3U07A

Crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
411
structure length
398
Chain Sequence
TNVDLAEDAYIYGYSIDEAYKFFYHTAVENNYPLNEFQPTINNDTLHLMGWLDVAAEPVIVSVPDMDEGRYWILHTMDMGHYTNAAFSSRTRGTKGGQFMFAAQDWQGEVPASVDEVVRVDSNLVKLMGRIMAVNDEDAKVALNYMDQWNIRTLSEYLGKNGPKPVQRTYPDPKKSTWLERVNFVLCDGSMGNADKQWLDKYQSIGVEPCKTDFTPEQLKLAKVGEKKGMEHLVELAPKMTDARTLLGTRDTLGDAPRDIFAEGTYLGQWGLPPIEASYRKSDFDSIGQKLDGSKHDYVMRFKAPNVSEFWSVTIYGNDNRLMAKNDLNRHSRGDRTMKADKDGYYTIYMSANEKGRADDPNFLPVPEKPFYAIMRFYGADDAIQSGEYQMPEIKVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein VPA0106
publication title Crystal Structure of the VPA0106 protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
total genus 105
structure length 398
sequence length 411
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06742 DUF1214 Protein of unknown function (DUF1214)
A PF06863 DUF1254 Protein of unknown function (DUF1254)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1600 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u07A02
3U07A
chains in the Genus database with same CATH superfamily
1U0AA 4FOYA 4I02A 1IQAA 5GLZA 2YPJA 3CDZB 1DYOA 4GZ9A 5GLUA 3VHRA 5ERLA 1O3RA 4FPFA 4O61A 4WVZA 2FZ2A 2YHJA 3K75B 4Y20A 4CPBA 4ZONA 5IK7A 2VC9A 2WO3A 4I3PA 4YM1A 2YG0A 2WUHA 4Q4W3 2WFPA 3S7IA 5KWRA 1NY72 2GNMA 2VTXJ 4XF0A 2VZSA 1JW6A 3NJZA 1D0GA 1N1YA 2ES3A 1JN2P 2R042 4NHYA 1IHMA 1RB8G 1L7LA 4FPCA 3Q8FA 1R083 4YM0A 5SV8A 1LGBA 3DV8A 3IN9A 4LO6B 5BPXA 5FKBA 1OQDA 5JZGB 4ASLA 4CUBA 2W1QA 2H6BA 4NVPA 3VBUA 3HBZA 1PM4A 4FSJA 1WMXA 5JOWA 4IEWA 2ZGRA 1CESA 3WF3A 1RUG2 2QTWB 3E5QA 1ND2B 1MPXA 4BQ2A 2YYOA 3AKRA 5A3UA 3WSOA 2HKXA 3GZAA 4QGNA 1NXD1 3JBG3 3AFGA 4CDUC 1RUC2 3QLQA 2EXKA 1BLZA 5L9BA 4YVWC 3UJQA 1WCSA 1XSQA 1S2BA 1X33A 2EF6A 1SLIA 4R9DA 4DEQA 5IVFA 3ZFGA 4QKFA 1VMFA 2ZKNA 3GZEA 3POSA 2PHUA 4QPYA 2DFCA 2PHRA 2RM23 5C4WA 4DXRA 1IS3A 1VALA 1WMDA 2Z42A 1SHWB 2VH9A 3JB8A 3NV3A 3UKTA 4CU7A 5C33A 2YC4A 3VZJA 1LR5A 1V6LA 2K0GA 1AYM2 2ZX4A 4CDXB 3WDYA 3A0KA 3KHBA 4GKXA 1GWKA 1MS9A 4QDRA 3JQXA 1H1MA 3N7JA 1GWMA 3DKQA 3OF1A 5A1FA 1ZBE2 1JZ7A 2VMFA 4EROA 1XYPA 1Q43A 4MGQA 1Q5OA 3QACA 1H8TC 3T4HB 1W6MA 4S2FA 4WZCA 3EYPA 5JR2A 4CDQC 3TBDA 1MQTC 4IEZA 3AP9A 1ASJ1 4Q1PA 4BHPA 2Q8DA 3ST7A 1O5UA 1DQ0A 1MZ6A 4FCAA 4YZ5A 5FO9B 3U0ZA 3BGAA 3B9IA 2XONA 3I2IA 2FMYA 3ACIA 4XMAA 4CP0A 4U2AA 1EAH3 1YFYA 2L9LA 2A3WA 1ZZBA 3I2JA 4HPKB 4JGYB 5DZEA 1RXFA 3CJIB 3I8TA 1MS3A 4IE4A 1WCDJ 4ZS2A 1POV3 4JGZA 1OLQA 3ZXAC 1F4HA 4HT1T 4DY3A 5FMOS 4MXVA 1SPPA 2ZMKA 4AEDA 3A7QA 4HFSA 4QWNA 1O3QA 1O8PA 1SDWA 2VZ3A 4FI9A 4F83A 4AZZA 1OFNA 5J09A 2Y33A 2PQQA 1E5RA 1AR93 1F15A 5IK8A 1UW8A 4Q4W1 2PQSA 5DDJ3 5F6LB 4Q5OA 1ENSA 1NUKA 1PVXA 2JKXA 3PIJA 4QQHA 1LHVA 1XXNA 1R1A2 4V2WA 5F7UA 2ZTNA 1JYXA 3JD72 3KQ4B 4DUXA 3K77A 3IBMA 5BNPA 3OJBA 2BU9A 3ILRA 3MZHA 2VVDA 1S0FA 1SFNA 5IFTA 2OPWA 5D8AB 1CJDA 3AM2A 5FZIA 2NQYA 1XPWA 4YGEA 5JVVA 1J3QA 1XB9A 3HJRA 4YGCA 5JZGA 1PVC2 5L36A 2R32A 4FO9A 3DYOA 3WDXA 2V5DA 4M4RA 2BYVE 2XKOA 4AE2A 5FY8A 2ILMA 3HOBA 4IV3C 4N53C 4PF1A 3RRDA 3JBG1 1K5MC 1KXGA 5HXMA 3TOJA 2Q1ZB 4WM8C 3H8RA 2HEWF 5AFBA 1KQRA 1YHFA 2QQOA 2B9UA 4AHZA 2HWD2 1D4M2 1TE1B 3N9PA 4ITCA 1JYCA 3H50A 3WF0A 4HK9A 2V09A 3T2QA 1D2QA 2WQZC 4Y5TA 3HN1A 1PK6A 4HMZA 2RS33 1ZREA 2XL7A 5GKAC 3R05A 3IAQA 2VPVA 4ZU7A 1J1LA 2RM21 3VBHC 1VBE3 3MFAA 1HRI3 3HQXA 2BVVA 3NNJA 3GBGA 5JMCA 2OW4A 4LBQA 5B4XA 5I93A 2Q0AA 2ZX3A 1CAVB 4OQ8A 4AI9A 1H0BA 3VBSC 2JJ6A 4E2SA 4L0PA 4B4RA 3NQHA 5H9RA 5FUPA 4C8DA 1S4CA 1X50A 5GM0A 1KEXA 2ZABA 1F31A 4K9SA 4RSUA 4Q1RA 4XUNA 1MS0A 3NNGA 2QQVA 1ODNA 2FMDA 1SLBA 1AR63 1X9PA 2GAUA 5F5IA 3MUZ1 3IB3A 4PBOA 1AF9A 3GHNA 4LA2A 3POBA 4L99A 2GC1A 4LBLA 2VCAA 1IPKA 4GB32 1ULFA 2XHNA 3OGSA 1VBD2 4XW3A 4BB3A 2BNMA 1UU6A 1C1LA 2Z4FA 1PHMA 3ZMNA 5A3PA 4A3ZA 4IXLA 1WMEA 1EAH1 1UN1A 3JB4C 3O14A 4NPRA 2RMU2 1J3RA 4Z07A 3U11A 1POV1 3FN9A 5J37A 2FHRA 2AGSA 3UJOA 3ZYBA 4DUWA 3O12A 3T0DA 3AXEA 2VGDA 1BCXA 1DCSA 3G6JB 3PNAA 4WV8A 1O91A 1AR91 4AR2A 2ADEA 2JE9A 5DDJ1 4PT6A 4LQRA 3WCSA 5FWEA 4EN6B 4XOGA 5JXGA 3R4SA 3AJYA 1BYHA 1UWWA 1XNDA 1NA1C 1OOPB 1LOCA 1NE6A 2BVBA 4MSVA 4I09A 5CKNA 4ISRA 3CL1A 1DP0A 1Q56A 4EN0A 4ARYA 3MIDA 5T5JA 1W6PA 4ATFA 3IMNA 5IK4A 5KHHA 1Y43B 4MGIE 1MS4A 1WW6A 4N7IA 5A7SA 3PMEA 3BU0A 1DLLA 3M70A 3B7MA 4YVSB 4A7YA 3I2FA 4MVTA 5A7WA 1QJY3 1UU5A 2EXJA 1H4GA 3AXDA 4XZUG 3CMGA 2Q1MA 3ZSLA 3U14A 4JTNA 1DQ1A 3HNYM 4K7JA 3ZIWA 1JZ4A 4PDWB 3I2GA 3H7JA 3J8F3 1N3QA 1GZCA 4HVRA 4QX2A 2HWE2 4Q0PA 1AR72 2RDSA 5CADA 5JPMB 4A7KA 1Y3TA 2KA3A 4Z82A 2WQ8A 4E4SA 2RDNA 2AEYA 2DCJA 3B3QE 3N7MA 2RS31 3PUSA 3WY6A 3NKTA 2VVFA 3GCWA 2JG8B 2D3PA 1CZVA 4K21A 1HRI1 2FQPA 1ULGA 2GC0A 2OQ6A 2VZOA 5GLWA 1ZBE3 2CDPA 2WJSA 3W21A 5ABJA 5C70A 3VD3A 1LGCA 3NSTA 2IFWA 5KHKA 5DN2A 1O8SA 4IERA 3T08A 2DF7A 1WA4A 3E6CC 1POQA 3I59A 4JGYC 5F3EA 3KV9A 1ZNPA 5CFCB 1AX0A 2VOWA 2D44A 5FJHA 1WMFA 2J1SA 3L2HA 2B7YA 4D7SA 1JHNA 3VB9A 1L3JA 2WT2A 2QCSB 3A4UA 5FZ6A 2RDQA 5GALA 3VKFC 5BNOA 1HLCA 1AR61 5EXOA 1UCXA 2JWPA 5D2AA 5FK8A 2VMCA 5ANQA 2ZXQA 2B8MA 2DWRA 2PN5A 3N9LA 4KBBA 4AI3A 2Y6GA 4HVOA 2E7AA 4YW6A 2DVFA 2P4EA 5FY4A 2QKDA 5C8CC 5I8TA 1HN1A 4OMCA 4EZHA 5A3WA 1VBA3 3S5AA 4H2AA 5L9RA 2Y6HA 3RYRA 1AL22 3GCXA 1LOBA 2VMGA 1GP5A 3GXUA 2YBSA 3M1HA 2DTYA 5D8AC 3WQ1A 2ZGQA 1CPMA 4GKYA 1PX4A 2FCUA 1MZEA 3POEA 1CAUB 5DAPA 5LRSA 5FPBA 1R1A3 4JQRA 3ZXGA 5JIAA 4K40A 3BN6A 4NRMA 4AFBA 4FFIA 2D40A 1UU4A 3FHIB 3PL0A 4LLOA 1W0PA 2PA7A 5KHIA 5EZWA 1UL9A 4LO5B 4XFHA 1AR82 2A6WA 1R1ZA 4P00B 3VZLA 5C5UA 4KWJA 2HYXA 1R64A 1W99A 4FVVA 2YXSA 4TYSA 2ZX0A 5FYZA 2ZGTA 3WQ0A 1VAVA 1PVC3 5HV4A 4CA9A 3Q9OA 2QQJA 2D43A 4FP3A 5DAQA 2WNVA 5JI7A 1TEIA 1OPOA 5FBZA 3WEZA 3VDAA 3M3QA 1W39A 1GR3A 1DG6A 4KU7A 4TLGA 3W20A 3KGZA 2D7FA 2VO5A 4MGZE 1QJY1 2XQRA 2VQ0A 3CBNA 3UNPA 1IPJA 1YQ6A 1NKGA 2V73A 3OY8A 4I2OA 2HWD3 3VBRA 4RR3A 1VB2A 5FY5A 5I0DA 3H3ZA 1NE4A 3IM0A 3Q8BA 3J8F1 4RFT0 1PZ8A 3ZYJB 5FPZA 4CTEA 3V0AB 3O1TA 2ETEA 3ILNA 3ZXEA 1SBFA 4GH4C 1W6QA 1H6XA 3JXSA 4RGKA 3I2HA 2LUWA 4NMIA 4Q2FA 5A3TA 3GZTB 4OMDA 1W04A 1B09A 1EYBA 4WZFA 4BJ0A 1QGLA 3ZPYA 2H0BA 3UKNA 4QHOA 1JOJA 5AVPA 4L9BA 5FMOL 4FPLA 2QQLA 1IS4A 2WSVA 3HVDA 2XH6A 5FZAA 1QQP1 3ZN6A 4N43A 4HBNA 3IT8A 4NE9A 2X5IC 4META 5FZFA 3H1WA 5FCCA 5KXEA 3UGGA 1W6NA 1JZ5A 1YI9A 4S2HA 1IKPA 2UURA 3N9QA 4WM7C 4BQ4A 2XLGA 2C1FA 2W87A 4DB5A 2WRAA 3AP5A 1G7YA 2OS2A 2W5FA 3GALA 2VR4A 2B46X 2ZHNA 3U1XA 3FHAA 3K4DA 1F5JA 1VBD3 5JR7B 1MVEA 4QX8A 4XCAA 2DUOA 5T5OA 5AC93 4C1WA 2DURA 4RQPB 1GKBA 2A6XA 3ZYPA 4A45A 2D3SA 4AFAA 1OKQA 1OOPC 4JV4A 2YB7A 2E32A 1VBA1 2GC2A 4FPHA 2JENA 4I0AA 3GZUC 2CGNA 4NHXA 2D6LX 1C5HA 4P9LA 2GNDA 5FQ0B 3KMHA 3WLUA 5A3LA 4BMEA 4LHKA 4XE9A 3J7NA 3AZZA 3PTRB 4LEJA 2EVXA 2Q8OA 4AAXA 4LOTA 1R1A1 2JG9A 4G3YC 1DQ5A 2ZACA 3ZFFA 4CEWA 4YW7A 3TNQA 1WD4A 2J1UA 1ONAA 1W8NA 2WO1A 4YFWA 4AGGA 1ODMA 1CONA 5L19A 1UYPA 2NLRA 2Q30A 2XWBB 3SISA 1OA2A 1LODA 4LK7A 2R073 3RYKA 4FTBA 4OVEA 3AMNA 1W05A 1ZZ6A 4AEJA 1V6JA 1ASJ2 1LHUA 1RXGA 2JDAA 3KT4A 5GZEA 4M01A 4KMQA 3FFZA 4AI2A 5C3RA 1PVC1 2Z79A 3THTA 3PHMA 4YW3A 3ZSJA 5C3PA 4LR4A 5E6HA 3B9CA 4QAWA 4R9AA 1F9KA 3GBWA 5F8PA 1YUDA 1Z0HA 1TZOA 1UZVA 1QJFA 1XNCA 2VG9A 2Y6FA 4MZUA 5DAVA 3X29B 1HXS1 4A3XA 1O4ZA 5A32B 1PGL1 4IGOA 5C9AA 4MHRA 1AR73 1NZIA 1YFUA 3ZKUA 2VECA 1YQCA 5C3QA 2Y38A 3E1F1 5L7OB 4XABA 1WW4A 1HB2A 4TSVA 2GP3A 4XFGA 1MS5A 2D6KA 4UBHA 4Q4W2 3O1MA 4RGAA 5A3OA 3HBKA 1H2MA 1OLME 3BIWE 3KLSA 3ZMOA 1H2KA 3ZXLA 3USUB 5M0TA 4KWLA 3UK9A 2ZKLA 4FOVA 5CNAA 1BHGA 3VD5A 4I30A 3M3IA 1VP6A 3QD6A 2JICA 4G4FA 2XLAA 3KCCA 2R1BA 4UOJA 4BWOA 4BXFA 4C0HA 5BNNA 3AMPA 2BV4A 1UD1A 3NRUA 3OPZA 3I3QA 4OCTA 5DUUA 3FC0A 2OPKA 4QXHA 1UZWA 3OD0A 3P5BA 1OF3A 4ISQA 4XILA 2OYZA 1K42A 3WR0A 2ORXA 1OKOA 2RV9A 4OHVA 3LFMA 1RHI2 3MDPA 2VBDA 2R49A 3M3OA 3IMMA 3ZX7A 4TXWA 1S0CA 3JBG2 5I0UA 5K7PA 4BXSV 3SEEA 2A6ZA 3LD8A 3IPVA 1WKYA 3NL1A 2OQ7A 4J1XA 5CKMA 1VBD1 3VZOA 4Y1ZA 1SLTA 3CHXA 5AC91 3OGVA 2W3JA 4L11A 3MW3A 4ASMB 1RUJ3 4S2GA 2BGOA 1W8TA 4NRQA 4XXPA 2RM22 5FP7A 3K4AA 4CDUB 3KVAA 4EN8B 4BK5A 5EJ1B 5CFDA 1RC6A 4CP9A 2C9AA 5FPLA 2VMIA 4DRVA 4YVWB 3WG1A 4Z2WA 5A6QA 1MS1A 1W6OB 1AR83 1FMD3 1BEV3 4OLLA 4I0WB 5FLJA 3KV6A 5J48A 2BGPA 3AYAA 3KWVA 4PCRA 3U75A 5FPUA 4DS0A 2Q5TA 3OUIA 2QQUA 2R071 2R0FA 5BUVA 1O7FA 2WFF2 5K0UC 4UAPA 1XE8A 3T0BA 4FAGA 4B7KA 2XPJA 2WWSA 1CZSA 4IV1B 1H2NA 2VJXA 1OLMA 3O0WA 4M0NA 4O9EA 1ZBA3 1PZ9A 3DECA 4UI9L 4KG0A 3VBFA 4PLOA 2YPDA 4LA3A 2VXRA 4DXTA 2HYKA 2DTWA 2Y6KA 3LFIA 4NPMA 3WNMA 3AL5A 1EAH2 1H8TB 3OD4A 1JZ8A 1Q8VA 1UOJA 3AZYA 4CDQB 2W52A 3RPQA 4QDQA 1RMU3 3I54A 3VBOC 2BJSA 2QQKA 5IVYA 4NWWA 4W6WA 4AOCA 4KWUA 2H6CA 2BERA 2UWCA 2EALA 4LKFA 1SBDA 1AR92 5CZKA 4Q8KA 5DDJ2 4K1YA 4DRRA 3AZXA 1URXA 3KF5A 3PIGA 1U5ZA 3VKMA 4AHWA 2FDHA 2J1AA 1QXPA 3JQWA 5KXDA 1W2OA 4HOOA 4XBLA 3EBRA 1QWRA 1X36A 1TMF3 4RQPC 3T3YA 4QMAA 2TUNA 5LBBA 2XGXA 1GANA 2W91A 3LIHA 4CCEA 1PM7A 2VOKA 3H9AA 2G9GA 1WA6X 5JCTA 2FDFA 2YC2A 3O1VA 3WNXA 2DCKA 3H8UA 3RWNA 1DQ4A 2O8QA 3AP7A 1UKGA 3NV1A 2JE7A 1YJKA 3PUHA 4TLFA 4ZKTB 3ROUA 3OGJA 2O8OA 2VCBA 1DIWA 2WNUC 1CAXB 4OUMA 3INAA 5IFPA 4B7EA 3B94A 5FAXA 1VPHA 2DBNA 2CV6A 3TNPB 2QQPA 4XMIA 4C1XA 4AI0A 1SQ4A 3GF6A 3NJYA 3PU3A 3SNMA 2RS32 1RUJ1 4CVUA 1ENRA 1RUD2 1U5XA 4FBFA 5T54A 4YM3A 1OUSA 4IV3B 4MYEA 4N53B 4PHZA 1K5MB 5FXWA 1HRI2 4UWDA 1ZA4A 4WM8B 3SC7X 2F4LA 2X53S 5J3UA 3W5MA 2ZEZA 2ZGUA 4AXOA 2TNFA 1N1TA 4QB1A 4CUGA 2GNTA 2FZ1A 1OVSA 4MXWA 1AR81 1FMD1 1BEV1 1WCQA 4XTPA 1RINA 2V4VA 3M3CA 5D21A 4ZY9A 3C8XA 4M4PA 3VDDA 5LASA 1ST8A 4XUTA 4FTSA 1XYNA 5CIRA 5JIUA 5K9YA 4AQ6A 4EYUA 3ELNA 5DUXA 1AR62 4J25A 4ET7A 2VMEA 2PAKA 5F37A 5A6ZA 2VW2A 5C3OA 2JE8A 3VBSB 1ZBA1 1QHDA 3KD4A 3GJBA 3O1RA 2VUJA 1AUYA 3I49A 1TNRA 3M7AA 4HLTA 5FWJA 1HQNA 3ILFA 1S0JA 4YM2A 4QPIA 1EV11 4JCKA 5E8AA 3D82A 5CU1A 3B02A 3WNPA 4CDWA 1SLLA 3RNSA 4CCDA 4XJWA 3MIBA 4CCKA 1EUUA 1RMU1 4P9YA 2P3JA 3AC0A 2ADDA 3WG3A 3FE5A 4OZXA 1QKQA 3EHKA 2XKPA 2Y8KA 1B35A 1AYN1 1OH3A 4JRAA 1CX4A 1MQTA 4GXLA 2WAAA 1PMHX 2GP5A 1BBT3 3OOXA 5FY9A 4W6YA 4GWNA 2PHWA 2VZUA 1R093 2DVAA 4G9SB 3B00A 3DPRC 1HKDA 4MADA 4CCNA 5FRAA 2V72A 4AEKA 2PXJA 1D7PM 5HPOA 4CEYA 3IAPA 1TMF1 1V6IA 4Y1UA 4HETA 2BDRA 1RHI3 4JDNA 1UY2A 1W3VA 4IGQA 2I07B 5LA9A 2F6BA 2VTFA 3IDBB 3ME2A 1NCRC 1LTEA 3TN93 1QJY2 5I91A 3ZVXA 1NA1B 3RQ0A 3PJYA 2ZZJA 4GD4A 3S7EA 3FBMA 4IEQA 1TME3 3CKHA 1UMIA 2PYTA 3DGTA 3POYA 3DEMA 3J8F2 3DKWA 4NIIA 4YSFA 4D6RA 4BQ1A 5FZLA 5L9VA 3DL3A 3U78A 4AFCA 3FBYA 1V00A 2W1UA 2Y34A 1VB4A 1GZWB 4ORFA 1CIWA 1VBC2 2HBUA 3ES4A 3LGRA 1DFQA 4OZOA 3O0XA 4IEVA 1RVF1 4N9HA 5EJZB 3WVJA 1G9AA 4LT5A 5HCBA 2A5ZA 4P9JA 5CG8A 1OBNA 5IW0A 2FDJA 1HB3A 4DMIA 1RUI3 4D7YA 2WWJA 4IV1C 5JI9A 4QPGC 4ZPIA 3PUIA 5ACA3 3PVEA 1H1IA 1QQP2 3OTFA 3ABZA 4XFCA 4O9GA 5FZ7A 1NCQA 2IXHA 1OD5A 2D6PA 5DZFA 1LOEA 1VIWB 2WFF3 4Y4YA 1AZDA 5LZ6A 1WW7A 2LROA 1WWYA 4S2DA 4P14A 4UW3A 4CU8A 3WNLA 2HBTA 2JDKA 4OQ9A 4P5YA 1PIV1 2D97A 2EAAA 2YBPA 1GU3A 3LWCA 3THPA 3ZFEA 4CCMA 1KITA 3SXWA 2WNEA 1I6XA 1V6KA 1YIPA 4UFJA 3VBHA 5FXVA 4XBNA 5I0SA 3AMHA 4Q29A 1AXKA 5GLTA 3A23A 4DZGA 2CYFA 4AVBA 1O6UA 5K8SA 2MHFA 1VBA2 2WN3A 4HKOA 1JS9A 2PAEA 5CB7A 5F9TA 1GQGA 2BOJA 2OIIA 4KGGA 5FR3A 1JUHA 2BNNA 3O1OA 3N7LA 4XQDA 1HB1A 2ZGNA 3V64A 2F17A 3J7HA 1FYUA 5KHGA 3R4UA 4HVQA 3GNEA 4W8JA 5IVJA 3WW2A 2VCMA 3NV4A 4QM9A 4GWJA 3M4FA 5C8CB 4YLZA 1RUF3 3DF0A 5F3GA 4URAA 3QH6A 1BBT1 5I0RA 1DGWA 4I3GA 3UKVA 4FOQA 2D5FA 4QX1A 1R091 3ZR5A 3WT3A 1AVBA 4DQAA 3MEPA 2ARCA 4Q26A 5DQ0A 2XMLA 3BCWA 1VMJA 1N3OA 2EA7A 2VW1A 4YW1A 4D94A 4FPJA 5FZGA 2E9QA 1ZZ8A 2RHPA 3L2YA 1RHI1 2ET7A 3ZN4A 4AEMA 4AWDA 4QGMA 1LHWA 4ZHNA 5JOXA 1ND2A 3MV01 3NAPC 1YJLA 3ZFGC 4Y24A 3B01A 3TN91 4LK6A 5DG2A 1HXS2 4BM8A 2UY8A 4E8CA 5LY1A 1PGL2 4AL9A 1YEWA 2GNBA 4QD2A 1DYKA 2UYAA 1GNYA 4OHWA 4XFAA 1W03A 1TME1 2CGOA 5JOZA 3AMQA 5I0TA 2XVKA 5FXZA 2WZR3 5FFOC 5DXDA 3RYPA 1RUD3 4W50A 3ZSEA 3OBRA 1K12A 1PGSA 4PI0A 3PVNA 4Q4Y2 5C7GA 2XVLA 3OSDA 3B93A 1KJRA 3I2OA 3ZXDA 2VZQA 4E2GA 5ANNA 3S6PA 1KFUL 3H7YA 1OQEA 1RUI1 4H3WA 5EYYA 1W06A 1UOBA 1FNYA 2O14A 2W46A 4QKBA 3LSDA 3T30A 4P5HA 1OF4A 2CU5A 4BZ4A 5ACA1 1FV3A 1RJ8A 3EQEA 1LHNA 3I3BA 1QY4A 4CDXA 3KCYA 4GH4B 4JX0A 4K3UA 3VLBB 3BUCA 4LO7A 4R4ZA 5DUVA 4GIQA 1BZWA 2WFF1 4I0BA 5BYNA 1WLCA 5CA6A 1W2TA 1LKNA 2CWMA 2W94A 4CP2A 1CR7A 2Q1FA 5HXVA 4E27A 3PUQA 2ZOEB 3O7OA 1WZXA 1F35A 2VNGA 2BFUS 2DCYA 4NAOA 2QDRA 4JGZC 3NKGA 3RJRA 3ZYIB 3Q8AA 4GJZA 3FX3A 4LO8A 1DBNA 2DUPA 5A7OA 4Y1YA 4M3CB 3THDA 4AEDC 3VZMA 3RZZA 5AC92 3TEXA 1ZX5A 5IVCA 2X5IB 4R52A 1UY3A 2XOMA 1BMV1 1F2NA 1KS4A 4BOWA 1XU1A 1BVVA 2KR2A 1XNTA 4WM7B 5BV6A 5FKCA 2A70A 2VZPA 4KNCA 3PDQA 4QHZA 2OX0A 2XUEA 3WDUA 1A8MA 4HPKA 3LKJA 4JGYA 3SH5A 2QNKA 3CJIA 3ETQA 3POWA 4XAEA 3OYWB 3W58A 4FTEA 5FZMA 3JCIA 4A44A 1C57A 3OGRA 3PUAA 4F3JA 2HWF3 1IQDC 4YYOA 4OFGA 2IVJA 2D6NA 1RUF1 4OI1A 5KXBA 1QJZA 2ZHKA 1DF0A 1O4TA 4RS5B 5FZOA 2P37A 2R072 2RJKA 1JODA 2LALA 3RDIA 3ZXFA 4QGLA 1VMHA 2A71A 5IVBA 2WABA 3ZSKA 4BQYA 1JTZX 4CRQA 2Y60A 4HG6B 4UXAA 2J1EA 2JX9A 4KL1A 2B45X 5D8AA 3FFQA 2P3YA 4UFLA 5IAXA 3W9AA 2OUJA 3S30A 1A34A 3HEIA 1O3TA 2AACA 1YQ5A 4JC1A 2G9ZA 4YZ3A 2FCTA 2Y0OA 1PK6C 5E1RA 4COWA 3LDRA 4XHBA 1AXYA 3E6BA 3H42B 3AYCA 1DYPA 3ZM8A 5AFEA 1VBC3 3WW3A 1X9TA 4MOAA 1CJPA 4BISA 2VUAA 2QJVA 2WZR1 4PQQA 1PO13 3HD8B 1Q3EA 2BBAA 4INDA 1RUD1 4L8QA 4MG2A 1S55A 1S0GA 1V6OA 1C8NA 1NOVA 4Q8LA 2ZAAA 3D0JA 4E4HA 2I45A 4J1WA 3USSA 1QQP3 1DGWX 2GMEA 1XOYA 1XSRA 2PTMA 4Q4X3 1LRHA 1NLSA 1G9BA 3O1UA 1D0HA 3FLTA 4QU1A 1FAYA 3B5LB 3SMHA 5FYCA 1UIKA 2WAOA 1CAVA 5LEJA 5FK7A 2ATFA 2NM1A 4GWMA 4L97A 3WXPA 4UFHA 4EZ4A 1Y9MA 2ZJCA 2BQPA 2N7GA 5E16A 1U12A 3ACHA 3NO8A 4AVVA 4RYDA 1OHFA 4CXXA 3CJXA 4H7LA 2EXIA 1Z7S3 1KDKA 4H14A 4BYYA 5E89A 1QF3A 1BQPA 4WVMB 4YRDA 1WCKA 3BOPA 4K6BA 3I2KA 4FPEA 1HRV3 1A3KA 5FYMA 2C24A 3NNFA 1RUJ2 4FAHA 1CAWB 1N1SA 3K3OA 5A3NA 1NZCA 4M3CA 1G86A 2DDUA 3GYDA 5FYSA 3KM5A 1G9CA 1MR5A 1QDOA 4JDMA 2YBKA 2WO2A 3LQCA 2LW8A 2PHLA 1TVGA 1YNAA 3MW2A 1MS8A 2EIDA 4WM7A 5FY0A 4TZDA 1V70A 2E31A 2RE9A 4Z8BA 1FMD2 1BEV2 1PO21 2HWF1 3IWZA 3UGFA 4CCOA 4IDZA 2BGCA 1AHSA 3N35A 2PMWB 1GUIA 2R16A 3I2DA 1ALYA 2PELA 3TB0A 2YY1A 3IZOA 4Y1VA 2XUMA 5EHDA 2B42B 1YCIA 1XC6A 3FJSA 3T09A 1ZRCA 1OOPA 2YGLA 3IIIA 1FOD3 3RMYA 1VBB3 2FDIA 4FXGB 3URFA 3U4SA 1DGRN 3ETPA 1GBGA 1ZBA2 1HXS3 1EY2A 1W8UA 3WP4A 3WZ1A 3POFA 1WBLA 4AHYA 2CHHA 3RI8A 3KS7A 4QXKA 1WGPA 3DCQA 4CXYA 1ND3B 3KB5A 1EV12 5LK7B 1JXNA 4YVSA 2ZEWA 1SCSA 3RGBA 3V56A 2W1SA 5EYXA 5K0UB 1IG0A 1X82A 2ZX2A 3OPTA 4CXWA 1RMU2 1TNFA 2AEZA 3D4KA 1OPMA 4OI4A 4QQLA 5FO8B 3MLKA 1A8DA 1VBC1 4EJRA 4O65A 5A33B 4BQXA 3H1MA 4PDWA 4Q4Y3 1H6YA 2J1VA 3S5QA 4COUA 5F3IA 4N90A 1AYN2 5ABJC 1PO11 2R062 4WVVA 2B9VA 3K46A 3LA2A 4XVHA 4EV0A 4XIKA 4IL7A 1E5IA 2YU2A 3FWEA 3IDEA 3T2PA 3VBOB 3OUJA 2LTNA 4GAZA 3SQOA 1W9WA 1UYYA 2JG8A 5FYVA 1TMF2 5SV5A 4A6OA 2VQUA 4Q4X1 1UX6A 5BNOC 3TYJA 4ES9A 2PHTA 1YLLA 3U4XA 4XC9A 2CL2A 2CNAA 4LIUA 4TTGA 1RUH1 5JXHA 2EIEA 1KGYA 3Q8EA 5FLHA 1UF2C 5KXCA 1UYZA 1J84A 3E6DA 3LZZA 1KJLA 2WR9A 4BU2A 4BMBA 2PHXA 5CFCA 1AJOA 1FV2A 1HX6A 2XBO1 5T55A 4RL7A 1UYXA 5A7QA 1OSGA 3TRSB 4K1ZA 1Z7S1 1OLRA 3N9NA 4UYBA 4YZ4A 3NNMA 3BPZA 2XB6C 3DN7A 3D8CA 3MLJA 4RS5C 2E26A 3RWKX 1HRV1 1WLDA 3A0NA 4YW2A 1RVF2 4FFHA 5FUNA 2UY9A 1LENA 5I8YA 1FNZA 1DGLA 5FZ1A 4QQOA 1T6BX 2UYBA 2ZGPA 1OURA 3KHCA 1N1VA 1S1AA 4XUPA 4UF0B 2WNUB 1GQHA 1IPSA 2JKBA 4RD7A 4QKDA 3WQ7A 1I5ZA 3RZLA 1VE0A 2BNOA 1CAUA 2NN8A 3NMBA 3PMSA 1GNHA 2WNVC 4QX5A 1X8EA 5BXXA 3SLIA 3BYWA 5LA1A 1LJ7A 2P5BA 1PIV2 3N3HA 4PJYA 1QU0A 4NAMA 4TWTA 2VOTA 1XBFA 4C91A 3HNMA 3ZXKA 1GOHA 1REEA 1YO8A 3VBRC 4MHUA 1FOD1 1VBB1 3WOGA 3MUY1 1IGOA 1NT0A 1NYWA 3HAGA 3HNBM 3AP4A 5FV3A 4FXKB 2RDRA 4Y22B 4L2NA 1RITA 1ULCA 1W8FA 4QPWA 1MACA 1Q8SA 4GMP0 1PGW1 4PLNA 1DDLA 1AX1A 3PU8A 2R30A 1G6NA 3WF2A 2XWJB 1GMMA 4EWDA 1DHKB 2BFUL 2Z5WA 1YFWA 2XJUA 3PURA 5F39A 2P3IA 1E5SA 2DVGA 4FT8A 5FZCA 4Q4Y1 5IAVA 3VKOA 2RS53 3V0AA 1L7QA 3AMMA 1UMHA 3WDTA 1M4WA 4N43C 2JXAA 4Q0UA 3RZKA 1OUXA 1BBT2 4B3NA 1GYKA 5A33A 4LBKA 1OA4A 1R092 1ULDA 2G9FA 2PLV1 3AKQA 3THCA 4B1MA 4CYDA 5G05L 4FPOB 1TQ5A 3WUDA 4PQ9A 4AFDA 4B4QA 2ZCWA 1RUE2 3BTZA 3O1PA 3WUCA 4P9GA 5FMDA 3VZNA 2WC2A 4RA0A 4SBVA 3WNOA 5FBJA 2WA3A 2E7TA 5FY7A 4D6QA 1MZFA 2UWAA 2JDHA 3AJZA 3SITA 2IC1A 3TN92 2OA2A 1NX9A 2XL9A 1QXRA 2VM9A 3DPRB 2C0ZA 2XHKA 4Z92B 2D6OX 3R6SA 3AK0A 2WWUA 3LCPA 4LIVA 1ZRRA 1TME2 3E5UA 1V6NA 5F32A 4ONUA 1W8WA 4M0HA 4YZ2A 2DV9A 2XJVA 4UFKA 3FHQA 3RZMA 1NCRB 4JZRA 5JUVA 4RQPA 2JG9C 3MYXA 4QHBA 1ZZ9A 4CEWC 1C5IA 1C8M3 2GU9A 2R0HA 1DZTA 3H1YA 1O4YA 3POIA 4HKLA 3V0BB 4CU6A 2VY0A 3PVBB 4D6SA 2X29A 1QNWA 1RUI2 5A3MA 4IE5A 2Z69A 1I5PA 4OHZA 5ACA2 5FQ0A 2ERFA 5LATA 1BVP1 4NIHA 5FLIA 2CAVA 1FT9A 2LS6A 2Q8CA 1ND3C 2RS13 2PAMA 3TEWA 1YIFA 1K5JA 4AAPA 1K45A 2IXLA 1S0DA 2W68A 4M00A 4P9IA 1G9FA 2W92A 4FPKA 4XF1A 4K8RB 4XJ8A 3CQOA 3VD7A 2HJIA 3ZIXA 4C0BA 3CLPA 3H8XA 4P9WA 3D0SA 1LOFA 2VW0A 3LA7A 4LORA 4QPGB 4AF9A 3ZSMA 5C9AC 1LGNA 3ASIA 2WINB 1JYWA 5A80A 2VCCA 1EV13 1UQXA 1QMJA 5FP3A 1BMV2 3B69A 4Y5SA 2OUHA 3ZYHA 1QJX3 2Q4SA 3AFKA 3BTYA 1HQWA 3HR9A 2F4PA 4NHLA 5T3NA 3BVCA 4XF4A 1MVQA 4Z1VA 4WBBA 3P3NA 4F8AA 1AYN3 2VBBA 5A32A 2R063 5F2WA 4NIGA 2CTVA 5EJ3A 4Y26A 1US2A 2LM3A 2XR4A 5L7OA 2JD9A 4HANA 5J96B 3MHZA 3I7DA 4Y20B 2TEPA 4ES8A 1LEMA 5BNNC 3C7FA 2RS51 3ZXJA 2X8KA 1RUF2 4X8NA 4LKSA 3K48A 4QKNA 1VR3A 2ORZA 5F5QA 4E9KA 3ZLIA 4ZZ5A 2IXIA 1J83A 5FZDA 5H9QA 2EXHA 1MEC3 5FZHA 5FO7B 2CWSA 3E5XA 1UPSA 5I8SA 3RJ2X 3USUA 1PNGA 2GALA 1DQ6A 3QH7A 3AL6A 1G9DA 2BZDA 3AZVA 2ZMNA 5T52A 3ZYGA 3VBUB 1C3HA 2OZJA 5EQUA 3J7MA 2BWCA 3T1MA 2DVDA 5LRRA 3DYPA 3VL8A 5T5LA 3MW4A 1YFXA 3WCRA 4EWEA 5JPNB 5T50A 4XYXA 3LOBA 5LB6A 4QQPA 1QOTA 4HXCA 4GA9A 2HWB3 1JI6A 3DYMA 2GH8A 5FXXA 3BPSA 1N47A 2EIGA 5FYIA 4KGQA 4N8MA 4D7TA 3AVSA 5CFDC 1RVF3 1JOBA 5CBLA 3OUHA 4QDSA 4Y3OA 1UZ0A 2VQTA 1JU3A 2WZR2 3F95A 2CSGA 3RFRA 1I9RA 3RZJA 2RR12 2J22A 2YC0A 4LOSA 3NAPB 4PIYA 3ZFGB 1S0EA 2WIIB 1C8M1 2YZ4A 5KBFA 4DXZA 1UO9A 1UZYA 3C3VA 4Q0SA 4ASKA 4BE3A 4DXSA 2XVGA 3LPGA 3WHTA 4CDUA 2WKKA 1Y7BA 4XFIA 4NWVA 4D69A 1SCRA 4YPJA 5J98B 4AQSA 4NHMA 1UIJA 2AC1A 1UXZA 2GMMA 2JDMA 4QU2A 3KSCA 4YVWA 1GFF2 1PIV3 5FOJB 1REDA 2RS11 1W6OA 3VBFC 3WV6A 3BI3A 4OYUA 4AFMA 4XCBA 5LA2A 3VKLA 5FP4A 3ZYFA 1KS5A 2VZVA 1CQ9A 2DU1A 1W6MB 2B4KA 3C2UA 2K9ZA 4MH0E 1LB2A 5F5CA 3PJQA 1US3A 2E53A 4IGPA 4HSLA 1HIXA 5A7NA 3VGIA 4IV1A 5FZBA 3WW4A 3BU7A 4AVAA 4B8EA 1DZRA 3BB6A 5LBEA 4BQ3A 1QJX1 3E97A 2A1XA 2GMPA 2Q8EA 2BP6A 1JBCA 3ACLA 3FL7A 1ULEA 4EN7B 4F7ZA 1H8TA 2QVSB 1XU2A 4JGZB 2IXJA 1SPPB 3ALQA 4AEDB 4CDQA 2R061 3I4IA 2GDFA 2IZWA 4DO0A 2BBVA 2JD4A 4IEUA 4XURA 2HWF2 1PO22 1Y9GA 4FPYA 3SH4A 5B4NA 1ZZCA 4XTMA 2D98A 2R1DA 3FUQA 5FYBA 5JWPA 4O7XA 3KV5A 4YW4A 1RUE3 2H0VA 2O0OA 3EB7A 1G8WA 4COVA 4BA6A 1MEC1 2ZAHA 3MPBA 2EAKA 1QOOA 1H4HA 3M8LA 3ZPOA 1QH7A 3T0AA 5BNPB 3MLLA 5FTTC 2QBXA 4QQ2A 4AYUA 4KH9A 4NPLA 2JDYA 5DG1A 4XUQA 2PHFA 2QUOA 3WP3A 3BODA 4LUKA 2ZEYA 1GSLA 2C9KA 4RFRB 5IVVA 1TG7A 2ZS6B 4NN0A 2C4XA 2HWB1 2D93A 3FMGA 3RS6A 2ZHMA 2NPIA 4ZXKA 5JOYA 1SFYA 2CGPA 3AX4A 2VNOA 1FATA 4OUSA 3U07A 2XJTA 3Q8CA 3CZUA 1OXCA 2IUWA 4JKKA 4P08A 2W95A 5IVEA 1JZ6A 5FPXA 4RHV3 2G19A 3APBA 1CAXA 3GDBA 4DEVA 2XJRA 1PO12 2YUEA 1LESA 2ZBJA 2QDNA 4JKLA 1PK6B 3VZKA 3VDDC 3VHOA 1W9SA 4YNIA 3UESA 4IV3A 4N53A 1YXWA 5KC6A 2GH2A 1K5MA 1OFSA 2YMZA 3NAPA 4Q4X2 4WM8A 2LRPA 5FIXA 3CU7A 4IEPA 4LBQB 2K2SA 4M3CF 2AR6A 3RSJA 5IHRA 1RUH2 4GALA 1LHOA 2VAUA 1V9U3 1AJKA 4A6SA 1VRH3 4YARA 4R8HA 4IQPA 5FZOB 2YDEA 3BTAA 1H2LA 2VZRA 2BWAA 1DGRA 2WYFA 1CIYA 2XBO2 1UNBA 2J1TA 4HN0A 4LITA 4QPIC 1SDDB 4CDWC 4JTOA 3J9SA 1KDMA 1Z7S2 5DUWA 3P3PA 2C5DA 2OXBA 5JMOA 1HRV2 4MUVA 2E33A 2WT0A 3VBSA 1B35C 4JHZA 5DABA 2K46A 2WYSA 5EP9A 1QJU3 1RUOA 1H8VA 1IS6A 1RJ7A 4NIAA 4A7ZA 5DAWA 5FZEA 3WQBA 1ENXA 5BNQA 5H9SA 1WLWA 4YG3A 2G4IA 3VBUC 5FYTA 3RVHA 4CCCA 1YC61 4JHTA 2ARXA 1NLRA 1K3IA 4OULA 3EMRA 5AVAA 4CEYC 2GC3A 2QQWA 3C7GA 1BXHA 2HWC3 1ZA7A 3IIAA 2ENRA 2VMDA 1OD3A 4IEOA 4CU9A 2KXLA 4QT6A 4PLMA 4QX7A 3ZOIA 2JEMA 3SHRA 1RTVA 3LDKA 1RUE1 1Q8PA 3ECQA 2YFUA 4LULA 4NR1A 1PMIA 4JVAA 3WP5A 4COYA 1IOAA 1FOD2 4DNYA 2QZ3A 1VBB2 1W0OA 1W6PB 5GZDA 1W9TA 2NP0A 1IS5A 3EJKA 1O3SA 2AREA 4HK8A 4HONA 5IUQA 5C8WA 1R081 4NROA 3HQRA 5C4WC 1PGW2 4AW7A 3UT0A 2WA4A 4MGKE 5FZ4A 4AVSA 5A7WB 2DFBA 2WS92 1LULA 4DIQA 3KZ4C 1H9PA 4V2VA 1NA1A 2TBVA 4IW3A 4Q27A 2QQIA 3UYJA 1GOFA 1LNSA 2RR13 3CEWA 1COV3 2O1QA 1WUVA 3GHMA 5E88A 4A41A 3WF1A 5IYYA 4RHV1 3R0RA 4BLIA 5KHJA 5IK5A 4W6XA 2VTXA 4NJ4A 2QE3A 5LY2A 4YG6A 3GGLA 1BKZA 5CFDB 1IG3A 5FZ0A 1GZWA 1NCQC 3MF6A 3MICA 1CPNA 4AI8A 3ENRA 5LA0A 1SMVA 2PLV2 3I3DA 3OCPA 3VKNA 4DPNA 3K3NA 1RYYA 3A22A 3KF3A 3C7EA 1UAIA 3ACFA 4LXLA 1NQJA 1EUTA 1FX5A 2OZ6A 4N9IA 3ZFEC 2A73B 5ABJB 3M3EA 4YFZA 2CY6A 1JZ3A 1OI6A 3V65A 3N36A 3NV2A 1C28A 2VZ1A 3GJAA 3MIGA 4FFGA 3S57A 1V9U1 2JB4A 3I59B 1T2XA 1VRH1 2XG3A 4CP1A 2VOXA 3SKJE 5CKQA 1HV0A 1O5LA 4OI2A 4CSWA 4Q4V3 1Q8OA 1REFA 2ZGKA 5EWSA 5A6YA 3VV1A 4BK4A 5BNOB 4LHLA 4CCLA 1XYOA 4LPLA 1HQLA 4FP2A 3WNKA 1POV0 3D6EA 4JKMA 2YV8A 3N4MA 1C4RA 2VUDA 5HCAA 2AENA 1UX7A 4JRLA 1QJU1 2MEV3 3J7LA 3CF6E 3OBZA 4QXBA 5BNPC 1W28A 2QQMA 4R4XA 1FPN3 3NVCA 1PO23 5FYUA 1FXZA 1NQDA 5CEHA 2IWGB 3H3UA 3AYDA 2JDNA 3AKSA 5T5PA 1W8ZA 3LOIA 2C26A 5JZGC 1BK0A 2HWC1 2P1BA 4KI5M 2ET1A 2RG4A 5C8CA 2AH2A 5HCHA 2OVUA 5FOBB 2GN3A 5J1XA 3VD9A 2SBAA 3BOWA 1ND2C 4M3CE 2EIBA 1ULOA 2W47A 4YGDA 3WW1A 2R043 4XJZA 4Y33A 3RI9A 3O1SA 4XPVA 4B4PA 5A6XA 3TAYA 5FUIA 2P6CA 2A7AA 4E8DA 5B2GB 4HSJA 3KQRA 1JOPA 2VE1A 2IVIB 3TWIA 1OH4A 2WNVB 3HPNA 2E7QA 1W0NA 1HJFA 3IKWA 1H30A 1RUG3 1Y4WA 3KT1A 4R9BA 1KD7A 4KBZA 2FD8A 1GZ9A 1YWKA 4XJUA 1H1AA 4LBJA 3TEYA 4XFBA 1SFPA 3MIFA 3OY8B 5H9PA 5FYYA 3VBRB 4RR3B 1GP4A 5K4LA 1CN1A 1J59A 2IXCA 4LHSA 1RUC3 1UOFA 4XACA 2RR11 3ON7A 3WG2A 2VUCA 4KQ7A 1I1EA 1COV1 1XQNA 3MBWA 1D4VB 4YGBA 2SLIA 1AL0G 5A1LA 3LEMA 2RS52 1PZ7A 1YI7A 4CDXC 1W6QB 3NNLA 2MPFA 3WX5A 1J3PA 3VDBA 3KVBA 4N7UA 1OT5A 1GP6A 2KM2A 2YGMA 1YRZA 4J6GA 5APAA 1JMUB 2R7EB 1HB4A 4COZA 4AGVA 3T4VA 1RUH3 3KGLA 2BPA2 2X09A 1U5YA 4XAAA 1AYM3 2P34A 1V6MA 3JZVA 3ZN6B 3PTYA 1F5FA 4N43B 3VHPA 3EO6A 1W2AX 4GH4A 1VBE1 2XBO3 4UW4A 4XDPA 5IT6A 4XZPA 4MX3A 3RZHA 5EPAA 1U5IA 1W6NB 1XJAA 4LBMA 5C5TA 3MPPG 4NHKA 1XE7A 3S0MA 5CYYA 4EWAA 2FBEA 2X05A 4Q4V1 3DXTA 2NZ9A 2W08A 5FP8A 3BKZA 4MLOA 5FMCA 2ZGMA 2IFRA 3MIHA 5FY1A 5CAZA 3CJIC 3BALA 4AQ2A 1GLHA 5HI0A 1JYIA 1XNAA 1M06G 4AQTA 1GWLA 4P9XA 4AHXA 1OMIA 1RUNA 3N9MA 2ID4A 2X5IA 5HBAA 2QZ2A 3OBTA 1W9YA 3LE0A 2ZGLA 1C8M2 4FFFA 4MGYE 1CZTA 2MEV1 1J1TA 5BY5A 3OB8A 3K4ZA 4LHNA 2QFEA 1PMJX 3CZJA 4K8FA 5KC5A 1V0AA 2WBKA 3T2OA 3W5NA 4NUBA 3LA3A 1FPN1 3VN4A 4MGTA 2G1MA 2OT7A 3CO2A 3OYWA 4PF5A 4I01A 3ZKYA 2DYCA 3L9JT 1N3PA 2PHDA 3H0OA 1GV9A 2JG9B 2VVEA 1CX1A 3ZFFB 2RS12 3AKTA 4YG0A 4CEWB 4LJHA 5HCFA 4QM8A 4CPBD 1NG0A 1IZ3A 4UW5A 4PBPA 4ZU5A 2KD7A 1NY71 2BUKA 1UMZA 4RS5A 3JU9A 1UZZA 4LBNA 4BCUA 3OEBA 2R041 4D3WA 5GZCA 5EIYB 4Q0VA 3JD73 3AP6A 3HT2A 4XETA 3O0VA 3A21A 2WS93 3P6BA 4W65A 1F4AA 2XJSA 3FUOA 3SEPA 3RMXA 5EFUA 3U37A 1KRIA 5DMYA 1QJX2 3EXUA 4IEXA 4Q0QA 1RUG1 1W90A 2DCTA 4W4ZA 5C3SA 5FZKA 1ZVFA 1CD3G 4UW6A 1LOAA 5IJRA 1SLAA 2ARAA 3LF7A 2DU0A 5C9AB 5LW9A 1SZBA 1Z78A 1LU1A 3K51A 4K20A 5JLVA 3FLRA 1RUC1 2WZEA 2PLV3 4NOTA 4GMP3 2E63A 5GLVA 2VD7A 2BRTA 1D4M3 1JYVA 3MO4A 4YWAA 3I3MA 1HW5A 4IEYA 4XIOA 4EN9B 2V5YA 3LEIA 3LDBA 3OGGA 4LTAA 1VJ2A 4UFMA 3M2MA 1QNYA 2Y0IA 3FLPA 1MEC2 4QX3A 3VD4A 4H7MA 4BIFA 3WHUA 3T2TA 2VBPA 4FOWA 4AI1A 1EP0A 1PX3A 1UY0A 3CNAA 1D2SA 1NLQA 3AKPA 3RZGA 2FCVA 2AYHA 1OVPA 3BTXA 5C6CA 1AYM1 5BNNB 3LB9A 5HV0A 1JYTA 2JIJA 3NJVA 2I74A 5IWFA 4Y4RA 4X6QB 5FPAA 2WSUA 1J58A 1E57A 2HWB2 1ZBE1 5FZ8A 4LBOA 2WT1A 1XRUA 2B5HA 2WDBA 4Z2AA 2WO7A 1F8VA 3IPVB 4R9CA 1WW5A 1BJQA 2VXJA 1W3XA 3KCXA 5D1IA 2R6QA 5GZFA 1LOGA 4LE4A 5F2SA 3PVOA 3PLQA 2HEVF 4WVMA 1W2NA 2JB8A 1LAJA 4GB33 2ZMLA 3ES1A 3NW4A 2NYYA 4DFSA 1S0BA 1CAWA 3OPWA 2UWBA 3VL9A 4P02B 3SCGA 2A75A 2ZX1A 2RMU3 3O5SA 4U36A 1RIRA 3N9OA 4JAAA 3ZN5A 4DOUA 1ZZ7A 3QCWA 4CP9B 5JSOA 3POGA 1OC1A 1IKQA 2B39A 1P8JA 5FREA 4LLFA 3UGHA 2JECA 4UBGA 3LEKA 4DY5A 4MV2A 1SG3A 2J7MA 5FJKA 4IE7A 3ATGA 2P17A 5TSWA 2NMOA 1T6GC 3CIHA 4RR3C 1UXXX 3H3LA 4XQWA 1HDKA 5FYHA 2C6SA 3VHNA 4YVSC 2DVBA 4EQVA 3C7HA 2D3RA 2YU1A 4XDQA 3VDCA 5FZ3A 4QXCA 3JD71 5F5AA 4TN7A 2DCZA 3BIEA 2ZPXA 4PDWC 2WS91 3VBFB 5CVRA 1DU3D 1WCUA 3K2OA 5JSRA 2HLEA 1BK1A 1SLCA 1ZRDA 4KU8A 5CG9A 2NMNA 3JUUA 4QX0A 1ND3A 2HH9A 1H9WA 2PFWA 1QDCA 2XJPA 1JHJA 1S2KA 4RGGA 2UU8A 5K0UA 2VZTA 3WP6A 1FI2A 1HV1A 2JG8C 4H55A 3AB0A 3HIFA 3H8OA 4XEZA 3NJXA 1DLCA 2HWE3 2ZEXA 4GMP1 4XJAA 2HWD1 1YQ2A 1D4M1 3HWJA 4QB2A 2VMHA 1C1FA 1UY4A 5DPNA 1WBFA 2XQXA 5F6KA 4YW5A 2JDZA 5CFCC 5IATA 3VBOA 2CAUA 2RVAA 3IDCB 2V4AA 3P1IA 4GWIA 1NXMA 2Z2SB 3NWKA 4XFFA 3ZR6A 4A2UA 1W8OA 1R082 4LBQD 4AVTA 2WLPA 4PIXA 3FZ3A 3UV9A 1GQPA 1JH5A 4BQ5A 4YZ1A 1W9FA 4HZFA 4NO4A 4FPGA 4E4ZA 1VAKA 2WN2A 1RGSA 1STMA 3ITQA 3ORJA 3D5OA 4PIZA 4LKEA 3AZWA 3LIGA 2BOIA 3QBQA 2GSYA 1PNFA 2HEYF 3ZYRA 2E51A 4AK3A 2WQ4A 1A78A 4HL0A 5FPVA 3ZFFC 4RHV2 4CZSA 5JAXA 4BLJA 1I3HA 4HN1A 4DUVA 1LU2A 1UOGA 2BW8A 4XHXA 3ZO0B 4ZXEA 1X8MA 2VNVA 1AX2A 4GB31 3OBAA 2A3YA 2W1WA 2XDVA 4OI0A 3ACGA 3U10A 4BQWA 4X6RB 4BDVB 3HMYA 3N7KA 1AL23 4E4DX 2OKXA 1ENQA 4ARXA 1ZRFA 2ZZQA 3D3AA 1QEXA 4UFIA 2RMU1 5EV7A 1XNBA 3KV4A 4UF0A 5LWBA 5DAXA 2WNUA 3WNNA 1E5HA 1Y9QA 2P6HA 4GQ7A 4XBQA 1L7RA 2WNOA 1APNA 2Y6JA 3LEGA 4MO3M 4MXWB 1V9U2 4IUGA 2QQNA 1VRH2 4PI2A 1X7NA 2IXKA 3T1LA 1WLTA 2XXZA 4DINB 5A70A 3VDDB 1JZ2A 1DZQA 2DUQA 5C71A 3KT7A 2W9XA 3C7OA 2YFZA 4E2QA 4ZS3A 3ZDVA 2ZA9A 3HT1A 1SACA 1LECA 4CCJA 3VUOA 5LBCA 5JDBA 4NRPA 1CGPA 5CISA 2YROA 3IDAA 2JIGA 5FZ9A 3WDVA 3DUIA 4MGSA 1DQ2A 4Y22A 3WD5A 1VAMA 2RJLA 4XF9A 1QJU2 2W2IA 4QPIB 1HJGA 3MV11 1S0IA 4AG4A 4CDWB 4A4AA 1ACCA 2CDOA 2MNGA 4HKWA 2WZPP 4GULA 2HWC2 4CUCA 1W8HA 4FQZA 3RG0A 1B35B 4SLIA 4B1LA 4LKDA 1MQTB 3TEZA 2HWE1 1AR71 4XQ4A 4ZU4A 4X8PA 1A6CA 4BPZA 5F3CA 3MIEA 1CWPA 4LE3A 1VLNA 1YYNA 3UETA 2Y64A 3GBFA 2ZHLA 1GZTA 1MZ5A 4OUEA 1JU4A 3SCFA 3AYEA 2AZ5A 1EPWA 3LAGA 1QH6A 4CEYB 4ZZ8A 2J1RA 3MF9A 4IESA 2A6YA 2GN7A 1RL3A 5LBFA 2ZGOA 3R4DB 1UY1A 4LO4B 5JXIA 4D0QA 4Y5Z0 2EICA 1NAEA 2Y6LA 3DXUA 3F2ZA 4FQ4A 3SH3A 3SKVA 1SBEA 5GJ6A 1GNZA 4JDOA 1UKRA 4GJYA 2VL4A 3DPRA 2XJQA 1W2UA 4QB6A 2VOVA 3J4UH 3LSEA 4OHXA 5DZGA 2VQAA 3AVRA 5A7PA 4AGRA 4BIOA 1GOGA 4RN5A 5A1AA 1COV2 4A42A 1XE0A 2JDUA 4IETA 1AXZA 1ZRIA 2WL1A 2D6MA 3WG4A 2VU9A 3ZDSA 5LK5A 5LCWL 4ATEA 5C4WB 5FP9A 4XUOA 1JYNA 3OG2A 4Y1XA 3OEAA 4LNVA 1NCRA 4V1PA 3WF4A 5KR7A 4OHYA 2P2KA 2BEOA 2VULA 2J42A 4XDOA 4IE0A 4BH9A 3V0BA 2P3KA 2D5HA 4C90A 1QIQA 1WD3A 2E6VA 2Y26A 1AL21 1LOFC 1VRBA 2ARBA 4XJ9A 4L92A 1ZM1A 4B29A 4UT5A 3MFCA 2WLQA 2ZGSA 4URTA 3WDWA 4KWKA 1VBE2 2GZWA 1O59A 1SEFA 1NCQB 3I97A 5ISLA 2VNRA 4JQTA 4XXAA 1OA3A 4KG8A 2W39A 1YQ8A 2W0XA 3HQUA 2RJ2A 2I2SA 3MI8A 4IE6A 5FMBA 4CUAA 3POJA 4Q4V2 1XNKA 4WVWA 5GZGA 4NIDA 1ULPA 1HN0A 4D8MA 5L73A 3ZFEB 4AVCA 4QPGA 5G04L 1KFXL 1OQ1A 4EE2A 3HN3A 1EPZA 5J7MA 2XLFA 5JXJA 1QOSA 2FDKA 3QOPA 1QJEA 4XF3A 5J36A 1ASJ3 3J26N 3VBHB 2FDGA 5FDBA 1CVNA 2JDPA 1LCLA 1Q8QA 2AUYA 3SCHA 2BTVC 2WZ8A 5F1RA 3GM8A 3I3EA 5L7OC 2X10A 1JUIA 1UPIA 1QXJA 2DBIA 3MGUA 3UL2A 4LMFA 4CE8A 1LEDA 2MEV2 3WINE 5JSPA 3LPFA 1S2EA 2A3XA 1ZYBA 5LEKA 1GICA 4LUMA 2A6VA 3W59A 1FPN2 3G7DA
chains in the Genus database with same CATH topology
1U0AA 4FOYA 4I02A 1IQAA 5GLZA 2YPJA 5GLUA 3VHRA 1O3RA 4FPFA 4WVZA 2FZ2A 2YHJA 4Y20A 5IK7A 4I3PA 4YM1A 4Q4W3 2WFPA 3S7IA 5KWRA 1NY72 2GNMA 4XF0A 1JW6A 3NJZA 1D0GA 1N1YA 2ES3A 1JN2P 2R042 1RB8G 1IHMA 4FPCA 1R083 4YM0A 5SV8A 1LGBA 3DV8A 3IN9A 4LO6B 5BPXA 5JZGB 1OQDA 4ASLA 2H6BA 4NVPA 3VBUA 3HBZA 4FSJA 5JOWA 4IEWA 2ZGRA 1CESA 1RUG2 3E5QA 1ND2B 2YYOA 3AKRA 2HKXA 3GZAA 4QGNA 1NXD1 3JBG3 3AFGA 4CDUC 1RUC2 3QLQA 2EXKA 4YVWC 3UJQA 1WCSA 4R9DA 1S2BA 1X33A 2EF6A 1SLIA 3ZFGA 2ZKNA 3POSA 2PHUA 4QPYA 2DFCA 2PHRA 2RM23 5C4WA 1IS3A 1VALA 1WMDA 2Z42A 2VH9A 3JB8A 3NV3A 3UKTA 5C33A 3VZJA 1LR5A 1V6LA 2K0GA 1AYM2 2ZX4A 4CDXB 3WDYA 3A0KA 4GKXA 1MS9A 3JQXA 1H1MA 3N7JA 3OF1A 1ZBE2 4EROA 1XYPA 1Q43A 1Q5OA 3QACA 1H8TC 1W6MA 4S2FA 4WZCA 4CDQC 3TBDA 1MQTC 4IEZA 3AP9A 1ASJ1 4Q1PA 4BHPA 3ST7A 1O5UA 1DQ0A 1MZ6A 4FCAA 4YZ5A 5FO9B 3U0ZA 3B9IA 2FMYA 4XMAA 4CP0A 4U2AA 1EAH3 1YFYA 2A3WA 1ZZBA 4HPKB 5DZEA 4JGYB 3CJIB 3I8TA 1MS3A 1WCDJ 3ZXAC 1POV3 4JGZA 1OLQA 4HT1T 4DY3A 5FMOS 4MXVA 2ZMKA 4AEDA 4HFSA 1O3QA 1SDWA 4F83A 1OFNA 5J09A 2PQQA 1AR93 5IK8A 1UW8A 4Q4W1 5DDJ3 5F6LB 1ENSA 1PVXA 4QQHA 1LHVA 1XXNA 1R1A2 2ZTNA 3JD72 3IBMA 5BNPA 3OJBA 3ILRA 3MZHA 2VVDA 1S0FA 1SFNA 5D8AB 1CJDA 3AM2A 2NQYA 4YGEA 5JVVA 1J3QA 4YGCA 5JZGA 1PVC2 5L36A 2R32A 4FO9A 3WDXA 2BYVE 2XKOA 4AE2A 2ILMA 4IV3C 4N53C 3RRDA 3JBG1 1K5MC 1KXGA 3TOJA 2Q1ZB 4WM8C 2HEWF 5AFBA 1KQRA 1YHFA 2B9UA 4AHZA 2HWD2 1D4M2 1TE1B 4ITCA 1JYCA 3H50A 4HK9A 2V09A 1D2QA 2WQZC 3HN1A 1PK6A 4HMZA 2RS33 1ZREA 2XL7A 5GKAC 3R05A 2VPVA 4ZU7A 1J1LA 2RM21 3VBHC 1VBE3 3MFAA 1HRI3 3HQXA 2BVVA 5JMCA 3GBGA 2OW4A 4LBQA 5I93A 2Q0AA 2ZX3A 1CAVB 1H0BA 3VBSC 2JJ6A 4E2SA 4B4RA 5H9RA 1X50A 5GM0A 2ZABA 1F31A 4K9SA 4RSUA 4Q1RA 1MS0A 2FMDA 1SLBA 1AR63 2GAUA 4PBOA 1AF9A 3GHNA 4LA2A 4LBLA 4L99A 2GC1A 1IPKA 4GB32 1ULFA 1VBD2 4XW3A 2BNMA 1UU6A 1C1LA 1PHMA 3ZMNA 4IXLA 1WMEA 1EAH1 1UN1A 3JB4C 3O14A 4NPRA 2RMU2 1J3RA 4Z07A 3U11A 1POV1 5J37A 2FHRA 2AGSA 3UJOA 3O12A 3AXEA 2VGDA 1BCXA 3G6JB 3PNAA 4WV8A 1O91A 1AR91 2JE9A 5DDJ1 3WCSA 4EN6B 4XOGA 3R4SA 3AJYA 1BYHA 1XNDA 1NA1C 1OOPB 1LOCA 1NE6A 2BVBA 4MSVA 4I09A 4ISRA 3CL1A 1Q56A 4EN0A 3MIDA 5T5JA 1W6PA 4ATFA 3IMNA 5IK4A 5KHHA 1Y43B 4MGIE 1MS4A 1WW6A 4N7IA 3PMEA 1DLLA 3M70A 3B7MA 4YVSB 4A7YA 4MVTA 1QJY3 1UU5A 2EXJA 1H4GA 3AXDA 2Q1MA 3ZSLA 4JTNA 1DQ1A 4K7JA 3ZIWA 4PDWB 3H7JA 3J8F3 1N3QA 1GZCA 4HVRA 5CADA 2HWE2 4Q0PA 1AR72 4TZDA 5JPMB 4A7KA 1Y3TA 2KA3A 4Z82A 4E4SA 2DCJA 3B3QE 3N7MA 2RS31 3WY6A 3NKTA 2VVFA 2JG8B 2D3PA 4K21A 1HRI1 2FQPA 1ULGA 2GC0A 5GLWA 1ZBE3 2WJSA 5ABJA 1LGCA 3NSTA 2IFWA 5KHKA 3E6CC 4IERA 2DF7A 1WA4A 3I59A 4JGYC 1ZNPA 5CFCB 2VOWA 1AX0A 2D44A 1WMFA 3L2HA 4D7SA 2B7YA 1JHNA 1L3JA 2WT2A 2QCSB 3A4UA 5GALA 3VKFC 5BNOA 1HLCA 1AR61 5EXOA 1UCXA 2PN5A 2B8MA 2DWRA 4KBBA 4AI3A 4HVOA 2E7AA 5I8TA 2DVFA 5C8CC 2QKDA 1VBA3 3RYRA 1AL22 1LOBA 2VMGA 3M1HA 2DTYA 5D8AC 3WQ1A 2ZGQA 1CPMA 4GKYA 1MZEA 1CAUB 5LRSA 1R1A3 4JQRA 3ZXGA 5JIAA 4K40A 4AFBA 2D40A 1UU4A 3FHIB 4LLOA 1W0PA 2PA7A 5KHIA 5EZWA 1UL9A 4LO5B 4XFHA 1AR82 2A6WA 1R1ZA 3VZLA 4KWJA 4FVVA 2YXSA 4TYSA 2ZX0A 3WQ0A 2ZGTA 1VAVA 1PVC3 3Q9OA 2D43A 4FP3A 2WNVA 5JI7A 1TEIA 1OPOA 5FBZA 3M3QA 1W39A 1GR3A 1DG6A 4KU7A 3KGZA 2D7FA 4MGZE 1QJY1 2VQ0A 1IPJA 2V73A 3OY8A 4I2OA 2HWD3 3VBRA 4RR3A 1VB2A 3H3ZA 1NE4A 3IM0A 3J8F1 4RFT0 1PZ8A 3ZYJB 5FPZA 4CTEA 3V0AB 2ETEA 3ILNA 3ZXEA 1SBFA 4GH4C 1W6QA 2LUWA 4Q2FA 3GZTB 1B09A 1EYBA 4WZFA 1QGLA 3ZPYA 2H0BA 3UKNA 1JOJA 5AVPA 4L9BA 5FMOL 4FPLA 1IS4A 2WSVA 2XH6A 1QQP1 3ZN6A 4N43A 4HBNA 3IT8A 2X5IC 4META 3H1WA 5FCCA 5KXEA 1W6NA 1YI9A 4S2HA 1IKPA 2UURA 4WM7C 2XLGA 2C1FA 4DB5A 3AP5A 1G7YA 3GALA 2B46X 2ZHNA 5JR7B 1F5JA 1VBD3 1MVEA 5T5OA 2DUOA 5AC93 4C1WA 2DURA 4RQPB 1GKBA 2A6XA 3ZYPA 2D3SA 4AFAA 1OKQA 1OOPC 4JV4A 1VBA1 2GC2A 4FPHA 2JENA 4I0AA 3GZUC 2CGNA 2D6LX 1C5HA 4P9LA 2GNDA 5FQ0B 3KMHA 3WLUA 5A3LA 4BMEA 4LHKA 4XE9A 3AZZA 4LEJA 2Q8OA 2EVXA 1R1A1 2JG9A 4G3YC 1DQ5A 2ZACA 3ZFFA 4CEWA 3TNQA 1WD4A 4YFWA 1ONAA 4AGGA 5L19A 1CONA 2NLRA 2Q30A 3SISA 2XWBB 1OA2A 1LODA 2R073 3RYKA 4FTBA 4OVEA 3AMNA 1ZZ6A 4AEJA 1V6JA 1ASJ2 1LHUA 3KT4A 5GZEA 4M01A 3FFZA 4AI2A 1PVC1 2Z79A 3THTA 3PHMA 4YW3A 3ZSJA 4LR4A 3B9CA 4R9AA 1F9KA 3GBWA 1YUDA 1Z0HA 2VG9A 1XNCA 3X29B 1G9CA 4MZUA 1PGL1 1HXS1 4A3XA 1O4ZA 5A32B 5C9AA 1AR73 1YFUA 2VECA 2Y38A 5L7OB 1WW4A 4TSVA 4XFGA 1MS5A 2D6KA 4UBHA 4Q4W2 4RGAA 1H2MA 3BIWE 3KLSA 3ZMOA 3ZXLA 1H2KA 3USUB 4KWLA 3UK9A 2ZKLA 4FOVA 5CNAA 4I30A 3M3IA 1VP6A 3QD6A 2JICA 4G4FA 2XLAA 3KCCA 2R1BA 4BWOA 4C0HA 5BNNA 3AMPA 1UD1A 3OPZA 5DUUA 3FC0A 2OPKA 4XILA 3OD0A 4ISQA 2OYZA 3WR0A 4OHVA 1RHI2 3MDPA 2R49A 3M3OA 3ZX7A 1S0CA 3JBG2 5I0UA 5K7PA 2A6ZA 3IPVA 3NL1A 4J1XA 1VBD1 3VZOA 4Y1ZA 1SLTA 5AC91 4L11A 3MW3A 4ASMB 1RUJ3 4S2GA 4XXPA 2RM22 4CDUB 4EN8B 5CFDA 1RC6A 2C9AA 4DRVA 2VMIA 4YVWB 3WG1A 4Z2WA 1MS1A 1W6OB 1AR83 1FMD3 1BEV3 4OLLA 4I0WB 5FLJA 5J48A 3AYAA 4PCRA 4DS0A 2Q5TA 2R071 2R0FA 5BUVA 1O7FA 2WFF2 5K0UC 1XE8A 4FAGA 4B7KA 2XPJA 2WWSA 4M0NA 4IV1B 1H2NA 3O0WA 4O9EA 1ZBA3 1PZ9A 4KG0A 3VBFA 4PLOA 4LA3A 2VXRA 2HYKA 2DTWA 1EAH2 1H8TB 3OD4A 1Q8VA 3AZYA 4CDQB 2W52A 3RPQA 1RMU3 3I54A 3VBOC 4NWWA 4W6WA 2H6CA 2UWCA 2EALA 4Q8KA 1SBDA 1AR92 5DDJ2 4K1YA 4DRRA 3AZXA 1URXA 3VKMA 1U5ZA 4AHWA 1QXPA 3JQWA 5KXDA 4XBLA 3EBRA 1QWRA 1X36A 1TMF3 4RQPC 4QMAA 2TUNA 2XGXA 1GANA 1PM7A 2VOKA 3H9AA 2G9GA 5JCTA 3WNXA 2DCKA 3H8UA 3RWNA 1DQ4A 2O8QA 3AP7A 1UKGA 3NV1A 2JE7A 1YJKA 4TLFA 4ZKTB 3ROUA 3OGJA 2O8OA 1DIWA 2WNUC 1CAXB 4OUMA 3INAA 4B7EA 3B94A 5FAXA 2CV6A 3TNPB 2QQPA 4XMIA 4C1XA 4AI0A 1SQ4A 3GF6A 3SNMA 2RS32 1RUJ1 1ENRA 1RUD2 1U5XA 4FBFA 5T54A 4YM3A 4IV3B 4MYEA 4N53B 1K5MB 1HRI2 1ZA4A 4WM8B 2X53S 5J3UA 2ZGUA 4AXOA 2TNFA 1N1TA 2GNTA 2FZ1A 4MXWA 1AR81 1FMD1 1BEV1 4XTPA 1RINA 3M3CA 3VDDA 4FTSA 1XYNA 5CIRA 5JIUA 5K9YA 4AQ6A 3ELNA 5DUXA 1AR62 2PAKA 2VW2A 3VBSB 1ZBA1 1QHDA 3KD4A 2VUJA 1AUYA 1TNRA 3M7AA 4HLTA 1HQNA 3ILFA 1S0JA 4YM2A 4QPIA 1EV11 4JCKA 5E8AA 3D82A 5CU1A 3B02A 4CDWA 1SLLA 3RNSA 4XJWA 3MIBA 4P9YA 1RMU1 2P3JA 3WG3A 3FE5A 4OZXA 1QKQA 3EHKA 2XKPA 1B35A 1AYN1 4JRAA 1CX4A 1MQTA 4GXLA 1BBT3 4W6YA 4GWNA 2PHWA 1R093 2DVAA 4G9SB 3B00A 3DPRC 1HKDA 5FRAA 4AEKA 4CEYA 1TMF1 1V6IA 4Y1UA 4HETA 1RHI3 4JDNA 2I07B 2F6BA 3IDBB 3ME2A 1NCRC 1LTEA 3TN93 1QJY2 5I91A 3ZVXA 1NA1B 3RQ0A 3PJYA 2ZZJA 3S7EA 3FBMA 4IEQA 1TME3 3DGTA 2PYTA 3POYA 4YSFA 3J8F2 3DKWA 4BQ1A 3DL3A 4AFCA 3FBYA 1V00A 4ORFA 1VB4A 1GZWB 1CIWA 1VBC2 3ES4A 3LGRA 1DFQA 4LT5A 3O0XA 4IEVA 1RVF1 4N9HA 3WVJA 1G9AA 5HCBA 2A5ZA 4P9JA 5CG8A 4DMIA 1RUI3 4D7YA 4IV1C 5JI9A 4QPGC 5ACA3 3PVEA 1H1IA 1QQP2 3OTFA 4XFCA 4O9GA 1NCQA 2IXHA 1OD5A 2D6PA 5DZFA 1LOEA 1VIWB 2WFF3 4Y4YA 1AZDA 1WW7A 4S2DA 4P14A 4UW3A 1PIV1 2D97A 2EAAA 3LWCA 3THPA 3ZFEA 1KITA 3SXWA 2WNEA 1I6XA 1V6KA 1YIPA 3VBHA 4XBNA 5I0SA 3AMHA 4Q29A 1AXKA 5GLTA 4DZGA 2CYFA 4AVBA 5K8SA 2MHFA 1VBA2 4HKOA 2PAEA 5CB7A 5F9TA 1GQGA 2OIIA 4KGGA 1JUHA 2BNNA 3N7LA 4XQDA 2ZGNA 3V64A 1FYUA 5KHGA 3R4UA 4HVQA 3GNEA 3WW2A 3NV4A 4QM9A 3M4FA 5C8CB 4YLZA 1RUF3 3DF0A 3QH6A 1BBT1 5I0RA 1DGWA 4I3GA 3UKVA 4FOQA 2D5FA 1R091 3WT3A 1AVBA 4DQAA 3MEPA 4Q26A 3BCWA 1N3OA 2EA7A 2VW1A 4YW1A 4D94A 4FPJA 2E9QA 1ZZ8A 2RHPA 3L2YA 1RHI1 2ET7A 3ZN4A 4AEMA 4AWDA 4QGMA 1LHWA 5JOXA 1ND2A 3NAPC 1YJLA 3ZFGC 4Y24A 3B01A 3TN91 4BM8A 5DG2A 1HXS2 1G9DA 2UY8A 1PGL2 2GNBA 4QD2A 1DYKA 2UYAA 4OHWA 4XFAA 1TME1 2CGOA 5JOZA 3AMQA 5I0TA 2XVKA 2WZR3 5FFOC 5DXDA 3RYPA 1RUD3 3ZSEA 3OBRA 1PGSA 3PVNA 4Q4Y2 2XVLA 3B93A 1KJRA 3ZXDA 4E2GA 3S6PA 1KFUL 3H7YA 1OQEA 1RUI1 4H3WA 5EYYA 1FNYA 3LSDA 4P5HA 5ACA1 4BZ4A 1FV3A 1RJ8A 3EQEA 1LHNA 1QY4A 4CDXA 3KCYA 4GH4B 4K3UA 3VLBB 4LO7A 4R4ZA 5DUVA 4GIQA 1BZWA 2WFF1 4I0BA 5BYNA 1WLCA 5CA6A 1LKNA 2CWMA 4CP2A 4E27A 1CR7A 5HXVA 2ZOEB 3O7OA 2VNGA 2BFUS 2DCYA 2QDRA 4JGZC 3NKGA 3RJRA 3ZYIB 3FX3A 4LO8A 1DBNA 2DUPA 4Y1YA 4M3CB 4AEDC 3VZMA 3RZZA 5AC92 1ZX5A 2X5IB 4R52A 1BMV1 1F2NA 1KS4A 4BOWA 1XU1A 1BVVA 4WM7B 5BV6A 2A70A 4KNCA 3WDUA 1A8MA 4HPKA 3LKJA 4JGYA 3SH5A 2QNKA 3CJIA 3ETQA 3POWA 3OYWB 3W58A 4FTEA 3JCIA 1C57A 4F3JA 2HWF3 4YYOA 4OFGA 2D6NA 1RUF1 4OI1A 5KXBA 1QJZA 2ZHKA 1DF0A 1O4TA 4RS5B 2P37A 2R072 2RJKA 2LALA 3RDIA 3ZXFA 4QGLA 2A71A 3ZSKA 4CRQA 1JTZX 4UXAA 2JX9A 4KL1A 2B45X 5D8AA 3FFQA 3W9AA 2OUJA 3S30A 1O3TA 4JC1A 4YZ3A 5E1RA 2Y0OA 1PK6C 4COWA 4XHBA 1AXYA 3E6BA 3AYCA 1DYPA 5AFEA 1VBC3 3WW3A 1CJPA 2VUAA 2QJVA 2WZR1 1PO13 3HD8B 1Q3EA 4INDA 1RUD1 4L8QA 1S55A 1S0GA 1V6OA 1C8NA 1NOVA 4Q8LA 2ZAAA 3D0JA 2I45A 4J1WA 3USSA 1QQP3 1DGWX 2GMEA 2PTMA 4Q4X3 1LRHA 1NLSA 1G9BA 1D0HA 3FLTA 3SMHA 1FAYA 3B5LB 1UIKA 1CAVA 5LEJA 2ATFA 2NM1A 4GWMA 4L97A 3WXPA 2ZJCA 2BQPA 2N7GA 5E16A 1U12A 3NO8A 4AVVA 1OHFA 3CJXA 4H7LA 2EXIA 1Z7S3 1KDKA 4H14A 4BYYA 5E89A 1QF3A 1BQPA 4WVMB 4YRDA 1WCKA 3BOPA 4K6BA 4FPEA 1HRV3 1A3KA 1RUJ2 4FAHA 1CAWB 1N1SA 1NZCA 4M3CA 1G86A 3GYDA 3KM5A 1MR5A 1QDOA 4JDMA 2PHLA 1YNAA 3MW2A 1MS8A 4WM7A 1V70A 2RE9A 4Z8BA 1FMD2 1BEV2 1PO21 2HWF1 3IWZA 2BGCA 1AHSA 3N35A 2R16A 3I2DA 1ALYA 2PELA 3TB0A 2YY1A 4Y1VA 2XUMA 2B42B 1YCIA 3FJSA 1ZRCA 1OOPA 2YGLA 1FOD3 3RMYA 1VBB3 4FXGB 3URFA 1DGRN 1GBGA 1ZBA2 1HXS3 1EY2A 3WZ1A 3WP4A 1WBLA 4AHYA 3RI8A 3KS7A 4QXKA 1WGPA 1ND3B 3KB5A 1EV12 5LK7B 1JXNA 4YVSA 1SCSA 3V56A 5EYXA 5K0UB 1X82A 2ZX2A 1RMU2 1TNFA 3D4KA 1OPMA 4OI4A 4QQLA 5FO8B 3MLKA 1A8DA 1VBC1 4EJRA 5A33B 3H1MA 4PDWA 4Q4Y3 4COUA 5ABJC 4N90A 1AYN2 1PO11 2R062 4WVVA 3LA2A 4EV0A 4XIKA 4IL7A 3FWEA 3IDEA 3VBOB 2LTNA 2JG8A 1TMF2 5SV5A 4Q4X1 5BNOC 1UX6A 3TYJA 4ES9A 2PHTA 1YLLA 3U4XA 2CL2A 2CNAA 1RUH1 5FLHA 1UF2C 5KXCA 3E6DA 3LZZA 1KJLA 4BMBA 2PHXA 5CFCA 1AJOA 1FV2A 1HX6A 2XBO1 5T55A 4RL7A 1OSGA 3TRSB 4K1ZA 1Z7S1 1OLRA 4YZ4A 3BPZA 2XB6C 3DN7A 3D8CA 3MLJA 4RS5C 1HRV1 1WLDA 3A0NA 4YW2A 1RVF2 5I8YA 2UY9A 1LENA 1FNZA 1DGLA 4QQOA 2ZGPA 2UYBA 1N1VA 1S1AA 2WNUB 1GQHA 2JKBA 4RD7A 3WQ7A 1I5ZA 2BNOA 1CAUA 2NN8A 3PMSA 1GNHA 2WNVC 4QX5A 1X8EA 5BXXA 3SLIA 1LJ7A 1PIV2 3N3HA 4PJYA 1QU0A 4TWTA 4C91A 3ZXKA 1REEA 1YO8A 3VBRC 1FOD1 1VBB1 3WOGA 1IGOA 1NYWA 3HAGA 3AP4A 4FXKB 4Y22B 4L2NA 1RITA 1ULCA 1MACA 1Q8SA 4GMP0 1PGW1 4PLNA 1DDLA 1AX1A 2R30A 1G6NA 2XWJB 4EWDA 1DHKB 2BFUL 2Z5WA 1YFWA 2XJUA 2P3IA 2DVGA 4FT8A 4Q4Y1 3VKOA 2RS53 3V0AA 3AMMA 3WDTA 1M4WA 4N43C 2JXAA 4Q0UA 1BBT2 4B3NA 1GYKA 5A33A 4LBKA 1OA4A 1R092 1ULDA 2G9FA 2PLV1 3AKQA 4CYDA 4FPOB 1TQ5A 3WUDA 4PQ9A 4AFDA 4B4QA 2ZCWA 1RUE2 3WUCA 4P9GA 3VZNA 2WC2A 4RA0A 4SBVA 2WA3A 2E7TA 1MZFA 2UWAA 3AJZA 3SITA 2IC1A 3TN92 2OA2A 2XL9A 1QXRA 3DPRB 2C0ZA 2XHKA 4Z92B 2D6OX 3R6SA 3AK0A 3LCPA 1ZRRA 1TME2 3E5UA 1V6NA 4ONUA 4M0HA 4YZ2A 2DV9A 2XJVA 1NCRB 4RQPA 2JG9C 3MYXA 4QHBA 1ZZ9A 4CEWC 1C5IA 1C8M3 2GU9A 2R0HA 1DZTA 3H1YA 1O4YA 4HKLA 3V0BB 2VY0A 3PVBB 2X29A 1QNWA 1RUI2 5A3MA 2Z69A 4OHZA 5ACA2 5FQ0A 2ERFA 1BVP1 5FLIA 2CAVA 1FT9A 1ND3C 2RS13 2PAMA 1YIFA 2IXLA 4M00A 1S0DA 2W68A 4P9IA 1G9FA 4FPKA 4XF1A 4C0BA 4XJ8A 3ZIXA 2HJIA 3CLPA 4P9WA 3D0SA 1LOFA 2VW0A 3LA7A 4QPGB 4AF9A 3ZSMA 5C9AC 1LGNA 3ASIA 2WINB 1EV13 1QMJA 1BMV2 3B69A 2OUHA 1QJX3 2Q4SA 3AFKA 1HQWA 3HR9A 2F4PA 4NHLA 5T3NA 4XF4A 1MVQA 4Z1VA 4WBBA 3P3NA 4F8AA 1AYN3 5A32A 2R063 2CTVA 5EJ3A 4Y26A 2LM3A 5L7OA 5J96B 4HANA 3I7DA 4Y20B 2TEPA 4ES8A 1LEMA 5BNNC 2RS51 3ZXJA 2X8KA 1RUF2 4X8NA 3K48A 1VR3A 5F5QA 4E9KA 2IXIA 5H9QA 2EXHA 1MEC3 5FO7B 2CWSA 3E5XA 1UPSA 5I8SA 3RJ2X 3USUA 1PNGA 2GALA 1DQ6A 3QH7A 3AZVA 2ZMNA 5T52A 3ZYGA 3VBUB 1C3HA 2OZJA 2BWCA 3T1MA 2DVDA 5LRRA 3VL8A 5T5LA 3MW4A 1YFXA 3WCRA 4EWEA 5JPNB 5T50A 4XYXA 3LOBA 4QQPA 1QOTA 4GA9A 2HWB3 2GH8A 1N47A 2EIGA 4KGQA 4D7TA 5CFDC 1RVF3 5CBLA 2WZR2 1I9RA 2RR12 2YC0A 3NAPB 4PIYA 3ZFGB 1S0EA 2WIIB 1C8M1 2YZ4A 5KBFA 4DXZA 1UZYA 3C3VA 4Q0SA 4BE3A 2XVGA 3WHTA 4CDUA 2WKKA 1Y7BA 4XFIA 4NWVA 4D69A 1SCRA 4AQSA 5J98B 4NHMA 1UIJA 2GMMA 4QU2A 3KSCA 4YVWA 1GFF2 1PIV3 5FOJB 1REDA 2RS11 1W6OA 3VBFC 3WV6A 4AFMA 3VKLA 1KS5A 1CQ9A 2DU1A 1W6MB 3C2UA 2K9ZA 4MH0E 1LB2A 3PJQA 2E53A 4HSLA 1HIXA 3VGIA 4IV1A 3WW4A 4B8EA 3BU7A 4AVAA 1DZRA 3BB6A 1QJX1 3E97A 2GMPA 1JBCA 3ACLA 4EN7B 1ULEA 4F7ZA 1H8TA 2QVSB 1XU2A 4JGZB 2IXJA 3ALQA 4CDQA 4AEDB 2R061 3I4IA 2GDFA 2IZWA 2BBVA 2JD4A 4IEUA 2HWF2 1PO22 4FPYA 3SH4A 1ZZCA 4XTMA 2D98A 2R1DA 3FUQA 5JWPA 4YW4A 2O0OA 1RUE3 2H0VA 1G8WA 4COVA 4BA6A 1MEC1 2ZAHA 3MPBA 2EAKA 1QOOA 1H4HA 3M8LA 5BNPB 1QH7A 3MLLA 5FTTC 4QQ2A 4AYUA 4KH9A 5DG1A 3WP3A 2QUOA 2PHFA 3BODA 4LUKA 1GSLA 2ZS6B 4NN0A 2HWB1 2D93A 3FMGA 3RS6A 2ZHMA 2NPIA 4ZXKA 5JOYA 1SFYA 2CGPA 3AX4A 2VNOA 1FATA 4OUSA 3U07A 2XJTA 5FPXA 4RHV3 3APBA 1CAXA 2XJRA 1PO12 2YUEA 1LESA 2ZBJA 2QDNA 1PK6B 3VZKA 3VDDC 3VHOA 4YNIA 4IV3A 4N53A 1YXWA 5KC6A 2GH2A 1K5MA 1OFSA 2YMZA 3NAPA 4Q4X2 4WM8A 3CU7A 4IEPA 4LBQB 2K2SA 4M3CF 2AR6A 3RSJA 1RUH2 4GALA 1LHOA 1V9U3 1AJKA 1VRH3 4YARA 4R8HA 4IQPA 2YDEA 3BTAA 1H2LA 2BWAA 1DGRA 2XBO2 4QPIC 4HN0A 4CDWC 4JTOA 3J9SA 1KDMA 1Z7S2 5DUWA 3P3PA 2C5DA 1HRV2 4MUVA 3VBSA 2WT0A 1B35C 1RUOA 1QJU3 1H8VA 1IS6A 1RJ7A 4A7ZA 5BNQA 1ENXA 5H9SA 1WLWA 4YG3A 2G4IA 3VBUC 2ARXA 1NLRA 4OULA 5AVAA 4CEYC 2GC3A 1BXHA 2HWC3 3IIAA 2ENRA 4IEOA 2KXLA 4QT6A 4PLMA 2JEMA 3SHRA 1RTVA 1RUE1 1Q8PA 3ECQA 4LULA 4NR1A 1PMIA 4JVAA 3WP5A 4COYA 1IOAA 1FOD2 4DNYA 2QZ3A 1VBB2 1W0OA 1W6PB 5GZDA 2NP0A 1IS5A 3EJKA 1O3SA 2AREA 4HK8A 5IUQA 5C8WA 1R081 5C4WC 1PGW2 4AW7A 2WA4A 4MGKE 4AVSA 2DFBA 2WS92 1LULA 3KZ4C 1H9PA 1NA1A 2TBVA 4Q27A 2RR13 3CEWA 1COV3 2O1QA 1WUVA 3GHMA 5E88A 4RHV1 3R0RA 4BLIA 5KHJA 5IK5A 4W6XA 2QE3A 4YG6A 1BKZA 1GZWA 1NCQC 3MF6A 3MICA 1CPNA 4AI8A 3ENRA 1SMVA 2PLV2 3OCPA 3VKNA 4DPNA 1UAIA 1NQJA 2OZ6A 1FX5A 4N9IA 3ZFEC 2A73B 5ABJB 3M3EA 4YFZA 2CY6A 1OI6A 3V65A 3N36A 3NV2A 1C28A 3MIGA 1V9U1 3I59B 1VRH1 2XG3A 4CP1A 2VOXA 1HV0A 1O5LA 4OI2A 4Q4V3 1Q8OA 1REFA 2ZGKA 5EWSA 3VV1A 5BNOB 4LHLA 1XYOA 1HQLA 4FP2A 1POV0 3D6EA 2YV8A 3N4MA 1C4RA 5HCAA 2AENA 4JRLA 1QJU1 2MEV3 3CF6E 5BNPC 4R4XA 1FPN3 3NVCA 1PO23 1FXZA 1NQDA 2IWGB 3H3UA 3AYDA 3AKSA 5T5PA 3LOIA 5JZGC 2HWC1 2ET1A 5C8CA 2AH2A 2OVUA 5FOBB 2GN3A 2SBAA 3BOWA 1ND2C 4M3CE <