3U07A

Crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
411
structure length
398
Chain Sequence
TNVDLAEDAYIYGYSIDEAYKFFYHTAVENNYPLNEFQPTINNDTLHLMGWLDVAAEPVIVSVPDMDEGRYWILHTMDMGHYTNAAFSSRTRGTKGGQFMFAAQDWQGEVPASVDEVVRVDSNLVKLMGRIMAVNDEDAKVALNYMDQWNIRTLSEYLGKNGPKPVQRTYPDPKKSTWLERVNFVLCDGSMGNADKQWLDKYQSIGVEPCKTDFTPEQLKLAKVGEKKGMEHLVELAPKMTDARTLLGTRDTLGDAPRDIFAEGTYLGQWGLPPIEASYRKSDFDSIGQKLDGSKHDYVMRFKAPNVSEFWSVTIYGNDNRLMAKNDLNRHSRGDRTMKADKDGYYTIYMSANEKGRADDPNFLPVPEKPFYAIMRFYGADDAIQSGEYQMPEIKVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the VPA0106 protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein VPA0106
total genus 105
structure length 398
sequence length 411
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06742 DUF1214 Protein of unknown function (DUF1214)
A PF06863 DUF1254 Protein of unknown function (DUF1254)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1600 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u07A02
3U07A
chains in the Genus database with same CATH superfamily
3IWZA 1PGW2 1CIYA 4Q1PA 2WAAA 5DMYA 3FX3A 1PO22 5LATA 3CQOA 1S0IA 1RUF1 1WCSA 2VZOA 3HQRA 3NNJA 1GZWB 4XMIA 4R9AA 5JPMB 3K46A 3PURA 2GNMA 1V6MA 1YCIA 4Q4W3 2AC1A 5C9AA 2W2IA 3U11A 3AX4A 4U2AA 2HWD2 3USUA 3RYKA 2WZR3 3RDIA 1ASJ2 2ZGUA 4AEMA 5I8YA 2FHRA 3JD71 1GSLA 2RV9A 1O59A 1HLCA 2AR6A 4Y24A 2QQJA 2WWJA 2VMGA 4PIZA 3T2TA 4AQ2A 1ZRFA 3FMGA 4WVZA 3E6DA 2WFF1 4C1XA 5FQ0A 1JH5A 4HLTA 2ZX0A 4NROA 4XUOA 5EZWA 4CUBA 4XF1A 5IVBA 1JZ7A 4CXYA 5HCBA 2ZEYA 4QX3A 5FO8B 3DN7A 1QQP3 1VBC1 2QQVA 2V5YA 5KHHA 3PTRB 1G8WA 4FOYA 1J3PA 1YFXA 2WNUA 2WA3A 4OFGA 4Y33A 4B4RA 1AR63 1XQNA 3ZXGA 2WFPA 2VZVA 1NA1B 4GWMA 4CDXB 2W95A 1HW5A 3ZIXA 1POV0 1W9WA 4HVOA 3AKSA 4OI1A 3O14A 2D93A 1R1A2 5EHDA 4QPWA 2XB6C 5HXMA 2VC9A 2XHKA 4KWUA 3VBFC 1V6LA 1W28A 1W6PB 4XCAA 2WO2A 2ZS6B 5FTTC 3WY6A 1VB2A 2C26A 2B45X 3TBDA 2Y64A 3AMHA 3NRUA 3J8F2 5FLIA 3VBUC 2XHNA 4BJ0A 2ZMNA 1MEC3 1LJ7A 2VOWA 1S0GA 1YUDA 3V64A 2TUNA 1WBFA 4XUPA 3VDDC 1BJQA 1BZWA 1CAVB 2CNAA 2OIIA 4AAXA 1AR82 3FLTA 3WNXA 4AHWA 4NHKA 3H3ZA 1XNKA 2QQIA 2EXIA 4NR1A 5EJ3A 3O1RA 5SV5A 3PIGA 1CJDA 3BCWA 4OI2A 2QQKA 3BI3A 1REDA 3RZGA 5C3OA 2JDHA 5JOXA 1W0PA 2HJIA 2I07B 4O9GA 5K7PA 5L7OC 1QF3A 5FZ7A 1C28A 3UKVA 4X6QB 5FY7A 4I0WB 3SXWA 3A0KA 2JE7A 3VKNA 5T3NA 5A3OA 4DNYA 2D40A 3BPSA 1JODA 2WS92 1JN2P 2RDNA 4BOWA 3AP7A 4G9SB 3RSJA 2W87A 3IZOA 3V0AA 1YFYA 2HWE1 1KDMA 1RUJ1 3VBUA 2XDVA 3IT8A 3PVOA 3KF3A 4QHZA 2RDSA 2K46A 4DY3A 4YW6A 3KV6A 3HR9A 4IEWA 1UZVA 3BTAA 1JYWA 2ZGRA 5F2WA 3KD4A 2BBAA 1NY72 1YI7A 4UWDA 1RTVA 1O4YA 3TYJA 5F39A 5GLTA 2CGNA 3FJSA 4B1MA 4EZ4A 5IVVA 4CCJA 3MIFA 1Q8PA 1QNWA 4CTEA 5CBLA 1V6KA 2P3IA 1SLAA 5DABA 1K5MC 2X5IC 1POV3 5IK7A 1RUD1 1PIV1 4ARYA 2HWB1 3OGVA 2I2SA 4MHUA 1VALA 3LDRA 3T1LA 3MV01 1PMHX 5FP7A 3JBG3 3MIBA 1U5ZA 1VRH3 3A21A 3VKOA 4AE2A 5CFCA 4WVMB 5FYHA 1D4M2 3TOJA 1REFA 2HWB2 4XUTA 1YO8A 3SHRA 4JGZB 2DFCA 1LTEA 2IUWA 4GWNA 2EA7A 1ST8A 5H9QA 2R1DA 3BVCA 3KGZA 4AR2A 5BXXA 1OPOA 5FZOA 4LBQD 4CXXA 4XHBA 4HFSA 4ITCA 5ABJC 1AR61 3FLPA 3KMHA 4AI1A 2D7FA 4DY5A 2WO7A 4GMP1 5C3QA 2ENRA 3H8OA 5ACA2 3LFIA 2Q8OA 1LKNA 2BW8A 1NCRA 4Q4Y3 4BISA 2CL2A 1B35C 3DYOA 4HXCA 1W6MB 4K1ZA 4L9BA 1JYNA 3LOBA 2R0HA 3I59A 1SCRA 1F9KA 2JG8B 4QPGB 5FY8A 4LA3A 4XDPA 3A0NA 4LNVA 4XFGA 1XOYA 3HNYM 4B4QA 2ID4A 1YFWA 1SBFA 1HJFA 1EAH3 5FO9B 4QMAA 2VO5A 2VECA 1R092 4K8FA 3KSCA 2DV9A 3GALA 5FZ9A 4Q4W1 1OOPB 2ZABA 4FPYA 1H8TB 2BGCA 3NJZA 1RUI3 2JDNA 2BVVA 2JJ6A 3AMQA 3AZZA 3DCQA 4H55A 4Q0QA 2NQYA 2YROA 1UD1A 4LLOA 3VBRA 2CGPA 3WNOA 3MHZA 3B69A 1Z7S1 2Y8KA 1UMIA 1UU4A 5BYNA 4PQQA 1WW4A 3AB0A 4G3YC 2XMLA 3RYPA 5I0TA 2EIEA 1ZZBA 4QQ2A 4FCAA 5FMOL 2ZAHA 1RGSA 2VM9A 3ETPA 2ZX3A 1AXZA 1CESA 1ZBA2 4F83A 2EAAA 5IWFA 4D0QA 3MIDA 1BLZA 1WZXA 1BBT2 2VTXJ 4GMP0 1JTZX 1LOGA 3K77A 4E4ZA 2VMDA 3K4ZA 1QXPA 1C5HA 2VAUA 1YXWA 5DDJ2 1ULFA 4FFHA 4QU1A 1GYKA 1ZZ6A 1SLLA 3LEMA 2OVUA 5EWSA 3RFRA 3UV9A 1W39A 3T30A 3T4VA 3ZR5A 4UYBA 1ZRCA 1D0GA 3M3IA 3WOGA 4OQ9A 4XOGA 4JGZA 1JU3A 2FZ1A 1O7FA 1R091 1HRV3 1JU4A 2JDMA 2K0GA 2WFF2 1V9U3 2HLEA 4JGZC 2QBXA 4LKEA 4P9WA 1CD3G 4ZS2A 1N3QA 2EICA 2VMFA 3QH6A 2W1QA 4Q4V2 3Q8BA 2A3XA 1JXNA 3LCPA 3BUCA 5DZFA 5FZ8A 3RJRA 3O0VA 1SEFA 2QZ3A 4DQAA 2C0ZA 1CIWA 4H2AA 4UFKA 5CG8A 3I2HA 4FFGA 3CDZB 4HKOA 1XNCA 5EJ1B 3VHOA 2RJLA 5K0UA 3WP3A 1RUF2 3WQ7A 2VXRA 4MXWA 3KB5A 4D7YA 3AJZA 5IAXA 1QJEA 1QJU3 3JCIA 1OMIA 2YBKA 2R063 5FXVA 4D3WA 4JVAA 2Y0IA 3V0AB 4OHYA 1DP0A 2DBNA 2ZEWA 3ITQA 2GMMA 1LOFC 4CVUA 3ECQA 2BZDA 1C3HA 4WM8B 2V4VA 2JDAA 1C5IA 3PLQA 4LXLA 3K4AA 1AL22 2EALA 4AAPA 5G04L 4ZONA 1QJY3 1W6OA 3VV1A 4BE3A 3NSTA 5B4NA 1V6JA 1FV3A 1EV12 2VBPA 3ILFA 3OYWB 2D3RA 3FZ3A 3I2IA 4XJ9A 2JB4A 2WNOA 1UAIA 4MVTA 3OD0A 4UW5A 1PO12 3D8CA 5KC5A 1F15A 1RJ8A 4Z07A 2VR4A 4ZXKA 1MS5A 1MS4A 2QDNA 3N3HA 4RFT0 4L11A 2ZKNA 4UF0B 5FBZA 3EO6A 1YI9A 2R071 3KT1A 2WQZC 4NE9A 5A1LA 1HB2A 1NQDA 3W58A 1FPN2 4NPRA 2JXAA 1XXNA 4QXBA 1QGLA 3A7QA 3CZJA 1ULCA 2DCTA 1RVF3 2ZACA 3J7MA 2JG9B 4S2HA 3UL2A 5F7UA 3VZOA 1RUG1 4Q0VA 2HWE2 4N90A 5FY4A 2H0BA 1C8M1 1NKGA 2RR11 1RUF3 4J6GA 4BQ4A 2LRPA 4UAPA 4I30A 1GWLA 3VD7A 1PO11 3X29B 3L2YA 4CDWB 4AK3A 3FBMA 3VBOC 1LB2A 1X9TA 1DQ0A 1CX4A 2EXKA 1V9U1 1IKQA 1JHNA 4YSFA 2IXKA 2RMU3 4LBLA 1O91A 2BDRA 4BQXA 5A3TA 1DHKB 4AFCA 1QY4A 2V73A 4YZ2A 4J1XA 1U5YA 1UO9A 1AR81 1ZBE1 2BGPA 2YG0A 3NAPA 4IERA 1O8PA 1FT9A 5EP9A 2I74A 1XNAA 1RVF2 4AEDA 3J4UH 2WT0A 2YBSA 1S2BA 5FY1A 1BVP1 1LESA 5GJ6A 2ZGMA 1CPMA 1HQLA 2KD7A 2A73B 1RINA 2X5IA 2XLFA 5F1RA 2DUPA 4ISQA 4ET7A 1JZ4A 1J3QA 2VH9A 1D4VB 3OUJA 4WM7A 3ZX7A 1DIWA 3HAGA 5IW0A 1PVC1 1Y7BA 4O7XA 2W1SA 4AI9A 1S0CA 4IV3B 3MLLA 1VRH1 3KVAA 3KF5A 1WBLA 2BQPA 4Z2AA 1NLQA 1Q8QA 1UKGA 1LULA 2WT2A 4IXLA 1N3PA 3RWNA 3T0AA 5LRRA 3F2ZA 4HPKA 5D1IA 4F3JA 3MGUA 5GLVA 1AL0G 3W9AA 2D5FA 4YW3A 2DTWA 4QU2A 5EV7A 3VGIA 1UMZA 1UZZA 1IZ3A 3RI8A 1O3TA 2XL9A 2IZWA 3ZR6A 4HBNA 3LD8A 5A1AA 1QOOA 5FZFA 4HANA 4EWAA 2HWE3 4OULA 5FKBA 5T5LA 2R062 4M3CF 1I9RA 5FP8A 3VDAA 3ZXAC 4A7KA 5LWBA 1LENA 2Z5WA 5HPOA 5FMBA 2JG9A 3I3DA 4RN5A 3WDTA 3S57A 3WW3A 3AP6A 1OXCA 3M2MA 1GQPA 2VG9A 4NO4A 4XFCA 2ORZA 1F2NA 1TMF3 2OZJA 4PDWA 1NA1A 4B4PA 1ODMA 1MVQA 2OX0A 3VBHB 1HKDA 4QQLA 1AUYA 1OD3A 1D0HA 4EQVA 1J84A 3R4DB 4A2UA 3E5XA 2ARAA 4IE5A 1W0NA 3I2DA 5F37A 3E97A 3K75B 1C8M2 4M4PA 2DVFA 2BNOA 4LIUA 3WSOA 1RHI1 3ILNA 1KJRA 4Q4X2 4A45A 2QCSB 3NKTA 2X8KA 3HN1A 4U36A 2VMHA 5KC6A 4XXPA 3VDDB 1IPJA 4KI5M 2Z42A 4QHBA 4NHYA 1WWYA 1W2OA 2W9XA 5C9AC 2BFUL 4EN0A 5I8SA 4DS0A 5FFOC 4YNIA 4D7SA 3R4SA 1GBGA 2A70A 4E4SA 5A3NA 1ZM1A 1W6MA 2P2KA 2R16A 3POEA 5F32A 5FXWA 5T5PA 1IQDC 4D8MA 5ANNA 2XGXA 2UWCA 1RC6A 1AYM3 4XFAA 2ZGNA 5BY5A 4NRQA 3AYAA 2OPWA 4DIQA 3GXUA 4AGRA 5IVCA 3RMXA 4Z1VA 2DCJA 2VZPA 4COZA 3IN9A 3T4HB 4AF9A 1IG3A 1NYWA 1JYVA 3LPFA 1YHFA 2HWF1 3ZO0B 4MGQA 2G19A 4RHV3 1N3OA 1OLME 1F35A 1IGOA 2QTWB 3AZVA 4Y5TA 4NJ4A 4X8PA 3TEZA 1VBD1 1VJ2A 5FZHA 4Y20A 1P8JA 2CSGA 4NMIA 4INDA 5EQUA 4CPBD 2BVBA 4XBLA 2BYVE 4NIHA 1NT0A 2XJQA 5JOZA 5FO7B 3P3NA 3VBRC 5J3UA 1W6PA 1PZ9A 3NV3A 4X8NA 5ABJA 4AI8A 2VBDA 4NIIA 1JZ8A 4MGTA 5CKNA 1OD5A 4XFHA 4GA9A 4HPKB 4LOTA 3N9NA 3OB8A 5J37A 4H7MA 3B7MA 3RGBA 4FOVA 2DVGA 4JV4A 2WN2A 5F5IA 3O1TA 4Y22A 1RUC1 4YZ4A 4ZPIA 2P1BA 4COWA 5FOJB 3LDBA 3S7EA 4EN8B 5KR7A 4XBNA 5HV4A 4ATEA 4E9KA 5FOBB 1DGWX 1LR5A 2VOKA 3KGLA 4Y1VA 2BBVA 1OT5A 3OEBA 3ZYFA 1W9TA 1LU2A 1U5XA 2E32A 5A1FA 4XTPA 1OF4A 3JZVA 4CEWB 1KDKA 1H1AA 4LBJA 4FBFA 1K5MA 3DL3A 3NV1A 3AXDA 5A32A 1IS3A 1MEC2 1L7RA 2YXSA 2PHRA 1E57A 3ZN5A 3O1VA 5EFUA 3K48A 5IVJA 4JRLA 1DCSA 3O5SA 2OUHA 4LBKA 2A3WA 5BNOC 2HH9A 1RMU3 4LKDA 3NNGA 1W2NA 4IEVA 1FOD2 1R093 3C7GA 1VMFA 3BTXA 5L73A 3PJQA 4FPOB 4MLOA 4YW1A 1U12A 3ZYIB 3OTFA 1AF9A 2LM3A 4JDMA 4GKXA 4A3ZA 4D6QA 3GZTB 3VD5A 4XC9A 1Q43A 3BU7A 4HK8A 3VKFC 4AHXA 3CJXA 3TAYA 5KWRA 4EV0A 2A7AA 4GWJA 4IGQA 2YPJA 4AFMA 3ALQA 1VBE3 5GZFA 5J09A 4QHOA 1NCRB 1BEV3 3B94A 1MACA 2OS2A 2QE3A 1TNRA 4R9DA 2QQNA 4WVVA 4QX5A 4FTSA 2JEMA 4FPCA 1F4AA 3NL1A 2R041 3OGJA 2A6WA 4KGQA 1GR3A 2VQTA 3S5QA 3AKRA 4XZPA 5A3WA 4GULA 5SV8A 1J1LA 4CDQC 3O7OA 4UOJA 1H0BA 4B7EA 4BB3A 2XQRA 5FZOB 5CFCB 4CDQA 3BIEA 2L9LA 4RS5A 5LCWL 1R1A1 4MUVA 4QX7A 3JD73 4QQOA 5BNNC 4QX8A 1UKRA 1VRH2 2ERFA 5G05L 3SQOA 1C1FA 5FWJA 4PI2A 4ATFA 1H2KA 1VRBA 5LA1A 1DQ5A 1ZZ7A 2BTVC 3CKHA 1H30A 1R1A3 1LU1A 4CEYC 1UN1A 5LW9A 5EIYB 1RUE2 5GKAC 1K3IA 1F4HA 3DV8A 3PL0A 1OA2A 1AL23 1DQ2A 3DXTA 4XF3A 4ZS3A 2RDQA 4MADA 5FZEA 3LE0A 5DUUA 3UYJA 3OEAA 1FPN1 3CIHA 1GWKA 1WW6A 1LHNA 2VD7A 3WF0A 4BQ1A 1RUC2 4DZGA 1FMD1 3WDWA 4GZ9A 1QJU2 3VDDA 4LA2A 4META 3ES4A 4JTOA 3EYPA 1XJAA 3M70A 4M00A 2Q8EA 4LT5A 4YG0A 3H9AA 4FQZA 4IW3A 4IE7A 1DQ4A 4BU2A 3LGRA 4H7LA 4MXVA 2GC1A 3OPWA 2CTVA 2PN5A 4H3WA 4KWLA 1J58A 4UFHA 3D3AA 5KHGA 5JMCA 2NLRA 1RITA 5JR2A 5IHRA 3KV4A 1EP0A 1FMD2 2AUYA 2AENA 1DF0A 1TNFA 2NPIA 2RDRA 1TZOA 3VHRA 5C6CA 3OUIA 3KHBA 3NV2A 2MEV2 1PM4A 2E6VA 4D69A 4BXSV 3Q9OA 3C7EA 2AZ5A 4ZY9A 3W5NA 3O1SA 2XPJA 1UYZA 4P14A 2OKXA 3C2UA 3CBNA 1FMD3 1T6BX 1WUVA 4KG0A 1BBT3 4K8RB 4LPLA 4RA0A 4CXWA 4LO5B 1G86A 4F7ZA 3UT0A 3WF2A 4AQSA 1G6NA 5F3CA 1PGL2 1AR73 2OW4A 3OCPA 2VUAA 1MQTB 3RS6A 1GLHA 1O5UA 3R0RA 4NRMA 4IV3C 5CA6A 5L7OB 2JE8A 2PAMA 1LOCA 2TBVA 4MZUA 3KHCA 1ACCA 1WKYA 2BNMA 4KU8A 3RI9A 4QX0A 4CRQA 3IDAA 4YGBA 5CADA 3EXUA 4V1PA 2ZX2A 1GNHA 3VZKA 1XB9A 3DYMA 1SFYA 4LBQB 1VBB2 2UWAA 3KWVA 2W91A 5LEJA 1X82A 3FHQA 2Y6GA 1FXZA 2R49A 1W6OB 3POYA 1SBEA 3ZDSA 1RXGA 1SHWB 1F5FA 3LA7A 1EUTA 4FFFA 3PDQA 4JHTA 3H42B 2GU9A 2VNGA 4PBOA 3ETQA 3THCA 2D6LX 1VAMA 1RJ7A 2P17A 5J1XA 3BTYA 2XWBB 4XMAA 1W8TA 5ERLA 5I0RA 1RL3A 3O1MA 3ZOIA 2EVXA 1WA4A 3PMEA 3POBA 2FDKA 3F95A 2R061 5C8CB 2JD4A 2YUEA 3PIJA 4QB1A 1NG0A 4OI0A 2ZBJA 3FLRA 3N7LA 4FSJA 4X6RB 4YVSC 5J98B 3PU3A 4XURA 1IKPA 2JDKA 3KT7A 2E51A 3POJA 4FPFA 1AYM1 3BOWA 3FUOA 4W65A 5JSRA 5CFDC 1DBNA 5DAVA 5LY1A 4CU9A 4XABA 3WUCA 1WCDJ 2R32A 1VBB3 5FR3A 1CN1A 2HBTA 3VBFA 1C8NA 5GZEA 1X33A 3LSEA 4BQWA 1AXYA 1UYYA 5ABJB 2Y34A 4M0HA 4N7IA 3GCWA 1HV1A 4XQDA 4LHNA 3VHPA 4LOSA 3VDCA 4BQYA 4OZXA 3RRDA 3AK0A 1UZYA 3THPA 3CO2A 3N9LA 1FOD3 2FMYA 2JE9A 4Q4Y1 3WG4A 1DGRN 4LHLA 1DLLA 3T0BA 2PHUA 2JB8A 1KFUL 2PA7A 2MHFA 1CAXA 2RS52 2YGLA 2ZGPA 4IV1B 4PLNA 5HCAA 4UBHA 1ZBE2 1S0JA 3N36A 2IXLA 1TEIA 3HQXA 3GBWA 3VBSB 4MYEA 3T1MA 3M7AA 3BYWA 4BYYA 2QFEA 2ZHMA 4IV3A 2PAKA 3SLIA 3N4MA 2JDYA 5I91A 1XSRA 2YB7A 1O3SA 2ZA9A 4ORFA 5DG1A 2VQ0A 4YW2A 4DXSA 4WM7B 2WUHA 3NMBA 4TLFA 2DU1A 2YFZA 4RQPC 3LEIA 3KCXA 3KV5A 3I2OA 1UIKA 1NLRA 2RE9A 4MHRA 4QQPA 2W94A 3I3BA 1LGCA 4KG8A 3WDYA 5C70A 5BNQA 3WT3A 1SG3A 2WDBA 2ADEA 5LZ6A 1RUD2 4AEDB 1ULEA 3TNPB 3ZKUA 4E8DA 4Y3OA 2CWSA 2JECA 4YM3A 2OZ6A 4K21A 1V00A 3WXPA 3RJ2X 2IXHA 4P5HA 2MEV1 4OHXA 2J7MA 4QD2A 5L36A 4N9HA 3APBA 1JI6A 3ZXDA 1DFQA 4JKLA 4D6RA 4IUGA 3HN3A 1DQ1A 4RYDA 4YG6A 5E89A 3ZPYA 4BPZA 1O3RA 3AFGA 2D6PA 1B35A 1YFUA 2P37A 2V5DA 1LNSA 3AZXA 3D0JA 3MEPA 3PMSA 5DXDA 1FV2A 3PUQA 4IGPA 4RQPB 3C7HA 1PVC3 1UZWA 5ISLA 2YY1A 5TSWA 2I45A 5KHKA 3DKQA 3I3EA 3O0WA 2XJVA 4UBGA 4AHZA 4GAZA 4DEVA 3TEWA 3KCCA 2PQSA 3PVBB 5FYIA 1DYPA 1UQXA 4JAAA 1LHOA 2LTNA 2DTYA 1LCLA 4J25A 2P4EA 5LY2A 4HVRA 2VQUA 4AG4A 3BOPA 3VBFB 2W1WA 3IM0A 5LBFA 1U5IA 2NMNA 3POGA 1PIV2 1KEXA 4WZCA 3KQ4B 5IFTA 1EAH2 3D82A 4BZ4A 4ZZ5A 4ASLA 2VVEA 2B9VA 2AH2A 2FCUA 2G4IA 2VPVA 3HMYA 2WL1A 1CONA 2D43A 1QJY2 2EIDA 2XWJB 3E5QA 4I0AA 2Q1ZB 4N53C 4PQ9A 5JSOA 1A34A 3WF4A 4CU8A 1NA1C 3J8F1 1GANA 3BKZA 2GNBA 2JD9A 5FXXA 2WNVA 2E7QA 4FT8A 3RG0A 3PJYA 3VBSA 3MIHA 3QD6A 1LAJA 4E2GA 4XFIA 1OQ1A 4LBQA 4CDUA 2F17A 5CNAA 2ARBA 2YYOA 4JX0A 2XG3A 4RFRB 3ZXFA 4IEYA 4XEZA 3AP9A 2OA2A 1SLTA 3GGLA 1HXS3 2W5FA 1D7PM 4JZRA 3ZYBA 1DZQA 1G9BA 5IT6A 2Q1FA 2BFUS 2FDFA 5FP3A 5I0SA 5FP4A 1AZDA 1D4M3 4AW7A 1UYPA 2WQ8A 4IV1A 3RZKA 3I4IA 1JMUB 1AYM2 5IVEA 4YARA 5ANQA 1EPZA 2LUWA 3JBG2 3WD5A 5C3RA 4QKDA 5DDJ1 1VLNA 3I59B 2VZQA 2DCZA 2VNRA 4A4AA 5JXHA 2WZEA 1STMA 4K20A 4MGYE 1JOPA 5JIAA 5L9RA 5A7SA 5K4LA 4ZZ8A 5CAZA 4LULA 2BP6A 3WW4A 3KVBA 2F4LA 3IBMA 2QQWA 1VMHA 1ND3A 2WWUA 4QQHA 1HQNA 3WHUA 4ISRA 2C5DA 3WDUA 3ZFFC 4HSLA 3C7OA 3I3QA 4YVSB 5C7GA 2C1FA 3WZ1A 1FOD1 2ZAAA 3DPRC 4IEXA 4UF0A 1DGLA 1KITA 4HN0A 5JXIA 4FTBA 4GJZA 3ZDVA 1UZ0A 3MFCA 1Z7S2 1KRIA 2WSUA 2AEZA 4COVA 1MEC1 1EV13 1SACA 5FZBA 5FZKA 1Q5OA 3OGSA 1L7QA 4JC1A 1N1SA 2VL4A 4B29A 3M3EA 4LORA 2PLV1 2RR13 3JU9A 1LODA 2A5ZA 4QXKA 3SCFA 4UI9L 1Y3TA 3AKPA 3WP6A 2Y6JA 2SLIA 3WINE 5KXCA 1DU3D 5JMOA 3U4XA 4ONUA 4LHSA 3WG3A 4M0NA 4FPEA 3OF1A 4R4ZA 1BK0A 3AMPA 3AYCA 5LBBA 1UF2C 2XKOA 2ZXQA 4Y1UA 1FAYA 3EJKA 2YV8A 5JI9A 2VTXA 2JKBA 4MGIE 4PBPA 3J7HA 3CEWA 2R073 2ZGQA 4BXFA 1IS5A 2RJ2A 1NZIA 3PTYA 4UXAA 3BU0A 3D0SA 1KJLA 3T0DA 4GJYA 2RHPA 1PO21 2NYYA 4BQ2A 5FDBA 1GZTA 4KMQA 3POSA 1CZVA 1IS6A 4XCBA 3WP4A 1BVVA 2QKDA 3MV11 1JZ5A 4DUVA 2WFF3 3LKJA 1W6QA 1UMHA 2XUEA 3KLSA 1RHI2 4PLOA 5GLUA 5KXBA 1DZTA 5JPNB 2C24A 2RS31 3OD4A 4TN7A 4YPJA 5DPNA 1JYIA 2WR9A 2GC0A 1F8VA 4CDQB 5FZ6A 2XR4A 3BB6A 3R4UA 3HNBM 1W3VA 4FPHA 3U14A 1WD4A 5CFCC 2Y33A 3V0BA 2ZGSA 1ODNA 2BOIA 2BOJA 1AR93 3HNMA 3AZYA 3MUY1 5CISA 1ZRIA 4LE3A 4OHWA 4MX3A 5FPLA 4HK9A 5L9VA 1IOAA 4M4RA 3JUUA 2EAKA 2ILMA 1LOAA 3SKVA 4AFAA 2ZZJA 5FJHA 3JB8A 4YGCA 3ZSLA 1M06G 3JQXA 5KXDA 4QKNA 4Y26A 1UOBA 3I2GA 4CP2A 3MICA 3ORJA 3NVCA 4NAOA 4QKBA 1L7LA 5F6LB 3RZJA 1X7NA 1CAUB 2YU1A 1RUH3 4GB33 3IDEA 1NQJA 3CJIA 3VZNA 2GMEA 3SMHA 3WNMA 1SDDB 4NHXA 5LB6A 5BNPC 5BNPB 2CAUA 2J22A 2JDPA 4IE6A 2PLV2 4YZ3A 3UKTA 2JDZA 3FUQA 3N9OA 2VW2A 1AXKA 2ZHNA 3B01A 2QQPA 4Z8BA 2UWBA 4GIQA 4Q4X1 4HKWA 3MO4A 4LO6B 1ULOA 1TVGA 1N1TA 5BNNA 1ZX5A 5IVFA 2Z79A 5KHJA 1BHGA 4EWEA 5EXOA 4XW3A 1YQCA 3LDKA 4NN0A 2DUOA 5L19A 4AFDA 1RUI2 1UOFA 3T09A 3OBTA 3U4SA 2VGDA 4IL7A 4QGNA 4UW3A 1WCUA 1S0BA 1UCXA 4WV8A 3WEZA 2F4PA 4A7ZA 3NNMA 4DMIA 5CFDB 2YU2A 3VBHA 4N53B 1SQ4A 3LB9A 1CPNA 3GDBA 3WLUA 4A3XA 4CDUB 3SITA 1NCQA 4QXCA 1E5IA 3N7JA 4ASKA 4P9IA 1ZYBA 2HEYF 4GH4B 3S0MA 4F8AA 3QLQA 5GLWA 2LW8A 5DQ0A 1JZ6A 5FYBA 4CU7A 1HRI3 1JW6A 3VN4A 2GAUA 3JBG1 1X9PA 4OLLA 3ZMOA 3ZXJA 1V6OA 4NUBA 1MQTA 2JWPA 2P34A 1B35B 4Y1XA 1GWMA 1OKQA 4QDSA 3VZMA 4UT5A 1MS0A 1XYOA 3RZMA 5JR7B 2IVJA 4KWKA 5JOWA 5CU1A 2BGOA 3THTA 2G9ZA 1H1MA 2Y60A 3CZUA 4AI3A 2CYFA 4Q4X3 1UYXA 1W03A 1RUI1 4HMZA 4N43B 1VBA2 3KS7A 3GZAA 2ZTNA 4S2DA 4CDXA 2PELA 1XNBA 1SLCA 1XBFA 3IAPA 1OH4A 4LE4A 4YM1A 2WNEA 4FXGB 4UW6A 3IPVA 4Q29A 4Y1ZA 3SC7X 1JOJA 4P9JA 5CG9A 1BKZA 2GP5A 2NMOA 4TWTA 1RVF1 4NHLA 3TN92 2PHFA 1AR62 2W92A 1US3A 4AEDC 2R043 3P5BA 1PNFA 4RHV1 3RZZA 1RUOA 1YNAA 4XE9A 1OOPA 4QB6A 1WA6X 1ENQA 2X5IB 5IAVA 5BV6A 1QMJA 5FZMA 4TXWA 2HWD1 3HIFA 4LUKA 4E27A 5FZAA 4DO0A 3T2OA 4PI0A 4XUNA 1OVPA 1PX3A 3AL5A 2JG8A 2DUQA 2MPFA 4MGZE 2BEOA 1FX5A 4A42A 4IV1C 2E33A 2QQOA 2ZMLA 3AKTA 4FP3A 4COYA 1KGYA 3I3MA 2C6SA 1GKBA 2VUDA 2YPDA 4BLJA 3H1WA 3WQBA 3RNSA 2V4AA 3W20A 1H8TA 1H1IA 3HT1A 3DKWA 2ZGOA 4QGMA 1QWRA 1ZBA3 2WJSA 5DZEA 3ZYRA 1VBA3 2E26A 1POV1 2WSVA 5A33A 1GNZA 2OPKA 1UXXX 1VIWB 2D6NA 1ULPA 2PHWA 3S30A 1EUUA 3ZIWA 4QPIC 4AVCA 3MI8A 1YEWA 1YJKA 2HWC3 1OUSA 2ZHLA 1O4ZA 4L8QA 5JUVA 3QBQA 1OHFA 1GOHA 4BK4A 4BWOA 5AFBA 1QU0A 3FL7A 1Q8OA 3HOBA 5H9PA 4O65A 4YVSA 1REEA 1BEV2 1DZRA 2ZKLA 2RS12 2J1UA 1UWWA 1EV11 3O12A 2XH6A 1IPSA 2WZR1 4LEJA 1HRV1 1MQTC 3IIIA 5A3UA 3S6PA 1UY3A 3KCYA 3TN93 3IAQA 3B9CA 4D94A 4RR3B 1AYN1 1RUJ3 4NWWA 4RR3C 5F5AA 3ZMNA 4AFBA 1DGWA 5FRAA 4DPNA 5C5UA 3SISA 1R081 1QIQA 1KQRA 1HDKA 2QDRA 1W8ZA 2A6XA 3LEGA 4QGLA 4YG3A 3POFA 1GOGA 3WW1A 2QQUA 3WQ1A 3U1XA 1XYNA 3DPRB 2C9AA 4YZ1A 1JZ3A 3N7KA 2BJSA 1ZZCA 3EQEA 4Q4Y2 3IMMA 5K8SA 1MS9A 1RMU2 1X8MA 4JKMA 4R9CA 3MLKA 3ACLA 4XQ4A 1W6NA 1NX9A 2BNNA 1H9PA 3NAPC 4LK7A 4QWNA 2FDJA 1MPXA 1AR71 2BRTA 2CWMA 2MNGA 2P3KA 2VZUA 3MIEA 5DDJ3 3Q8AA 4ZU5A 1YRZA 3UGGA 2OT7A 1YIFA 4Z92B 3CJIB 1CAWA 2ADDA 2Q5TA 1VBB1 4QPYA 4QXHA 3BGAA 2OQ6A 4IGOA 4JGYA 1FYUA 4AI0A 3MFAA 2GNDA 4C8DA 4OHZA 1UPSA 1Q8VA 1IG0A 1V6NA 1WLDA 3VBOA 1WMDA 1Z7S3 1XNDA 4DRVA 5A6QA 1COV3 4URAA 1J83A 3HBKA 2PYTA 4W8JA 2AACA 4XAEA 4CCDA 5A6XA 4GWIA 4J1WA 4TYSA 1MS8A 4P9XA 5HXVA 5A7OA 2CAVA 3VZLA 3NKGA 4PIXA 5C4WB 1L3JA 1W06A 1LOEA 2VOVA 4L0PA 1BMV2 2WO1A 3TRSB 2BU9A 1QEXA 2RG4A 1WD3A 3NW4A 4Y22B 5C9AB 2VNOA 4Z2WA 1YQ2A 5LEKA 4C1WA 2VCMA 4WZFA 3J8F3 3HT2A 3K3NA 2EIGA 5JZGB 1A3KA 3POWA 5FJKA 2WQ4A 4YVWC 3VDBA 3RZLA 2XBO1 1NCRC 4E2SA 1OVSA 5A80A 5K0UC 2ZPXA 3LEKA 5F3EA 4BDVB 3IB3A 1SDWA 2ET7A 3Q8FA 5ACA1 5JCTA 3VD9A 1DGRA 5DUXA 3OBAA 1NOVA 2VUJA 2JX9A 1OFSA 4AGGA 4W6WA 1SCSA 5JIUA 3AJYA 5J96B 4XF4A 5FPXA 1ZNPA 2YMZA 1PMIA 4OHVA 5FPVA 1YQ8A 2JG8C 3R05A 3RYRA 4QPGC 2WKKA 2VW1A 3CHXA 3CU7A 1OBNA 1FATA 1AYN2 3MBWA 4RS5C 4D7TA 5FKCA 4LIVA 1HXS2 1OA4A 1PO13 4FOWA 3ZFFB 2E31A 3HPNA 1HRV2 5FY9A 1X36A 1N1YA 1S0FA 4Q5OA 2MEV3 1OLMA 5FZDA 4ES9A 1RUG3 2W3JA 2PTMA 2P6CA 2Q1MA 3PVEA 5E6HA 5A7PA 1XE7A 1FI2A 2H6CA 3QCWA 5K0UB 4WM8C 5E16A 3NAPB 2GALA 4FQ4A 5JSPA 2XJUA 4N53A 2PHTA 2HWB3 4Q26A 1YYNA 1RUG2 2HKXA 1J1TA 5FMOS 3M3OA 5FUNA 4YFWA 2XBO3 5A7NA 3W5MA 4O61A 5A6YA 2J1SA 1H8VA 2G9GA 3J26N 4V2WA 2D6OX 4RS5B 2VMEA 3ZN6B 2O1QA 2WC2A 1RUE1 2TNFA 3LPGA 3K51A 3ZFEA 3OBRA 3WP5A 3C8XA 3WR0A 1J59A 4FTEA 2P3JA 4FPKA 3ZSKA 4XHXA 1ND2B 1ND3C 3ZM8A 5I0UA 1OURA 4CDUC 4DUWA 4P00B 4FPLA 2VOXA 4YGEA 3VD3A 2HEVF 1JOBA 1ENRA 3NWKA 5HI0A 5FZIA 4JTNA 1X50A 2RM23 3OPTA 4PDWB 5C4WA 4LO7A 4BHPA 4LHKA 4RGKA 4QB2A 4L99A 3V65A 3LOIA 4PT6A 2BUKA 3ZVXA 4AVBA 3UETA 1I5ZA 3PHMA 5FXZA 2VXJA 1UPIA 2DVAA 2XLGA 2J1VA 5A7WB 4FO9A 2DWRA 4YGDA 4CPBA 4ZU4A 1W8UA 2ATFA 4XJ8A 1G7YA 4IETA 1LOBA 2PLV3 1OC1A 2WINB 2Y6FA 1XSQA 4DFSA 4N7UA 2A1XA 3ZXEA 2RVAA 4TZDA 2GDFA 1ENSA 4NWVA 1S4CA 5FK7A 5EYYA 4GXLA 3SCGA 3KT4A 4L97A 1W05A 5T5JA 1R083 2EF6A 3DPRA 1VBA1 4NHMA 3WX5A 3DF0A 2VMIA 1NCQB 1JBCA 4EZHA 3FC0A 5IUQA 2XXZA 4NVPA 5DAWA 1ZA7A 4L92A 2GC3A 4JHZA 1JHJA 5E88A 3VBSC 3VBUB 2VY0A 1JYTA 1PVC2 1W2TA 2VU9A 1HB1A 2Z4FA 1WLWA 1S0EA 3O1OA 3D5OA 2DCKA 3N9QA 5FYMA 2CDPA 3B9IA 4LK6A 4YRDA 2LS6A 4CP0A 4FFIA 1WW7A 1UY0A 4GD4A 2X53S 3TEXA 1QJY1 2RS33 2HWC1 5FZ1A 1SBDA 5AVAA 1BQPA 3MW4A 1O8SA 1QJZA 2VOTA 3OGRA 5FMDA 3HJRA 4LTAA 2B4KA 1C57A 2D98A 3UGFA 4MV2A 5DN2A 3NQHA 4I09A 4QPGA 1ZBA1 1ND2A 4NPLA 3ZFGC 4JDNA 1I3HA 1CZTA 1VAKA 1GQHA 3ON7A 5APAA 3WVJA 5BNOB 4HONA 3ZFGA 2J1TA 2Y6LA 1HB3A 2UYBA 5A3PA 4K1YA 1HQWA 1QOSA 4FOQA 4NAMA 2WA4A 3TEYA 2FDIA 3GJAA 1LECA 1B09A 1OFNA 4XAAA 5CEHA 2ETEA 2HWC2 1CQ9A 1AX1A 2E9QA 4E2QA 3ZN4A 4Y4YA 3MPPG 4CCLA 1S2KA 1BXHA 1UY2A 1VBC2 4PLMA 4BQ3A 3HVDA 2W47A 3RZHA 3WF3A 2DVBA 3U37A 4Q8LA 1YJLA 2ES3A 1PX4A 4GALA 4AXOA 4LJHA 4QDRA 2DCYA 4AOCA 3AYEA 3VD4A 1XNTA 2CV6A 3I54A 3UK9A 3NO8A 3VL8A 3MLJA 2BERA 4FPGA 5FYSA 3DUIA 5F5CA 2V72A 5JVVA 4Q27A 4NIDA 1H6XA 2JIJA 3VBRB 4BLIA 5IYYA 5A3MA 3OYWA 1AVBA 4NOTA 4R52A 2WNVB 5FZ3A 2IVIB 3EMRA 1GV9A 4NRPA 3AZWA 2BWAA 2ZX1A 1RUE3 2RJKA 2D6KA 3W59A 1VBD2 1YIPA 2RS32 3N35A 3SH4A 1LOFA 1Y9GA 2B5HA 3MZHA 2W1UA 2HWF2 4WBBA 5FV3A 3ACIA 2E63A 4Y1YA 2PHXA 3C7FA 5LK7B 4CE8A 1PZ7A 4Q1RA 1V0AA 3H7JA 1APNA 3RVHA 2WZ8A 4K3UA 3VBHC 3VKMA 5LRSA 2EIBA 1AX0A 1JYXA 4LLFA 2CHHA 3WDXA 2A6ZA 4N43A 5FPZA 4XVHA 2W46A 4N43C 4IDZA 3O1UA 1ZRDA 4CEYA 2FBEA 2ZX4A 3ZSEA 5D8AA 4XDOA 4DXZA 3C3VA 3IDBB 4GQ7A 2JG9C 1HB4A 5DG2A 4W50A 2O8QA 2GN3A 4I02A 4RHV2 1ULDA 3WF1A 1AX2A 3AP4A 3A23A 4MG2A 1ND2C 1ND3B 3MDPA 4GMP3 4QM9A 5BPXA 1CR7A 4COUA 1WLTA 3TN91 5EPAA 5CIRA 1K42A 3ACGA 2B8MA 1QH7A 1H2LA 1TME2 3VBOB 2VVFA 2XLAA 2Y6KA 3P3PA 4R9BA 2WAOA 3K4DA 1NXD1 4S2GA 1BCXA 1GP6A 1QH6A 1W8HA 3AKQA 3H1YA 2TEPA 4K6BA 4OYUA 5GALA 3TB0A 4TTGA 3ILRA 2Q8CA 2ZMKA 2X09A 2WBKA 2UU8A 1VBD3 1GU3A 2WLPA 5FZCA 4LBMA 4WM8A 3U78A 3E5UA 1GNYA 4NIAA 2Q8DA 3OG2A 1EYBA 4CP1A 2VZTA 4K40A 4YM0A 4CCEA 1QJX2 3D4KA 1GZCA 2QUOA 2Q0AA 3B02A 2A75A 4MXWB 4YWAA 3THDA 1JZ2A 3PU8A 1J3RA 3H0OA 1EPWA 1COV1 2W08A 3V56A 1GUIA 1NUKA 1C8M3 3FFZA 5F3GA 4HZFA 4P9GA 4XIOA 1TG7A 1A6CA 1COV2 1KS4A 4AZZA 1PZ8A 1QNYA 3PNAA 1GICA 2GH8A 3LAGA 4GKYA 4JGYC 2P6HA 4XZUG 4CDWC 5A70A 4XBQA 1W0OA 5FPUA 1WCKA 2E53A 1GZWA 5JZGA 3E6CC 3IMNA 1QOTA 3UNPA 4C90A 4DUXA 3WCRA 3G6JB 1R64A 2H6BA 3KV9A 1ONAA 1S0DA 1DG6A 4S2FA 5A33B 2FDGA 2B7YA 4OUSA 5AC91 4WVMA 2XL7A 3A22A 3USSA 1Y4WA 4YZ5A 4AEKA 2QNKA 3U0ZA 2FZ2A 2FCTA 2GN7A 2O14A 4JCKA 4AI2A 4A6OA 3A4UA 1H8TC 4KU7A 4HKLA 4XUQA 5FYZA 5JI7A 3ROUA 1LEDA 1AYN3 2BWCA 3MW2A 4BMBA 1VE0A 4HOOA 3M3CA 1UIJA 2YGMA 3H7YA 1UU5A 4JGYB 2RS53 1IPKA 3BODA 3URFA 5LASA 2UY9A 4E8CA 4Q4V3 5LA9A 5FAXA 1ALYA 3OY8A 3ZFEB 3ZKYA 2J1AA 3MUZ1 2QQMA 4AVVA 1Z78A 2BV4A 3U07A 1AR72 1Q56A 2OQ7A 5D21A 5HV0A 1BYHA 5DAXA 1SFPA 4CYDA 2PQQA 5F3IA 5T55A 3K3OA 4CA9A 1PMJX 1PK6C 2JENA 4CUAA 1E5HA 5F2SA 2H0VA 4M3CE 2A6VA 4SBVA 2D44A 5FYTA 1YWKA 2XVLA 1CX1A 3DYPA 1CAWB 4P9YA 5CVRA 5H9RA 2GNTA 2XKPA 4PHZA 3DGTA 3GCXA 2GZWA 3HBZA 4Q8KA 1MR5A 3ST7A 2CGOA 2R6QA 1ZRRA 4R4XA 4E4HA 1AJKA 1UL9A 3IDCB 1W6NB 2QQLA 3OSDA 2WIIB 4I2OA 1ASJ3 4QX2A 3PUIA 5FZ4A 4E4DX 4LR4A 3J7NA 5BNNB 1LHUA 1NZCA 3WV6A 2VQAA 1H4HA 3B5LB 5FPAA 3AC0A 3WNNA 3ZYHA 2QZ2A 3KZ4C 3MW3A 4MGKE 4AQTA 5JLVA 1D2SA 2A6YA 1F31A 1YC61 4LUMA 4QX1A 4W6XA 2B42B 1H6YA 1UX6A 4LBOA 1GQGA 2RS13 2YBPA 3AXEA 1AR83 4QPIA 2WZPP 2VVDA 1SLBA 4YW7A 3CL1A 2YFUA 2UY8A 4XIKA 3FN9A 5F8PA 2JKXA 4GH4A 3I2FA 1S2EA 2R042 4IEQA 3OUHA 4M3CA 3GZUC 5DAQA 4AL9A 4XF0A 1ZZ9A 3AVSA 4FAGA 4DRRA 2X10A 4XFFA 1SLIA 3NJXA 2VZSA 2ZGLA 3H8UA 4O9EA 4MO3M 1H2MA 2DDUA 5LBEA 5CFDA 4BA6A 4FP2A 2ARCA 3J9SA 5T50A 3U75A 1RUH1 4GB31 1HN0A 3GHMA 3OJBA 3T2PA 1BBT1 2E7TA 4IE0A 4AYUA 4CCMA 5IK5A 3BPZA 1TME3 3B3QE 2NM1A 5A32B 2XBO2 1W8NA 4RGAA 1MZEA 2ZEXA 3I7DA 4OUEA 4EN7B 1ZVFA 3ELNA 3PUHA 3SH3A 5FK8A 2YC4A 1ENXA 2B46X 4R8HA 4BMEA 4DOUA 4AVTA 3ZSMA 4IEPA 5DAPA 1IHMA 5CB7A 2PHDA 4EWDA 3VZJA 5JZGC 4KL1A 3AL6A 5AVPA 3N7MA 5FYUA 1NAEA 1KS5A 2C9KA 5FLHA 4Q0SA 3GM8A 2WNUC 3UGHA 5IATA 1Y43B 4KBBA 2IC1A 3IPVB 4FVVA 1HRI2 4C0HA 5B2GB 5HBAA 4NPMA 1DYOA 1HV0A 1N1VA 1H9WA 4RL7A 4FPJA 1HRI1 3WHTA 3BTZA 4IQPA 2K2SA 2WABA 3BN6A 5IK8A 4CDXC 4MGSA 5AC92 4XPVA 1NE4A 4FI9A 1O5LA 3ABZA 4XACA 1JUHA 1CAUA 4JQTA 4I01A 1ASJ1 2VBBA 2D3PA 3EB7A 3AMNA 1A8MA 4ZXEA 4BCUA 2KR2A 2XJRA 3LIHA 4OMCA 4UFLA 4XILA 3EBRA 2YC0A 4CUGA 4B1LA 4XFBA 1KXGA 1RMU1 4XETA 4CP9B 5GM0A 1PK6B 1UU6A 2EXHA 3ATGA 3ES1A 4QPIB 3UESA 3PVNA 4LKFA 5IFPA 3JB4C 1UNBA 1JS9A 4JKKA 2RMU1 5FUIA 2OXBA 2WN3A 3RQ0A 1R082 4BQ5A 4UFJA 2IXJA 5FBJA 3QOPA 2VTFA 2Z2SB 4TSVA 2DBIA 2VJXA 1US2A 5JAXA 2D6MA 4A6SA 3I49A 4HL0A 4OUMA 2OUJA 2WWSA 4A7YA 2VZ3A 2YDEA 2ZCWA 1NLSA 4SLIA 1OPMA 2GC2A 1SMVA 2VULA 4HT1T 1SPPA 1Z0HA 5FY5A 4YW4A 5CKQA 2R0FA 3ACFA 3M4FA 1CAXB 3W21A 3SNMA 3HEIA 1XYPA 2XVGA 5L9BA 3SEPA 3AVRA 1WW5A 1QJFA 2PAEA 3AP5A 4YM2A 3L9JT 2CY6A 4URTA 1DQ6A 1CWPA 2DURA 3H8XA 3ZYPA 5C71A 4KGGA 4CCCA 3ZFFA 2W39A 4YVWA 4CEWA 1POQA 1OQEA 5FQ0B 5J36A 4XDQA 2Y6HA 3USUB 4BH9A 4Q0PA 2V09A 2B9UA 4HSJA 1YQ6A 4OQ8A 1A8DA 3UKNA 3I2KA 4W6YA 4XJUA 2R072 5K9YA 1W8OA 3VKLA 4QM8A 4CCKA 1D4M1 4LBNA 1CAVA 2VCBA 2HEWF 2PXJA 4IEUA 4C91A 1CZSA 3LIGA 3WNPA 3H3UA 2JICA 4LKSA 5C33A 5C3SA 5L7OA 3FHAA 4QDQA 1MS3A 3HWJA 3N9PA 4AHYA 4HVQA 4RR3A 3OPZA 5J7MA 2PMWB 3FHIB 2D97A 5DUVA 5FCCA 1Y9MA 3ZXKA 1QJU1 4HETA 4KWJA 2JDUA 2XJPA 1JUIA 1Y9QA 4CEWC 1AR92 3WUDA 3OBZA 4IEZA 5BNOA 1GFF2 4OMDA 1NY71 3ZPOA 5T52A 1WMEA 2Z69A 1ULGA 5E8AA 4V2VA 2ARXA 2CU5A 1XC6A 5KBFA 3TNQA 4Y4RA 2G9FA 1QHDA 2ORXA 2P3YA 4AQ6A 5C8CC 1DYKA 1XU1A 3JXSA 3T2QA 1RHI3 2AYHA 4L2NA 1W2UA 4IEOA 1GP5A 4B7KA 2IXIA 3I97A 2BPA2 3HQUA 4P5YA 3OGGA 3RPQA 1FNYA 1TMF1 4OVEA 3MYXA 1SFNA 1K5JA 1PHMA 1GZ9A 4QAWA 1NXMA 4OZOA 5EJZB 1LHVA 1RUC3 2KA3A 4KH9A 4Q4V1 3I8TA 5GZCA 2YZ4A 1TQ5A 1QXJA 1XU2A 3LA2A 2IWGB 4ZHNA 1LHWA 1BMV1 2OYZA 2ZJCA 3BALA 4Q0UA 5HCHA 2NP0A 1PM7A 2W52A 5KXEA 5FUPA 3O0XA 1MZFA 1SPPB 5IVYA 3VHNA 2RM22 2KM2A 3OOXA 1WCQA 4N8MA 1C4RA 4CCNA 4K9SA 2RMU2 5LA2A 3H8RA 2A71A 2XQXA 3LF7A 4JQRA 4PJYA 5AC93 4XF9A 1G9DA 4IE4A 1OKOA 5I93A 4C0BA 4EJRA 3RMYA 2KXLA 1WMFA 4KBZA 3JD72 1MS1A 2GSYA 4BM8A 5FZGA 4LMFA 3TWIA 4PIYA 1SZBA 2DVDA 3LQCA 5FPBA 4CDWA 1QDOA 1G9FA 1QDCA 2W0XA 5FY0A 3SKJE 2E7AA 1V9U2 5DUWA 2HYKA 1Q3EA 2J1RA 2YHJA 2O0OA 4WVWA 4XYXA 3NJVA 3E6BA 1T6GC 2A3YA 5D8AB 3ZXLA 4WM7C 5FIXA 1UOJA 3S5AA 1UXZA 1V6IA 3DEMA 4MOAA 3ZLIA 2XJSA 1H2NA 3H1MA 2RR12 2VZ1A 4LITA 4YYOA 3WQ0A 5JWPA 1W8WA 3S7IA 3PUAA 4YLZA 2WLQA 3KM5A 1OI6A 2JIGA 2WYSA 2HWD3 1S1AA 1W6QB 2D5HA 5T5OA 3POIA 2UURA 5AFEA 4Q4W2 5B4XA 3LWCA 3MF6A 2AREA 1MZ6A 1MZ5A 2HBUA 1LGNA 4AEJA 5KHIA 2FQPA 4DINB 2Y26A 1W04A 3R6SA 1PGL1 3L2HA 1VMJA 3GBGA 3CLPA 4ZKTB 4CU6A 4CZSA 1RXFA 2W68A 1WGPA 3RWKX 1TMF2 1W9SA 4XTMA 1OH3A 4DEQA 5C8CA 4HN1A 2B39A 2VUCA 2C4XA 2R7EB 4RGGA 2VNVA 2WNVC 1W9YA 1GP4A 2R30A 1VP6A 4XQWA 4RD7A 3GJBA 1WLCA 4PDWC 4XJAA 2VMCA 4LO4B 2YC2A 2XVKA 3WG1A 1RB8G 1PGW1 4D6SA 1O4TA 5BNPA 1UOGA 1W8FA 1URXA 4JDOA 1AR91 3FFQA 1HJGA 1OLQA 4PF1A 3ZSJA 3INAA 2R1BA 1R1ZA 1FNZA 2WZR2 3PUSA 3NJYA 2DYCA 5F6KA 4AWDA 1RUD3 4LQRA 1XPWA 2RS11 1OQDA 2FDHA 1MVEA 3P1IA 1BEV1 3I2JA 1I6XA 1K45A 2N7GA 3AFKA 5EYXA 3GYDA 4UFMA 4RQPA 5FMCA 1I5PA 3GBFA 1PO23 5FZ0A 5A7QA 2WT1A 2UYAA 5JDBA 3D6EA 4OI4A 3CJIC 1NCQC 4EN9B 2VZRA 2QVSB 1QJX3 3MIGA 2AGSA 1EY2A 4XJZA 3CMGA 3M3QA 3ZFGB 4OCTA 4FAHA 3JQWA 4QT6A 2ET1A 1ZBE3 3NNFA 2VW0A 4P9LA 1S55A 5FLJA 5T54A 4EYUA 5FYVA 1ZA4A 2ZGKA 3BIWE 4HG6B 4I3GA 4PCRA 4H14A 1XE8A 3UJQA 5FREA 1G9CA 5C4WC 4JRAA 1KD7A 3ME2A 4Z82A 4CEYB 1VBE2 5GZGA 5E1RA 4ES8A 4I0BA 2F6BA 5JXJA 2GMPA 3ENRA 1C1LA 5I0DA 3FBYA 1W3XA 3ACHA 2LROA 4N9IA 1KFXL 2ZHKA 3CF6E 2VE1A 2VCAA 1AHSA 1LEMA 2Y0OA 5HCFA 2O8OA 2GP3A 2DF7A 2NZ9A 3ZN6A 1QQP2 3AMMA 3K2OA 4BIOA 1OLRA 2CDOA 4CSWA 1QXRA 5JOYA 1RIRA 4DB5A 1W99A 4ARXA 1BK1A 3OY8B 3LFMA 3HD8B 3LSDA 5FYCA 2FMDA 2RS51 5D8AC 1CJPA 4K7JA 3J7LA 3LA3A 4AVAA 4DXRA 1T2XA 2DU0A 3WCSA 1ZREA 1GOFA 4UFIA 5M0TA 2RM21 1XE0A 3E1F1 3Q8EA 1K12A 5FYYA 3WNKA 1QQP1 1VBC3 3G7DA 2ZGTA 4RSUA 3DECA 3O1PA 1QJX1 1U0AA 1LGBA 3QH7A 1W90A 1UX7A 1IQAA 3SEEA 4AGVA 1W2AX 5JXGA 2HWF3 1HX6A 2Q4SA 2NN8A 2VCCA 1DDLA 1HN1A 4W4ZA 4DXTA 3EHKA 1OUXA 2D3SA 5LA0A 5FWEA 1E5SA 1VR3A 3MF9A 4ZU7A 2FD8A 1DLCA 1UW8A 4M3CB 1O3QA 4Y20B 1VPHA 3AM2A 1UY1A 2WRAA 2X29A 1XRUA 1LRHA 2EXJA 2ZOEB 3GHNA 2XONA 1TME1 3DXUA 4XXAA 5CZKA 5IK4A 5J48A 3FE5A 1ZZ8A 5A7WA 5CYYA 1OF3A 1UY4A 1VB4A 2J42A 1YLLA 2IXCA 5C8WA 3WG2A 5IJRA 3M1HA 5D2AA 1GMMA 2WO3A 3LZZA 4A41A 1OOPC 1HIXA 4UW4A 2AEYA 1I1EA 1EAH1 4XJWA 5DZGA 3ZFEC 5FZLA 3ASIA 1H4GA 4Y5SA 3H50A 4Q2FA 2SBAA 4G4FA 1X8EA 1G9AA 5A6ZA 4PF5A 1E5RA 4GH4C 4YFZA 4CCOA 3QACA 3M8LA 4FXKB 5F5QA 4AVSA 1YQ5A 4MH0E 4B8EA 3CNAA 1RUNA 5H9SA 3T08A 3SCHA 1RUH2 4GB32 2ZEZA 1W9FA 4TLGA 1K5MB 4P02B 4A44A 1OA3A 4NIGA 3IKWA 4YVWB 1AJOA 1O6UA 4I3PA 2WNUB 5BUVA 1OSGA 3AYDA 1VBE1 4LO8A 3SH5A 1F5JA 4KNCA 4EN6B 2WYFA 3WW2A 5ACA3 5GLZA 3GZEA 2PHLA 3MPBA 2X05A 2QJVA 3H3LA 4IESA 5FP9A 3VL9A 1WMXA 1QKQA 3U10A 5F9TA 1JYCA 1D2QA 4P08A 2WS93 3N9MA 4QKFA 3B93A 3ZYGA 1CVNA 2IFRA 2IFWA 2XUMA 3GNEA 4BK5A 3FWEA 2FCVA 4M01A 3P6BA 3IIAA 2GH2A 1PVXA 1VAVA 4BIFA 1RUJ2 1V70A 4MSVA 3NNLA 4YW5A 2ZZQA 4CUCA 2Q30A 3Q8CA 2G1MA 2J1EA 3UJOA 4B3NA 1RYYA 2WS91 3VLBB 1PIV3 2Y38A 5GZDA 4CP9A 3V0BB 5I8TA 5C5TA 5C3PA 2PFWA 3KQRA 3NV4A 5A3LA 1A78A 4EROA 2LALA 2HYXA 2DFBA 1Q8SA 3WNLA 4EE2A 5LK5A 4KQ7A 2XOMA 2K9ZA 3VB9A 1PGSA 3B00A 3GF6A 1AL21 1NE6A 2XJTA 1PK6A 1HXS1 5LBCA 1PNGA 4Y5Z0 1IS4A 3T3YA 1TE1B 3ZYJB 3WDVA 4ASMB 1M4WA 2P5BA 1FPN3 5CKMA 3VUOA 1CGPA 1N47A
chains in the Genus database with same CATH topology
3IWZA 1PGW2 4Q1PA 3FX3A 1PO22 1S0IA 1RUF1 1WCSA 5JPMB 1GZWB 4XMIA 4R9AA 2GNMA 1V6MA 1YCIA 4Q4W3 5C9AA 3U11A 3AX4A 4U2AA 2HWD2 3USUA 3RYKA 2WZR3 3RDIA 1ASJ2 2ZGUA 4AEMA 5I8YA 2FHRA 3JD71 1GSLA 5LK5A 2AR6A 1HLCA 4Y24A 3T2TA 4FBFA 2VMGA 4PIZA 4AQ2A 1ZRFA 3FMGA 4WVZA 3E6DA 2WFF1 4C1XA 5FQ0A 1JH5A 4HLTA 2ZX0A 5EZWA 4XF1A 5HCBA 5FO8B 3DN7A 1QQP3 1VBC1 2V5YA 5KHHA 1G8WA 4FOYA 1J3PA 1YFXA 2WNUA 2WA3A 4OFGA 4B4RA 1AR63 1XQNA 3ZXGA 2WFPA 1NA1B 4GWMA 4CDXB 1HW5A 3ZIXA 1POV0 4HVOA 3AKSA 4OI1A 3O14A 2D93A 1R1A2 2XB6C 2XHKA 3VBFC 1V6LA 1W6PB 2ZS6B 5FTTC 3WY6A 1VB2A 2B45X 3TBDA 3AMHA 3J8F2 5FLIA 3VBUC 2ZMNA 1MEC3 1LJ7A 2VOWA 1S0GA 1YUDA 3V64A 2TUNA 1WBFA 3VDDC 1BJQA 1BZWA 1CAVB 2CNAA 2OIIA 4AHWA 1AR82 3FLTA 3WNXA 4NHKA 3H3ZA 1XNKA 2EXIA 4NR1A 5EJ3A 5SV5A 1CJDA 3BCWA 4OI2A 1REDA 5JOXA 1W0PA 2HJIA 2I07B 4O9GA 5K7PA 5L7OC 1QF3A 1C28A 3UKVA 4X6QB 4I0WB 3SXWA 3A0KA 2JE7A 3VKNA 5T3NA 4DNYA 2D40A 2WS92 1JN2P 4BOWA 3AP7A 4G9SB 3RSJA 3V0AA 1YFYA 2HWE1 1KDMA 1RUJ1 3VBUA 3IT8A 3PVOA 4DY3A 3HR9A 4IEWA 3BTAA 2ZGRA 3KD4A 1NY72 1YI7A 1RTVA 1O4YA 3TYJA 5GLTA 2CGNA 3FJSA 3MIFA 1Q8PA 1QNWA 4CTEA 5CBLA 1V6KA 2P3IA 1SLAA 1K5MC 2X5IC 1POV3 5IK7A 1RUD1 1PIV1 2HWB1 2I2SA 3T1LA 1VALA 3JBG3 3MIBA 1U5ZA 1VRH3 3VKOA 4AE2A 5CFCA 4WVMB 1D4M2 3TOJA 1REFA 2HWB2 3SHRA 1YO8A 4JGZB 2DFCA 1LTEA 4GWNA 2EA7A 5H9QA 2R1DA 3KGZA 5BXXA 1OPOA 4LBQD 4XHBA 4HFSA 4ITCA 5ABJC 1AR61 3FLPA 3KMHA 4AI1A 2D7FA 4DY5A 4GMP1 2ENRA 5ACA2 2Q8OA 1LKNA 2BW8A 1NCRA 4Q4Y3 2CL2A 1B35C 4K1ZA 1W6MB 4L9BA 3LOBA 2R0HA 3I59A 1SCRA 1F9KA 2JG8B 4QPGB 4LA3A 3A0NA 4LNVA 4XFGA 4B4QA 1YFWA 1SBFA 1EAH3 5FO9B 4QMAA 2VECA 1R092 4K8FA 3KSCA 2DV9A 3GALA 4Q4W1 1OOPB 2ZABA 4FPYA 1H8TB 2BGCA 3NJZA 1RUI3 2JJ6A 2BVVA 3AMQA 3AZZA 4H55A 4Q0QA 2NQYA 2YROA 1UD1A 4LLOA 3VBRA 2CGPA 3B69A 1Z7S1 1UU4A 5BYNA 1WW4A 3AB0A 4G3YC 3RYPA 5I0TA 1ZZBA 4QQ2A 4FCAA 5FMOL 2ZAHA 1RGSA 2ZX3A 1AXZA 1CESA 1ZBA2 4F83A 2EAAA 3MIDA 4GMP0 1BBT2 1JTZX 1LOGA 4E4ZA 1QXPA 1C5HA 1YXWA 5DDJ2 1ULFA 1GYKA 1ZZ6A 1SLLA 3UV9A 2OVUA 5EWSA 1W39A 1ZRCA 1D0GA 3M3IA 3WOGA 4XOGA 4JGZA 2FZ1A 1O7FA 1R091 1HRV3 2K0GA 2WFF2 1V9U3 4JGZC 4P9WA 1CD3G 1N3QA 3QH6A 4Q4V2 2A3XA 1JXNA 3LCPA 5DZFA 3RJRA 3O0VA 1SEFA 2QZ3A 4DQAA 2C0ZA 1CIWA 5CG8A 4HKOA 1XNCA 3VHOA 2RJLA 5K0UA 3WP3A 1RUF2 3WQ7A 2VXRA 4MXWA 3KB5A 4D7YA 3AJZA 1QJU3 3JCIA 1OMIA 2R063 4D3WA 3V0AB 4JVAA 2Y0IA 4OHYA 2GMMA 1LOFC 3ECQA 1C3HA 4WM8B 1C5IA 3PLQA 1AL22 2EALA 4BE3A 1QJY3 1W6OA 3VV1A 3NSTA 1V6JA 1FV3A 1EV12 3ILFA 3OYWB 2D3RA 3FZ3A 4XJ9A 1UAIA 4MVTA 3OD0A 4UW5A 1PO12 3D8CA 5KC5A 1RJ8A 4Z07A 4ZXKA 1MS5A 1MS4A 2QDNA 3N3HA 4RFT0 4L11A 2ZKNA 5FBZA 3EO6A 1YI9A 2R071 3KT1A 2WQZC 1NQDA 3W58A 1FPN2 4NPRA 2JXAA 1XXNA 1QGLA 1ULCA 2DCTA 1RVF3 2ZACA 2JG9B 4S2HA 3UL2A 3VZOA 1RUG1 4Q0VA 2HWE2 4N90A 2H0BA 1C8M1 4J6GA 2RR11 1RUF3 4I30A 1PO11 3X29B 3L2YA 4CDWB 4AK3A 3FBMA 3VBOC 1LB2A 1DQ0A 1CX4A 2EXKA 1V9U1 1IKQA 1JHNA 4YSFA 2IXKA 2RMU3 4LBLA 1O91A 1DHKB 4AFCA 1QY4A 2V73A 4YZ2A 4J1XA 1U5YA 1AR81 1ZBE1 4IERA 3NAPA 1FT9A 2I74A 1RVF2 4AEDA 3J4UH 2WT0A 1S2BA 1BVP1 1LESA 5GJ6A 2ZGMA 1CPMA 1HQLA 2XLFA 2A73B 1RINA 2X5IA 5F1RA 2DUPA 4ISQA 1J3QA 2VH9A 1D4VB 4WM7A 3ZX7A 1DIWA 3HAGA 1PVC1 1Y7BA 1S0CA 4IV3B 3MLLA 1VRH1 1WBLA 2BQPA 1Q8QA 1UKGA 1LULA 2WT2A 4IXLA 1N3PA 3RWNA 5LRRA 4HPKA 5D1IA 4F3JA 3MGUA 5GLVA 1AL0G 3W9AA 2D5FA 4YW3A 2DTWA 4QU2A 5EV7A 3VGIA 1UMZA 1UZZA 1IZ3A 3RI8A 1O3TA 2XL9A 2IZWA 4HBNA 1QOOA 4HANA 4EWAA 2HWE3 4OULA 5T5LA 2R062 4M3CF 1I9RA 3ZXAC 4A7KA 1LENA 2Z5WA 2JG9A 3WDTA 3WW3A 3AP6A 3M2MA 2VG9A 4NO4A 4XFCA 4B4PA 1F2NA 1TMF3 2OZJA 4PDWA 1NA1A 1MVQA 3VBHB 1HKDA 4QQLA 1AUYA 1D0HA 3R4DB 4A2UA 3E5XA 3I2DA 3E97A 1C8M2 2DVFA 2BNOA 1RHI1 3ILNA 1KJRA 4Q4X2 2QCSB 3NKTA 2X8KA 3HN1A 4U36A 2VMHA 5KC6A 4XXPA 3VDDB 1IPJA 2Z42A 4QHBA 5C9AC 2BFUL 4EN0A 5I8SA 4DS0A 5FFOC 4YNIA 4D7SA 3R4SA 1GBGA 2A70A 4E4SA 1ZM1A 1W6MA 2P2KA 2R16A 5T5PA 2XGXA 2UWCA 1RC6A 1AYM3 4XFAA 2ZGNA 5BY5A 3AYAA 4AGRA 3RMXA 4Z1VA 2DCJA 4COZA 3IN9A 4AF9A 1NYWA 1YHFA 2HWF1 3ZO0B 4RHV3 1N3OA 3AZVA 1IGOA 4X8PA 1VBD1 1VJ2A 4Y20A 4INDA 2BVBA 4XBLA 2BYVE 2XJQA 5JOZA 5FO7B 3P3NA 3VBRC 5J3UA 1W6PA 1PZ9A 3NV3A 4X8NA 5ABJA 4AI8A 1OD5A 4XFHA 4GA9A 4HPKB 5J37A 4H7MA 3B7MA 4FOVA 2DVGA 4JV4A 4Y22A 1RUC1 4YZ4A 4COWA 5FOJB 3S7EA 4EN8B 4XBNA 4ATEA 4E9KA 5FOBB 1DGWX 1LR5A 2VOKA 3KGLA 4Y1VA 2BBVA 1LU2A 1U5XA 4XTPA 3JZVA 4CEWB 1KDKA 1H1AA 4LBJA 3DL3A 1K5MA 3NV1A 3AXDA 5A32A 1IS3A 1MEC2 2YXSA 2PHRA 1E57A 3ZN5A 5EFUA 3K48A 4JRLA 3O5SA 2OUHA 4LBKA 2A3WA 5BNOC 1RMU3 4IEVA 1FOD2 1R093 5L73A 3PJQA 4FPOB 4MLOA 4YW1A 1U12A 3ZYIB 3OTFA 1AF9A 2LM3A 4JDMA 4GKXA 3GZTB 1Q43A 3BU7A 4HK8A 3VKFC 4AHXA 3CJXA 3TAYA 5KWRA 4EV0A 2A7AA 2YPJA 4AFMA 3ALQA 1VBE3 5GZFA 5J09A 1NCRB 1BEV3 3B94A 1MACA 2QE3A 1TNRA 4R9DA 4WVVA 4QX5A 4FTSA 2JEMA 4FPCA 3NL1A 2R041 3OGJA 2A6WA 4KGQA 1GR3A 3AKRA 4XZPA 5SV8A 4GULA 4CDQC 1J1LA 3O7OA 4B7EA 1H0BA 5CFCB 4CDQA 4RS5A 1R1A1 4MUVA 3JD73 4QQOA 5BNNC 1UKRA 1VRH2 2ERFA 1C1FA 4ATFA 1H2KA 1DQ5A 1ZZ7A 2BTVC 1H30A 1R1A3 1LU1A 4CEYC 1UN1A 1RUE2 5GKAC 3DV8A 1OA2A 1AL23 1DQ2A 4XF3A 5DUUA 1FPN1 1WW6A 1LHNA 4BQ1A 1RUC2 4DZGA 1FMD1 3WDWA 3VDDA 1QJU2 4LA2A 4META 3ES4A 4JTOA 4M00A 4LT5A 3M70A 4YG0A 3H9AA 4FQZA 1DQ4A 3LGRA 4H7LA 4MXVA 2GC1A 2CTVA 2PN5A 4H3WA 4KWLA 1J58A 5KHGA 5JMCA 2NLRA 1RITA 1EP0A 1FMD2 2AUYA 2AENA 1DF0A 1TNFA 2NPIA 3VHRA 5C6CA 3NV2A 2MEV2 2E6VA 4D69A 3Q9OA 2AZ5A 2XPJA 4P14A 3C2UA 1FMD3 1WUVA 4KG0A 1BBT3 4RA0A 4LO5B 1G86A 4F7ZA 4AQSA 1PGL2 1G6NA 1AR73 2OW4A 3OCPA 2VUAA 1MQTB 3RS6A 1GLHA 1O5UA 3R0RA 5CA6A 4IV3C 5L7OB 2TBVA 2PAMA 1LOCA 4MZUA 2BNMA 4KU8A 3RI9A 4CRQA 4YGBA 5CADA 3EXUA 4V1PA 2ZX2A 1GNHA 3VZKA 1SFYA 4LBQB 1VBB2 2UWAA 5LEJA 1X82A 1FXZA 2R49A 1W6OB 3POYA 1SBEA 3ZDSA 1F5FA 3LA7A 2GU9A 2VNGA 4PBOA 3ETQA 2D6LX 1VAMA 1RJ7A 2P17A 2XWBB 4XMAA 5I0RA 1RL3A 2EVXA 1WA4A 3PMEA 2R061 5C8CB 2JD4A 2YUEA 4FSJA 4OI0A 1NG0A 2ZBJA 3FLRA 3N7LA 4X6RB 4YVSC 5J98B 1IKPA 3KT7A 4FPFA 2E51A 4W65A 1AYM1 3BOWA 3FUOA 5JSRA 5CFDC 1DBNA 3WUCA 1WCDJ 2R32A 1VBB3 1CN1A 3VBFA 1C8NA 5GZEA 1X33A 3LSEA 1AXYA 5ABJB 4M0HA 4N7IA 1HV1A 4XQDA 4LHNA 3VHPA 4OZXA 3RRDA 3AK0A 1UZYA 3THPA 3CO2A 4Q4Y1 1FOD3 2FMYA 2JE9A 3WG4A 1DGRN 4LHLA 1DLLA 2PHUA 1KFUL 2PA7A 2MHFA 1CAXA 2RS52 2YGLA 2ZGPA 4IV1B 4PLNA 5HCAA 4UBHA 1ZBE2 1S0JA 3N36A 2IXLA 1TEIA 3HQXA 3GBWA 3VBSB 4MYEA 3T1MA 3M7AA 4BYYA 2QFEA 2ZHMA 4IV3A 2PAKA 3SLIA 3N4MA 5I91A 1O3SA 2ZA9A 4ORFA 5DG1A 2VQ0A 4YW2A 4WM7B 4TLFA 2DU1A 4RQPC 3KCXA 1UIKA 1NLRA 2RE9A 4QQPA 1LGCA 4KG8A 3WDYA 5BNQA 3WT3A 1RUD2 4AEDB 1ULEA 3TNPB 2CWSA 2JECA 4YM3A 2OZ6A 4K21A 1V00A 3WXPA 3RJ2X 2IXHA 4P5HA 2MEV1 4OHXA 4QD2A 5L36A 4N9HA 3APBA 3ZXDA 1DFQA 5E89A 1DQ1A 4YG6A 3ZPYA 1O3RA 4BPZA 3AFGA 2D6PA 1B35A 3D0JA 1YFUA 2P37A 3AZXA 3MEPA 3PMSA 5DXDA 1FV2A 4RQPB 1PVC3 2YY1A 5TSWA 2I45A 5KHKA 3O0WA 2XJVA 4UBGA 4AHZA 3KCCA 3PVBB 1DYPA 4JAAA 1LHOA 2LTNA 2DTYA 1LCLA 4HVRA 4AG4A 3BOPA 3VBFB 3IM0A 1U5IA 2NMNA 1PIV2 4WZCA 1EAH2 3D82A 4BZ4A 4ASLA 2VVEA 2AH2A 2G4IA 2VPVA 3HMYA 2WL1A 1CONA 1QJY2 2D43A 3E5QA 2XWJB 4I0AA 4N53C 2Q1ZB 4PQ9A 5JSOA 1NA1C 3J8F1 1GANA 2GNBA 2WNVA 2E7QA 4FT8A 3RG0A 3PJYA 3VBSA 3MIHA 3QD6A 4E2GA 4XFIA 1OQ1A 4LBQA 4CDUA 5CNAA 2ARBA 2YYOA 2XG3A 3ZXFA 4IEYA 4XEZA 3AP9A 2OA2A 1SLTA 1HXS3 1DZQA 1G9BA 5IT6A 2BFUS 5I0SA 1AZDA 1D4M3 4AW7A 4IV1A 3I4IA 1AYM2 4YARA 1EPZA 2LUWA 3JBG2 3WD5A 5DDJ1 1VLNA 3I59B 2DCZA 2VNRA 5JIAA 4K20A 4MGYE 5CAZA 4LULA 3WW4A 3IBMA 1ND3A 4QQHA 1HQNA 3WHUA 4ISRA 2C5DA 3WDUA 3ZFFC 4HSLA 4YVSB 2C1FA 3WZ1A 2ZAAA 1FOD1 3DPRC 4IEXA 1DGLA 1KITA 4HN0A 4FTBA 3MFCA 1Z7S2 1KRIA 2WSUA 4COVA 1MEC1 1EV13 1SACA 1Q5OA 4JC1A 1N1SA 4B29A 3M3EA 2PLV1 2RR13 3JU9A 1LODA 2A5ZA 4QXKA 3SCFA 1Y3TA 3AKPA 3WP6A 2SLIA 3WINE 5KXCA 1DU3D 3U4XA 4ONUA 3WG3A 4M0NA 4FPEA 3OF1A 4R4ZA 3AMPA 3AYCA 1UF2C 2XKOA 4Y1UA 1FAYA 3EJKA 2YV8A 5JI9A 2JKBA 4MGIE 4PBPA 3CEWA 2R073 2ZGQA 1IS5A 3PTYA 4UXAA 3D0SA 1KJLA 2RHPA 1PO21 2NYYA 5FDBA 3POSA 1IS6A 3WP4A 1BVVA 2QKDA 2WFF3 3LKJA 1W6QA 3KLSA 4PLOA 1RHI2 5KXBA 1DZTA 5JPNB 3OD4A 2RS31 1JYIA 1F8VA 2GC0A 4CDQB 4FPHA 3BB6A 3R4UA 5CFCC 1WD4A 3V0BA 2ZGSA 1AR93 3AZYA 4LE3A 4OHWA 4MX3A 4HK9A 1IOAA 3JUUA 2EAKA 2ILMA 1LOAA 4AFAA 2ZZJA 3JB8A 4YGCA 3ZSLA 1M06G 3JQXA 5KXDA 4Y26A 4CP2A 3MICA 3NVCA 5F6LB 1X7NA 1CAUB 1RUH3 4GB33 3IDEA 1NQJA 3CJIA 3VZNA 2GMEA 3SMHA 5BNPC 5BNPB 2CAUA 3UKTA 2PLV2 4YZ3A 2JDZA 3FUQA 2VW2A 1AXKA 2ZHNA 3B01A 2QQPA 4Z8BA 2UWBA 4GIQA 4Q4X1 4HKWA 4LO6B 1N1TA 5BNNA 1ZX5A 5KHJA 2Z79A 4EWEA 5EXOA 4XW3A 4NN0A 5L19A 2DUOA 4AFDA 1RUI2 3OBTA 2VGDA 4IL7A 4QGNA 4UW3A 1S0BA 1UCXA 4WV8A 4A7ZA 2F4PA 5CFDB 4DMIA 3VBHA 4N53B 1SQ4A 3LB9A 1CPNA 3WLUA 4A3XA 4CDUB 3SITA 1NCQA 3N7JA 4P9IA 1ZYBA 2HEYF 4GH4B 3S0MA 4F8AA 3QLQA 5GLWA 1HRI3 1JW6A 3VN4A 2GAUA 3JBG1 4OLLA 3ZMOA 3ZXJA 1V6OA 1MQTA 1B35B 2P34A 4Y1XA 1OKQA 3VZMA 1MS0A 1XYOA 5JR7B 4KWKA 5JOWA 5CU1A 3THTA 4AI3A 1H1MA 2CYFA 4Q4X3 4HMZA 1RUI1 4N43B 1VBA2 3KS7A 3GZAA 2ZTNA 4S2DA 4CDXA 2PELA 1XNBA 1SLCA 4LE4A 4YM1A 2WNEA 4FXGB 4UW6A 3IPVA 4Q29A 4Y1ZA 1JOJA 4P9JA 5CG9A 1BKZA 2NMOA 4TWTA 1RVF1 4NHLA 3TN92 2PHFA 1AR62 4AEDC 2R043 1PNFA 4RHV1 3RZZA 1RUOA 1YNAA 4XE9A 1OOPA 5BV6A 2X5IB 1ENQA 1QMJA 2HWD1 3HIFA 4LUKA 4E27A 2JG8A 2DUQA 2MPFA 4MGZE 2BEOA 1FX5A 4IV1C 2ZMLA 3AKTA 4FP3A 4COYA 1GKBA 4BLJA 3H1WA 3RNSA 1H8TA 1H1IA 3HT1A 3DKWA 2ZGOA 4QGMA 1QWRA 1ZBA3 2WJSA 5DZEA 3ZYRA 1VBA3 1POV1 2WSVA 5A33A 1GNZA 2OPKA 1VIWB 2D6NA 2PHWA 3S30A 3ZIWA 4QPIC 4AVCA 3MI8A 2ZHLA 1YJKA 2HWC3 1O4ZA 4L8QA 3QBQA 1OHFA 4BWOA 5AFBA 1QU0A 5H9PA 1Q8OA 4YVSA 1REEA 1BEV2 1DZRA 2ZKLA 2RS12 1EV11 3O12A 2XH6A 2WZR1 4LEJA 1HRV1 1MQTC 3S6PA 3KCYA 3TN93 3B9CA 4D94A 4RR3B 1AYN1 1RUJ3 4NWWA 4RR3C 3ZMNA 4AFBA 1DGWA 5FRAA 4DPNA 3SISA 1R081 1KQRA 1HDKA 2QDRA 2A6XA 4QGLA 4YG3A 3WW1A 3WQ1A 1XYNA 3DPRB 2C9AA 4YZ1A 3N7KA 1ZZCA 3EQEA 4Q4Y2 5K8SA 1MS9A 1RMU2 1X8MA 4R9CA 3MLKA 3ACLA 4XQ4A 1W6NA 2BNNA 1H9PA 3NAPC 5GLUA 3MIEA 1AR71 2CWMA 2MNGA 2P3KA 5DDJ3 4ZU5A 1YRZA 1YIFA 4Z92B 3CJIB 1CAWA 2Q5TA 4QPYA 1VBB1 4AI0A 4JGYA 1FYUA 3MFAA 2GNDA 4OHZA 1UPSA 1Q8VA 1V6NA 1WLDA 3VBOA 1WMDA 1Z7S3 1XNDA 4DRVA 1COV3 2PYTA 4J1WA 4TYSA 1MS8A 4P9XA 5HXVA 3VZLA 2CAVA 5C4WB 3NKGA 4PIXA 1L3JA 2VOVA 1LOEA 1BMV2 3TRSB 1WD3A 3NW4A 4Y22B 5C9AB 2VNOA 4Z2WA 5LEKA 4C1WA 4WZFA 3J8F3 3HT2A 2EIGA 5JZGB 1A3KA 3POWA 2WQ4A 4YVWC 2XBO1 1NCRC 4E2SA 5K0UC 2ZPXA 1SDWA 2ET7A 5ACA1 5JCTA 1DGRA 5DUXA 1NOVA 2VUJA 2JX9A 1OFSA 4AGGA 4W6WA 1SCSA 5JIUA 3AJYA 5J96B 4XF4A 5FPXA 1ZNPA 2YMZA 1PMIA 4OHVA 3RYRA 2JG8C 3R05A 4QPGC 2WKKA 2VW1A 3CU7A 1FATA 1AYN2 4RS5C 4D7TA 1HXS2 1OA4A 1PO13 4FOWA 3ZFFB 1HRV2 1X36A 1N1YA 1S0FA 2MEV3 4ES9A 1RUG3 2PTMA 2Q1MA 3PVEA 5K0UB 1XE7A 1FI2A 2H6CA 3QCWA 4WM8C 5E16A 3NAPB 2GALA 4FQ4A 5JSPA 2XJUA 4N53A 2PHTA 2HWB3 4Q26A 1YYNA 1RUG2 2HKXA 1J1TA 5FMOS 3M3OA 4YFWA 2XBO3 3J26N 1H8VA 2G9GA 2D6OX 4RS5B 3ZN6B 2O1QA 2WC2A 1RUE1 2TNFA 3K51A 3ZFEA 3OBRA 3WP5A 3WR0A 1J59A 4FTEA 2P3JA 4FPKA 3ZSKA 4XHXA 1ND2B 1ND3C 5I0UA 4CDUC 4FPLA 2VOXA 4YGEA 2HEVF 1ENRA 3NWKA 5HI0A 4JTNA 1X50A 2RM23 4PDWB 5C4WA 4LO7A 4BHPA 4LHKA 4L99A 3V65A 3LOIA 3ZVXA 2BUKA 4AVBA 1I5ZA 3PHMA 1UPIA 2DVAA 2XLGA 4FO9A 2DWRA 4YGDA 4ZU4A 2ATFA 4XJ8A 1G7YA 4IETA 1LOBA 2PLV3 2WINB 4DFSA 4N7UA 3ZXEA 4TZDA 2GDFA 1ENSA 4NWVA 5EYYA 4GXLA 3SCGA 3KT4A 4L97A 5T5JA 1R083 3DPRA 2EF6A 1VBA1 4NHMA 3WX5A 3DF0A 2VMIA 1NCQB 1JBCA 3FC0A 5IUQA 4NVPA 4L92A 2GC3A 5E88A 3VBSC 3VBUB 2VY0A 1PVC2 2VU9A 1WLWA 1S0EA 3D5OA 2DCKA 3B9IA 4YRDA 4CP0A 1WW7A 2X53S 1QJY1 2RS33 2HWC1 1SBDA 5AVAA 1BQPA 3MW4A 1QJZA 4LTAA 1C57A 2D98A 4MV2A 4I09A 4QPGA 1ZBA1 1ND2A 3ZFGC 4JDNA 1I3HA 1VAKA 3WVJA 1GQHA 5BNOB 3ZFGA 2UYBA 4K1YA 1HQWA 1QOSA 4FOQA 2WA4A 1LECA 1B09A 1OFNA 2ETEA 2HWC2 1CQ9A 1AX1A 2E9QA 4E2QA 3ZN4A 4Y4YA 3MPPG 1S2KA 1BXHA 1VBC2 4PLMA 2DVBA 4Q8LA 1YJLA 2ES3A 4GALA 4AXOA 2DCYA 3AYEA 3I54A 2CV6A 3UK9A 3NO8A 3VL8A 3MLJA 4FPGA 3DUIA 5JVVA 4Q27A 3VBRB 4BLIA 5A3MA 3OYWA 1AVBA 4NOTA 4R52A 2WNVB 1GV9A 3AZWA 2ZX1A 2BWAA 1RUE3 2RJKA 2D6KA 3W59A 1VBD2 1YIPA 2RS32 3N35A 3SH4A 1LOFA 2B5HA 3MZHA 2HWF2 4WBBA 2E63A 4Y1YA 2PHXA 5LK7B 1PZ7A 4Q1RA 3H7JA 1APNA 4K3UA 3VBHC 3VKMA 5LRSA 1AX0A 4LLFA 3WDXA 2A6ZA 4N43A 5FPZA 4N43C 1ZRDA 4CEYA 2FBEA 2ZX4A 3ZSEA 5D8AA 4DXZA 3C3VA 3IDBB 4GQ7A 2JG9C 5DG2A 2O8QA 2GN3A 4I02A 4RHV2 1ULDA 1AX2A 3AP4A 1ND2C 1ND3B 3MDPA 4GMP3 4QM9A 5BPXA 1CR7A 4COUA 1WLTA 3TN91 5CIRA 2B8MA 1QH7A 1H2LA 1TME2 3VBOB 2VVFA 2XLAA 3P3PA 4R9BA 4S2GA 1NXD1 1BCXA 1QH6A 3H1YA 4K6BA 3AKQA 3TB0A 2TEPA 5GALA 3ILRA 2ZMKA 2UU8A 1VBD3 2WLPA 4LBMA 4WM8A 3E5UA 1EYBA 4CP1A 4K40A 4YM0A 1QJX2 3D4KA 1GZCA 2QUOA 2Q0AA 3B02A 2A75A 4MXWB 1J3RA 3H0OA 1EPWA 1COV1 2W08A 3V56A 1C8M3 3FFZA 4HZFA 4P9GA 4XIOA 1A6CA 1COV2 1KS4A 1PZ8A 1QNYA 3PNAA 1GICA 2GH8A 3LAGA 4GKYA 4JGYC 4CDWC 4XBQA 1W0OA 1WCKA 2E53A 1GZWA 5JZGA 3E6CC 3IMNA 1QOTA 4C90A 3WCRA 3G6JB 2H6BA 1ONAA 1S0DA 1DG6A 4S2FA 5A33B 2B7YA 4OUSA 5AC91 4WVMA 2XL7A 3USSA 4YZ5A 4AEKA 2QNKA 3U0ZA 2FZ2A 2GN7A 4JCKA 4AI2A 3A4UA 1H8TC 4KU7A 4HKLA 3ROUA 5JI7A 1LEDA 1AYN3 2BWCA 3MW2A 4BMBA 3M3CA 1UIJA 2YGMA 3H7YA 1UU5A 4JGYB 2RS53 1IPKA 3BODA 3URFA 2UY9A 4Q4V3 5FAXA 1ALYA 3OY8A 3ZFEB 4AVVA 1Z78A 3U07A 1AR72 1Q56A 1BYHA 4CYDA 2PQQA 5T55A 1PK6C 2JENA 2H0VA 4M3CE 2A6VA 4SBVA 2D44A 1YWKA 2XVLA 1CAWB 4P9YA 5CVRA 5H9RA 2GNTA 2XKPA 3DGTA 2GZWA 3HBZA 4Q8KA 1MR5A 3ST7A 2CGOA 2R6QA 1ZRRA 4R4XA 1AJKA 1UL9A 3IDCB 1W6NB 2WIIB 4I2OA 1ASJ3 4E4DX 4LR4A 5BNNB 1LHUA 1NZCA 3WV6A 2VQAA 1H4HA 3B5LB 2QZ2A 3KZ4C 3MW3A 4MGKE 4AQTA 5JLVA 1D2SA 2A6YA 1F31A 4LUMA 4W6XA 2B42B 1UX6A 4LBOA 1GQGA 2RS13 3AXEA 1AR83 4QPIA 2WZPP 2VVDA 1SLBA 3CL1A 2UY8A 4XIKA 4GH4A 2R042 4IEQA 4M3CA 3GZUC 4XF0A 1ZZ9A 4FAGA 4DRRA 4XFFA 1SLIA 2ZGLA 3H8UA 4O9EA 1H2MA 5CFDA 4BA6A 4FP2A 3J9SA 5T50A 1RUH1 4GB31 3GHMA 3OJBA 1BBT1 2E7TA 4AYUA 5IK5A 3BPZA 1TME3 3B3QE 2NM1A 5A32B 2XBO2 4RGAA 1MZEA 4EN7B 3I7DA 1ZVFA 3ELNA 3SH3A 4BMEA 4R8HA 1ENXA 2B46X 4DOUA 4AVTA 3ZSMA