A;  1SL2 A;  1Q5Y A;  2EPI A;  4QIE A;  5F8M A;  3DGV A;  2WCX A;  4Y2A A;  1Q16 B;  2JC1 A;  1X4C A;  3GB0 A;  3KUE A;  1TKX B;  4OYX A;  3FDS A;  3OR1 B;  5F9N A;  3H4B A;  2VUG A;  1R8P A;  4ZVF A;  3PY8 A;  3R27 A;  4PXB A;  5AJ3 J;  3AA8 A;  1QSY A;  1Z2L A;  1XER A;  4M5N A;  3BJY A;  1L3S A;  3M2V A;  4ANE A;  2X1G A;  2BJ9 A;  1N8R T;  2BBE A;  5L9N A;  2NQP A;  4PG7 A;  2WVE A;  3CJ0 A;  1U1Q A;  3BBF A;  5AXM A;  2QO3 A;  4R5P B;  2CWX A;  3VHQ A;  1DFD A;  5LT5 A;  4ECZ A;  3HD2 A;  1N33 F;  2BE7 D;  2EWH A;  3B4M A;  2ZM6 F;  1LWE A;  4X4R A;  4HTI A;  2DNK A;  3UQS A;  4DZ6 A;  2W8L A;  1NHU A;  4X66 F;  4C8N A;  4PWU A;  4N8N A;  5J2Q A;  5HP1 A;  1UVM A;  1HD1 A;  1M1H A;  3H7H B;  3I5A A;  2R7W A;  1YI2 S;  3CJK B;  3CC4 S;  1WEY A;  2YX4 A;  4WTO B;  3K7R A;  1FWL A;  2CJK A;  2MY8 A;  1Z2Z A;  2WOM B;  4WE1 A;  3VVT A;  5HSP A;  3AOB A;  3FSX A;  4FKY A;  3MCS A;  1SKW A;  3D6T B;  4Q8F A;  2XS5 A;  5B7W A;  3JAM Y;  3HHK A;  1N5S A;  2HWT A;  1KWM A;  2C2K B;  3X1L B;  3K5N A;  2AJQ A;  2PO4 A;  3OR2 A;  3FFI A;  3POT B;  4ZDN A;  3GV8 B;  2LEA A;  3EM1 A;  3QWP A;  2B4O A;  4ZP6 A;  3WBZ A;  2VBX A;  2AJ4 A;  3ISZ A;  1FD8 A;  4DX8 H;  5C5J A;  1VOM A;  2V9K A;  3AD7 C;  2HHH J;  2J5A A;  1LKZ A;  4DDF A;  1XR5 A;  2WOM A;  1QLN A;  2F1F A;  4B3S F;  3EDR B;  3ZNU A;  2ZD1 A;  2AEM A;  3EIC A;  3CJK A;  4C11 A;  4HKQ A;  3MR3 A;  1RWV B;  2F8M A;  2MQL A;  5DQH A;  5HP1 B;  1F60 B;  2QMW A;  1T02 A;  3CPW R;  4FYV B;  5A8W B;  1D09 B;  3O6Q A;  1S6U A;  1OS5 A;  1OO0 B;  2JNJ A;  3DU6 A;  3NEK A;  3UR0 A;  4R5P A;  2W9C B;  5IXU A;  1TK0 A;  4NXN F;  2UUW A;  2AZ3 A;  3LAL A;  1QY7 A;  3MF5 A;  1SL0 A;  3U7J A;  3CME S;  4DN0 A;  3OFE A;  4DSJ A;  2NCK L;  2Q79 A;  3GYX B;  4D3H A;  2OKQ A;  3IN5 A;  4F25 A;  2F3J A;  1HW9 A;  1NME B;  1IKV B;  2C1E B;  3LAM A;  2IC3 A;  3AXK A;  3Q2S C;  4YFU A;  2Y1R I;  4CLF A;  3GJR B;  3IWL A;  4F3M A;  5K8P A;  4YP3 A;  4DLE A;  1T7P A;  3AB2 B;  1B7Y B;  5KT2 A;  1TKX A;  3BR8 A;  1FE0 A;  2FY8 A;  3AOD A;  1JNZ B;  3D3C J;  3QLH B;  4ALZ A;  5DDR C;  5KFQ A;  3M6V A;  4RW8 B;  1RKJ A;  2W1B A;  1WHV A;  3A8I A;  4RU2 A;  4K4Z A;  3G8T A;  4OV1 A;  4K4T A;  1QSL A;  4KH1 B;  1QAX A;  3OXG A;  2J8S A;  3FBB A;  1E6V A;  2ZH8 A;  3DM2 A;  4RL1 A;  3VWS A;  3OLA A;  3ZC4 A;  2B6A B;  1A6L A;  1NDP A;  5DZ7 A;  4YB5 A;  2OFG X;  3SCL E;  3EX7 B;  4XPC A;  4FBU A;  2DNP A;  4V1A k;  1NJX A;  4WK3 A;  5KFS A;  3IG1 A;  1RHJ B;  4DF4 A;  2XQC A;  2FHO B;  3T5K A;  2E1P A;  1SH0 A;  4B9V A;  1KVI A;  1RLC L;  2EBE A;  4DR3 F;  4L76 A;  5IV3 A;  4FF4 A;  4WZM A;  2GO9 A;  2E1M C;  2PII A;  2VG7 A;  1UWB A;  3LP1 B;  3NKY A;  3QT8 A;  4HDH A;  1JLB B;  4P10 A;  2AX1 A;  3LA0 A;  3QO9 A;  3GE9 A;  1NJY A;  4QYZ K;  2Y8W A;  2IJN A;  2JVO A;  1U1L A;  2H5J B;  5K8O A;  3RB4 A;  2UUB J;  5CD4 H;  4AL5 A;  5CQG A;  3SQO P;  4ZLL A;  1L3T A;  5CAA A;  3H4D A;  2O67 A;  5B0B A;  5IT9 Y;  2GQ2 A;  5LOQ A;  4OHZ A;  1K1Q A;  5A8K A;  3SV4 A;  5HVG A;  4DQS A;  1RYR A;  1Q95 G;  3EPG A;  4B3M J;  1FRK A;  3EVW A;  1PC4 A;  4LFB J;  1LW0 A;  4O4R A;  5G0R A;  1UW9 A;  5HQ8 A;  2KH9 A;  4P2M A;  9ATC B;  3THT A;  1O8B A;  2I5J B;  1F1B B;  2Z2M A;  2K06 A;  2MB0 B;  5GMD A;  2XMU A;  4EWT A;  3D7S B;  5BYQ A;  2VKZ G;  3DYA A;  5KFW A;  1WEL A;  2HQF A;  1HHQ A;  3CIZ A;  1YDL A;  3RAX A;  1HHT P;  2JEF A;  4AMM A;  4K8R A;  2YKA A;  3N5F A;  3WIV A;  4DPU A;  1NKE A;  4ATN A;  4DL5 A;  4DR2 F;  3VZI A;  2K7J A;  3I0R B;  4DV6 F;  1JLG A;  1PAU B;  1VQ4 S;  2HYI B;  1HNW F;  2M9K A;  3MR6 A;  4HYK A;  1WOP A;  2LU2 A;  2V4J B;  4JI7 F;  1AT1 B;  5KFA A;  2HW3 A;  2GJ2 A;  4ES3 A;  3FVY A;  4CDI A;  4ZHR A;  3C46 A;  1RE1 B;  2B56 A;  4N7T A;  5B09 A;  3BO4 A;  2NZ4 A;  2L9W A;  3CED A;  4OZ5 A;  1R8C A;  2MKJ A;  1V5I B;  1SC1 B;  4LSN A;  1VIS A;  4R8U A;  2YQ1 A;  1FKP B;  2MQP A;  2QX0 A;  5D0H A;  2DR7 A;  2ZUA A;  4O4G A;  4HI1 A;  2XG8 A;  3UDC A;  1ARO P;  3DLG A;  1RP5 A;  1VK3 A;  4QWE A;  2DCU B;  3MAA A;  4ID5 B;  2HVI A;  4DV1 F;  3KK2 A;  3V5R A;  1N5V A;  3TUJ C;  4UF4 A;  4C48 A;  3N4W A;  2XHW A;  3H42 A;  2J0S D;  2YNH A;  3DRS A;  3DHX A;  4QZV B;  4ZPW R;  5IOL A;  3G82 A;  4FYD A;  3P45 B;  4NRU A;  5FLX U;  1F2H A;  1RKI A;  3N28 A;  4JI4 J;  3GWC A;  2DGV A;  1PAE X;  2HNZ A;  1WOS A;  1TK8 A;  3NP5 A;  4PG5 A;  1AFJ A;  4DF8 A;  4J37 A;  2A2D A;  2UXD J;  4Y00 A;  1LWF B;  2VDI A;  1NDK A;  1M5S A;  2G2Z A;  2G1D A;  2MMY A;  3J7Z T;  2YNF B;  3R1L A;  2XGQ A;  2DNR A;  3JXO A;  4DV4 F;  1WAC A;  1LWC B;  1L3K A;  2WZ1 A;  1RTZ A;  2OLW A;  1RTD A;  3T5J A;  2VG6 B;  2J9D E;  2DXE A;  3OTC A;  1GMW D;  2CNK B;  1WC4 A;  4FVM A;  4PXC A;  2WVF A;  4N5S A;  2KFY A;  3K5M A;  2OIH A;  3OFF A;  2EFP A;  2F8H A;  4A8K A;  3GIJ A;  2AYB A;  4KO0 A;  5HJX A;  2ZHB A;  1RZM A;  4DS4 A;  4F7V A;  1FTC A;  3CCZ A;  1W7W A;  3KK1 B;  3DKD A;  2ZC4 A;  3CJS A;  5ETM A;  2ZM6 J;  3M32 B;  3QT6 A;  2OHD A;  1BQN A;  1F6T A;  3OTO F;  3KLH B;  1RTJ A;  1YJV A;  3HHD A;  1IBL F;  2W4D A;  1E6Y B;  3R5D A;  4ERD A;  4DL0 C;  1UCN A;  4DFP A;  4EFA C;  4C8L A;  1URN A;  3UNG C;  4JI4 F;  2WVB A;  4OJ3 A;  5IC6 B;  2D3O 1;  5DZ6 A;  3FQK A;  4OYB A;  3QID A;  4CO4 A;  4X4V A;  3IR7 B;  2WAQ D;  5E2Q A;  1UJ4 A;  3IBC B;  1S6P A;  3NL0 A;  4MAK A;  2BDP A;  1OQ6 A;  1RLD A;  3QAT A;  1SBR A;  3R9L A;  5FJ4 A;  3TRG A;  3KLF B;  2HFS A;  4USV A;  5HN0 A;  1D8Y A;  2HPU A;  4KHP F;  5KFY A;  2ALY B;  2WK4 A;  4ED5 A;  3MEK A;  5F8N A;  3BS9 A;  3U02 A;  2I0X A;  4PG4 A;  4YQW A;  4DR7 F;  4ECS A;  2X3G A;  5KFM A;  3PO5 A;  1YKW A;  4F04 B;  1KN6 A;  2YX7 A;  5LMU F;  2MZT A;  4LVO P;  3VQS A;  5A8R A;  2VBZ A;  4JI1 F;  2J76 E;  3NY0 A;  4NE9 C;  4OYW A;  4FN5 A;  1HWU A;  3M2U A;  4OHV A;  2BUN A;  3AQP A;  3I5C A;  1OMS A;  2DHH A;  2JZ5 A;  3E01 B;  4P9S A;  5E41 A;  5HLF B;  1GXU A;  4C3L A;  1TUG B;  3LGN A;  1PCA A;  1DTT A;  2JH3 A;  2YKM A;  1MML A;  1HNI A;  2HMI B;  3CDU A;  1S1U B;  1REV B;  2EFN A;  3M6U A;  3RW7 A;  5K8N A;  3M9O B;  1V3Z A;  4LF6 F;  3GR0 A;  5EWG A;  1HI8 A;  1TVR B;  3FK4 A;  5H9F K;  5KG1 A;  3B4D A;  4DQP A;  4NLX A;  2LLZ A;  1TL4 A;  2NYH A;  2AIR B;  4LIR A;  1Y00 A;  4C97 A;  3V4I B;  2OD4 A;  4LFC F;  1WDD A;  2EFV A;  4IQX A;  1X9S A;  3DOK B;  4PG6 A;  3C6U A;  4IFY B;  2NXJ A;  3UPF A;  4KB7 A;  2OEK A;  3ZTP A;  2AQ4 A;  3NG8 A;  3ENA A;  1B4S A;  4JI2 F;  2E5L J;  1WF2 A;  3PX4 A;  5A0Y A;  3QGI A;  7FDR A;  3RUB L;  3RJM B;  3V6K A;  1TUV A;  4OYZ A;  5EWF A;  1HNZ F;  3AD8 C;  2AX0 A;  5B0F A;  4ZVG A;  2A3J A;  2Z30 B;  2DIU A;  3HCX A;  3H5U A;  4M1K A;  4RPF A;  4WFA Q;  2IYG A;  3QGG A;  3OJU A;  2VA2 A;  2MGZ A;  1IM6 A;  2DHG A;  1N5Y B;  1DQA A;  2LMI A;  3BGU A;  4F2S A;  2WON B;  4EU0 A;  1TKZ A;  1U0S A;  4CIO A;  4ZVT B;  1WHX A;  3KLV A;  3UW1 A;  2I1R A;  4HL9 A;  1NK9 A;  3NMR A;  1ITP A;  2NXE A;  2CQP A;  1FJ7 A;  3D0G E;  4OX9 J;  1IJF B;  1TAQ A;  4WU2 A;  5D78 A;  1BE4 A;  1OIA A;  4ZPC A;  2VIC A;  1Q78 A;  3LGH A;  4WFZ A;  4ZPA A;  2DGU A;  1F5A A;  3OL8 A;  4KKO A;  2RHQ B;  4ZOS A;  1YLX A;  3M6W A;  1H74 A;  2KJW A;  2GVZ A;  2CPD A;  4LUB A;  4OI3 A;  4YDX A;  4AXJ A;  1GMW A;  2GIQ A;  1DQ9 A;  4OHX A;  2DGX A;  2MLZ A;  2FLL A;  2Y1L B;  4PKD B;  3CIM A;  3OTB A;  3TW0 A;  3PW7 A;  4X4T A;  4UY8 5;  2V8D A;  3D6M B;  2J7U A;  3OQ2 A;  1S7H A;  3CCJ S;  2HFO A;  5F41 A;  1PJ5 A;  1FKO A;  5I3P A;  2XMA A;  4K5R A;  3CCR S;  2MZR A;  2DY9 A;  5HBM B;  3Q89 A;  3WX4 A;  2YTC A;  5A6P A;  5MAO A;  4LF8 F;  3RR8 A;  1TZ0 A;  2LA4 A;  2K7K A;  5H9F J;  1NK4 A;  1XMQ F;  2VA3 A;  2VOP A;  2CQI A;  3EXY A;  2X1A A;  3H5Y A;  1RT6 A;  5B0E A;  2KB2 A;  2GHP A;  4CNY A;  1P9Q C;  2XYG B;  1RUS A;  4WWS A;  1FHT A;  2PGC A;  2BVZ A;  2QA1 A;  5KG4 A;  4A8W A;  1FK9 B;  2HBR B;  2ASD A;  3JQK A;  2XI2 A;  5LM7 E;  5E0O A;  3MED A;  1ZZN A;  4UTG A;  1ZS6 A;  4Q43 A;  3BSO A;  4B9T A;  4J9M A;  3V6J A;  2JFD A;  1RB0 A;  3VAM A;  4K4U A;  5F8I A;  4Q44 A;  2HHT A;  1KLN A;  4RW6 B;  1Q53 A;  2BA9 A;  5IQ6 A;  3OL9 A;  1HW8 A;  2HAI A;  4A8M P;  5CZC A;  4NLQ A;  2OML A;  1R6Y A;  3W65 A;  4DV0 F;  1GTH A;  2NPI A;  3HHL B;  3EGW B;  4BDP A;  4NEY A;  3I31 A;  2JVR A;  1UFL A;  3LPY A;  4QPX A;  3HSJ A;  2BZ2 A;  4ECU A;  2H4Y B;  3EGV A;  5ETP A;  1CG2 A;  1VYA A;  3UE2 A;  1QJH A;  3KG4 A;  2XMV A;  5EDW A;  3BO3 A;  4C8Y A;  3NAH A;  4OYP A;  2VBY A;  3SDE A;  3T6B A;  1MU2 A;  4J5O A;  3SYZ A;  1N0U A;  2Q3P A;  1J5O B;  3EZU A;  1K47 A;  3BYP A;  2IM1 A;  7FD1 A;  2QFI A;  3LUY A;  1R31 A;  4KV8 A;  1RAJ A;  1SXL A;  1JLF A;  4UUX A;  4CQ1 A;  1EKS A;  1XBW A;  2CPX A;  2PSZ A;  1BWV A;  2HND A;  2KVI A;  3GPA A;  5JXS A;  2R2S A;  2ZHA A;  5I3U B;  1FVQ A;  3IA0 A;  1VLY A;  1CC8 A;  2XEX A;  4Y28 C;  3RR7 A;  2DNY A;  2FHM A;  2P5V A;  4OI2 A;  2ZZT A;  5LJ3 Y;  4G6V B;  1T03 B;  1S9G B;  3DU5 A;  3IC1 A;  5CCM A;  3Q83 A;  2QT7 A;  5D3G B;  2YWE A;  3DI6 B;  3MEC A;  1NH7 A;  3M9N B;  2CG8 A;  2RRA A;  3QGH A;  1LNQ A;  4MKA A;  3RG6 A;  2HWI A;  2VG5 B;  4O0I A;  4UOH A;  2B0G A;  2VZ9 A;  1FDN A;  4P2F A;  4BS2 A;  1M1G A;  3TQE A;  3WC0 A;  2DK2 A;  2DO0 A;  5F8G A;  4JI3 J;  1ZOT A;  4NA3 A;  4AE5 A;  4AXI A;  1AUD A;  4CZC A;  3KJQ B;  3H25 A;  4JV2 A;  1H0H B;  1VQN S;  2EK6 A;  2O66 A;  1NDC A;  1XNR F;  2NUH A;  3W60 A;  4YHH F;  1U1P A;  2HZC A;  4CRJ A;  4JV5 F;  4KC5 A;  4F0H A;  2BW2 A;  1B99 A;  4RW4 A;  1B0V A;  1HHS A;  2W2O P;  3HHN B;  2HGN A;  2WW8 A;  1FJG J;  1XK8 A;  2CFX A;  4H4O B;  2ACY A;  5C25 A;  1U47 A;  2PA8 D;  3WZ0 A;  3ZZT A;  1VCT A;  1HBN A;  3R7S B;  3PR4 A;  4YY3 F;  1XNQ J;  2JHE A;  4Y34 A;  3TX0 A;  2AD9 A;  1Z1Z A;  3UR3 C;  3PYG A;  1Q7L B;  2RB7 A;  2DNG A;  2ATC B;  1N4L A;  1RAB B;  1F0X A;  2BQ3 A;  2WRM A;  1Y3J A;  1CBK A;  1JXV A;  4FXV A;  3B82 A;  3RBZ A;  1NJZ A;  3HPO A;  2COL A;  3DRP A;  4PZV A;  1FRI A;  2IJF A;  3NLC A;  2A2C A;  2BE9 B;  3OTD A;  4URS A;  4CLU A;  1WNE A;  2IIH A;  4CH0 S;  3VAJ A;  1HLW A;  1SJ1 A;  4J9V A;  3KDN A;  2F40 A;  4ZIV A;  2QG9 B;  4EK2 A;  5GAH U;  1RTH B;  2ZOM A;  3DLK B;  1VMB A;  2W25 A;  3O1L A;  2BYC A;  5D4O A;  2HHP A;  4BWM A;  4LRF A;  4GVB A;  4DUT A;  1T3N A;  5DJB A;  4WII A;  4F0M A;  4RU9 A;  1B7F A;  3GIL A;  3L3C A;  2ZWP A;  2IRU A;  1N36 F;  3GV5 B;  5CZV A;  1Q8I A;  1ZPW X;  2GIR A;  3CC2 S;  3SI8 A;  1NM2 A;  3FSY A;  2F4V J;  4TN2 A;  1BLU A;  1T9Y A;  3MUR P;  3RGI A;  3AJ1 A;  4DPY A;  3W9I A;  4X4U A;  5B0A A;  1LK5 A;  2MTL A;  3MR7 A;  1DLO B;  2A1B A;  1EQ0 A;  2FJB B;  3CDW A;  2Z0G A;  4DQQ A;  1CJK B;  3ONQ A;  2DGS A;  2JFK A;  2J6U A;  1BGX T;  1RIS A;  2M2B A;  2RML A;  3MCN A;  1N54 B;  1SUQ A;  2AWZ A;  3NOG A;  3HKW A;  1BQM A;  1J5E F;  3BDP A;  3SQG B;  3T9N A;  3W9H A;  4FS1 A;  4GMK A;  4C8K A;  3TQ1 A;  1S1X A;  4UOG A;  1FNO A;  1SC4 B;  2JC0 A;  2EFO A;  3GP9 A;  4WTY A;  3UI3 A;  3HKZ D;  1VI7 A;  3A12 A;  4CLY A;  5C42 A;  5AXN A;  2M7S A;  4OZN A;  1X7V A;  1S9F A;  2XMJ A;  2BAN A;  3R6L B;  1D9A A;  4PXE A;  1NND A;  3ZZR A;  1UET A;  3L4B C;  2PI5 A;  2BMB A;  3V81 B;  4HI2 A;  1CPZ A;  4I67 A;  2KI2 A;  4CO1 A;  2RS2 A;  4PQU A;  2Q1L A;  3FBE A;  1CJU B;  4C0O C;  3CCU S;  4P74 A;  1AYE A;  2CQ0 A;  1WC3 A;  1U8W A;  2WSC C;  1UZD A;  3G6E S;  3MAQ A;  2DHS A;  4ED7 A;  3QWU A;  4DV7 J;  5EUH A;  4RW7 B;  1O51 A;  2ZBR A;  2GA7 A;  5M2P A;  1CUL B;  1HQ2 A;  1LW2 B;  3FZB A;  4R0J A;  4PYA A;  1PO6 A;  3DGP A;  1NXI A;  1K8A T;  5DDO C;  1S7I A;  3TEG A;  3RW6 A;  4ZVR B;  3G6V A;  4U9R A;  4WKR A;  4NLR A;  3GTY X;  3ILO A;  4PQU B;  1S6O A;  3DLL Q;  2J0X A;  2XO6 A;  1RT5 B;  2R8J A;  2BAN B;  2KVQ E;  3ILJ A;  2VPW B;  4RW9 A;  3MFI A;  3CCM S;  2DD8 S;  5C42 B;  2O5D A;  1TL1 B;  1FFW B;  4IDK A;  4DL4 A;  7AT1 B;  4ZP8 A;  3T1Y F;  1VQ8 S;  2GJI A;  1WEX A;  2RIJ A;  2ZVI A;  5IT4 A;  2N7Y A;  4Y3C A;  3M8S A;  3D2W A;  3SQG A;  4X4N A;  5CH7 B;  3CNQ P;  4NYP A;  3W9J A;  2LKZ A;  1HWI A;  4KTQ A;  2AJF E;  5IM0 A;  3K58 A;  5K9F A;  2ROG A;  4MTP A;  3CJ5 A;  5ADZ A;  2OPS A;  3W8P A;  2KRB A;  4DR1 J;  3W8G A;  4NLO A;  2W01 A;  2MXY A;  3OTE A;  2C3U A;  4TKT A;  3HLU A;  3W7B A;  3HP6 A;  3T6J A;  2P8I A;  4N76 A;  3HM9 A;  1RI7 A;  2MEW A;  3SFU A;  1PKU A;  4ZVP B;  5GAD I;  2RU3 A;  4FS2 A;  5CXT A;  5B0C A;  5BXI A;  4HDG A;  1SC6 A;  1HWJ A;  1MLA A;  3ULH A;  2UXB J;  4PWD B;  1RTH A;  2VFV A;  1HFE L;  3NNH A;  3MM5 A;  4OZJ A;  2ZH2 A;  5IS2 A;  2C3Y A;  2K3I A;  2GML A;  2XY7 A;  4IKA A;  2BQU A;  2ZZM A;  1VQ5 S;  3KDO A;  2HFU A;  2IM2 A;  4NX9 A;  2HWH A;  2VC1 A;  3MR5 A;  3CJT A;  1Y0H A;  2VOO A;  4WFY A;  1YIT S;  3DXS X;  3G6X A;  5IT9 U;  3DLE A;  4I1T A;  4CLK A;  2QTW A;  4ZCM A;  2CRL A;  4YB6 A;  3S1T A;  3TUZ C;  1Q8L A;  3LWL A;  8AT1 B;  3QBC A;  1SH2 A;  5C24 A;  4ZN1 A;  1RBL A;  3BGF A;  3SBM A;  4LQ3 A;  4RUB A;  4DU8 A;  1S10 A;  5C2C A;  4MYU A;  2DPJ A;  1S9E A;  4MMO A;  4OZ3 A;  3CD0 A;  2HKE A;  2R8H A;  1DZ5 A;  1HQE B;  3B6B A;  1TAU A;  4TU7 A;  2IMW P;  2BOP A;  4RNN A;  2YH0 A;  3EDQ B;  1UVI A;  1R3N A;  3ZTS A;  1SL1 A;  1XQI A;  3UCG A;  1UFK A;  1YJT A;  2MDA A;  2LVW A;  5HJY A;  2AYE A;  4YB1 P;  4F8R A;  2MKH A;  2KG1 A;  3RAQ A;  4RX6 A;  1V6H A;  4EO6 A;  1R0A B;  1B64 A;  2IY5 B;  2LQJ A;  3ENQ A;  1F9F A;  5L1I A;  2BM1 A;  4WF9 Q;  4I2P B;  1YWX A;  2EI5 A;  2EG2 A;  1RWU A;  2L08 A;  1Y7P A;  3JQJ A;  4Y2I A;  2ZZN A;  3E2E A;  1RAC B;  2AKW B;  4AD6 A;  3MAH A;  1H98 A;  3J7Y I;  4C3M A;  2HHX A;  3MMA B;  2M8H A;  3HFZ B;  4H4M A;  4U6P A;  1RWW B;  1URR A;  4YN3 B;  4JI8 F;  2EXU A;  2L48 A;  4DR7 J;  5KT7 A;  3FEZ A;  2IA0 A;  3CXC R;  2D74 B;  3KHR A;  2GAG C;  4KHP J;  1N5Q A;  1Q86 T;  3JB9 k;  2IA6 A;  4WP3 A;  2C2M B;  5AXL A;  2MKK A;  2ZH4 A;  4K4W A;  2R7O A;  4X4P A;  5F0U A;  1VQP S;  4DWI A;  1UP1 A;  5HQM A;  1JIH A;  3R5J B;  3GQC A;  5LSO A;  4MIW A;  1RA6 A;  1T05 A;  2F63 A;  2Q43 A;  3A8K A;  4P52 A;  4TYB A;  4J9N A;  1S0N A;  2ZKU A;  5FII A;  3OD2 A;  1YQH A;  5HAO A;  3HXM A;  1J5O A;  2ROP A;  3TR5 A;  1I94 F;  2HHW A;  2DNO A;  2C3M A;  2GGP B;  3KHH A;  3M8P B;  3S01 A;  4CT8 A;  2ZH3 A;  3HT3 A;  4DG1 B;  2YH1 A;  3ZZP A;  5KG0 A;  4ZJL A;  2HSE B;  3P4U B;  2VQF F;  2OPQ A;  3MM6 B;  3FKB A;  1QAY A;  1RCX B;  1ZA2 B;  2GHV C;  5IFM A;  1M5P C;  4HT7 A;  4KH0 B;  1P8G A;  3HHL A;  2HVZ A;  3ENV A;  1TK5 A;  3H90 A;  1WKK A;  3LGM A;  1JXE A;  4WYL A;  1UEK A;  3HD1 A;  3IS9 B;  1UMJ A;  4L74 A;  4W98 A;  1DAX A;  5D4P A;  1VLO A;  4EUV A;  5KFO A;  1U1R A;  3C16 A;  1DBD A;  3FUY A;  4FF2 A;  2DEJ A;  1RT7 B;  3P3D A;  1FXD A;  4EYH B;  1HPZ B;  1P6T A;  3QAE A;  4USK A;  1X31 C;  1YJU A;  2FDN A;  4GO5 X;  4NLP A;  3W2V A;  3Q0A A;  3A4T A;  3IRW P;  4TU8 A;  2C22 A;  4B3T J;  2L3M A;  1QUV A;  2G1H A;  3BB5 A;  1JX4 A;  2ILY A;  2UXD F;  2E5J A;  4LF2 A;  1RU1 A;  2OEM A;  2GFF A;  4K4S A;  4F50 A;  4AMP A;  2CVE A;  3U1M A;  5E5N A;  4PG8 A;  1NBE B;  1S1V B;  5C7P A;  4F4Y A;  4FP9 A;  1HNX F;  1WI8 A;  4PUO B;  1YK9 A;  1OJ4 A;  3MTJ A;  1OSC A;  1KLM A;  4P6Q A;  1REG X;  2POK A;  2BXJ A;  3GFZ A;  2Y1J A;  1VHI A;  1FKO B;  3D28 A;  1K9M T;  1JLA B;  1YIJ S;  2JL9 A;  2XTJ P;  1KBR A;  2WSE C;  2GVD B;  2HIY A;  2X3D A;  4DV0 J;  1C1B B;  3KLE A;  1X8D A;  2XUL A;  5B0D A;  3HVW A;  4X64 F;  3J80 Y;  3CD7 A;  5DQG A;  4TQR A;  1EET A;  1X4F A;  4AQY J;  3CUN A;  1S6Q A;  2MQM A;  5E33 A;  2XI3 A;  3VF0 B;  8RUC A;  4M5J A;  2N3O A;  2XC9 A;  4DV3 F;  1WHW A;  2W9B B;  1HYS A;  2AEJ A;  3LAN A;  3H98 A;  4LMZ A;  1QAI A;  1IUJ A;  4OZ1 A;  1NK6 A;  1B3T A;  4LR9 A;  3UVJ B;  1VR6 A;  3ILI A;  3QIP B;  2MKS A;  4FF1 A;  2QA4 G;  4NLT A;  6AT1 B;  4JI5 J;  3UDE A;  3CCV S;  1XMQ J;  2OGU A;  4LR8 A;  2R9L A;  1P27 B;  3M8Y A;  2IVY A;  4B3R F;  5KFC A;  3QJJ A;  2YKO A;  2F7V A;  2WVD A;  2XLI A;  4NLG A;  5EWE A;  4EYI B;  3I0S B;  3N6N A;  4BC9 A;  2UVV A;  1S72 S;  3ZZZ A;  2HFN A;  1MRO A;  1H2T Z;  4E2F B;  4DUY F;  2FJA B;  2IBK A;  3M2R A;  3MPD A;  3IFE A;  5T7L B;  4XO0 A;  3DCA A;  4JB8 B;  3IMQ J;  4J9U E;  2BQR A;  4B3M F;  4M5G A;  4LFB F;  1ACM B;  3SZ2 A;  4QCL A;  1YGY A;  3Q8P B;  3W3S A;  1JLC B;  2V5H G;  3HDS A;  5D0R A;  4DPX A;  3OHA A;  3LP2 A;  5DG7 A;  4WP9 A;  2ASY A;  1ZPV A;  3C6U B;  3V6H A;  2NR0 A;  3UDV A;  4ZPB A;  3NMA A;  3PW0 A;  1C0U A;  2AYM A;  1J2V A;  2DT9 A;  3C14 A;  1S1W A;  2LXF A;  4U95 A;  2VPY B;  2VFU A;  3LO3 A;  3PEJ A;  4KJI A;  1K0T A;  5J1E A;  2XSJ B;  1WKL A;  4QIW D;  3DC2 A;  4ZJO A;  5KFK A;  4X64 J;  1S1U A;  3PHE A;  1Y5L B;  5CYQ B;  3BH7 B;  1HNI B;  2DNL A;  3LQV A;  4LFA F;  1GH8 A;  2VQE J;  2YKM B;  1G2E A;  2PE8 A;  3A3P B;  4HHH A;  5HLF A;  1YRU A;  3N6L A;  3EWG A;  1D9D A;  3T1A A;  3TZW A;  1QTM A;  2WTF A;  2W9A A;  1A7G E;  3M8Q A;  3R97 A;  2HZV A;  4X65 J;  5A8R B;  2V4R A;  3D0H E;  4B3R J;  4C98 A;  4IG3 B;  2VON A;  2O3D A;  5CYQ A;  2UU9 J;  4ED8 A;  4JI5 F;  2R2R A;  1SQF A;  2YNI B;  4E0D A;  4LF4 J;  3D3B J;  2XSJ A;  4PEO A;  4L3N A;  2F5G A;  4HR2 A;  4OLP A;  4RNM A;  3KHG A;  4S0M A;  1UVN A;  2R7R A;  3C14 B;  3EGN A;  3TX8 A;  3AXM A;  4F4K A;  3DOM A;  1C0U B;  3O8W A;  4O3S A;  2C2E A;  1JNR B;  4KGM A;  4DV3 J;  1U8S A;  1YZ7 A;  4NPO A;  3KXD A;  1GT8 A;  1XWL A;  1FKA F;  2IAJ B;  3GSD A;  2NXC A;  3ZO7 A;  4QR2 A;  4X62 J;  2U2F A;  2CZ9 A;  2R7T A;  5KG7 A;  2HS0 A;  5T7L A;  1HA1 A;  2ZOF A;  4U7U K;  3QJL A;  2VV5 A;  3H2L A;  4UUW A;  2W2P P;  1PJ7 A;  1U49 A;  4NXN J;  1GQE A;  1C4C A;  1BQN B;  3KLH A;  2DBB A;  2UXC F;  1XEZ A;  2V69 A;  2WHO A;  3I0S A;  3T5H A;  1T11 A;  3VGT A;  3UFC X;  4K59 A;  2G4B A;  2RQM A;  3IXQ A;  4DR6 F;  1OYE A;  4AYB D;  4QYR A;  2C2O B;  1TR0 A;  1W26 A;  2QE5 A;  2YX1 A;  8ATC B;  1YRX A;  2GNK A;  5CZD A;  3BR9 A;  4I0W A;  4ZCL A;  3VGV A;  3I4P A;  5HK4 A;  2OAU A;  2CPE A;  4O3P A;  3AD9 C;  1ZYQ A;  3MTK A;  2BJ1 A;  1FXL A;  1LWC A;  1MW7 A;  3PAC A;  2XMW A;  4U8V A;  1UEU A;  1JJC B;  4ZS6 A;  3GII A;  2A0F B;  3J7A 1;  1ELO A;  2YNF A;  3AJ2 A;  1U6F A;  3DOM B;  4I56 A;  4JP8 A;  3SSS A;  2W9B A;  1GX5 A;  4F2R A;  1S6Q B;  4DCP B;  3NCP A;  4IR9 A;  2VC0 A;  2BAB A;  2DYA A;  4OYA A;  1LXN A;  1T94 A;  2YNI A;  2ROE A;  2HNZ B;  2DRD A;  2FGO A;  1SJ4 P;  1C1B A;  2H3E B;  2F8E X;  3PXG a;  1RAE B;  2LQ5 A;  3KJF B;  4IG3 A;  3K5O A;  4NZ0 A;  4NLY A;  1FDA A;  1RHK B;  1YG0 A;  4DR5 F;  3M7V A;  4DR6 J;  4OX6 A;  1VJQ A;  2YNH B;  1RWK B;  3HF5 A;  4P7V A;  4EBE A;  3CDE A;  3CCL S;  2G13 A;  2QZ8 A;  4KHR A;  4NZ7 A;  2B4V A;  5DG9 A;  4FYW B;  1VC5 A;  2YVS A;  3MAA B;  4FNI A;  1S1V A;  5JJB A;  3OFH A;  5KFX A;  4C8M A;  4USH A;  1I94 J;  4M5K A;  3VR1 A;  5A2Q Y;  1RYS A;  1NO8 A;  1M90 T;  2DIV A;  2ZOG A;  2Y8Y A;  1FRM A;  2H54 B;  1TKT B;  4CT9 A;  1VQ7 S;  1C4A A;  3L7O A;  1YBT A;  3DFE A;  4NA1 A;  4DL2 A;  2FJW A;  3PCO B;  1JJ4 A;  1S1W B;  3A13 A;  3K2Y A;  4KGK A;  1YSJ A;  4WPA A;  4ZHR B;  1HPZ A;  4QIV A;  4DS5 A;  3AOC A;  1RT7 A;  1RTI A;  2DXD A;  5AJ3 F;  3K17 A;  4IFV A;  4O3N A;  4ZMM A;  2DR8 A;  2Q6C A;  5IC4 B;  3C3L A;  1W2I A;  2VDH A;  3LP2 B;  3NWR A;  4KFB B;  3B54 A;  5KFU A;  2LYV A;  4QIF A;  4CO2 A;  1NK0 A;  3IS9 A;  4PYD A;  4ECX A;  4P73 A;  3W2W A;  4H54 A;  1U1M A;  1KVK A;  4ZLN A;  4L6V 3;  2V2V A;  3ETM A;  1R0B G;  2J7K A;  3QZ7 A;  2ERR A;  3FNN A;  4IH6 A;  3M2R B;  1GFW B;  4K4V A;  3GIK A;  3MCM A;  2QLX A;  3DYA B;  3QSI A;  3NS6 A;  4FZV A;  1JKH B;  4NLV A;  1I6J A;  2UXC J;  1X0P A;  2J7W A;  3BKF A;  1KQK A;  3LP0 B;  1N5T A;  3CCE S;  4A8Q A;  4ED1 A;  2AJ0 A;  3EZO A;  2DNZ A;  2KN4 A;  2WBM A;  2VQE F;  5G0R B;  1LW0 B;  2R7V A;  1Q5V A;  3CVK A;  4NLS A;  3GZ7 A;  1TV6 A;  2F65 A;  3JTO A;  3L09 A;  3BM7 A;  4PRF A;  3CCW A;  2B3T B;  4OIX A;  2UV8 G;  2FVP A;  1SIZ A;  2OFH X;  3QIP A;  3W62 A;  2BKN A;  1KS2 A;  1HI1 A;  2YKQ A;  5KTQ A;  2YQ0 A;  3GFH A;  4PCQ A;  5GVQ A;  3GV7 B;  4FBT A;  4ES1 A;  4B9N A;  1KC8 T;  1HYS B;  2V34 A;  4TY9 A;  3OFG A;  5E3C A;  4KGZ B;  1LXJ A;  4U67 Q;  2NRE A;  4LF4 F;  1EET B;  2ACM A;  1JLB A;  3QFW A;  1CSJ A;  1UWB B;  1PBA A;  2BM0 A;  1PIL A;  3LP1 A;  2QA2 A;  2V2Z A;  4B08 A;  4H4M B;  4CLZ A;  3MOZ A;  1VRU B;  1VJW A;  2GVD A;  2E7W A;  4YUD A;  2RKI B;  5HI7 A;  5D77 A;  3H40 A;  3T41 A;  2C2Z B;  2JOQ A;  5F3Z A;  3NAI A;  1RT3 B;  2E7X A;  2QSF A;  2OPR A;  2BKO A;  4IO9 Q;  2AJ2 A;  3W5X A;  2G2Y A;  2VBW A;  2Z2L A;  2B6A A;  3QMQ A;  5L1L A;  2KZZ A;  4LFA J;  1NLK L;  3PRB A;  2GJF A;  4Z37 A;  3F73 A;  2HHU A;  1RCO B;  2KL8 A;  2LDI A;  1NSK L;  3H20 A;  1Y11 A;  4HLB A;  2DH9 A;  4ECQ A;  4RNO A;  3TAR A;  2RVJ A;  4XK8 C;  3SCK E;  3VQT A;  4BC7 A;  3GSI A;  2GHW A;  3GMG A;  1X5T A;  3RBE A;  3PFE A;  3W2V B;  1S9E B;  2I6W A;  4QW9 A;  4DL7 A;  2OJ3 A;  2EC0 A;  2VOD A;  2DY1 A;  4HH0 A;  4QQB A;  4XDD A;  1T8E A;  3BZQ A;  1IKW A;  1YBU A;  2UZA A;  1XR7 A;  3HSD A;  1IR0 A;  2L9D A;  4QWB A;  2QV6 A;  5C24 B;  5L38 A;  4WU3 A;  3A1Y G;  3OLB A;  2NYI A;  3MMC A;  5DLF A;  1IKV A;  2GO8 A;  3TUP A;  3IO1 A;  3UO0 A;  3P49 B;  2UUA J;  2KG0 A;  2GW8 A;  3D9B A;  4QW8 A;  3VZH A;  3KG1 A;  1SIW B;  2FGC A;  1RT4 B;  4AUK A;  3M30 B;  4ILM A;  2BRL A;  4RBV A;  2W9C A;  3BSA A;  1M0S A;  1T9T A;  3EUN A;  4LBI A;  4DCO B;  1NKB A;  5KT4 A;  2CDR B;  5KFV A;  1HNV A;  2ALZ A;  3CD6 S;  1HNX J;  3MM5 B;  2GGP A;  2HLU A;  2LFV A;  2B9W A;  4ZPV R;  2EG1 A;  2V8P A;  1VGY A;  1XTZ A;  5KFD A;  1TTH B;  2XWX A;  1NHV A;  1T05 B;  4HTJ A;  4ZVU B;  4DMZ A;  3HZG A;  4DV5 J;  1EJ7 L;  4WXW A;  2AZ1 A;  3EE3 A;  1QUP A;  3GJS B;  1NB7 A;  2G0C A;  4NLD A;  2GCF A;  1U25 A;  1T9U A;  2CZV C;  2CJY B;  4HVZ A;  2UUC J;  3T5L A;  1TL3 A;  3NOC A;  1WSV A;  2R7X A;  1Q7Y T;  5CYJ A;  1MMN A;  2RS8 A;  5IM0 B;  1QSS A;  1DAR A;  3LF0 A;  4JI6 F;  2MJN A;  2JX2 A;  4JV1 A;  1Y4Z B;  3MM9 A;  4J90 A;  3MPY A;  3CMQ A;  3GCX P;  1FTR A;  2HHV A;  5LXR A;  1ULR A;  3N9U C;  4ZP7 A;  3AA9 A;  5JUM A;  3JYT A;  1MWY A;  2C3O A;  3BGO P;  3CDA A;  1JJH A;  4RW9 B;  5EX0 A;  1ZTW A;  1S79 A;  2HBQ B;  2P9E A;  2PI4 A;  1LWE B;  1RAD B;  3RB6 A;  3FMW A;  2IYI A;  4X4Q A;  2VIH A;  3A3N B;  2EBG A;  2C2N A;  3GFX A;  4UQT A;  3OVS A;  3D4J A;  4F4Z A;  3JS9 A;  4U7C A;  2FZG B;  3AT1 B;  2LXU A;  1FFG B;  2HK2 A;  1RHM B;  4IYQ A;  1EX8 A;  1OSD A;  4G1P A;  2YKN B;  4KIA A;  3J81 Y;  1VQO S;  2E1C A;  4B9L A;  3O3L A;  1DQ8 A;  1A9N B;  2X1B A;  5AXK A;  3W5Z A;  1LW2 A;  1GK8 A;  4MKB A;  3PG9 A;  2XGP A;  2MKI A;  3BO2 A;  2Z56 B;  5CCL A;  5DS7 A;  4EO8 A;  3AH6 A;  5DGA A;  2QGF B;  3OR1 A;  4FKX A;  4RW7 A;  3T9Z A;  2J9D A;  2MY7 A;  3IM8 A;  3SFG A;  2FLP A;  4JI8 J;  2MPU A;  2F4V F;  4XPE A;  5H9E K;  3DLJ A;  1WC1 A;  3DLE B;  2CAD A;  1CJU A;  1MMD A;  2MYF A;  2OEL A;  4FVC A;  2VQF J;  3BQ2 A;  4C4W A;  4K50 A;  2PT0 A;  3CJR A;  1NKC A;  1KOH A;  1BMQ B;  2ASJ A;  4JI3 F;  4X66 J;  4OI4 A;  1HWK A;  1WC0 A;  2DHA A;  2H1Y A;  1QE1 A;  1L3V A;  5ETK A;  3PRV A;  2DPI A;  4RUC A;  1NZA A;  2ZBQ A;  3H0P A;  1AXQ A;  4I2Q B;  4M63 A;  5JMN A;  2RUS A;  3Q8Y A;  1S4F A;  3DHW C;  1TEL A;  4GVL A;  2UVR A;  1S77 D;  5CAB A;  4YOE A;  3ILL A;  1BQM B;  2FVC A;  3TUI C;  1JLQ B;  4RR5 A;  3CMA S;  3O5T B;  4WP8 A;  2YBV A;  3P8B B;  3T1H F;  1VRT A;  3DMJ B;  1CJK A;  4IR1 A;  1EHW A;  1M5V C;  1JQG A;  4QBU A;  4YY3 J;  1XNQ F;  4NAS A;  5KFI A;  2MQO A;  3MEE B;  3DDI A;  1NSP A;  3A8J A;  3MEE A;  2XB2 D;  3QZ8 A;  3H5X A;  1N32 F;  2HVH A;  4AT1 B;  2FLO A;  2OPS B;  4BHQ A;  3K8W A;  2N7C A;  3GYG A;  3TVK A;  1JK9 B;  3LW5 C;  5GAE U;  3W63 A;  3DOL A;  2KT5 A;  1VIO A;  2N3L A;  2JRS A;  2QL9 B;  2BJE A;  2G2O A;  2ZBI A;  3KKF A;  4J9L A;  1JLQ A;  5T41 A;  2KM8 B;  1M5O C;  4OI1 A;  3CO0 P;  5ETV A;  1EAR A;  3US5 A;  1MN9 A;  1BC6 A;  1G6B A;  1WC5 A;  2M0G B;  3OUY B;  2W4P A;  1ZAW A;  3MD1 A;  2FHK A;  2KJV A;  4I2Q A;  4EEY A;  3TVY A;  2R42 A;  4DX6 A;  5DO2 A;  1FWP A;  3I82 A;  2M3D A;  3FQL A;  3TAM B;  3ELH A;  1RT2 A;  2BEF A;  2RT3 A;  1EQM A;  4GKJ F;  4I64 A;  2E1A A;  2E7V A;  3I5B A;  2FYX A;  4MJK A;  4OYM A;  3OSP A;  4L72 B;  1BWE A;  3K0J A;  2CJ9 A;  2MQ8 A;  2PEB A;  1KHV A;  4JI6 J;  3R8Y A;  2JWN A;  3FMB A;  3DGP B;  2WBR A;  2B4U A;  2N4C A;  4KE5 A;  4LVN P;  4O23 A;  2A18 A;  1CUL A;  4H4O A;  2VH7 A;  5C25 B;  5KFL A;  4YR2 A;  3N01 A;  1FRJ A;  1M5K C;  1JLE B;  1EB0 A;  4O3Q A;  5L9X A;  1WD6 A;  3TA2 A;  4OV6 A;  4DSF A;  3MEG B;  2RNE A;  1WKJ A;  2ZBP A;  3I32 A;  1RT1 A;  2XMM A;  2YKN A;  2GAH C;  2ZBC A;  4BLG A;  4I6Y A;  4DV5 F;  1D3W A;  1QM9 A;  2WB4 A;  3E51 A;  4I4B A;  1ZZF A;  4OZ0 A;  1HR0 F;  2D3O R;  4G1I A;  4WYW A;  4ILR A;  2BJ7 A;  1IVZ A;  2A10 A;  1IBC B;  4Y6I A;  4Z2X A;  4OI0 A;  2IRY A;  1N52 B;  5HRO A;  1FNX H;  2BX6 A;  4GO7 X;  1QDU B;  4ANC A;  3KUG A;  1WC6 A;  1I3O B;  5B08 A;  3JYT B;  1S76 D;  4RJV A;  2HFV A;  1TUW A; 
#chains in the Genus database with same CATH homology
 3HJV A;  4AMP A;  3QAT A;  3CJ8 A;  3SBM A;  2G2O A;  4AMN A;  4AMM A;  1NM2 A;  2C2N A;  2H1Y A;  2QJ3 A;  3BV8 A;  1MLA A;  3PTW A;  4AMO A;  3RGI A;  3H0P A;  3EZO A;  2CUY A;  3G87 A;  3HHD A;  4RR5 A;  3IM9 A;  4RL1 A;  2G2Y A;  5DZ7 A;  3TQE A;  2JFK A;  3TZW A;  3TZY A;  3R97 A;  5DZ6 A;  4QBU A;  2QC3 A;  3K89 A;  3TZZ A;  2G2Z A;  2G1H A;  3IM8 A;  2JFD A;  3TZX A;  3R8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...