3U0SA

Crystal structure of an enzyme redesigned through multiplayer online gaming: ce6
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
327
structure length
327
Chain Sequence
MEIPVIEPLFTKVTEDIPGATGPVFDKNGDFYIVASPLSEALTKANSPAEAYKASRGAGEILRIDLKTGKKTVICKPEVNGYGGSPIGCQCDRDANQLFVADMRLGLLVVQTDGTFEEIAKKDSEGRRMQGCAYCAFDYEGNLWITAPAGEVAPADFTISLREKFGSIYCFTTDGQMIQVDTAFQCPAGIAVRHMNDGRPYQLIVAEQPTKKLWSYDIKGPAKIENKKVWGHIPGTHKGGAAGMDFDEDNNLLVANWGSSHIEVFGPDGGQPKMRIRCPFEKPANLHFKPQTKTIFVTEHENNAVWKFEWQRNGKKQYCETLKFGIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased Diels-Alderase activity through backbone remodeling guided by Foldit players.
pubmed doi rcsb
source organism Loligo vulgaris
molecule tags De novo protein, hydrolase
molecule keywords Diisopropyl-fluorophosphatase
total genus 76
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 3.1.8.2: Diisopropyl-fluorophosphatase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08450 SGL SMP-30/Gluconolactonase/LRE-like region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3u0sA00
3O4PA 2W8BA 3SOVA 3Q6KA 2POOA 2FP8A 3G4EA 1QBIA 4O5TA 4IYGA 3Q6TA 2IAQA 1CVMA 2DG1A 1RWIA 3HLIA 3FW0A 2IAPA 2IAVA 3HLHA 3KYAA 1QLGA 2GHSA 3V1SA 5GX3A 4GNAA 3Q6PA 4GN9A 4GNBA 4A0PA 3P5BL 2IAOA 3V65B 2IVZA 3SOQA 3S2KA 2IARA 3BYCA 5GX2A 4DG6A 4R40A 5D9DA 2ISMA 1CRZA 1Q7FA 5GX4A 4ZLRA 2GVUA 1RWLA 2IAXA 3S8VA 3TC9A 4GNCA 3V64C 1H6LA 2W8BB 1V04A 3DASA 3U0SA 5EX7A 4HW6A 2GVXA 2DSOA 3LI5A 2V91A 1PJXA 2DG0A 2IASA 2IAWA 3SRGA 3SOBB 3S8ZA 5GX1A 2FP9A 2QE8A 1N7DA 4Q1UA 4GN7A 2FPCA 3G4HA 3SREA 2P4OA 1C5KA 3AMRA 3AMSA 3FVZA 4PWZA 2IATA 3WW9A 2GVWA 2FPBA 4JMLA 3LI3A 2HQSA 1E1AA 3HRPA 1CQ1A 3A9GA 5D9BA 3LI4A 3E5ZA 5FWWA 4GN8A 2OJHA 4O5SA 5GTQA 1IJQA 1NPEA 1C9UA 3I1CA 3KGGA 5D9CA 2G8SA 1CRUA 4HHOA 2VAQA 2IAUA 5GX5A 3S94A 3A9HA 3IAXA 4HHQA 2GVVA 3WWAA 1POOA 3DR2A 4IMBA
chains in the Genus database with same CATH superfamily
4GJTA 5FNUA 4XOGA 4GZXA 2Z32A 3NN9A 4MWXA 2H2UA 1B9TA 2QWCA 2YDTA 4WA4A 4L7BA 2IAQA 4M3MA 4WEFA 4YW5A 1MR5A 2DG1A 3H73A 1F8BA 1XOEA 1N1YA 1MS1A 2F12A 1K32A 3V1SA 5GX3A 1ZGKA 4QN4A 4GZSA 4MWWA 2QWFA 4GNBA 1X2RA 4XJ8A 3P5BL 2IAOA 2IVZA 5GX2A 4XJUA 4DG6A 2H2NA 1S0JA 1N1TA 5D9DA 4WA3A 2BERA 1EURA 4ZLRA 1IVFA 2W38A 3TI3A 4GNCA 5EO7A 3V64C 2W8BB 1WCQA 1NCBN 4IFLX 1NMBN 2YA8A 2ZW9A 4QNPA 4X6KA 3TI8A 4CPZA 1XOGA 2VVZA 1Z4VA 3W09A 3SALA 2V91A 1E8VA 1PJXA 2DG0A 4MZEA 1W0PA 1Z4WA 5GX1A 1B9SA 4XJAA 1Z4YA 1V2IA 3BEQA 4FZHA 1NCCN 2P4OA 1W0OA 1W8OA 3GVLA 1L7GA 3D12A 4B7QA 1KITA 2HTYA 5M1ZA 2BZDA 1Z4ZA 4D52C 3LI3A 2XN4A 4DGRA 4FPKA 2VWDA 4WA5A 3HRPA 5FNRA 1Z50A 4XIOA 4MC7A 1NSCA 4KS2A 5D9BA 3K39A 1SUUA 3O9JA 2BF6A 2F13A 1INVA 3I1CA 3ALWA 2G8SA 1W1XA 2XZKA 5FZNA 3WDZA 1USXA 2F0ZA 1IUBA 5GX5A 3SLIA 4B7RA 1S1DA 3A9HA 3B7EA 7NN9A 3IAXA 1F8CA 4HHQA 2GVVA 1SLLA 2ZWAA 3WWAA 3B69A 1POOA 3GVKA 2FLUX 4MWJA 4C1YB 4KS3A 3PJQA 3Q6KA 4YW2A 1NNCA 1N6DA 4XE9A 2POOA 3G4EA 4AGTA 4MWVA 2SILA 4GDIA 2F28A 2HU0A 4ZY3A 4AHAA 4YY8A 4FOYA 1V3EA 1RWIA 3HLIA 4N1BA 4FPGA 1L7HA 4XJRA 4IFNX 4D52B 4HZZA 4XMIA 1F8DA 1EUTA 5FZJA 3V65B 3S2KA 2ISMA 1SNTA 3TIAA 1MS5A 1EUUA 3II7A 1WP5A 2SIMA 2AEPA 4X49A 2IAXA 5F72C 2B8HA 1MZ5A 1NMAN 1H6LA 1V04A 4XILA 2AGSA 1N1VA 2VW0A 3UC1A 4G3NA 2GVXA 1V3DA 1ZI0A 2DSOA 4MZAA 1A14N 4X4AA 4MX0A 1E8TA 2IASA 2YA4A 1MS4A 1V3CA 2HTVA 3S8ZA 2FP9A 3GVJA 4M4VA 4Q1UA 4B7MA 2FPCA 2QWHA 1C5KA 1MS3A 4PWZA 5FNSA 4XJWA 2W20A 4GB1A 2IATA 2SLIA 1V0EA 3TI4A 2VPJA 3JU4A 4ASCA 4CPMA 1WCSA 3A9GA 3H6JA 1IVCA 4KS5A 2HTUA 4JF7A 1W8NA 4GN8A 2HTQA 3K37A 5GTQA 2C4AA 1NPEA 4FP2A 2QWAA 1C9UA 3O9KA 4FPHA 4FPJA 2XZIA 1VCUA 1INFA 1OFZA 1SLIA 4K1KA 1L7FA 5HUKA 4GZQA 4FVKA 2BATA 5H47A 2A75A 2VSKA 3SANA 4XHXA 1V3BA 4IQKA 1NMCA 4NC5A 4YZ4A 2HT8A 3Q6TA 4CPLA 4FOVA 4UOUA 2QWGA 4WEGA 1CVMA 4MWYA 5HUMA 2YA6A 2VK7A 4UF7A 1DIMA 1W20A 4MWUA 3FW0A 2IAVA 1N6FA 3T1EA 4NCSA 4CSDA 3HLHA 2F29A 1INXA 3KYAA 1IUCA 2YA5A 2F11A 4XJZA 3Q6PA 3TICA 4GN9A 1U6DX 3K3AA 4MWLA 4CHBA 1INYA 5B2CA 6NN9A 4QN5A 1A4QA 1S18A 2VW1A 4YZ2A 3VNGA 4FJ6A 1NNAA 1Z4XA 3H71A 1CRZA 4X47A 4M4NA 1Q7FA 2HU4A 4YW1A 4GZOA 1RWLA 3S8VA 3TIBA 2AEQA 4I00A 2VK6A 3DASA 4KS4A 2WOZA 3U0SA 5EX7A 4K1JA 1MZ6A 4HW6A 3LI5A 2YDPA 4M4UA 4HZYA 4HIZA 3ADEA 3SRGA 4CH9A 4XYXA 3SOBB 1W21A 1NN2A 5HUNA 1NSBA 4KS1A 1N7DA 1USRA 4GN7A 4MJVA 2F27A 3G4HA 3SREA 1VCJA 2QWBA 1N1SA 2ZB6A 4MWQA 4FPLA 3AMSA 4D8SA 5NN9A 2VW2A 1IVGA 2W5OA 3SILA 2FPBA 4BBWA 2HQSA 4H52A 4GZWA 4YW4A 1E1AA 2ZZKA 1CQ1A 4CPNA 1IVBA 2F24A 3LI4A 3E5ZA 5FWWA 2JKBA 2QWIA 3OPZA 3VNHA 1NSDA 1IJQA 3CKZA 4MWRA 3ALXA 4GDJA 5D9CA 3CYEA 1IVEA 2VAQA 2VSMA 4Q6KA 4B7JA 4H53A 4MJUA 4FQ4A 4YZ1A 1MWEA 2VK5A 1A4GA 2XZJA 4FPYA 1SO7A 3TI5A 3O4PA 2W8BA 2QWDA 3SOVA 4SLIA 2FP8A 1QBIA 4O5TA 4IYGA 3K36A 1N6EA 4QN6A 4B7NA 4FP3A 5CGJA 4HZWA 1B9VA 2F26A 1IVDA 2IAPA 1V0ZA 1INGA 1QLGA 2GHSA 3CL2A 4GNAA 3ZGCA 1MS8A 3ZGDA 1EUSA 3INBA 3L6VA 2QWKA 4A0PA 4XIKA 4YZ5A 4FOWA 3SOQA 1V0FA 2IARA 3BYCA 2RKCA 4XJQA 4AH4A 3TI6A 2FHRA 1NCDN 4R40A 4D4UA 4GZTA 2HT5A 1DILA 4XMBA 5GX4A 2GVUA 4IFJA 4IN4A 5EO8A 4GZPA 2DYHA 3TC9A 5FNQA 4XJ9A 4YZ3A 3A71A 4XMAA 1INHA 3WN7A 4HZVA 2C4LA 3K38A 4GEZA 2IAWA 4XHBA 3NSSA 1F8EA 1MS9A 4YW3A 5B2DA 4CPYA 3A72A 2ZB5A 2QE8A 2CMLA 4HZXA 2HTRA 4K1IA 4FPOB 4C1YA 1BJIA 3AMRA 4CPOA 3FVZA 2F25A 3H72A 4J9TA 5HUGA 3WW9A 3D11A 2GVWA 5FNTA 1NCAN 4JMLA 4QN7A 4NN9A 2XCYA 1NNBA 4FPCA 2YA7A 4L7DA 3NO0A 2OJHA 4O5SA 4K1HA 4FOQA 2F10A 4QN3A 2X9MA 4D52A 1X2JA 3KGGA 1CRUA 3CL0A 4FPEA 2HT7A 4HHOA 4AGIA 5HX0A 1E8UA 1S0IA 2IAUA 4FPFA 4ZGCA 1INWA 5JYYA 3S94A 2W5NA 2QWJA 2HTWA 4L7CA 4K3YA 3DR2A 2QWEA 1MS0A 4IMBA 5F9TA 2AH2A
chains in the Genus database with same CATH topology
3O4PA 2W8BA 3SOVA 3Q6KA 2POOA 2FP8A 3G4EA 1QBIA 4O5TA 4IYGA 3Q6TA 2IAQA 1CVMA 2DG1A 1RWIA 3HLIA 3FW0A 2IAPA 2IAVA 3HLHA 3KYAA 1QLGA 2GHSA 3V1SA 5GX3A 4GNAA 3Q6PA 4GN9A 4GNBA 4A0PA 3P5BL 2IAOA 3V65B 2IVZA 3SOQA 3S2KA 2IARA 3BYCA 5GX2A 4DG6A 4R40A 5D9DA 2ISMA 1CRZA 1Q7FA 5GX4A 4ZLRA 2GVUA 1RWLA 2IAXA 3S8VA 3TC9A 4GNCA 3V64C 1H6LA 2W8BB 1V04A 3DASA 3U0SA 5EX7A 4HW6A 2GVXA 2DSOA 3LI5A 2V91A 1PJXA 2DG0A 2IASA 2IAWA 3SRGA 3SOBB 3S8ZA 5GX1A 2FP9A 2QE8A 1N7DA 4Q1UA 4GN7A 2FPCA 3G4HA 3SREA 2P4OA 1C5KA 3AMRA 3AMSA 3FVZA 4PWZA 2IATA 3WW9A 2GVWA 2FPBA 4JMLA 3LI3A 2HQSA 1E1AA 3HRPA 1CQ1A 3A9GA 5D9BA 3LI4A 3E5ZA 5FWWA 4GN8A 2OJHA 4O5SA 5GTQA 1IJQA 1NPEA 1C9UA 3I1CA 3KGGA 5D9CA 2G8SA 1CRUA 4HHOA 2VAQA 2IAUA 5GX5A 3S94A 3A9HA 3IAXA 4HHQA 2GVVA 3WWAA 1POOA 3DR2A 4IMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O4P A;  2W8B A;  3SOV A;  3Q6K A;  2POO A;  2FP8 A;  3G4E A;  1QBI A;  4O5T A;  4IYG A;  3Q6T A;  2IAQ A;  1CVM A;  2DG1 A;  1RWI A;  3HLI A;  3FW0 A;  2IAP A;  2IAV A;  3HLH A;  3KYA A;  1QLG A;  2GHS A;  3V1S A;  5GX3 A;  4GNA A;  3Q6P A;  4GN9 A;  4GNB A;  4A0P A;  3P5B L;  2IAO A;  3V65 B;  2IVZ A;  3SOQ A;  3S2K A;  2IAR A;  3BYC A;  5GX2 A;  4DG6 A;  4R40 A;  5D9D A;  2ISM A;  1CRZ A;  1Q7F A;  5GX4 A;  4ZLR A;  2GVU A;  1RWL A;  2IAX A;  3S8V A;  3TC9 A;  4GNC A;  3V64 C;  1H6L A;  2W8B B;  1V04 A;  3DAS A;  3U0S A;  5EX7 A;  4HW6 A;  2GVX A;  2DSO A;  3LI5 A;  2V91 A;  1PJX A;  2DG0 A;  2IAS A;  2IAW A;  3SRG A;  3SOB B;  3S8Z A;  5GX1 A;  2FP9 A;  2QE8 A;  1N7D A;  4Q1U A;  4GN7 A;  2FPC A;  3G4H A;  3SRE A;  2P4O A;  1C5K A;  3AMR A;  3AMS A;  3FVZ A;  4PWZ A;  2IAT A;  3WW9 A;  2GVW A;  2FPB A;  4JML A;  3LI3 A;  2HQS A;  1E1A A;  3HRP A;  1CQ1 A;  3A9G A;  5D9B A;  3LI4 A;  3E5Z A;  5FWW A;  4GN8 A;  2OJH A;  4O5S A;  5GTQ A;  1IJQ A;  1NPE A;  1C9U A;  3I1C A;  3KGG A;  5D9C A;  2G8S A;  1CRU A;  4HHO A;  2VAQ A;  2IAU A;  5GX5 A;  3S94 A;  3A9H A;  3IAX A;  4HHQ A;  2GVV A;  3WWA A;  1POO A;  3DR2 A;  4IMB A; 
#chains in the Genus database with same CATH topology
 4GJT A;  5FNU A;  4XOG A;  4GZX A;  2Z32 A;  3NN9 A;  4MWX A;  2H2U A;  1B9T A;  2QWC A;  2YDT A;  4WA4 A;  4L7B A;  2IAQ A;  4M3M A;  4WEF A;  4YW5 A;  1MR5 A;  2DG1 A;  3H73 A;  1F8B A;  1XOE A;  1N1Y A;  1MS1 A;  2F12 A;  1K32 A;  3V1S A;  5GX3 A;  1ZGK A;  4QN4 A;  4GZS A;  4MWW A;  2QWF A;  4GNB A;  1X2R A;  4XJ8 A;  3P5B L;  2IAO A;  2IVZ A;  5GX2 A;  4XJU A;  4DG6 A;  2H2N A;  1S0J A;  1N1T A;  5D9D A;  4WA3 A;  2BER A;  1EUR A;  4ZLR A;  1IVF A;  2W38 A;  3TI3 A;  4GNC A;  5EO7 A;  3V64 C;  2W8B B;  1WCQ A;  1NCB N;  4IFL X;  1NMB N;  2YA8 A;  2ZW9 A;  4QNP A;  4X6K A;  3TI8 A;  4CPZ A;  1XOG A;  2VVZ A;  1Z4V A;  3W09 A;  3SAL A;  2V91 A;  1E8V A;  1PJX A;  2DG0 A;  4MZE A;  1W0P A;  1Z4W A;  5GX1 A;  1B9S A;  4XJA A;  1Z4Y A;  1V2I A;  3BEQ A;  4FZH A;  1NCC N;  2P4O A;  1W0O A;  1W8O A;  3GVL A;  1L7G A;  3D12 A;  4B7Q A;  1KIT A;  2HTY A;  5M1Z A;  2BZD A;  1Z4Z A;  4D52 C;  3LI3 A;  2XN4 A;  4DGR A;  4FPK A;  2VWD A;  4WA5 A;  3HRP A;  5FNR A;  1Z50 A;  4XIO A;  4MC7 A;  1NSC A;  4KS2 A;  5D9B A;  3K39 A;  1SUU A;  3O9J A;  2BF6 A;  2F13 A;  1INV A;  3I1C A;  3ALW A;  2G8S A;  1W1X A;  2XZK A;  5FZN A;  3WDZ A;  1USX A;  2F0Z A;  1IUB A;  5GX5 A;  3SLI A;  4B7R A;  1S1D A;  3A9H A;  3B7E A;  7NN9 A;  3IAX A;  1F8C A;  4HHQ A;  2GVV A;  1SLL A;  2ZWA A;  3WWA A;  3B69 A;  1POO A;  3GVK A;  2FLU X;  4MWJ A;  4C1Y B;  4KS3 A;  3PJQ A;  3Q6K A;  4YW2 A;  1NNC A;  1N6D A;  4XE9 A;  2POO A;  3G4E A;  4AGT A;  4MWV A;  2SIL A;  4GDI A;  2F28 A;  2HU0 A;  4ZY3 A;  4AHA A;  4YY8 A;  4FOY A;  1V3E A;  1RWI A;  3HLI A;  4N1B A;  4FPG A;  1L7H A;  4XJR A;  4IFN X;  4D52 B;  4HZZ A;  4XMI A;  1F8D A;  1EUT A;  5FZJ A;  3V65 B;  3S2K A;  2ISM A;  1SNT A;  3TIA A;  1MS5 A;  1EUU A;  3II7 A;  1WP5 A;  2SIM A;  2AEP A;  4X49 A;  2IAX A;  5F72 C;  2B8H A;  1MZ5 A;  1NMA N;  1H6L A;  1V04 A;  4XIL A;  2AGS A;  1N1V A;  2VW0 A;  3UC1 A;  4G3N A;  2GVX A;  1V3D A;  1ZI0 A;  2DSO A;  4MZA A;  1A14 N;  4X4A A;  4MX0 A;  1E8T A;  2IAS A;  2YA4 A;  1MS4 A;  1V3C A;  2HTV A;  3S8Z A;  2FP9 A;  3GVJ A;  4M4V A;  4Q1U A;  4B7M A;  2FPC A;  2QWH A;  1C5K A;  1MS3 A;  4PWZ A;  5FNS A;  4XJW A;  2W20 A;  4GB1 A;  2IAT A;  2SLI A;  1V0E A;  3TI4 A;  2VPJ A;  3JU4 A;  4ASC A;  4CPM A;  1WCS A;  3A9G A;  3H6J A;  1IVC A;  4KS5 A;  2HTU A;  4JF7 A;  1W8N A;  4GN8 A;  2HTQ A;  3K37 A;  5GTQ A;  2C4A A;  1NPE A;  4FP2 A;  2QWA A;  1C9U A;  3O9K A;  4FPH A;  4FPJ A;  2XZI A;  1VCU A;  1INF A;  1OFZ A;  1SLI A;  4K1K A;  1L7F A;  5HUK A;  4GZQ A;  4FVK A;  2BAT A;  5H47 A;  2A75 A;  2VSK A;  3SAN A;  4XHX A;  1V3B A;  4IQK A;  1NMC A;  4NC5 A;  4YZ4 A;  2HT8 A;  3Q6T A;  4CPL A;  4FOV A;  4UOU A;  2QWG A;  4WEG A;  1CVM A;  4MWY A;  5HUM A;  2YA6 A;  2VK7 A;  4UF7 A;  1DIM A;  1W20 A;  4MWU A;  3FW0 A;  2IAV A;  1N6F A;  3T1E A;  4NCS A;  4CSD A;  3HLH A;  2F29 A;  1INX A;  3KYA A;  1IUC A;  2YA5 A;  2F11 A;  4XJZ A;  3Q6P A;  3TIC A;  4GN9 A;  1U6D X;  3K3A A;  4MWL A;  4CHB A;  1INY A;  5B2C A;  6NN9 A;  4QN5 A;  1A4Q A;  1S18 A;  2VW1 A;  4YZ2 A;  3VNG A;  4FJ6 A;  1NNA A;  1Z4X A;  3H71 A;  1CRZ A;  4X47 A;  4M4N A;  1Q7F A;  2HU4 A;  4YW1 A;  4GZO A;  1RWL A;  3S8V A;  3TIB A;  2AEQ A;  4I00 A;  2VK6 A;  3DAS A;  4KS4 A;  2WOZ A;  3U0S A;  5EX7 A;  4K1J A;  1MZ6 A;  4HW6 A;  3LI5 A;  2YDP A;  4M4U A;  4HZY A;  4HIZ A;  3ADE A;  3SRG A;  4CH9 A;  4XYX A;  3SOB B;  1W21 A;  1NN2 A;  5HUN A;  1NSB A;  4KS1 A;  1N7D A;  1USR A;  4GN7 A;  4MJV A;  2F27 A;  3G4H A;  3SRE A;  1VCJ A;  2QWB A;  1N1S A;  2ZB6 A;  4MWQ A;  4FPL A;  3AMS A;  4D8S A;  5NN9 A;  2VW2 A;  1IVG A;  2W5O A;  3SIL A;  2FPB A;  4BBW A;  2HQS A;  4H52 A;  4GZW A;  4YW4 A;  1E1A A;  2ZZK A;  1CQ1 A;  4CPN A;  1IVB A;  2F24 A;  3LI4 A;  3E5Z A;  5FWW A;  2JKB A;  2QWI A;  3OPZ A;  3VNH A;  1NSD A;  1IJQ A;  3CKZ A;  4MWR A;  3ALX A;  4GDJ A;  5D9C A;  3CYE A;  1IVE A;  2VAQ A;  2VSM A;  4Q6K A;  4B7J A;  4H53 A;  4MJU A;  4FQ4 A;  4YZ1 A;  1MWE A;  2VK5 A;  1A4G A;  2XZJ A;  4FPY A;  1SO7 A;  3TI5 A;  3O4P A;  2W8B A;  2QWD A;  3SOV A;  4SLI A;  2FP8 A;  1QBI A;  4O5T A;  4IYG A;  3K36 A;  1N6E A;  4QN6 A;  4B7N A;  4FP3 A;  5CGJ A;  4HZW A;  1B9V A;  2F26 A;  1IVD A;  2IAP A;  1V0Z A;  1ING A;  1QLG A;  2GHS A;  3CL2 A;  4GNA A;  3ZGC A;  1MS8 A;  3ZGD A;  1EUS A;  3INB A;  3L6V A;  2QWK A;  4A0P A;  4XIK A;  4YZ5 A;  4FOW A;  3SOQ A;  1V0F A;  2IAR A;  3BYC A;  2RKC A;  4XJQ A;  4AH4 A;  3TI6 A;  2FHR A;  1NCD N;  4R40 A;  4D4U A;  4GZT A;  2HT5 A;  1DIL A;  4XMB A;  5GX4 A;  2GVU A;  4IFJ A;  4IN4 A;  5EO8 A;  4GZP A;  2DYH A;  3TC9 A;  5FNQ A;  4XJ9 A;  4YZ3 A;  3A71 A;  4XMA A;  1INH A;  3WN7 A;  4HZV A;  2C4L A;  3K38 A;  4GEZ A;  2IAW A;  4XHB A;  3NSS A;  1F8E A;  1MS9 A;  4YW3 A;  5B2D A;  4CPY A;  3A72 A;  2ZB5 A;  2QE8 A;  2CML A;  4HZX A;  2HTR A;  4K1I A;  4FPO B;  4C1Y A;  1BJI A;  3AMR A;  4CPO A;  3FVZ A;  2F25 A;  3H72 A;  4J9T A;  5HUG A;  3WW9 A;  3D11 A;  2GVW A;  5FNT A;  1NCA N;  4JML A;  4QN7 A;  4NN9 A;  2XCY A;  1NNB A;  4FPC A;  2YA7 A;  4L7D A;  3NO0 A;  2OJH A;  4O5S A;  4K1H A;  4FOQ A;  2F10 A;  4QN3 A;  2X9M A;  4D52 A;  1X2J A;  3KGG A;  1CRU A;  3CL0 A;  4FPE A;  2HT7 A;  4HHO A;  4AGI A;  5HX0 A;  1E8U A;  1S0I A;  2IAU A;  4FPF A;  4ZGC A;  1INW A;  5JYY A;  3S94 A;  2W5N A;  2QWJ A;  2HTW A;  4L7C A;  4K3Y A;  3DR2 A;  2QWE A;  1MS0 A;  4IMB A;  5F9T A;  2AH2 A; 
#chains in the Genus database with same CATH homology
 3O4P A;  2W8B A;  3SOV A;  3Q6K A;  2POO A;  2FP8 A;  3G4E A;  1QBI A;  4O5T A;  4IYG A;  3Q6T A;  2IAQ A;  1CVM A;  2DG1 A;  1RWI A;  3HLI A;  3FW0 A;  2IAP A;  2IAV A;  3HLH A;  3KYA A;  1QLG A;  2GHS A;  3V1S A;  5GX3 A;  4GNA A;  3Q6P A;  4GN9 A;  4GNB A;  4A0P A;  3P5B L;  2IAO A;  3V65 B;  2IVZ A;  3SOQ A;  3S2K A;  2IAR A;  3BYC A;  5GX2 A;  4DG6 A;  4R40 A;  5D9D A;  2ISM A;  1CRZ A;  1Q7F A;  5GX4 A;  4ZLR A;  2GVU A;  1RWL A;  2IAX A;  3S8V A;  3TC9 A;  4GNC A;  3V64 C;  1H6L A;  2W8B B;  1V04 A;  3DAS A;  3U0S A;  5EX7 A;  4HW6 A;  2GVX A;  2DSO A;  3LI5 A;  2V91 A;  1PJX A;  2DG0 A;  2IAS A;  2IAW A;  3SRG A;  3SOB B;  3S8Z A;  5GX1 A;  2FP9 A;  2QE8 A;  1N7D A;  4Q1U A;  4GN7 A;  2FPC A;  3G4H A;  3SRE A;  2P4O A;  1C5K A;  3AMR A;  3AMS A;  3FVZ A;  4PWZ A;  2IAT A;  3WW9 A;  2GVW A;  2FPB A;  4JML A;  3LI3 A;  2HQS A;  1E1A A;  3HRP A;  1CQ1 A;  3A9G A;  5D9B A;  3LI4 A;  3E5Z A;  5FWW A;  4GN8 A;  2OJH A;  4O5S A;  5GTQ A;  1IJQ A;  1NPE A;  1C9U A;  3I1C A;  3KGG A;  5D9C A;  2G8S A;  1CRU A;  4HHO A;  2VAQ A;  2IAU A;  5GX5 A;  3S94 A;  3A9H A;  3IAX A;  4HHQ A;  2GVV A;  3WWA A;  1POO A;  3DR2 A;  4IMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...