3U07A

Crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
411
structure length
398
Chain Sequence
b'TNVDLAEDAYIYGYSIDEAYKFFYHTAVENNYPLNEFQPTINNDTLHLMGWLDVAAEPVIVSVPDMDEGRYWILHTMDMGHYTNAAFSSRTRGTKGGQFMFAAQDWQGEVPASVDEVVRVDSNLVKLMGRIMAVNDEDAKVALNYMDQWNIRTLSEYLGKNGPKPVQRTYPDPKKSTWLERVNFVLCDGSMGNADKQWLDKYQSIGVEPCKTDFTPEQLKLAKVGEKKGMEHLVELAPKMTDARTLLGTRDTLGDAPRDIFAEGTYLGQWGLPPIEASYRKSDFDSIGQKLDGSKHDYVMRFKAPNVSEFWSVTIYGNDNRLMAKNDLNRHSRGDRTMKADKDGYYTIYMSANEKGRADDPNFLPVPEKPFYAIMRFYGADDAIQSGEYQMPEIKVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein VPA0106
publication title Crystal Structure of the VPA0106 protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
total genus 105
structure length 398
sequence length 411
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06742 DUF1214 Protein of unknown function (DUF1214)
A PF06863 DUF1254 Protein of unknown function (DUF1254)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1600 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u07A02
3U07A
chains in the Genus database with same CATH superfamily
1BKZA 5A1AA 4D7YA 1QMJA 4RS5A 1W9WA 1YQCA 5DMYA 1V6IA 1H0BA 1JU4A 1FAYA 4Q0QA 4CCOA 1J83A 2ADEA 2ZEXA 5DABA 2WFPA 4HKLA 3WY6A 4DUVA 4Q4Y2 3H0OA 5LRSA 1O4ZA 3MI8A 2VOTA 1Q43A 3RFRA 1I5PA 2VW1A 4H2AA 4X6RB 3WNPA 1WBLA 5HCAA 2GSYA 1DHKB 2VVDA 2ZGUA 5F3GA 1JS9A 2IXKA 2DBIA 4W50A 5D21A 2VTXJ 2B45X 4K8FA 4MGZE 1W8OA 5FPBA 4COVA 2AUYA 1PO12 4UFKA 3TNQA 1KXGA 1PGSA 1UYZA 3S57A 2WNUA 2RJLA 1UOFA 1XXNA 2RM22 3ACLA 4Y1UA 5FPUA 1YWKA 1ZBA1 3AXEA 4KU7A 2UWCA 1G86A 5I8SA 3SCGA 3EO6A 1K42A 3GBGA 4BQYA 1VBB2 3VBRA 4AWDA 1SBEA 5F9TA 2HWF3 2R30A 1C8M1 1GICA 3ETQA 4N53C 3PU8A 4AVCA 4FSJA 1ND2A 3FL7A 4CXYA 1NG0A 1W0OA 2D6NA 2YFUA 4Y1YA 3WDYA 5BNNC 3DN7A 2L9LA 1SDDB 3V64A 1OH4A 5EYYA 1GU3A 2OUHA 3W9AA 4NPRA 3WP6A 1GZ9A 2XPJA 2V72A 3PIGA 5FMDA 3BVCA 4RR3C 5A33B 3J7NA 1BQPA 4META 1STMA 4YG3A 2JG9A 4FPOB 1QJX1 2D3PA 3LIGA 4LOSA 5FZHA 5FBJA 4IEPA 3V0AB 3ZFFC 1PGL2 5FJHA 1OA3A 2JG8C 4CYDA 1PVC3 1WLCA 4CCMA 1HXS1 2DCKA 3ROUA 5C71A 5HV4A 1UZZA 1KS5A 1J3QA 3BCWA 2XLFA 2ZBJA 4XHBA 4FFIA 4IV3C 1GNHA 1REDA 1BMV1 5EJ3A 4Y1ZA 1IG3A 2XVKA 4HFSA 3RZMA 3DGTA 2ZEWA 1AR62 4GMP0 2ZGNA 5FK8A 5IFTA 4CDUC 2VVFA 3W5NA 5KR7A 4LJHA 3H3LA 4XF3A 2Y34A 3ZXJA 3VN4A 1AL22 4CEWC 1MVEA 3PVBB 1PM4A 1UY4A 2W1QA 3MF9A 5LK7B 4DOUA 4IEYA 1F4HA 2W92A 2YROA 3ZN6B 5F3CA 5IHRA 1UPIA 3E5UA 3I59A 4IQPA 4Z82A 5FYTA 4BU2A 1A78A 1HRI1 3KV4A 3LE0A 3A22A 4XXPA 1V9U1 4OI1A 5ACA2 2WZPP 3S7IA 2JIJA 1KDKA 4XF1A 4ZU5A 1AR82 1UD1A 1DZQA 1F4AA 1XNDA 4CE8A 4HL0A 1RVF3 2E51A 3AP5A 4L0PA 1TNRA 4YW5A 3MUY1 3V0BA 3FBMA 4CCNA 1R1A1 5C4WB 2Y6GA 5A3MA 1MEC2 1MACA 1QHDA 3H8XA 1TQ5A 4Y5TA 4NPMA 1VLNA 2IFRA 3CJIC 1ZZ7A 3NAPA 1Z0HA 3HT2A 4XACA 1W8ZA 2BW8A 3R4DB 4Q4Y3 2XR4A 3MIEA 1I3HA 2VZ3A 3AYDA 3POIA 3U0ZA 3APBA 1MVQA 2VW0A 1HRV2 3I2DA 3U37A 4BJ0A 3THPA 4EROA 5BUVA 5HCFA 1G9AA 4JQTA 5FP3A 1SFYA 1UNBA 3VD3A 3O1RA 3I3MA 4QB6A 1BVVA 2WZR3 2JXAA 1CN1A 3S5AA 1JHJA 3CL1A 1PZ8A 1WW5A 4S2GA 2FCVA 3K4DA 5KWRA 1J59A 3AZZA 4XDPA 1J1LA 1R092 1PO13 5B2GB 1ZRIA 1AR73 2VOXA 3FLPA 3ZYRA 4EN6B 1F2NA 2VQAA 1HIXA 2WJSA 3R6SA 4CDWA 1XOYA 1UU4A 2JKBA 4NOTA 1FMD2 2GMEA 4PIXA 2G9GA 1VBB3 1WLTA 1ZBE1 1IG0A 2ZMLA 1CIYA 3KWVA 3NO8A 5FZ4A 3RMYA 1LOGA 1AF9A 3D6EA 3OD4A 3OJBA 4QPGB 5LA2A 5FJKA 1JYXA 4YVWA 4BQ4A 5CFDB 1A6CA 5CG9A 5F3EA 3B93A 2WN3A 4KMQA 2WC2A 5EIYB 1PMHX 1X36A 1ZYBA 4MXWA 1NA1A 3N7MA 4QPIB 3WHTA 4COWA 5C8CB 1D4M2 2DFBA 1MZFA 1C1LA 4LBOA 5FY8A 4FQ4A 4CRQA 1V00A 3P1IA 2FD8A 1LOEA 3TEWA 1H1MA 3IAPA 4K40A 4NMIA 5IAVA 1F9KA 4N53A 4XBNA 4BOWA 2XJTA 3DKWA 5ISLA 1KS4A 1W06A 2WABA 1KDMA 3SNMA 2QKDA 4ZKTB 2BOIA 3WZ1A 3I3BA 4QHZA 4Y5Z0 3GZUC 4DS0A 3NSTA 1JXNA 4UF0A 2A5ZA 3JD72 2W47A 4AEDC 1YCIA 2W0XA 2YFZA 3AZVA 4LKSA 4CXXA 2FDGA 1BCXA 3OUIA 3UKNA 5C5UA 1NQJA 4WBBA 2HLEA 2RS51 2W91A 4XFGA 2WA4A 5GALA 4ZU7A 1IS6A 4C8DA 4DFSA 1UX7A 1AR63 4DRVA 5LBFA 3DECA 5FZOA 4OQ9A 2JKXA 3ZFFA 3WD5A 1CAXA 1NCRA 4XC9A 1XBFA 2WO1A 4L11A 3WF3A 2VBDA 2N7GA 3EBRA 3RYKA 3OY8A 2G1MA 3QOPA 1B35B 3VKOA 1AL23 3SQOA 1J3PA 1OUSA 2WAOA 1KJLA 1P8JA 3MBWA 1GOFA 2EICA 2K2SA 4AEMA 3OUJA 1YHFA 1YLLA 5ABJB 5I0SA 1PZ9A 5T50A 3ZDVA 3FZ3A 4IE7A 4R52A 5ACA3 5A7NA 2ZGTA 3WT3A 3PIJA 5FYSA 2GC3A 3HIFA 5A7WB 4C1WA 1O3RA 1AR83 2JDUA 4YGBA 5LASA 1H8TC 1A8DA 4AL9A 4CP0A 4PHZA 5FZCA 3NNFA 2JDNA 5IVVA 1WLWA 4FPHA 3UL2A 1MEC3 4MLOA 4JX0A 4AF9A 4TYSA 2QDRA 3M1HA 4GAZA 3VKLA 2XGXA 2EVXA 3KT7A 3LA3A 4OCTA 4QXCA 4AFAA 2VMCA 1RUF1 1BK1A 3NV4A 3OBZA 2WZEA 1GWKA 4FPYA 2GALA 4H14A 4FTSA 4Q4W2 3AMQA 3ZPOA 2TBVA 3V56A 2UU8A 4JAAA 3BIWE 4WV8A 1HRV3 5LBEA 2BBAA 1F31A 1PO23 2VXJA 3NNGA 1QJEA 3PUAA 4FOWA 1G9CA 1BLZA 4Y22A 1XYOA 1QJU2 3HBKA 4C0HA 1DG6A 1W9TA 1Y9MA 5C9AC 2VBBA 4HVOA 1UKRA 1R093 5FYZA 1IHMA 1OBNA 1RMU1 3HJRA 1TVGA 2KA3A 5GZCA 5I0DA 2HEVF 1DZTA 1Y9QA 4MH0E 4Y20B 4DQAA 2WIIB 4PI2A 1FOD2 2DVBA 2XWJB 3CKHA 3HMYA 4IE5A 5F2WA 1VAKA 4XYXA 1VBA2 2VZOA 2XG3A 1WMEA 4GWMA 5F5AA 1RUE2 4FPGA 4BQ3A 3T2PA 5GKAC 4JGYC 5T52A 2CGPA 4LHLA 4OVEA 2E32A 2BZDA 2ET7A 1OVSA 3T1MA 1O7FA 3N7LA 3B3QE 4QXBA 4AVBA 1D4M3 1OF3A 3GF6A 2X5IC 3VBSC 4PQ9A 4ET7A 5L7OA 1Y43B 2XL7A 4ATFA 1C1FA 5F7UA 1W6NB 4XPVA 2A6YA 1PNFA 1MQTB 2E9QA 2WQ4A 2I2SA 3MIGA 1ULGA 2DVAA 1TME2 2VD7A 4LK6A 2Z42A 5FP9A 2ORZA 3A4UA 4QKNA 1EPZA 3AFKA 3VBOB 2JJ6A 2R32A 3ZX7A 4UOJA 2R1BA 1YI9A 3KT1A 1UZ0A 5EXOA 2FQPA 5JXGA 5CYYA 3JD73 1QDOA 1W6QB 2WFF1 3I2HA 5FTTC 4KWJA 1HB1A 2AEYA 1V6JA 4NWVA 4M3CE 4HSLA 5E6HA 5FZ8A 1G7YA 3ENRA 1LAJA 1LOBA 3ACFA 4RGKA 2QBXA 4AFCA 5FPLA 5K0UC 3KCXA 2P3JA 4JGZC 4R9AA 2DUOA 4WM7C 4OYUA 1AJKA 4F3JA 5FYHA 1SBDA 4BM8A 1LOCA 2W87A 2AH2A 4NWWA 1ASJ1 3D0SA 3D3AA 2TNFA 4NHKA 3WF2A 1CD3G 1ZBA2 2OQ7A 1HX6A 4MADA 4P9LA 2YXSA 3DV8A 3K4AA 4HK8A 1Q3EA 2Y0OA 1QOOA 2K46A 2BV4A 1RINA 1C8M2 3I54A 5DUVA 3UNPA 3GNEA 3WQ7A 4HKOA 5DQ0A 1S0JA 2ZKLA 2ZKNA 4CU7A 1COV1 1XJAA 1RUG1 2Q1FA 3GDBA 2P6CA 1VAMA 3O1TA 2IFWA 1RUOA 5F6KA 5FZLA 3AMHA 4EN9B 2IC1A 4R4XA 4DY3A 1H6XA 1ENQA 1SACA 1JODA 1UY3A 4AK3A 4YM3A 4OHVA 3ZYPA 1OFSA 4XJ8A 3ETPA 1H4GA 5FZKA 3VBUB 3JB8A 2YDEA 2YV8A 1T2XA 1OKQA 4CDQB 1G9DA 1JYCA 4Q4W3 1TNFA 3LDRA 3N36A 4TSVA 4YM2A 5IT6A 3PVEA 3ZYIB 4N43B 5EQUA 1W8UA 3VZLA 1HXS2 2BP6A 2Y33A 4PBPA 2E31A 3UT0A 1XYPA 4CDXC 3ZIWA 3OB8A 3OSDA 4L92A 2J1TA 4PCRA 1BMV2 1V6LA 2VY0A 2FDFA 2P3IA 4JZRA 5C70A 4UWDA 1G6NA 2BFUL 3VD5A 3MFAA 2UYAA 3NL1A 2OW4A 4FT8A 3VBHA 5F5CA 1FOD3 1VJ2A 4QU1A 1OLME 4LHKA 1SDWA 2JDMA 1S0DA 5A6ZA 3WNNA 4RQPA 1QEXA 4JHTA 5GLWA 1I9RA 1SFNA 5LZ6A 1RUE3 2VZVA 2W1UA 2V5YA 1YQ2A 1JW6A 4Q4V1 4AVVA 5DDJ1 3IT8A 1OUXA 4XJ9A 4A7YA 2YGLA 3JB4C 4ORFA 1ZRFA 2X10A 4FAHA 2VCCA 4M3CA 2ERFA 5DAXA 2NMOA 4TLFA 1UPSA 2JEMA 1IPSA 3MIFA 2D44A 3ZKYA 2DV9A 2HWB2 3C3VA 4BLJA 2VNRA 4OHXA 3B9CA 1QIQA 1QXPA 1EV12 4IV1C 4P9IA 5JI9A 2ZHMA 3LB9A 4MXVA 1R1A2 4LNVA 3WXPA 4CP9B 4DINB 1TME3 1QXJA 5AC92 4FTEA 3BTYA 1LR5A 4XBLA 2VC9A 3N9MA 4OZOA 4XXAA 2R071 4FXKB 4BCUA 2DUPA 3AP6A 4RD7A 4GWJA 4AHYA 2W68A 1HKDA 2X53S 3OYWB 5FYVA 4AQSA 4DXRA 4UXAA 4BQ1A 4NRPA 2VO5A 4RSUA 4M01A 1F15A 2IWGB 1JZ3A 4Z92B 4BPZA 1CAVA 4IGQA 2VOWA 2CSGA 1ENXA 3J26N 1ZVFA 4QT6A 2OVUA 4GH4B 4Q1RA 4XE9A 2FCUA 2RE9A 3NJXA 5L9BA 1MZ6A 5FKCA 1ZBA3 4COYA 1WZXA 2W2IA 5D8AB 3ZSLA 1ZBE2 3BTZA 4BLIA 1UX6A 2WSVA 2WLQA 2OPKA 1C8M3 4AI1A 3DPRC 2ZX1A 4L99A 4QB2A 3SHRA 4QPWA 3O1OA 1N1SA 3MW4A 1OOPB 5J98B 3ZXLA 2XQXA 5EV7A 5AVPA 4LOTA 1DP0A 3AK0A 4JKMA 3MIDA 4KWKA 2WN2A 3WDTA 1KD7A 2HWD1 2QQVA 3EQEA 3MW2A 5GZEA 5G05L 1XE7A 1UU5A 2VULA 3FN9A 4LO6B 2VOKA 4Q0SA 1EY2A 2QNKA 4CP2A 3O0XA 4YVSC 4YARA 2V09A 3O14A 1QJX3 1OA4A 1X82A 5DPNA 2Q8OA 2VPVA 1Q8VA 1LESA 3K3OA 1W0NA 3NNLA 5LWBA 1HXS3 3PMSA 1YNAA 3ZFEB 1LGBA 1TMF1 1GOGA 1JTZX 2P3YA 4GXLA 1FV3A 3VDDA 2DDUA 1AX0A 5A32A 4U2AA 1POQA 4LMFA 4BQXA 5DXDA 1X9TA 1HJGA 2RS52 2YC2A 3ZSJA 1A3KA 2LUWA 3S30A 3UK9A 2WS92 4H3WA 2B8MA 3VD7A 1GOHA 3MGUA 1AUYA 3IDAA 1G9BA 5BNOB 1PVXA 2A6VA 2A70A 4R9BA 4KH9A 1ZREA 2DYCA 1S0BA 1DGWX 4CTEA 3OGRA 2VQTA 2A75A 4EYUA 2EIEA 3NWKA 1O3QA 1UOBA 2IVJA 4PDWA 2XB6C 5JI7A 1BBT1 5CFCC 4AVTA 3HPNA 2Q1MA 5C6CA 2R16A 3ZXDA 3HNMA 4E8CA 1SBFA 4GQ7A 4KI5M 2OZJA 3VBFB 3SKJE 3BN6A 3AMPA 1OKOA 1K12A 1OHFA 2W52A 1V9U3 3LSEA 5DZFA 3T1LA 3VZKA 3KGLA 4KWLA 3AKSA 1RXGA 1N1VA 3AX4A 2PMWB 5FQ0A 2HWB3 5LK5A 3P3PA 4WZCA 3KGZA 1GV9A 1CVNA 1EV13 4IE6A 5FPZA 4IERA 2V4AA 1VBD1 5JLVA 1R1A3 4IEOA 1UMHA 3A7QA 5AC93 4LQRA 2B4KA 1GWMA 2YMZA 4IEXA 5GLUA 4HT1T 3QD6A 4BK4A 2C6SA 1RUC1 4ASKA 2WQ8A 1RUF2 1CZVA 4LO8A 5A6QA 1HJFA 5JIUA 4LLOA 3RWNA 4AHZA 4PI0A 1ND3A 3K4ZA 3USSA 2CU5A 1VRH1 1S0FA 4NR1A 1R081 2GNDA 1WKYA 2PFWA 4JKLA 3GZEA 4IE4A 3JCIA 3JXSA 2Y0IA 3ABZA 3PMEA 4LO4B 4V2WA 3AZYA 2R062 1AR91 2D7FA 5FXVA 5A7OA 1UAIA 5I93A 1ULCA 1WD3A 2ZGPA 2WWJA 4O65A 1S0GA 3N9NA 3WW1A 4MYEA 2GN3A 3PLQA 4UW5A 3VZNA 2FDHA 1KRIA 1QH7A 3WW2A 4RS5B 2A73B 1OQ1A 1RMU2 4F83A 2B39A 2Z2SB 2JDKA 4FI9A 1CPMA 1LHNA 2C26A 1C5IA 1NYWA 1JI6A 1SLLA 1ZBE3 4MHUA 2W39A 3CLPA 2NLRA 5IVBA 1UMZA 3UGFA 4RHV1 4AVSA 1XE8A 1JZ4A 4YZ2A 3IM0A 4GALA 3PURA 4A42A 1ZX5A 3NRUA 4Q0VA 2XLGA 1C8NA 1LHVA 4Q0UA 3KV9A 1D2SA 3RZGA 3QLQA 1GP5A 4E4DX 1L7LA 3GHNA 4RA0A 4BHPA 5FZEA 1ODNA 4D3WA 1DIWA 2Y6HA 1Q8OA 4L9BA 2BBVA 2WNUB 2UYBA 1REEA 4YYOA 4FAGA 3VKFC 3RI8A 1UU6A 1SCSA 5EP9A 2PN5A 3NNMA 4MGTA 3VBRB 3IMMA 3M2MA 2G9ZA 2D97A 2JENA 2VTFA 3PUQA 2PTMA 1NY72 3N4MA 2VU9A 1W3XA 2YUEA 3ZSEA 5D1IA 1IS3A 1XB9A 5F8PA 5FYMA 2YGMA 1ND2B 4LBLA 1NQDA 2VUCA 4FBFA 2RVAA 2VCMA 2RS53 2PLV1 2LALA 2OA2A 4YW2A 3K3NA 2ZX3A 2WS93 4Q4X2 3FBYA 3M8LA 3U07A 4TLGA 4JHZA 4UBHA 1RC6A 1LOAA 1EAH1 1IS5A 1PX3A 3C7OA 2QQWA 3PJQA 4JC1A 1LGCA 2HWE1 2J1UA 2YBPA 3K51A 3P5BA 4XF4A 3S0MA 4CCCA 2JG9B 3G6JB 2ID4A 1ASJ2 5FYIA 5JOYA 2JE8A 1PNGA 2G4IA 1KGYA 1X7NA 3QCWA 1E57A 4FFFA 4PIYA 4ZU4A 1L7QA 5HI0A 1JZ7A 4QAWA 1IQDC 1C4RA 4ZHNA 2ZHLA 4F7ZA 2KD7A 1CWPA 1JUIA 4YG0A 1Z7S2 1N47A 2ZABA 4AGRA 1PGW1 1RUG2 3KVBA 2P34A 3EHKA 3C2UA 3HD8B 1A34A 1SLTA 1ENSA 1B09A 2VTXA 4PF5A 4XZUG 3ELNA 4ES9A 3WV6A 2VNVA 1ACCA 3QH7A 5L73A 2WWSA 4BQWA 5CAZA 2NM1A 1NUKA 4JRAA 1WGPA 2VNOA 2HYKA 3T4HB 1RUF3 4OUEA 2WZR2 2Z5WA 5A3LA 4S2FA 3JZVA 3PUIA 2A71A 1UMIA 4NAOA 1UWWA 3B9IA 1LODA 3OBAA 3TEZA 1AR72 4WM8A 5JXJA 2MPFA 2ORXA 3H7JA 3H9AA 3HT1A 2GAUA 1W90A 2R063 2H6CA 3JU9A 3TN91 2XJRA 1OQEA 5FOBB 4M0NA 3V0BB 4Y33A 1FI2A 1UY0A 3GYDA 3POGA 1RMU3 3KMHA 5E16A 1OLRA 5I0RA 5KXBA 4YZ4A 2QJVA 5F6LB 5JCTA 5CBLA 5JZGB 4HXCA 3POJA 4NHLA 2WT2A 4U36A 5JOZA 4LR4A 5T5PA 1GR3A 1JUHA 2DCZA 2YHJA 2Z4FA 4QXKA 4GIQA 4ZPIA 3ZYJB 4Q4V2 2C5DA 2QQNA 3FC0A 1Y3TA 1RUJ1 1ST8A 2D43A 2DCYA 2PYTA 3H1YA 5FFOC 3D4KA 3AKQA 4XF9A 2XVGA 3IKWA 4N7UA 5FY0A 1CZTA 2GP5A 1REFA 2ZX2A 4IEZA 3VHRA 5I8YA 5JUVA 3BGAA 4AGVA 4ZS3A 1HB4A 4AG4A 3C7EA 3OGJA 3OPZA 4ZZ5A 1YC61 4DZGA 2DFCA 2EIDA 1MS8A 4QWNA 4CDWB 4L8QA 1DF0A 1UZYA 3BTAA 2DTYA 4CCDA 5A1FA 3M3CA 5BNPA 4UT5A 3DYOA 2QVSB 5GLVA 3QACA 4QQOA 2XJSA 1W6MA 2JB8A 2R072 3POEA 3S6PA 1HQNA 2WFF3 5E1RA 4YVWB 3VHPA 5C4WC 1I5ZA 5HXMA 2Z79A 1DCSA 1UXZA 2WNVA 4XBQA 4MXWB 1NA1B 1RUD2 2RHPA 4YGEA 1CGPA 4Q4X3 3LF7A 3K46A 2ZMKA 3GALA 1XPWA 4YGCA 2ZZJA 2E6VA 5APAA 4DUWA 1FV2A 2BTVC 3FWEA 4K8RB 1RUNA 1ZA4A 4IDZA 4KGQA 1FATA 2WBKA 4QKBA 4E4ZA 4OMDA 4EN7B 2SBAA 3JBG1 5SV8A 3TB0A 2ZAAA 4QKFA 1ASJ3 1CX4A 1FPN1 4P5HA 1DLCA 3O1SA 1LECA 5FZFA 4RN5A 4UF0B 4BMBA 4NROA 2ILMA 1BZWA 2VXRA 3KV6A 3WNXA 3U4XA 4NJ4A 4IL7A 1ZM1A 3P3NA 4R9DA 1QJZA 1WLDA 1Z7S3 5FY7A 2D6PA 2PQQA 1W0PA 3GM8A 3LD8A 3UJOA 5J48A 5KHJA 4EWAA 3H3ZA 1AJOA 1RUG3 5JMCA 5FYCA 5L19A 1QOSA 4Y4RA 5FZOB 3NV1A 4QPGC 1RJ7A 1CAXB 1NCRB 5CFDC 3IAQA 3J7LA 1E5RA 3L2HA 1QQP1 1W6PA 1Z78A 4WVWA 5IK8A 1OSGA 1PO22 3OY8B 1UOJA 3OGGA 2J7MA 4MVTA 2K0GA 3SITA 4E4SA 1ULEA 4QPIC 1DYOA 1JOPA 2VUJA 5C8CC 2V73A 3PTYA 2GNTA 1RUI1 1ZZ8A 3PNAA 3POWA 2CGOA 5FLHA 3RPQA 3BTXA 3ZXAC 2EXKA 1RHI2 3N7KA 1GZWA 4OI4A 4YG6A 3WR0A 4F8AA 2FDIA 2BWAA 3M3OA 1CESA 1YFYA 3WEZA 3R05A 2LW8A 3KHBA 1VR3A 3H50A 4FOQA 5FZ9A 4E9KA 2ARXA 5FWEA 2WKKA 1JZ6A 2ZACA 1SLBA 1VBC1 3LEKA 2AACA 2FZ2A 2ATFA 1NXD1 2DF7A 1JHNA 1UKGA 2P1BA 4BB3A 2QTWB 5A3UA 3AJYA 2YBSA 4XIOA 2GH8A 2CWSA 1BEV1 2BOJA 4ARYA 4EE2A 3ZR5A 1ZRCA 1JN2P 4Q0PA 2VUDA 5KHHA 1WMDA 2O1QA 5CKQA 5HCHA 2W9XA 2IXHA 3V0AA 3IPVA 5JOXA 1D0HA 3K48A 4X8PA 4Q8LA 3QBQA 3WDVA 1BBT2 2H0VA 4TZDA 4Q4V3 1H30A 1WCQA 4M00A 1WW4A 4Y22B 1AYM1 2HKXA 3GBFA 3MLLA 3RVHA 5J37A 3RZKA 4LKFA 2ARAA 1B35C 3LFMA 1F5JA 4CU8A 1KITA 2QQPA 2BNNA 1D0GA 3K2OA 4LBMA 2GC2A 3WF4A 3LEIA 2CDOA 5ABJC 5BNNA 5IWFA 1JZ5A 3TWIA 2Q1ZB 2BRTA 2VW2A 2PHXA 3KQRA 1LULA 2D40A 1QNWA 4RR3A 1VIWB 2VGDA 4SBVA 4FFHA 4FP3A 4XFAA 3VZOA 4AFBA 3WF1A 2VZ1A 1RUC2 3WX5A 2R073 4JQRA 4IEUA 1SZBA 1W2OA 4GKYA 1YYNA 4CPBD 2JG8A 1K5MC 5CB7A 1QU0A 3DEMA 1RUD3 5A3WA 1R082 1HB3A 4XFBA 4AGGA 3NV2A 2EXIA 2GC0A 5FUPA 4W6WA 4IV3A 4LBQD 1HN1A 4NIIA 1RB8G 1WW6A 3DXTA 1OURA 5L7OB 2VMHA 3ZO0B 2FZ1A 2WT1A 1R64A 4BQ5A 3MUZ1 4ASMB 2D98A 2YC4A 1NCQB 4ITCA 4CDUA 4QQLA 1SLIA 3ZXEA 2BNMA 5IATA 4WVMA 3POYA 1OC1A 3CBNA 3KM5A 3NKTA 4FQZA 3RZZA 3G7DA 4ONUA 3HN1A 3MV11 3OUHA 3T3YA 5JDBA 1UIKA 4DEVA 4E27A 5HPOA 5H9PA 4CEWA 5DUXA 4EJRA 3W58A 3LQCA 3NJYA 2Y60A 3OEBA 2QE3A 1YIFA 1QOTA 3VKNA 3VKMA 3THCA 5A80A 1K5JA 1PIV2 4GMP3 4XTMA 5FYUA 3ZLIA 4D7SA 1NT0A 5DG2A 1Q8PA 5FUIA 4Q8KA 4QMAA 4C1XA 2QQJA 4CCJA 1RTVA 2W46A 1DQ4A 3CMGA 3GZAA 3LKJA 3QH6A 4DIQA 3KVAA 2GNMA 4I0AA 5FXZA 3CJIA 4HSJA 4YZ5A 4TN7A 3CDZB 5C3SA 2ARCA 3PVOA 4PIZA 5ANQA 2CGNA 5C3PA 3O1VA 1RHI3 4P9XA 1J3RA 1URXA 5CFDA 1MQTC 2RS31 3LPGA 4M4RA 1TMF3 1LJ7A 4UYBA 2XJUA 2LM3A 3VBOC 3KLSA 3WG2A 4B1LA 4QX8A 2GZWA 3N9QA 3U75A 3FHIB 5C8CA 4XF0A 4AEJA 1XQNA 3ACIA 3AYEA 2FMDA 1FT9A 1PMIA 2D6KA 4KQ7A 1RUH2 1QJY1 5JR7B 4A7ZA 3HR9A 1W8HA 4W8JA 4FCAA 2OYZA 2JDZA 4B4QA 2HWF1 2JDHA 4LK7A 4MSVA 3CIHA 5KHGA 4C0BA 1BBT3 1PMJX 4D7TA 3I3EA 3RJ2X 2XBO2 2V5DA 4IE0A 4PJYA 4PF1A 2ZMNA 2NP0A 5I0TA 5G04L 4AI8A 3O7OA 1UZVA 4JVAA 4LO5B 3ZXGA 5DZEA 3C7GA 4GA9A 3T2TA 2I74A 5KHIA 3WW3A 4BK5A 1AYN1 1NZIA 1AXYA 2VCAA 2RJKA 3VBHB 2HBTA 3JQXA 4I3PA 4AQ6A 4HONA 3ZSMA 1RUC3 2RDNA 4HPKA 5EZWA 1N3QA 3T2OA 2QQOA 4RQPB 4QX3A 3POBA 2ZJCA 3DYPA 1VMFA 2J1VA 1DQ1A 4HLTA 4AEDA 1R083 4MX3A 3VBUC 4QB1A 2NYYA 4CDQC 2BPA2 4M3CB 1S0IA 3SCFA 5GLTA 2NZ9A 3HBZA 1AR93 1GKBA 1W9YA 2BGCA 4LITA 5FMOS 2XKPA 2JD9A 1RGSA 2WRAA 3K77A 4N43C 4O61A 4WZFA 4XOGA 1AX1A 1K5MA 3LAGA 3N9LA 4PLOA 4XMAA 1GZCA 1W6OA 1IS4A 4PQQA 5BY5A 4BXFA 2J1RA 3A23A 2ZXQA 3IN9A 4QX7A 1S2BA 5A3OA 4YLZA 3KZ4C 3URFA 4XAAA 1XU1A 3M70A 1ODMA 1O3SA 2B7YA 2V4VA 1AHSA 5FY4A 2ZTNA 4XFCA 4BZ4A 5FMBA 1NLQA 1UQXA 2AGSA 4JKKA 1T6GC 3N35A 2EAAA 4LA2A 3ME2A 1WWYA 1SPPA 3LGRA 1RUJ2 2F4PA 1PIV3 2E7QA 5E88A 3WSOA 4OHYA 2Q4SA 1CAVB 2VZPA 1QJX2 1H8TA 2IXIA 2F4LA 4UAPA 2A3XA 5GM0A 5LA1A 3WW4A 4SLIA 4B7EA 4E8DA 4ZY9A 4IGPA 1R1ZA 1VRBA 3O0WA 2C9KA 4M3CF 1LEDA 4MO3M 4XABA 1V70A 4YW4A 4CEYB 3T0AA 3CO2A 4Q4Y1 4EV0A 5LA9A 2WWUA 5FZDA 4LTAA 4B1MA 4RGGA 3Q8BA 4MGYE 4RFRB 3CQOA 4CU9A 4AXOA 2XJVA 4O9EA 4AI2A 3I2IA 5FPVA 2RDSA 1EP0A 4LHNA 4Z07A 4BQ2A 2LS6A 3ST7A 2ZEYA 5JIAA 2B9UA 1QWRA 1PK6B 1F5FA 3WUDA 4J6GA 4A3XA 5LW9A 1DFQA 5C9AA 1PO11 2F6BA 4K9SA 1ZZBA 2JIGA 1D4VB 1EAH3 1RUH3 1UZWA 2RM21 3AZXA 1J1TA 4G4FA 4Y3OA 5A3PA 1Y9GA 2VE1A 2VVEA 1HRI2 4BXSV 3RSJA 1V9U2 4N9IA 2YC0A 2LTNA 3RQ0A 2XBO3 3HQXA 3SCHA 4GH4C 1W8FA 3WINE 4R8HA 3VDDB 2ZOEB 4QX2A 1WMXA 5A32B 5K7PA 1AZDA 4JGYA 4W4ZA 4GKXA 1AXKA 2DVFA 2GP3A 1MS9A 4M4PA 3HNBM 3AXDA 4OUSA 4XJZA 4Y5SA 4YM1A 5D8AC 1ZRDA 3N7JA 2DVDA 1XE0A 4LBQA 1YO8A 4ZXEA 3VBSA 4AVAA 2X5IA 3CEWA 2WSUA 3OEAA 5E8AA 1W04A 4XQ4A 4D94A 5FY1A 2XXZA 4O7XA 4E2SA 1O5LA 3VL9A 1OOPC 4XZPA 3VDBA 5JSPA 1GMMA 1HB2A 1QQP2 5FOJB 1WCUA 1PGL1 2VUAA 3BALA 4DXTA 4PDWB 2BGOA 4D0QA 3ATGA 1ZZ6A 5H9QA 5IVEA 5IVFA 3S5QA 4XCBA 3GXUA 4Q26A 3NJZA 4QGLA 4UFLA 3THDA 1M4WA 3AM2A 5FZBA 1KJRA 1UYXA 2W1SA 1Q56A 5AFEA 4P14A 3D8CA 5K0UA 1AR61 1ENRA 4KWUA 5FCCA 4I3GA 5K4LA 3WCSA 1QKQA 3TN93 1VBC2 4JGZA 3W20A 1POV0 2GN7A 4WM7A 4JDOA 3ZFEC 1RXFA 4XVHA 5FY9A 3EJKA 3MIBA 4BIFA 1CAWA 4GWNA 3I3QA 3SISA 1BEV2 4FFGA 3ZVXA 5IYYA 2XHKA 1NOVA 1YFWA 3EMRA 3E6CC 1MZEA 2B5HA 4LT5A 2PHUA 3I2FA 1W28A 1ND3B 2HWC1 5F3IA 5BNOC 3FLRA 2BUKA 4XEZA 4OULA 3LCPA 3KF5A 1Q8QA 3RDIA 3U78A 4GWIA 4FPLA 3PHMA 3IWZA 4YZ1A 1AR81 1RUJ3 3MYXA 4QX1A 3GGLA 2TUNA 5JSRA 1OLMA 2E53A 2HBUA 1K45A 5DUUA 1MPXA 3GJAA 1BJQA 4B4PA 4E2GA 2GMPA 3GZTB 4ISRA 5A3NA 3TEYA 2DU0A 2XUEA 1VE0A 4I30A 2H6BA 5JAXA 4FPEA 3WOGA 3B69A 2XH6A 1XYNA 2XMLA 2VZUA 1CJPA 4N8MA 1DBNA 5DG1A 4R9CA 4CA9A 5BNQA 4BIOA 5F32A 2O8QA 3GJBA 5IK5A 4H7MA 2MEV1 3WDWA 3WG3A 5FBZA 5GZGA 3E5QA 5ERLA 1O3TA 2QDNA 3ZOIA 1NE6A 3IB3A 2UWAA 4JV4A 4M0HA 4N7IA 4URTA 3KHCA 3M7AA 3PJYA 5I91A 2Y6KA 3EYPA 3Q8AA 2D6LX 2D5FA 3OBTA 4YM0A 2J1SA 1DDLA 2VCBA 2YYOA 3AL5A 3MO4A 4LORA 4CDXA 5K8SA 2I07B 1H8VA 3CF6E 5FUNA 1JYWA 4KNCA 3ORJA 3VLBB 5J96B 4Y26A 4YW6A 2R0FA 3M4FA 4B7KA 3O1MA 1BYHA 4I02A 2E33A 2Y6FA 3OG2A 3KQ4B 3MLKA 5B4NA 2WNOA 1FMD1 3FHQA 5JR2A 4KG8A 1H4HA 4P00B 3TOJA 1C57A 3AYCA 1HRI3 1N3OA 3H7YA 3B94A 2G9FA 1FPN3 1KQRA 4HK9A 4EZHA 1K3IA 5A6YA 2VMEA 4FP2A 4HMZA 2NQYA 1NX9A 4UFHA 4UW6A 5FZ7A 2AREA 4HZFA 3ZFGB 4RS5C 5FP4A 1AVBA 3WP5A 4AFMA 5LBCA 3LIHA 3RZJA 5EPAA 4AFDA 2RS11 1W39A 2EA7A 1GANA 4QX0A 5FO7B 4FTBA 3RMXA 4G3YC 5K9YA 2E26A 4LBNA 5KHKA 4GH4A 4AW7A 5T5OA 1GQHA 4L2NA 4IV1A 1QQP3 4PLMA 5FY5A 3THTA 2D6MA 1S0EA 2WYFA 1YJKA 4OLLA 2XWBB 2VMDA 3AP9A 5F2SA 3NW4A 5FLJA 3TNPB 3W59A 5IFPA 3H1WA 5JSOA 2RMU1 1DQ0A 2WNUC 4K3UA 4W65A 4MG2A 2ZPXA 1UYPA 2O0OA 2WO3A 3BOPA 4XETA 1OOPA 3KF3A 1W3VA 4LBKA 4LUKA 2AEZA 4BDVB 3VBRC 3OPTA 4I01A 2A1XA 2YB7A 4XJWA 1CAUA 2VZSA 3IDCB 1L3JA 1VBC3 2WYSA 3CZUA 3VB9A 4OHWA 2ET1A 1ZRRA 1W9SA 1ULDA 1YQ6A 2R0HA 1FX5A 4CCEA 3ILNA 1ND2C 1FXZA 5A6XA 3WQBA 5BYNA 1BEV3 5E89A 4JTNA 1OF4A 3I2JA 3ZPYA 2O8OA 5FZ3A 1CPNA 1QGLA 2W08A 4LULA 3LEGA 3UJQA 2DCTA 3CU7A 2BVBA 2HEYF 1LB2A 3IDEA 1LHUA 1Y7BA 1H9WA 1W8TA 4WM8B 2RR11 4Z2AA 3DPRA 2OXBA 2PAMA 2JG9C 4I0WB 3J8F1 3ON7A 3TBDA 1CQ9A 2VOVA 2C24A 4XCAA 5HXVA 2JX9A 5IK7A 1XU2A 3DCQA 3MIHA 4QDRA 1U5ZA 2X29A 4XUTA 1WW7A 3M3IA 2W5FA 3KSCA 4YW7A 1UXXX 2WFF2 2B46X 4UFIA 4FPJA 4OFGA 2EALA 3F95A 4TXWA 4A4AA 5DAQA 2AYHA 4QXHA 2DVGA 4YVSA 3SEEA 4WVVA 4AI9A 3SH3A 3C7FA 3UYJA 4CUCA 2LROA 2J22A 5T5LA 3WG1A 1W03A 3EXUA 1QJU1 4RGAA 1W2UA 2PHDA 4BISA 3HN3A 2E7TA 3I2KA 3O0VA 5L9VA 5IAXA 3VDAA 2GNBA 3DUIA 4YGDA 3TEXA 3VD4A 3I49A 5J7MA 4HOOA 4CCLA 2FDKA 3WNKA 5BNPB 4J1XA 4DPNA 1VBA1 1LCLA 1AL0G 3MICA 2SLIA 4XUNA 3BIEA 1COV2 2EIGA 1W6MB 2PHTA 2PXJA 1FNZA 3POFA 4Y1VA 5CFCA 2ENRA 4DO0A 1C3HA 1MZ5A 4ZXKA 4QQ2A 2WNVB 1GLHA 3P6BA 5T55A 1NKGA 5JZGC 2E63A 1FYUA 1WBFA 2EF6A 3TYJA 2CAUA 5LEKA 4AHXA 5KBFA 1DGRA 1GP6A 4Z2WA 5CA6A 2A3WA 3I59B 4XDOA 4EWDA 5IVJA 1MS3A 1XNAA 3FUOA 1TME1 3K75B 2DTWA 3PU3A 1E5IA 3U1XA 3MFCA 3FJSA 1US2A 1D2QA 1ZNPA 4A7KA 5KXCA 2D3RA 3HQUA 2CDPA 1QH6A 2VZTA 4R4ZA 3ZYFA 2J42A 1H1AA 4IETA 5BPXA 2XLAA 2Q8CA 1JYTA 4MGQA 1WMFA 4A6SA 2JB4A 4Q27A 3OPWA 2P6HA 4CDWC 2IXJA 4EWEA 2CTVA 5CIRA 2RS33 3USUA 5T54A 4QD2A 4OI0A 4DMIA 1W2TA 5FO8B 1OH3A 5HBAA 3VV1A 1IKPA 1XRUA 3L2YA 3NAPB 2ETEA 1S4CA 4XUOA 1OLQA 3T08A 2OIIA 4AAXA 5FREA 2NPIA 2VG9A 1OA2A 4YVWC 3U4SA 1LTEA 3S7EA 2Y8KA 3ACHA 3AKTA 5B4XA 1W6PB 3ZN5A 2Q30A 2ZGQA 1CR7A 4LE3A 1GP4A 1NA1C 5TSWA 1QJY3 1U5IA 5DDJ2 1H9PA 3AB0A 2HJIA 1MS4A 1YFXA 2QQKA 2OZ6A 3MPBA 4K21A 4UW4A 5L9RA 2VAUA 1IQAA 3SXWA 1TZOA 1H2NA 5HV0A 1LU2A 4NIGA 3NNJA 3HWJA 1LEMA 5A7SA 1GZWB 4RL7A 4LO7A 1O8PA 2BNOA 3VGIA 2C9AA 3VHOA 4DY5A 2HYXA 3DXUA 4KU8A 2DCJA 4IW3A 1F35A 4UBGA 4HBNA 4NO4A 3T4VA 3VZMA 1GQGA 4CZSA 5LY1A 2BGPA 1I6XA 1SG3A 5GJ6A 2R041 3UETA 2XJPA 1KFXL 1AYN3 1HW5A 3WDUA 1V6KA 2GDFA 1J58A 4LBJA 3GBWA 5J3UA 4QKDA 5FAXA 2VR4A 3IPVB 3KS7A 5H9SA 1NCRC 3E6BA 1HN0A 1OVPA 1VBE1 5FIXA 2VL4A 4IGOA 1OI6A 5GZFA 4LKEA 1LKNA 4DXSA 3ILFA 4N53B 1N1YA 2JDPA 2P4EA 2C4XA 1M06G 2X05A 1QNYA 1QXRA 1C5HA 3SC7X 3ES1A 1C28A 5BNNB 3VUOA 3AL6A 2DWRA 3BUCA 1TG7A 3HQRA 2PHFA 2OX0A 1LOFC 1QF3A 3CJXA 3FUQA 5FZMA 3ECQA 3VL8A 2WL1A 4J1WA 4RR3B 2X09A 3I2OA 1O5UA 1XC6A 3SLIA 1COV3 1HDKA 1E5HA 1L7RA 4KBZA 4PT6A 3WG4A 2A6WA 2BERA 4NAMA 4S2DA 1RJ8A 2UWBA 1DQ5A 2UURA 3BOWA 3E1F1 3ZFFB 4HVQA 2JG8B 1W8NA 1X9PA 5FZAA 5FDBA 4LEJA 3SH5A 2HWC2 3H8OA 2HWD2 2P2KA 3D5OA 3LSDA 4TWTA 3KT4A 4IV3B 1H6YA 4EN8B 5F39A 2HWB1 3B7MA 2BYVE 4L97A 4XQDA 1EV11 3VDCA 1GZTA 3CNAA 4EZ4A 2XONA 1UN1A 4OZXA 4B3NA 1MS0A 5AC91 3J9SA 3U11A 4CDUB 3BU7A 1ONAA 3B5LB 1DGRN 2Z69A 2YU1A 4WVMB 5EWSA 2ZX0A 1TMF2 4AHWA 3A21A 3PUHA 1BK0A 5JZGA 2D93A 2XHNA 2Q5TA 1EPWA 4RFT0 3T0BA 2R1DA 4CEWB 5FRAA 5CEHA 1GYKA 2PA7A 2MEV2 1GNZA 1GQPA 1OMIA 2W1WA 3ZXFA 5CADA 2YG0A 4INDA 2PELA 5A33A 1KEXA 4XJAA 3OD0A 2VM9A 1NZCA 1WCKA 4AR2A 1ZZCA 1PX4A 4NE9A 1HQWA 1Y4WA 4Q2FA 4OMCA 5BV6A 1Q8SA 2ZGSA 2RM23 1OPOA 4GB31 3SEPA 4NHYA 5A70A 1JMUB 5DDJ3 2RJ2A 1GNYA 3BYWA 2JICA 3UGGA 3CJIB 5L7OC 2QQUA 2WO2A 4K6BA 3B00A 2ARBA 5H9RA 4NIHA 3EB7A 2Q8EA 1SLCA 2VZQA 2XJQA 1NCQC 1JYIA 4P9GA 4MGKE 2EAKA 3HVDA 5CISA 2ZGOA 5GLZA 4J25A 4HKWA 4CCKA 2Y38A 1VBD2 2RDQA 2RS12 2VQUA 4K7JA 5FZ0A 4BMEA 1DYPA 1HQLA 2XDVA 1POV1 1H2MA 1IGOA 2XUMA 3AVSA 2ZS6B 1US3A 1XSRA 3FHAA 2JE7A 5FXXA 2ZEZA 3ZN6A 1YXWA 3SH4A 1CJDA 4XJUA 5FZ6A 3UKTA 2WO7A 4ZONA 5JVVA 5CU1A 4GD4A 2ADDA 3NQHA 1NAEA 1JOBA 1VRH2 1IPKA 1PM7A 3RZHA 1EYBA 4XQWA 4Y24A 4BA6A 5F37A 2NN8A 2A6ZA 4P02B 5FPAA 5GZDA 4ARXA 3AKPA 3O5SA 1MS5A 4MHRA 2XOMA 3ZSKA 1AR92 3LZZA 4LKDA 1IZ3A 1O8SA 5LY2A 4AAPA 2RMU2 5LRRA 5C4WA 3X29B 4AZZA 2AENA 1DU3D 4B8EA 4OQ8A 1VP6A 4ISQA 2WS91 2ZCWA 3ZMNA 2CAVA 2PAKA 4CP1A 4CSWA 5C3OA 5IVYA 1ULOA 1LHWA 5C8WA 2WT0A 2WQZC 4ATEA 1YFUA 4LIVA 5DAVA 1DQ6A 2OT7A 4RHV2 5FMCA 4P9WA 5T3NA 1BVP1 1YIPA 2MHFA 4XILA 4A3ZA 1LU1A 4GZ9A 1GBGA 4FPFA 4HPKB 4Q5OA 4YW1A 4Z8BA 1U5XA 4WVZA 3RS6A 5J09A 3IBMA 4UFMA 2HWC3 4MGIE 2HWD3 4CVUA 4AEDB 3AFGA 1LOFA 2QFEA 4LE4A 4CUAA 3H8RA 1HV1A 2RR12 4YFZA 1TE1B 5FKBA 3MZHA 1X33A 4CU6A 3RRDA 3L9JT 3FX3A 2VNGA 4XURA 3J8F2 4QHOA 2VBPA 1YUDA 4QDSA 2VMFA 3N9OA 2IUWA 4YWAA 4QPGA 3OGSA 5FZ1A 1K5MB 2C1FA 2BWCA 3LPFA 4K20A 1OQDA 3D0JA 1W6OB 5FZGA 2R49A 2EXHA 4FXGB 3ES4A 1JZ2A 4NVPA 4Z1VA 2PHLA 3E5XA 5CZKA 3U10A 1UW8A 3F2ZA 4QPIA 2MEV3 2PLV2 4XFIA 3WQ1A 4IUGA 3WLUA 3VBHC 5FR3A 1OT5A 3C7HA 1RITA 2JD4A 2NMNA 3MEPA 2FBEA 2WR9A 1S1AA 1WCSA 1EAH2 2B9VA 4CXWA 5FPXA 1SPPB 2R061 5CG8A 4QGMA 2HWE2 5DAWA 2CNAA 2WUHA 1WA4A 4RQPC 3UGHA 3NV3A 5DZGA 1H8TB 4MUVA 3C8XA 4LA3A 2RDRA 1GFF2 1SQ4A 1FMD3 3BU0A 1W2NA 1NXMA 4HETA 4URAA 1S2EA 1LHOA 5JPMB 1X8MA 1YJLA 1EUUA 4E4HA 3DYMA 1PGW2 2ZHKA 2BDRA 4ZS2A 4CUBA 4E2QA 2WLPA 3HEIA 4HVRA 3J7MA 3HNYM 4XW3A 3ILRA 1VBD3 2RS13 2E7AA 2BFUS 2WDBA 3MPPG 4LHSA 3VZJA 3ZKUA 3E97A 1SFPA 1GWLA 3DKQA 4FPCA 1B35A 3R0RA 3WUCA 3O1UA 5C9AB 3U14A 1PVC1 5LCWL 3I97A 3KCYA 2AC1A 5ABJA 1H2LA 2WINB 2Y6JA 1NCQA 5FYBA 3GCXA 3NKGA 3OTFA 3R4SA 4HN0A 1VRH3 4N9HA 3PL0A 2P5BA 2W94A 5KXEA 2YBKA 4V1PA 5EHDA 1V6NA 1QDCA 1NY71 4NRQA 5CNAA 5A7WA 3LDKA 1APNA 2X8KA 4GJZA 5C3RA 4OI2A 4AE2A 2UY9A 3CHXA 4O9GA 3TN92 2RMU3 2XVLA 2B42B 1DLLA 3TRSB 3VHNA 1CZSA 4QX5A 4CEYC 2CHHA 2BJSA 4IXLA 4JGYB 5DAPA 5F1RA 2H0BA 4Q4X1 4IESA 3MW3A 5JOWA 3T09A 3HOBA 1XNTA 1TEIA 2A6XA 1F8VA 4LBQB 4LPLA 1XSQA 3MF6A 4MZUA 3VBSB 4A45A 2AZ5A 2BU9A 2DUQA 2X5IB 3I3DA 4V2VA 3RNSA 3J4UH 3AYAA 4DRRA 5FK7A 3AJZA 4ZZ8A 4RHV3 4XFHA 5T5JA 2ZX4A 2ZZQA 1PK6C 4RYDA 2D3SA 1NLRA 1GUIA 1AXZA 1UOGA 1XNKA 2RV9A 2UY8A 3I2GA 3N9PA 3H8UA 5D2AA 1I1EA 5FV3A 4AEKA 5JXIA 3T0DA 1WUVA 1RVF1 4XFFA 2CWMA 3RWKX 4DEQA 2YPDA 5JXHA 1ULFA 3IIIA 3H1MA 4S2HA 4D6QA 1Z7S1 2MNGA 2YZ4A 3DF0A 2RR13 2J1EA 3JUUA 4Y20A 1X8EA 1W9FA 5DN2A 5FXWA 1OXCA 3I4IA 1VPHA 3J8F3 1S2KA 3N3HA 4MOAA 3NMBA 3ZN4A 5K0UB 1W8WA 5F5QA 2WA3A 5FWJA 1RL3A 3O1PA 4JGZB 4QHBA 4WM7B 5EFUA 1IOAA 1YEWA 3VDDC 1BXHA 2R042 4YSFA 1UCXA 1CAWB 3BPSA 3WHUA 5EJZB 2WZR1 1U5YA 2BQPA 2Y26A 4Q29A 5ANNA 3BB6A 3OF1A 2I45A 4KGGA 4NIDA 2PLV3 2XL9A 5CKMA 2DBNA 3PDQA 1AR71 2EIBA 4P08A 5EJ1B 1EUTA 1SHWB 3FMGA 1VBE2 2D5HA 3ACGA 1W6NA 1QJU3 1VAVA 4FPKA 1MQTA 1YQ8A 1W2AX 1MR5A 2ES3A 2HWE3 1RYYA 3FE5A 2IXCA 4PDWC 1HV0A 1VBB1 3JBG2 3Q8FA 5C33A 1YQ5A 3VBOA 5JMOA 2CYFA 4HN1A 5KXDA 3AZWA 3LA2A 3UKVA 1FPN2 1V6OA 4QPYA 5FLIA 1W6QA 1UY2A 1H2KA 3RJRA 3MV01 4FOVA 4CPBA 4X6QB 2RG4A 1DQ2A 2QZ3A 4JDNA 1QJFA 2OS2A 3BPZA 5EYXA 3RGBA 3PVNA 4P9YA 1DGLA 5IW0A 1VBA3 3LDBA 3WVJA 3ZM8A 1S0CA 2WNEA 4HANA 2KR2A 3J7HA 4MV2A 2D6OX 5SV5A 1MS1A 2LRPA 3JQWA 4B4RA 2YU2A 4AI3A 4EN0A 3WDXA 4CDXB 5CVRA 3MLJA 5FMOL 3RG0A 3GHMA 3I7DA 4LXLA 3RZLA 1OD3A 2QQMA 1ND3C 1RUI2 1U12A 5DUWA 3BKZA 4IEWA 2G19A 3LA7A 2W3JA 5FYYA 4QQHA 3V65A 4DUXA 1XNCA 5A7QA 1O6UA 2VQ0A 2CV6A 1W99A 1O4TA 4HG6B 3H42B 4GJYA 5HCBA 1NLSA 5FQ0B 5FP7A 2A7AA 4YFWA 3ZYHA 1E5SA 1V0AA 3ZXKA 4KG0A 3M3EA 1RUD1 1YI7A 2VZRA 3KB5A 4P9JA 5F5IA 1BHGA 1X50A 3INAA 2JE9A 1PZ7A 2FMYA 1AL21 2VECA 4XUQA 4CUGA 4NN0A 1JBCA 4Q1PA 2R6QA 3VBUA 4CDQA 4NPLA 1VB4A 1IPJA 3FFZA 3W21A 3ZIXA 2VH9A 5KC5A 4QQPA 4AYUA 2VMIA 4N43A 3KV5A 5I0UA 4IV1B 4I0BA 4AQ2A 5ACA1 1ZZ9A 4CEYA 1A8MA 2J1AA 4GB32 4A41A 4IEQA 3I8TA 3ZR6A 1AYM2 4G9SB 1VALA 1VMHA 2FCTA 3AP4A 2OKXA 1WA6X 5IJRA 1UF2C 2Y6LA 3DL3A 2F17A 2OUJA 3NVCA 4BH9A 4P5YA 1MEC1 5LBBA 3OCPA 2IVIB 4H7LA 3TAYA 4D8MA 3VBFC 1V6MA 1OD5A 2WAAA 2GC1A 4UI9L 1PK6A 1IKQA 2QQLA 1FNYA 3KCCA 4GMP1 1CAUB 4JCKA 4LIUA 4LUMA 1UL9A 4PLNA 3ZFGC 4FVVA 2JECA 1LENA 1HRV1 1N1TA 2R043 2PAEA 4GULA 1PO21 1T6BX 1CIWA 3E6DA 4YRDA 2HH9A 3BI3A 3T30A 5L36A 5LEJA 3B02A 3W5MA 5LB6A 1LGNA 1R091 1RHI1 5CKNA 2OQ6A 1UY1A 3RYPA 4BWOA 1VBE3 3HAGA 5JWPA 3FFQA 2JDYA 2C0ZA 4QDQA 5FP8A 1SCRA 3DPRB 4BYYA 2BVVA 1SEFA 1JU3A 1N3PA 3NJVA 4X8NA 3SKVA 4CP9A 1LRHA 5C7GA 3A0NA 3JBG3 3POSA 1Q5OA 4UFJA 4I09A 3VD9A 4UW3A 4I2OA 4QM9A 4JRLA 4NUBA 4W6XA 4XAEA 1O91A 1UYYA 1O59A 4C91A 3UESA 5M0TA 2ZGKA 4C90A 3OBRA 2EXJA 3OYWA 4XDQA 3Q9OA 1W05A 3ALQA 2KM2A 2KXLA 5AFBA 3LWCA 1UIJA 4XHXA 4ASLA 4XMIA 2W95A 2ZGRA 5C3QA 4YVSB 2JDAA 1D4M1 2QQIA 2ZA9A 1J84A 3Q8EA 3AC0A 2QCSB 5A7PA 4EQVA 1SLAA 4DXZA 3GCWA 2TEPA 3WF0A 4A6OA 5IK4A 4TTGA 1PHMA 1G9FA 2K9ZA 2CY6A 5A3TA 1OFNA 3WQ0A 5LA0A 2ZGMA 1WCDJ 3AP7A 1DZRA 3IZOA 4IEVA 5D8AA 3JD71 4PBOA 4Y4YA 3RI9A 2VMGA 1RUI3 1VMJA 2HEWF 5IVCA 4NHXA 4AI0A 4FOYA 4H55A 1S55A 2XQRA 4WM8C 1GSLA 1JH5A 2PHWA 2O14A 2YY1A 4MGSA 3ZYBA 2OPWA 1VB2A 3ASIA 4DB5A 2RS32 5C5TA 3WP3A 1LNSA 3LOBA 1DGWA 1XNBA 5CFCB 2P3KA 2CL2A 4A2UA 4JDMA 4LLFA 3RYRA 2FHRA 3ZMOA 1OPMA 1QJY2 1HLCA 4K1YA 4D6SA 1NE4A 4YPJA 4NRMA 4A44A 2P37A 2HWF2 4QGNA 4COUA 4COZA 5J1XA 2Y64A 3OOXA 4XTPA 3R4UA 3BODA 2A3YA 3ZFEA 3D82A 4GB33 2ZAHA 3WP4A 2PHRA 1AYM3 4YZ3A 1ZA7A 3LEMA 2WZ8A 4NIAA 2PQSA 5J36A 4KBBA 4QU2A 4YW3A 2Q8DA 2IZWA 3WCRA 2ZGLA 2GH2A 1ALYA 3IDBB 2XKOA 3OGVA 3PTRB 1JYVA 1YRZA 5I8TA 3USUB 4JTOA 5BNOA 4BE3A 1AYN2 4OHZA 3UV9A 3MHZA 5BNPC 2Q0AA 4YNIA 1PIV1 4FO9A 3SMHA 4Q4W1 3T2QA 4D6RA 1POV3 2QZ2A 2IXLA 4QM8A 1U0AA 5KC6A 3CZJA 2GMMA 1H1IA 1PVC2 2QUOA 3MDPA 4XIKA 3M3QA 4ES8A 3AVRA 4B29A 2P17A 2WNVC 3IMNA 4W6YA 3VBFA 2FDJA 3AMMA 3AMNA 4AQTA 3H3UA 1SMVA 1UO9A 4AOCA 1JYNA 3WNOA 1JOJA 2BEOA 1QY4A 3PUSA 3ZFGA 3ZYGA 4OUMA 5BXXA 4Y1XA 3A0KA 5LATA 2YPJA 2DU1A 1FOD1 3ITQA 1O4YA 1RIRA 4K1ZA 3KD4A 5A1LA 1WD4A 2DURA 3AKRA 3B01A 1D7PM 5AVAA 4NHMA 2ZHNA 5FZIA 3WNMA 1RUE1 1RUH1 2AR6A 1DYKA 3WNLA 5JPNB 1AX2A 2R7EB 2VJXA 1CX1A 5FO9B 1G8WA 3ZDSA 2GU9A 3LOIA 5IUQA 1ULPA 3NAPC 1CONA 4D69A 3LFIA 4DNYA 3Q8CA 2JWPA 4XUPA 3O12A 3FLTA 4N90A 1JZ8A 2XBO1 1KFUL 3IIAA 4KL1A 1RVF2
chains in the Genus database with same CATH topology
1BKZA 4D7YA 1QMJA 4RS5A 1V6IA 1H0BA 1FAYA 4Q0QA 3WY6A 2WFPA 4HKLA 4Q4Y2 3H0OA 5LRSA 1O4ZA 3MI8A 1Q43A 5HCAA 2VW1A 4X6RB 1WBLA 2GSYA 1DHKB 2VVDA 2ZGUA 2IXKA 4K8FA 2B45X 4MGZE 4COVA 2AUYA 1PO12 3TNQA 1KXGA 1PGSA 2WNUA 2RJLA 1XXNA 2RM22 3ACLA 4Y1UA 1YWKA 1ZBA1 3AXEA 4KU7A 2UWCA 1G86A 5I8SA 3SCGA 3EO6A 3GBGA 1VBB2 3VBRA 4AWDA 1SBEA 5F9TA 2HWF3 2R30A 1C8M1 1GICA 3ETQA 4N53C 4AVCA 4FSJA 1ND2A 1NG0A 1W0OA 2D6NA 4Y1YA 3WDYA 5BNNC 3DN7A 3V64A 5EYYA 2OUHA 3W9AA 4NPRA 3WP6A 1GZ9A 2XPJA 4RR3C 5A33B 1BQPA 4META 4YG3A 2JG9A 4FPOB 1QJX1 2D3PA 4IEPA 3V0AB 3ZFFC 1PGL2 1OA3A 2JG8C 4CYDA 1PVC3 1WLCA 1HXS1 2DCKA 3ROUA 1UZZA 1KS5A 1J3QA 3BCWA 2XLFA 2ZBJA 4XHBA 4IV3C 1GNHA 1REDA 1BMV1 5EJ3A 4Y1ZA 2XVKA 4HFSA 3DGTA 1AR62 4GMP0 2ZGNA 4CDUC 2VVFA 4XF3A 3ZXJA 3VN4A 1AL22 4CEWC 1MVEA 3PVBB 3MF9A 5LK7B 4DOUA 4IEYA 2YROA 3ZN6B 1UPIA 3E5UA 3I59A 4IQPA 4Z82A 1A78A 1HRI1 4XXPA 1V9U1 4OI1A 5ACA2 2WZPP 3S7IA 1KDKA 4XF1A 4ZU5A 1AR82 1UD1A 1DZQA 1XNDA 4HL0A 1RVF3 2E51A 3AP5A 1TNRA 4YW5A 3V0BA 3FBMA 1R1A1 5C4WB 5A3MA 1MEC2 1MACA 1QHDA 1TQ5A 1VLNA 2IFRA 3CJIC 1ZZ7A 3NAPA 1Z0HA 3HT2A 3R4DB 2BW8A 4Q4Y3 3MIEA 3U0ZA 1I3HA 3AYDA 3APBA 1MVQA 2VW0A 1HRV2 3I2DA 5BUVA 3THPA 4EROA 1G9AA 5HCFA 1SFYA 1BVVA 2WZR3 2JXAA 1CN1A 3CL1A 1PZ8A 1WW5A 4S2GA 5KWRA 1J59A 3AZZA 1J1LA 1R092 1PO13 1AR73 2VOXA 3FLPA 3ZYRA 4EN6B 1F2NA 2VQAA 1HIXA 2WJSA 3R6SA 4CDWA 1UU4A 2JKBA 4NOTA 1FMD2 2GMEA 4PIXA 2G9GA 1VBB3 1WLTA 1ZBE1 2ZMLA 3NO8A 3RMYA 1LOGA 1AF9A 3D6EA 3OD4A 3OJBA 4QPGB 4YVWA 5CFDB 1A6CA 5CG9A 3B93A 2WC2A 1X36A 1ZYBA 4MXWA 1NA1A 3N7MA 4QPIB 3WHTA 4COWA 5C8CB 1D4M2 2DFBA 1MZFA 1C1LA 4LBOA 4CRQA 4FQ4A 1V00A 1LOEA 1H1MA 4K40A 1F9KA 4N53A 4XBNA 4BOWA 2XJTA 3DKWA 1KS4A 3SNMA 1KDMA 2QKDA 4ZKTB 3WZ1A 4Y5Z0 4DS0A 3GZUC 3NSTA 1JXNA 2A5ZA 3JD72 4AEDC 1YCIA 2W0XA 3AZVA 1BCXA 3UKNA 1NQJA 4WBBA 2RS51 4XFGA 2WA4A 5GALA 4ZU7A 1IS6A 4DFSA 1AR63 4DRVA 3ZFFA 3WD5A 1CAXA 1NCRA 4L11A 2N7GA 3EBRA 3RYKA 3OY8A 3QOPA 1B35B 3VKOA 1AL23 1J3PA 1KJLA 4AEMA 2K2SA 5I0SA 1YHFA 1YLLA 5ABJB 1PZ9A 5T50A 3FZ3A 4R52A 5ACA3 2ZGTA 3WT3A 4C1WA 2GC3A 3HIFA 1O3RA 1AR83 4YGBA 4CP0A 1H8TC 1A8DA 1WLWA 4FPHA 3UL2A 1MEC3 4MLOA 4AF9A 4TYSA 2QDRA 3M1HA 3VKLA 2XGXA 2EVXA 3KT7A 3LA3A 4AFAA 1RUF1 1BK1A 3NV4A 4FPYA 2GALA 4H14A 4FTSA 4Q4W2 3AMQA 2TBVA 3V56A 2UU8A 4JAAA 3BIWE 4WV8A 1HRV3 1F31A 1PO23 4FOWA 1G9CA 4Y22A 1XYOA 1QJU2 4C0HA 1DG6A 5C9AC 4HVOA 1UKRA 1R093 1IHMA 1RMU1 5GZCA 2KA3A 2HEVF 1DZTA 1Y9QA 4MH0E 4Y20B 4DQAA 2WIIB 1FOD2 2DVBA 2XWJB 3HMYA 1VAKA 4XYXA 1VBA2 2XG3A 1WMEA 4GWMA 1RUE2 4FPGA 5GKAC 4JGYC 5T52A 2CGPA 4LHLA 4OVEA 2ET7A 3T1MA 1O7FA 3N7LA 3B3QE 4AVBA 1D4M3 3VBSC 3GF6A 2X5IC 4PQ9A 5L7OA 1Y43B 2XL7A 4ATFA 1C1FA 1W6NB 4XPVA 2A6YA 1PNFA 1MQTB 2E9QA 2WQ4A 2I2SA 3MIGA 1ULGA 2DVAA 1TME2 2Z42A 3VBOB 3A4UA 1EPZA 3AFKA 3ZX7A 2JJ6A 2R32A 2R1BA 1YI9A 3KT1A 5EXOA 2FQPA 3JD73 1QDOA 1W6QB 2WFF1 5FTTC 4KWJA 1V6JA 4NWVA 4M3CE 4HSLA 1G7YA 3ENRA 1LOBA 4AFCA 5K0UC 3KCXA 2P3JA 4JGZC 4R9AA 2DUOA 4WM7C 1AJKA 4F3JA 1SBDA 4BM8A 1LOCA 2AH2A 4NWWA 1ASJ1 3D0SA 2TNFA 4NHKA 1CD3G 1ZBA2 1HX6A 4P9LA 2YXSA 3DV8A 4HK8A 1Q3EA 2Y0OA 1QOOA 1RINA 1C8M2 3I54A 5DUVA 3GNEA 3WQ7A 4HKOA 1S0JA 2ZKLA 2ZKNA 1COV1 1RUG1 1VAMA 2IFWA 1RUOA 5F6KA 3AMHA 4EN9B 2IC1A 4R4XA 4DY3A 1ENQA 1SACA 4AK3A 4YM3A 4OHVA 3ZYPA 1OFSA 4XJ8A 1H4GA 3VBUB 4CDQB 3JB8A 2YDEA 2YV8A 1G9DA 1OKQA 1JYCA 4Q4W3 1TNFA 3N36A 4TSVA 4YM2A 5IT6A 3PVEA 3ZYIB 4N43B 3VZLA 1HXS2 4PBPA 1XYPA 4CDXC 3ZIWA 4L92A 4PCRA 1BMV2 1V6LA 2VY0A 2P3IA 1G6NA 2BFUL 3MFAA 2UYAA 3NL1A 2OW4A 4FT8A 3VBHA 1FOD3 1VJ2A 4LHKA 1SDWA 1S0DA 4RQPA 5GLWA 1I9RA 1SFNA 1RUE3 4Q4V1 2V5YA 1JW6A 4AVVA 5DDJ1 3IT8A 4XJ9A 4A7YA 2YGLA 3JB4C 4ORFA 1ZRFA 4FAHA 4M3CA 2ERFA 2NMOA 4TLFA 1UPSA 2JEMA 3MIFA 2D44A 2DV9A 2HWB2 3C3VA 4BLJA 2VNRA 4OHXA 3B9CA 1QXPA 4IV1C 1EV12 5JI9A 4P9IA 2ZHMA 3LB9A 4MXVA 1R1A2 4LNVA 3WXPA 4DINB 5AC92 1TME3 1QXJA 4FTEA 1LR5A 4XBLA 4XXAA 2R071 4FXKB 4BCUA 2DUPA 3AP6A 4RD7A 4AHYA 2W68A 1HKDA 2X53S 3OYWB 4AQSA 4UXAA 4BQ1A 4RSUA 4M01A 2IWGB 4Z92B 4BPZA 1CAVA 2VOWA 3J26N 1ENXA 1ZVFA 4QT6A 2OVUA 4GH4B 4Q1RA 4XE9A 2RE9A 1MZ6A 1ZBA3 4COYA 5D8AB 3ZSLA 1ZBE2 4BLIA 1UX6A 2WSVA 2WLQA 2OPKA 1C8M3 4AI1A 3DPRC 2ZX1A 4L99A 3SHRA 1N1SA 3MW4A 1OOPB 5J98B 3ZXLA 5EV7A 5AVPA 3AK0A 3MIDA 4KWKA 3WDTA 1KD7A 2HWD1 3EQEA 3MW2A 5GZEA 1XE7A 1UU5A 2VULA 4LO6B 2VOKA 4Q0SA 1EY2A 2QNKA 4CP2A 3O0XA 4YVSC 4YARA 2V09A 3O14A 1QJX3 1OA4A 1X82A 2Q8OA 2VPVA 1Q8VA 1LESA 1HXS3 3PMSA 1YNAA 3ZFEB 1LGBA 1TMF1 1JTZX 4GXLA 3VDDA 1FV3A 1AX0A 5A32A 4U2AA 5DXDA 2RS52 3ZSJA 1A3KA 2LUWA 3S30A 3UK9A 2WS92 4H3WA 2B8MA 3MGUA 1AUYA 1G9BA 5BNOB 1PVXA 2A6VA 2A70A 4R9BA 4KH9A 1ZREA 2DYCA 1S0BA 1DGWX 4CTEA 2A75A 3NWKA 1O3QA 4PDWA 2XB6C 5JI7A 1BBT1 5CFCC 4AVTA 2Q1MA 5C6CA 2R16A 3ZXDA 1SBFA 4GQ7A 2OZJA 3VBFB 3AMPA 1OHFA 2W52A 1V9U3 3LSEA 5DZFA 3T1LA 3VZKA 3KGLA 4KWLA 3AKSA 1N1VA 3AX4A 5FQ0A 2HWB3 5LK5A 3P3PA 4WZCA 3KGZA 1GV9A 1CVNA 1EV13 5FPZA 4IERA 1VBD1 5JLVA 1R1A3 4IEOA 5AC93 2YMZA 5GLUA 4IEXA 4HT1T 3QD6A 1RUC1 1RUF2 4LO8A 5JIUA 4LLOA 3RWNA 1ND3A 3USSA 1VRH1 1S0FA 4NR1A 1R081 2GNDA 2PFWA 3JCIA 2Y0IA 3PMEA 4LO4B 3AZYA 2R062 1AR91 2D7FA 5I93A 1UAIA 1ULCA 1WD3A 2ZGPA 3WW1A 5B2GB 1S0GA 4MYEA 2GN3A 3PLQA 4UW5A 3VZNA 1KRIA 1QH7A 3WW2A 4RS5B 2A73B 1OQ1A 1RMU2 4F83A 2B39A 2Z2SB 1CPMA 1LHNA 1C5IA 1NYWA 1SLLA 1ZBE3 2W39A 3CLPA 2NLRA 1UMZA 4RHV1 4AVSA 1XE8A 4YZ2A 3IM0A 4GALA 1ZX5A 4Q0VA 2XLGA 1C8NA 1LHVA 4Q0UA 1D2SA 3QLQA 4E4DX 3GHNA 4RA0A 4BHPA 4D3WA 1DIWA 1Q8OA 4L9BA 2BBVA 2WNUB 2UYBA 1REEA 4YYOA 4FAGA 3VKFC 3RI8A 1UU6A 1SCSA 2PN5A 3VBRB 3M2MA 2JENA 2D97A 2PTMA 1NY72 3N4MA 2VU9A 2YUEA 3ZSEA 5D1IA 1IS3A 2YGMA 1ND2B 4LBLA 1NQDA 4FBFA 2RS53 2PLV1 2LALA 2OA2A 4YW2A 4Q4X2 2ZX3A 2WS93 3FBYA 3M8LA 3U07A 4UBHA 1RC6A 1LOAA 1EAH1 1IS5A 3PJQA 4JC1A 1LGCA 2HWE1 4XF4A 3K51A 3S0MA 2JG9B 3G6JB 1ASJ2 5JOYA 1PNGA 2G4IA 1X7NA 3QCWA 4PIYA 1E57A 4ZU4A 5HI0A 1C4RA 2ZHLA 4F7ZA 1JUIA 4YG0A 1Z7S2 1N47A 2ZABA 4AGRA 1PGW1 1RUG2 2P34A 3EHKA 3C2UA 3HD8B 1SLTA 1ENSA 1B09A 4PF5A 4ES9A 3ELNA 3WV6A 3QH7A 5L73A 2WWSA 5CAZA 2NM1A 4JRAA 1WGPA 2VNOA 2HYKA 1RUF3 2WZR2 2Z5WA 5A3LA 4S2FA 3JZVA 2A71A 3B9IA 1LODA 1AR72 4WM8A 2MPFA 3H7JA 3H9AA 3HT1A 2GAUA 2R063 2H6CA 3JU9A 3TN91 2XJRA 1OQEA 5FOBB 4M0NA 3V0BB 1FI2A 3GYDA 1RMU3 3KMHA 5E16A 1OLRA 5I0RA 5KXBA 4YZ4A 2QJVA 5F6LB 5JCTA 5CBLA 5JZGB 4NHLA 2WT2A 4U36A 5JOZA 4LR4A 5T5PA 1GR3A 1JUHA 2DCZA 2YHJA 4QXKA 3ZYJB 4GIQA 4Q4V2 2C5DA 3FC0A 1Y3TA 1RUJ1 2D43A 2DCYA 2PYTA 3H1YA 5FFOC 3D4KA 3AKQA 4XF9A 2XVGA 3IKWA 4N7UA 5I8YA 1REFA 4IEZA 2ZX2A 3VHRA 4AG4A 4AGVA 3OGJA 3OPZA 4DZGA 2DFCA 4CDWB 1MS8A 4L8QA 1DF0A 1UZYA 3BTAA 2DTYA 5BNPA 3M3CA 2QVSB 5GLVA 3QACA 4QQOA 2XJSA 1W6MA 2R072 3S6PA 1HQNA 2WFF3 5E1RA 4YVWB 3VHPA 5C4WC 1I5ZA 2Z79A 2WNVA 4XBQA 4MXWB 1NA1B 1RUD2 2RHPA 4YGEA 1CGPA 4Q4X3 2ZMKA 3GALA 4YGCA 2ZZJA 2E6VA 1FV2A 2BTVC 3FWEA 1RUNA 1ZA4A 4KGQA 1FATA 4E4ZA 4EN7B 2SBAA 3JBG1 5SV8A 3TB0A 2ZAAA 1ASJ3 1CX4A 1FPN1 4P5HA 1LECA 4BMBA 2ILMA 1BZWA 2VXRA 3WNXA 3U4XA 4IL7A 1ZM1A 3P3NA 4R9DA 1QJZA 1WLDA 1Z7S3 3UJOA 2D6PA 2PQQA 1W0PA 4AHZA 5J48A 5KHJA 4EWAA 3H3ZA 1AJOA 1RUG3 5JMCA 5L19A 1QOSA 3NV1A 4QPGC 1RJ7A 1CAXB 1NCRB 5CFDC 3L2HA 1QQP1 1W6PA 1Z78A 4WVWA 5IK8A 1OSGA 1PO22 3OY8B 3OGGA 3SITA 4MVTA 4E4SA 2K0GA 1ULEA 4QPIC 2VUJA 5C8CC 2V73A 3PTYA 2GNTA 1RUI1 1ZZ8A 3PNAA 3POWA 2CGOA 5FLHA 3RPQA 3ZXAC 2EXKA 1RHI2 3N7KA 1GZWA 4OI4A 4YG6A 3WR0A 4F8AA 2BWAA 3M3OA 1CESA 1YFYA 3R05A 1VR3A 3H50A 4FOQA 4E9KA 2ARXA 2WKKA 2ZACA 1SLBA 1VBC1 2FZ2A 2ATFA 1NXD1 2DF7A 1JHNA 1UKGA 3AJYA 4XIOA 2GH8A 2CWSA 1BEV1 1ZRCA 1JN2P 4Q0PA 5KHHA 1WMDA 2O1QA 2IXHA 3V0AA 3IPVA 5JOXA 1D0HA 3K48A 4X8PA 4Q8LA 3QBQA 3WDVA 1BBT2 2H0VA 4TZDA 4Q4V3 1H30A 4M00A 1WW4A 4Y22B 1AYM1 2HKXA 3GBFA 3MLLA 5J37A 1B35C 1F5JA 1KITA 2QQPA 2BNNA 1D0GA 4LBMA 2GC2A 5ABJC 5BNNA 3TWIA 2Q1ZB 2VW2A 2PHXA 3KQRA 1LULA 2D40A 1QNWA 4RR3A 1VIWB 2VGDA 4SBVA 4FP3A 4XFAA 3VZOA 4AFBA 1RUC2 3WX5A 2R073 4JQRA 4IEUA 4GKYA 1YYNA 2JG8A 1K5MC 5CB7A 1QU0A 1RUD3 1R082 4XFBA 4AGGA 3NV2A 2EXIA 2GC0A 4W6WA 4IV3A 4LBQD 1RB8G 1WW6A 5L7OB 2VMHA 3ZO0B 2FZ1A 2WT1A 4ASMB 2D98A 1NCQB 4ITCA 4CDUA 4QQLA 1SLIA 3ZXEA 2BNMA 4WVMA 3POYA 3KM5A 3RZZA 3NKTA 4FQZA 3G7DA 4ONUA 3HN1A 5JDBA 1UIKA 4E27A 5H9PA 4CEWA 5DUXA 4EJRA 3W58A 2QE3A 1YIFA 1QOTA 3VKNA 3VKMA 1PIV2 4GMP3 4XTMA 4D7SA 5DG2A 1Q8PA 4Q8KA 4QMAA 4C1XA 1RTVA 3GZAA 1DQ4A 3LKJA 3QH6A 2GNMA 4I0AA 3CJIA 4HSJA 4YZ5A 3PVOA 4PIZA 2CGNA 1RHI3 4P9XA 1J3RA 1URXA 5CFDA 1MQTC 2RS31 1TMF3 1LJ7A 2XJUA 2LM3A 3VBOC 3KLSA 3WG2A 2GZWA 3FHIB 5C8CA 4XF0A 4AEJA 1XQNA 3AYEA 2FMDA 1FT9A 1PMIA 2D6KA 4KQ7A 1RUH2 1QJY1 5JR7B 4A7ZA 3HR9A 4FCAA 2OYZA 2JDZA 4B4QA 2HWF1 4MSVA 5KHGA 4C0BA 1BBT3 4D7TA 3RJ2X 2XBO2 4PJYA 2ZMNA 2NP0A 5I0TA 4AI8A 3O7OA 4JVAA 4LO5B 3ZXGA 5DZEA 4GA9A 3T2TA 2I74A 5KHIA 3WW3A 1AYN1 3VBHB 1AXYA 4AQ6A 2RJKA 3JQXA 4I3PA 3ZSMA 1RUC3 4HPKA 5EZWA 1N3QA 4RQPB 2ZJCA 1DQ1A 4HLTA 4AEDA 1R083 4MX3A 3VBUC 4CDQC 2NYYA 2BPA2 4M3CB 1S0IA 3SCFA 5GLTA 2NZ9A 3HBZA 1AR93 1GKBA 2BGCA 5FMOS 2XKPA 1RGSA 4N43C 4WZFA 4XOGA 1AX1A 1K5MA 3LAGA 4PLOA 4XMAA 1GZCA 1W6OA 1IS4A 5BY5A 3IN9A 1S2BA 4YLZA 3KZ4C 3URFA 1XU1A 3M70A 1O3SA 2B7YA 4BZ4A 1AHSA 2ZTNA 4XFCA 2AGSA 1T6GC 3N35A 2EAAA 4LA2A 3ME2A 3LGRA 1RUJ2 2F4PA 1PIV3 2E7QA 5E88A 4OHYA 2Q4SA 1CAVB 1QJX2 1H8TA 2IXIA 2A3XA 5GM0A 3WW4A 4SLIA 4B7EA 1R1ZA 4M3CF 3O0WA 1LEDA 4YW4A 1V70A 4CEYB 3CO2A 4Q4Y1 4EV0A 4LTAA 4RGGA 4MGYE 4AXOA 2XJVA 4O9EA 4AI2A 4LHNA 1EP0A 4Z07A 3ST7A 5JIAA 2B9UA 1QWRA 1PK6B 1F5FA 3WUDA 4J6GA 4A3XA 1DFQA 5C9AA 1PO11 2F6BA 4K9SA 1ZZBA 1D4VB 1EAH3 1RUH3 2RM21 3AZXA 1J1TA 4G4FA 2VVEA 1HRI2 3RSJA 1V9U2 4N9IA 2YC0A 2LTNA 3RQ0A 2XBO3 3HQXA 3SCHA 4GH4C 3WINE 4R8HA 3VDDB 2ZOEB 5A32B 5K7PA 1AZDA 4JGYA 4GKXA 1AXKA 2DVFA 1MS9A 4OUSA 4XJZA 3AXDA 4YM1A 5D8AC 1ZRDA 3N7JA 2DVDA 4LBQA 1YO8A 3VBSA 4AVAA 2X5IA 3CEWA 2WSUA 5E8AA 4D94A 4XQ4A 4E2SA 1O5LA 3VL9A 1OOPC 4XZPA 5JSPA 1QQP2 5FOJB 1PGL1 2VUAA 3BALA 4PDWB 3ATGA 1ZZ6A 5H9QA 4Q26A 3NJZA 4QGLA 1M4WA 3AM2A 1KJRA 1Q56A 5AFEA 4P14A 3D8CA 5K0UA 1AR61 1ENRA 5FCCA 4I3GA 3WCSA 1QKQA 3TN93 1VBC2 4JGZA 1POV0 2GN7A 4WM7A 4JDOA 3ZFEC 3EJKA 3MIBA 4BIFA 1CAWA 4GWNA 3SISA 1BEV2 3ZVXA 2XHKA 1NOVA 1YFWA 3E6CC 1MZEA 2B5HA 4LT5A 2PHUA 1ND3B 2HWC1 5BNOC 3FLRA 2BUKA 4XEZA 4OULA 3LCPA 3RDIA 1Q8QA 4FPLA 3PHMA 3IWZA 4YZ1A 1AR81 1RUJ3 3MYXA 2TUNA 5JSRA 2E53A 5DUUA 1BJQA 4B4PA 4E2GA 2GMPA 3GZTB 4ISRA 2DU0A 4I30A 2H6BA 5JAXA 4FPEA 3WOGA 3B69A 2XH6A 1XYNA 1CJPA 5DG1A 1DBNA 5BNQA 4R9CA 4BIOA 2O8QA 5IK5A 4H7MA 2MEV1 3WDWA 3WG3A 5FBZA 5GZGA 3E5QA 2QDNA 1NE6A 2UWAA 4JV4A 4M0HA 4N7IA 4URTA 3M7AA 3PJYA 5I91A 2D6LX 2D5FA 3OBTA 4YM0A 1DDLA 2YYOA 4CDXA 5K8SA 2I07B 1H8VA 3CF6E 4KNCA 5J96B 3VLBB 4Y26A 2R0FA 3M4FA 4B7KA 1BYHA 4I02A 3MLKA 1FMD1 4KG8A 1H4HA 3TOJA 1C57A 3AYCA 1HRI3 1N3OA 3H7YA 3B94A 2G9FA 1FPN3 1KQRA 4HK9A 4FP2A 4HMZA 2NQYA 3ZFGB 4UW6A 2AREA 4HZFA 4RS5C 1AVBA 3WP5A 4AFMA 4AFDA 2RS11 1W39A 2EA7A 1GANA 5FO7B 4FTBA 3RMXA 4G3YC 5K9YA 5KHKA 4LBNA 4GH4A 4AW7A 5T5OA 1GQHA 4L2NA 4IV1A 1QQP3 4PLMA 3THTA 2D6MA 1S0EA 1YJKA 4OLLA 2XWBB 3AP9A 3NW4A 5FLJA 3TNPB 3W59A 5JSOA 3H1WA 2RMU1 1DQ0A 2WNUC 4K3UA 4W65A 2ZPXA 2O0OA 3BOPA 4XETA 1OOPA 4LBKA 4LUKA 3VBRC 4I01A 4XJWA 1CAUA 3IDCB 1L3JA 1VBC3 4OHWA 2ET1A 1ZRRA 1ULDA 2R0HA 1FX5A 3ILNA 1ND2C 1FXZA 5BYNA 1BEV3 5E89A 4JTNA 3ZPYA 2O8OA 1CPNA 1QGLA 2W08A 4LULA 3UJQA 2DCTA 3CU7A 2BVBA 2HEYF 1LB2A 3IDEA 1LHUA 1Y7BA 1H9WA 4WM8B 2RR11 3DPRA 2PAMA 2JG9C 4I0WB 3J8F1 3TBDA 1CQ9A 2VOVA 5HXVA 2JX9A 5IK7A 1XU2A 3MIHA 1U5ZA 2X29A 1WW7A 3M3IA 3KSCA 2WFF2 2B46X 4FPJA 4OFGA 2EALA 4YVSA 2AYHA 2DVGA 4WVVA 3SH3A 5T5LA 3WG1A 3EXUA 1QJU1 4RGAA 1W2UA 2PHDA 2E7TA 3O0VA 2GNBA 3DUIA 4YGDA 5J7MA 5BNPB 4J1XA 4DPNA 1VBA1 1LCLA 1AL0G 3MICA 2SLIA 1COV2 2EIGA 1W6MB 2PHTA 1FNZA 4Y1VA 5CFCA 2ENRA 1C3HA 1MZ5A 4ZXKA 4QQ2A 2WNVB 1GLHA 5T55A 5JZGC 2E63A 1FYUA 1WBFA 2EF6A 3TYJA 2CAUA 5LEKA 4AHXA 5KBFA 1DGRA 5CA6A 4Z2WA 2A3WA 3I59B 4EWDA 1MS3A 3FUOA 1TME1 2DTWA 3MFCA 3FJSA 1D2QA 1ZNPA 4A7KA 5KXCA 2D3RA 1QH6A 4R4ZA 1H1AA 4IETA 5BPXA 2XLAA 1WMFA 4Q27A 4CDWC 2IXJA 4EWEA 2CTVA 5CIRA 2RS33 3USUA 5T54A 4QD2A 4OI0A 4DMIA 5FO8B 5HBAA 3VV1A 1IKPA 1XRUA 3L2YA 3NAPB 2ETEA 1OLQA 2OIIA 5FREA 2NPIA 2VG9A 1OA2A 4YVWC 1LTEA 3S7EA 3AKTA 1W6PB 3ZN5A 2Q30A 2ZGQA 1CR7A 4LE3A 1NA1C 5TSWA 1QJY3 1U5IA 5DDJ2 1H9PA 3AB0A 2HJIA 1MS4A 1YFXA 3MPBA 2OZ6A 4K21A 4UW4A 1IQAA 3SXWA 1H2NA 1LU2A 3HWJA 1LEMA 1GZWB 4RL7A 4LO7A 3VGIA 2BNOA 2C9AA 3VHOA 4DY5A 4KU8A 2DCJA 4UBGA 3VZMA 4HBNA 4NO4A 4CZSA 1GQGA 1I6XA 5GJ6A 2R041 2XJPA 1KFXL 1AYN3 1HW5A 3WDUA 1V6KA 2GDFA 1J58A 4LBJA 3GBWA 5J3UA 5FAXA 3IPVB 3KS7A 5H9SA 1NCRC 3E6BA 1VBE1 1OI6A 5GZFA 1LKNA 3ILFA 4N53B 1N1YA 1M06G 1QNYA 1QXRA 1C5HA 3ES1A 1C28A 5BNNB 3VUOA 2DWRA 2PHFA 1LOFC 1QF3A 3CJXA 3FUQA 3VL8A 3ECQA 2WL1A 4J1WA 4RR3B 1O5UA 3SLIA 1COV3 1HDKA 3WG4A 2A6WA 4S2DA 1RJ8A 2UWBA 1DQ5A 2UURA 3BOWA 3ZFFB 4HVQA 5FDBA 2JG8B 4LEJA 3SH5A 2HWC2 2HWD2 2P2KA 3D5OA 3LSDA 4TWTA 3KT4A 4IV3B 4EN8B 2HWB1 3B7MA 2BYVE 4L97A 4XQDA 1EV11 3CNAA 1UN1A 4OZXA 4B3NA 1MS0A 5AC91 3J9SA 3U11A 4CDUB 3BU7A 1ONAA 3B5LB 1DGRN 2Z69A 4WVMB 5EWSA 2ZX0A 1TMF2 4AHWA 5JZGA 2D93A 2Q5TA 1EPWA 4RFT0 2R1DA 4CEWB 5FRAA 1GYKA 2PA7A 2MEV2 1GNZA 1OMIA 3ZXFA 5CADA 4INDA 2PELA 5A33A 4XJAA 3OD0A 1NZCA 1WCKA 1ZZCA 1HQWA 4Q2FA 5BV6A 1Q8SA 2ZGSA 2RM23 1OPOA 4GB31 5DDJ3 2JICA 3CJIB 5L7OC 4K6BA 3B00A 2ARBA 5H9RA 1SLCA 2XJQA 1NCQC 1JYIA 4P9GA 4MGKE 2EAKA 2ZGOA 5GLZA 4HKWA 2Y38A 1VBD2 2RS12 4K7JA 4BMEA 1DYPA 1HQLA 1POV1 1H2MA 1IGOA 2XUMA 2ZS6B 2JE7A 3ZN6A 1YXWA 3SH4A 1CJDA 4XJUA 3UKTA 5JVVA 5CU1A 1VRH2 1IPKA 1PM7A 1EYBA 4XQWA 4Y24A 4BA6A 2NN8A 2A6ZA 5GZDA 3AKPA 3O5SA 1MS5A 3ZSKA 1AR92 3LZZA 1IZ3A 2RMU2 5LRRA 5C4WA 3X29B 2AENA 1DU3D 4B8EA 1VP6A 4ISQA 2WS91 2ZCWA 3ZMNA 2CAVA 2PAKA 4CP1A 1LHWA 5C8WA 2WT0A 2WQZC 4ATEA 1YFUA 1DQ6A 4RHV2 4P9WA 5T3NA 1BVP1 1YIPA 2MHFA 4XILA 1LU1A 1GBGA</